3ODWA

Crystal structure of the linker-dh/ph domains of p115-rhogef
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
355
structure length
331
Chain Sequence
PKSQVKRQEVISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLDELIEVHSLFLDRLMKRRQESIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSHLRQSMLSEFKNLDITKKKLVHEGPLTWRVTKVEVHVLLLDDLLLLLQRQDERLLLKSHMLRPVLRLTSAMTREVATDHKAFYVLFTEAQIYELVAQTVSERKNWCALITETAGSLKVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho guanine nucleotide exchange factor 1
publication title Modulation of a GEF switch: Autoinhibition of the intrinsic guanine nucleotide exchange activity of p115-RhoREF
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 119
structure length 331
sequence length 355
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
A PF17838 PH_16 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 3odwA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3odwA02
1NTYA 1EF1A 3KSYA 1X1GA 2Z0QA 4GPTB 1M7RA 3A8QA 1XX0A 1BWNA 1N3HA 2D9WA 1WJ1A 1DDMA 5DI9B 1KI1B 2N23A 5C5BB 2LYDA 3OANA 4A5KA 2H7EA 2DHJA 5KQ1A 4HATB 1RJ2A 4GMVA 2LULA 5DHFB 4GOUA 2MWNB 5J3TA 2VKIA 1U29A 4EMOA 2DHIA 1MIZB 4K81A 5LOPB 1EAZA 2JP2A 1DBHA 1DDWA 2COCA 3T06A 2HTHB 4K17A 4MK0A 3CIKA 1V61A 4GXBA 3DXCA 4KHAA 2HE7A 5HE0A 1WGUA 2VSZA 1KZGA 4EJNA 2N0YA 5FI0A 4ZRIA 5C16A 2YT0A 1MAIA 3O96A 1E5WA 1V5UA 3D8FA 2PZ1A 1TQZA 3PSCA 3GYPA 1WGQA 1Y19B 3G9WA 2RLOA 1NI2A 3KRWA 1BAKA 4PQ0A 3DXEA 2YT1A 4HHVA 1UEFA 1UNRA 2RNRB 4F7HA 4HAYB 3TVVA 1FGYA 1QC6A 2QKLA 4YONA 5GOWB 2J59M 2P0HA 2MDXA 1MK7B 2COFA 2XQNM 1U5DA 2K2JA 3FM8C 1W1DA 1X86A 3KZ1A 2NMBA 5JLJB 3GF9A 2DKPA 2LG1A 1PFJA 1B55A 2D9ZA 1ZM0A 1FAOA 1FOEA 4Y94A 5D27A 4Z2NA 2ROVA 2P0FA 1MKEA 1Y5OA 3ODOA 2X18A 2ELBA 1FHXA 3PVWA 1H4RA 2GCLA 4HB4B 3KY9A 3SV1A 2K2UA 2EJ8A 2ELAA 1Z87A 1XD4A 3HW2B 5HE2A 2EMTA 2M14A 2IFSA 3FSSA 2M38A 5L81A 5KQ4A 2KR9A 4D0NB 3V5WA 3PVLA 1SHCA 1FHWA 2CRFA 5D3VA 3BINA 3MDBC 2W2XC 4IAPA 2OTXA 3PEGA 1W1HA 5CLQB 3MPXA 1V5PA 1W1GA 4F7GA 2DX5A 2EC1A 1J0WA 4HDQA 3CXBB 2RGNB 3PZDA 1MPHA 4KHOA 4P7IA 5KCVA 2KUPA 3JV3A 1U5FA 4HB3B 1H10A 2ADZA 4HB2B 2D9VA 4HAXB 3UZTA 5LONB 2YS5A 2MFQA 4H8SA 1ZC4B 4MY6A 2UVMA 5D3YA 3AU4A 2Q13A 1SGHA 2DKQA 4DX8A 4TKNA 1NU2A 4KHBB 1WJMA 1XCGA 3SUZA 2CAYA 2QKMA 1F5XA 2I5CA 2KCJA 2Y8GA 2IYBA 4A6KA 1V89A 3SO6A 2YS3A 4F7UP 3FEHA 3SNHA 1Q67A 4NSWA 1RRPB 1UPQA 3ML4A 3D8EA 1I2HA 3ODWA 4A6HA 3F0WA 3NSUA 1K5GB 1U5GA 2NZ8B 3A8PA 2AL6A 2RUKB 3ZDTA 2I1KA 2KGXB 1IRSA 1J19A 1OMWA 1WI1A 4WSFA 2COAA 4KVGB 2R0DA 1BTNA 1MIXA 2YF0A 3F5RA 3WA0A 1V5MA 5J3YA 1TJ6A 2GS0A 2AEHA 2L2IA 2DYQA 1U2BA 1FGZA 5CLLB 1X11A 1KZ7A 2G35A 3DXDA 4B6HA 3RCPA 2J0JA 1OY2A 1AQCA 4HAWB 2ROZB 2P8VA 1LW3A 2DN6A 1K5DB 4KAXB 2W2XD 4CHMA 4GN1A 2K00A 3VIAA 1WG7A 3P6AA 1ZSQA 1OQNA 2Y8FA 2VRWB 1DYNA 3QBVB 4IOYX 2YVCA 5JHGA 3ODXA 1XODA 2I1JA 4XWXA 1ISNA 1P3RA 4CHJA 5JP4A 1TXDA 5FI1A 2BCJA 2OQBA 3A98B 3X23A 4TYZA 2FJLA 2Y7BA 1P6SA 1BY1A 4HAZB 3U7DA 5D3WA 1M7EA 2D4QA 1P5TA 2GCJA 3U8ZA 4K2PA 2Z0PA 4NY0A 2D9XA 3PP2A 1FHOA 2J0KA 3N7CA 4A6FA 1PMSA 1EGXA 2D9YA 3SYXA 1UNQA 2D10A 4BBKA 1XKEA 2DFKA 5J3QA 3HQCA 3TCAA 1U5EA 4ZRKA 1UPRA 2LOZA 1U27A 2DA0A 3VOQA 3QIJA 4CYEA 2DX1A 2DTCA 1GC6A 5DIFB 3PG7A 2UZSA 3EO2A 4HAUB 5HE3A 4DBBA 4A6FB 3ZVRA 2RSGA 4D0OA 4HDOA 4EKUA 1MK9B 2J0MA 3KRXA 1QQGA 2D2QA 1ZVRA 2GJYA 1GG3A 2E2XA 5C79A 1LB1A 1V88A 1UNPA 3WYFB 4HB0B 4DXAB 4C0AA 1X1FA 4K2OA 2DHKA 5D3XA 3LJUX 1GC7A 2H7DA 4WVFB 2W2WA 5EFXA 2CY4A 2DYNA 1I7AA 2CODA 4PNKA 5C6RA 3AU5A 4GMXB 2YS1A 3QWMA 2MKRA 3ULBA 4MT7A 5DH9B 1BTKA 3M1IB 3IVFA 2D11A 2LKOA 5DHAB 1X05A 4ZRJA 3TO1A 1EVHA 2RVBB 1DROA 2I5FA 3P7ZA 1XR0B 4L6EA 4GZUA 2P0DA 3D8DA 2Z0OA 4DX90 4HAVB 1FB8A 4GYVA 3AJ4A 2L1CA 3HK0A 3TFMA 2EMSA 1NTVA 2R09A 2YSZA 4Z2MB 2DLWA 2CY5A 2V76A 3TW1A 5C5BA 3ULCA 3PVUA 5HE1A 1PLSA 2YRYA 2UZRA 5JHHA 1DDVA 2LOXA 3BJIA 1WVHA 1ZC3B 4WJ7A 2ZPYA 4IFSA 3GYOA 1AWEA 4YL8A
chains in the Genus database with same CATH superfamily
2FJUB 1NTYA 1EF1A 3KSYA 1X1GA 2Z0QA 4GPTB 1M7RA 3A8QA 1XX0A 1BWNA 1N3HA 2D9WA 1WJ1A 1DDMA 5DI9B 1KI1B 2N23A 5C5BB 2LYDA 3OANA 4A5KA 2H7EA 2DHJA 5KQ1A 4HATB 4QXAB 2Z4DA 1RJ2A 4GMVA 2LULA 5DHFB 4GOUA 2MWNB 5J3TA 2VKIA 1U29A 4EMOA 2DHIA 1MIZB 4K81A 5LOPB 1EAZA 2JP2A 1DBHA 1DDWA 2COCA 3T06A 5I2MA 2HTHB 4K17A 4MK0A 3CIKA 1V61A 4GXBA 2KIEA 3DXCA 4KHAA 2HE7A 5HE0A 1WGUA 2VSZA 1KZGA 4EJNA 2N0YA 5FI0A 4ZRIA 5C16A 2YT0A 1MAIA 3O96A 1E5WA 1V5UA 3D8FA 2PZ1A 1TQZA 3PSCA 3GYPA 1WGQA 1Y19B 3G9WA 2RLOA 1NI2A 3KRWA 1BAKA 2KUQA 4PQ0A 3DXEA 2YT1A 4HHVA 1UEFA 1UNRA 2RNRB 4F7HA 4HAYB 3TVVA 1FGYA 1QC6A 2QKLA 4YONA 5GOWB 2J59M 2P0HA 2MDXA 1MK7B 2COFA 2XQNM 1U5DA 2K2JA 3FM8C 1W1DA 1X86A 3NWFA 3KZ1A 2NMBA 5JLJB 3GF9A 2DKPA 2LG1A 1PFJA 1B55A 2D9ZA 5LG4B 1ZM0A 1FAOA 1FOEA 4Y94A 5D27A 4Z2NA 2ROVA 2P0FA 1MKEA 1Y5OA 3ODOA 2X18A 2ELBA 2NBVA 1FHXA 3PVWA 1H4RA 2GCLA 4HB4B 3KY9A 3SV1A 2K2UA 2EJ8A 2ELAA 1Z87A 1XD4A 3HW2B 4CSQA 5HE2A 2EMTA 2M14A 1ZYIA 2IFSA 3FSSA 2M38A 5L81A 5KQ4A 2KR9A 4D0NB 3V5WA 3PVLA 1SHCA 1FHWA 2CRFA 5D3VA 3BINA 3MDBC 2W2XC 4IAPA 2OTXA 3PEGA 1W1HA 4KHBA 5CLQB 3MPXA 1V5PA 1W1GA 4F7GA 2DX5A 2EC1A 1J0WA 4HDQA 3CXBB 2RGNB 3PZDA 1MPHA 4KHOA 4P7IA 5KCVA 2KUPA 3JV3A 1U5FA 4HB3B 1H10A 5I2SA 2ADZA 4HB2B 2D9VA 4HAXB 3UZTA 5LONB 2YS5A 2MFQA 4H8SA 1ZC4B 4MY6A 2UVMA 3U12A 3OHMB 5D3YA 2R2YA 3AU4A 2Q13A 4OSNA 1SGHA 2DKQA 4DX8A 4TKNA 1NU2A 4KHBB 1WJMA 1XCGA 3SUZA 2CAYA 2QKMA 1F5XA 2I5CA 2KCJA 2Y8GA 2IYBA 4A6KA 1V89A 3SO6A 2YS3A 3A58A 4F7UP 3FEHA 3SNHA 1Q67A 4NSWA 4GNKB 1RRPB 1UPQA 3ML4A 3D8EA 1I2HA 4OT1A 3ODWA 4A6HA 5IRSA 3F0WA 4HSIA 3NSUA 1K5GB 1U5GA 2NZ8B 3A8PA 2AL6A 2RUKB 3ZDTA 2I1KA 2KGXB 3FVCA 1IRSA 1J19A 1OMWA 1WI1A 3NW8A 4WSFA 2Z14A 2COAA 4KVGB 2R0DA 1BTNA 1MIXA 1T77A 2YF0A 3DCXA 3F5RA 3WA0A 1V5MA 5J3YA 1TJ6A 2GS0A 2AEHA 2L2IA 2DYQA 1U2BA 1FGZA 5CLLB 1X11A 1KZ7A 2G35A 3DXDA 4B6HA 3RCPA 2KIGA 2J0JA 1OY2A 4QJ5B 4QJ4B 1AQCA 4HAWB 2ROZB 2GUMA 2P8VA 1LW3A 5M4YB 2DN6A 1K5DB 4KAXB 2W2XD 4CHMA 4GN1A 2Z59A 2K00A 3VIAA 1WG7A 3P6AA 1ZSQA 4L1RA 1OQNA 2Y8FA 2VRWB 1DYNA 3QBVB 4IOYX 2YVCA 5JHGA 3ODXA 1XODA 2I1JA 4XWXA 1ISNA 1P3RA 4CHJA 5JP4A 1TXDA 5FI1A 2BCJA 2OQBA 3A98B 3X23A 2KR0A 4TYZA 2FJLA 2Y7BA 1P6SA 1BY1A 4HAZB 3U7DA 5D3WA 1M7EA 2D4QA 1P5TA 2GCJA 3U8ZA 4K2PA 2Z0PA 2Z13A 4QJ3B 4NY0A 2D9XA 3PP2A 1FHOA 2J0KA 3N7CA 3HIEA 4A6FA 1PMSA 1EGXA 2D9YA 3SYXA 1UNQA 2D10A 4BBKA 1XKEA 2DFKA 5J3QA 3HQCA 2RRFA 3TCAA 4DIXA 1U5EA 2K49A 4ZRKA 1UPRA 2LOZA 1U27A 2DA0A 3VOQA 3QIJA 4CYEA 2DX1A 2DTCA 1GC6A 5DIFB 3PG7A 2UZSA 3EO2A 4HAUB 5HE3A 4DBBA 4A6FB 3ZVRA 2RSGA 4D0OA 4HDOA 4EKUA 1MK9B 2J0MA 3KRXA 1QQGA 2D2QA 1ZVRA 2GJYA 1GG3A 2E2XA 5C79A 1LB1A 2ZKMX 1V88A 1UNPA 3NWDA 4HB0B 3WYFB 4DXAB 4C0AA 1X1FA 4K2OA 2DHKA 5D3XA 3LJUX 1GC7A 2H7DA 4WVFB 2W2WA 5EFXA 2CY4A 2DYNA 1I7AA 2CODA 4PNKA 5C6RA 3AU5A 4GMXB 2YS1A 3QWMA 2MKRA 3ULBA 4MT7A 5DH9B 3HSAA 1BTKA 3M1IB 3IVFA 2D11A 2LKOA 5DHAB 1X05A 4ZRJA 3TO1A 1EVHA 2RVBB 1DROA 2I5FA 3P7ZA 1XR0B 4L6EA 4GZUA 2P0DA 2YT2A 3D8DA 2Z0OA 4DX90 4HAVB 1FB8A 4GYVA 3NWAA 3AJ4A 1MI1A 2L1CA 3B77A 3HK0A 3TFMA 2EMSA 1NTVA 2R09A 2YSZA 4Z2MB 4D6WA 2DLWA 2CY5A 2V76A 3TW1A 5C5BA 3ULCA 2K8EA 3PVUA 5HE1A 1PLSA 2YRYA 2UZRA 5JHHA 1DDVA 2LOXA 3BJIA 1WVHA 1ZC3B 4WJ7A 2ZPYA 4IFSA 3GYOA 1AWEA 4YL8A
chains in the Genus database with same CATH topology
1NTYA 1EF1A 3KSYA 1X1GA 2Z0QA 4GPTB 1M7RA 3A8QA 1XX0A 1BWNA 1N3HA 2D9WA 1WJ1A 1DDMA 5DI9B 1KI1B 2N23A 5C5BB 2LYDA 3OANA 4A5KA 2H7EA 2DHJA 5KQ1A 4HATB 1RJ2A 4GMVA 2LULA 5DHFB 4GOUA 2MWNB 5J3TA 2VKIA 1U29A 4EMOA 2DHIA 1MIZB 4K81A 5LOPB 1EAZA 2JP2A 1DBHA 1DDWA 2COCA 3T06A 2HTHB 4K17A 4MK0A 3CIKA 1V61A 4GXBA 3DXCA 4KHAA 2HE7A 5HE0A 1WGUA 2VSZA 1KZGA 4EJNA 2N0YA 5FI0A 4ZRIA 5C16A 2YT0A 1MAIA 3O96A 1E5WA 1V5UA 3D8FA 2PZ1A 1TQZA 3PSCA 3GYPA 1WGQA 1Y19B 3G9WA 2RLOA 1NI2A 3KRWA 1BAKA 4PQ0A 3DXEA 2YT1A 4HHVA 1UEFA 1UNRA 2RNRB 4F7HA 4HAYB 3TVVA 1FGYA 1QC6A 2QKLA 4YONA 5GOWB 2J59M 2P0HA 2MDXA 1MK7B 2COFA 2XQNM 1U5DA 2K2JA 3FM8C 1W1DA 1X86A 3KZ1A 2NMBA 5JLJB 3GF9A 2DKPA 2LG1A 1PFJA 1B55A 2D9ZA 1ZM0A 1FAOA 1FOEA 4Y94A 5D27A 4Z2NA 2ROVA 2P0FA 1MKEA 1Y5OA 3ODOA 2X18A 2ELBA 1FHXA 3PVWA 1H4RA 2GCLA 4HB4B 3KY9A 3SV1A 2K2UA 2EJ8A 2ELAA 1Z87A 1XD4A 3HW2B 5HE2A 2EMTA 2M14A 2IFSA 3FSSA 2M38A 5L81A 5KQ4A 2KR9A 4D0NB 3V5WA 3PVLA 1SHCA 1FHWA 2CRFA 5D3VA 3BINA 3MDBC 2W2XC 4IAPA 2OTXA 3PEGA 1W1HA 5CLQB 3MPXA 1V5PA 1W1GA 4F7GA 2DX5A 2EC1A 1J0WA 4HDQA 3CXBB 2RGNB 3PZDA 1MPHA 4KHOA 4P7IA 5KCVA 2KUPA 3JV3A 1U5FA 4HB3B 1H10A 2ADZA 4HB2B 2D9VA 4HAXB 3UZTA 5LONB 2YS5A 2MFQA 4H8SA 1ZC4B 4MY6A 2UVMA 5D3YA 3AU4A 2Q13A 1SGHA 2DKQA 4DX8A 4TKNA 1NU2A 4KHBB 1WJMA 1XCGA 3SUZA 2CAYA 2QKMA 1F5XA 2I5CA 2KCJA 2Y8GA 2IYBA 4A6KA 1V89A 3SO6A 2YS3A 4F7UP 3FEHA 3SNHA 1Q67A 4NSWA 1RRPB 1UPQA 3ML4A 3D8EA 1I2HA 3ODWA 4A6HA 3F0WA 3NSUA 1K5GB 1U5GA 2NZ8B 3A8PA 2AL6A 2RUKB 3ZDTA 2I1KA 2KGXB 1IRSA 1J19A 1OMWA 1WI1A 4WSFA 2COAA 4KVGB 2R0DA 1BTNA 1MIXA 2YF0A 3F5RA 3WA0A 1V5MA 5J3YA 1TJ6A 2GS0A 2AEHA 2L2IA 2DYQA 1U2BA 1FGZA 5CLLB 1X11A 1KZ7A 2G35A 3DXDA 4B6HA 3RCPA 2J0JA 1OY2A 1AQCA 4HAWB 2ROZB 2P8VA 1LW3A 2DN6A 1K5DB 4KAXB 2W2XD 4CHMA 4GN1A 2K00A 3VIAA 1WG7A 3P6AA 1ZSQA 1OQNA 2Y8FA 2VRWB 1DYNA 3QBVB 4IOYX 2YVCA 5JHGA 3ODXA 1XODA 2I1JA 4XWXA 1ISNA 1P3RA 4CHJA 5JP4A 1TXDA 5FI1A 2BCJA 2OQBA 3A98B 3X23A 4TYZA 2FJLA 2Y7BA 1P6SA 1BY1A 4HAZB 3U7DA 5D3WA 1M7EA 2D4QA 1P5TA 2GCJA 3U8ZA 4K2PA 2Z0PA 4NY0A 2D9XA 3PP2A 1FHOA 2J0KA 3N7CA 4A6FA 1PMSA 1EGXA 2D9YA 3SYXA 1UNQA 2D10A 4BBKA 1XKEA 2DFKA 5J3QA 3HQCA 3TCAA 1U5EA 4ZRKA 1UPRA 2LOZA 1U27A 2DA0A 3VOQA 3QIJA 4CYEA 2DX1A 2DTCA 1GC6A 5DIFB 3PG7A 2UZSA 3EO2A 4HAUB 5HE3A 4DBBA 4A6FB 3ZVRA 2RSGA 4D0OA 4HDOA 4EKUA 1MK9B 2J0MA 3KRXA 1QQGA 2D2QA 1ZVRA 2GJYA 1GG3A 2E2XA 5C79A 1LB1A 1V88A 1UNPA 3WYFB 4HB0B 4DXAB 4C0AA 1X1FA 4K2OA 2DHKA 5D3XA 3LJUX 1GC7A 2H7DA 4WVFB 2W2WA 5EFXA 2CY4A 2DYNA 1I7AA 2CODA 4PNKA 5C6RA 3AU5A 4GMXB 2YS1A 3QWMA 2MKRA 3ULBA 4MT7A 5DH9B 1BTKA 3M1IB 3IVFA 2D11A 2LKOA 5DHAB 1X05A 4ZRJA 3TO1A 1EVHA 2RVBB 1DROA 2I5FA 3P7ZA 1XR0B 4L6EA 4GZUA 2P0DA 3D8DA 2Z0OA 4DX90 4HAVB 1FB8A 4GYVA 3AJ4A 2L1CA 3HK0A 3TFMA 2EMSA 1NTVA 2R09A 2YSZA 4Z2MB 2DLWA 2CY5A 2V76A 3TW1A 5C5BA 3ULCA 3PVUA 5HE1A 1PLSA 2YRYA 2UZRA 5JHHA 1DDVA 2LOXA 3BJIA 1WVHA 1ZC3B 4WJ7A 2ZPYA 4IFSA 3GYOA 1AWEA 4YL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTY A;  1EF1 A;  3KSY A;  1X1G A;  2Z0Q A;  4GPT B;  1M7R A;  3A8Q A;  1XX0 A;  1BWN A;  1N3H A;  2D9W A;  1WJ1 A;  1DDM A;  5DI9 B;  1KI1 B;  2N23 A;  5C5B B;  2LYD A;  3OAN A;  4A5K A;  2H7E A;  2DHJ A;  5KQ1 A;  4HAT B;  1RJ2 A;  4GMV A;  2LUL A;  5DHF B;  4GOU A;  2MWN B;  5J3T A;  2VKI A;  1U29 A;  4EMO A;  2DHI A;  1MIZ B;  4K81 A;  5LOP B;  1EAZ A;  2JP2 A;  1DBH A;  1DDW A;  2COC A;  3T06 A;  2HTH B;  4K17 A;  4MK0 A;  3CIK A;  1V61 A;  4GXB A;  3DXC A;  4KHA A;  2HE7 A;  5HE0 A;  1WGU A;  2VSZ A;  1KZG A;  4EJN A;  2N0Y A;  5FI0 A;  4ZRI A;  5C16 A;  2YT0 A;  1MAI A;  3O96 A;  1E5W A;  1V5U A;  3D8F A;  2PZ1 A;  1TQZ A;  3PSC A;  3GYP A;  1WGQ A;  1Y19 B;  3G9W A;  2RLO A;  1NI2 A;  3KRW A;  1BAK A;  4PQ0 A;  3DXE A;  2YT1 A;  4HHV A;  1UEF A;  1UNR A;  2RNR B;  4F7H A;  4HAY B;  3TVV A;  1FGY A;  1QC6 A;  2QKL A;  4YON A;  5GOW B;  2J59 M;  2P0H A;  2MDX A;  1MK7 B;  2COF A;  2XQN M;  1U5D A;  2K2J A;  3FM8 C;  1W1D A;  1X86 A;  3KZ1 A;  2NMB A;  5JLJ B;  3GF9 A;  2DKP A;  2LG1 A;  1PFJ A;  1B55 A;  2D9Z A;  1ZM0 A;  1FAO A;  1FOE A;  4Y94 A;  5D27 A;  4Z2N A;  2ROV A;  2P0F A;  1MKE A;  1Y5O A;  3ODO A;  2X18 A;  2ELB A;  1FHX A;  3PVW A;  1H4R A;  2GCL A;  4HB4 B;  3KY9 A;  3SV1 A;  2K2U A;  2EJ8 A;  2ELA A;  1Z87 A;  1XD4 A;  3HW2 B;  5HE2 A;  2EMT A;  2M14 A;  2IFS A;  3FSS A;  2M38 A;  5L81 A;  5KQ4 A;  2KR9 A;  4D0N B;  3V5W A;  3PVL A;  1SHC A;  1FHW A;  2CRF A;  5D3V A;  3BIN A;  3MDB C;  2W2X C;  4IAP A;  2OTX A;  3PEG A;  1W1H A;  5CLQ B;  3MPX A;  1V5P A;  1W1G A;  4F7G A;  2DX5 A;  2EC1 A;  1J0W A;  4HDQ A;  3CXB B;  2RGN B;  3PZD A;  1MPH A;  4KHO A;  4P7I A;  5KCV A;  2KUP A;  3JV3 A;  1U5F A;  4HB3 B;  1H10 A;  2ADZ A;  4HB2 B;  2D9V A;  4HAX B;  3UZT A;  5LON B;  2YS5 A;  2MFQ A;  4H8S A;  1ZC4 B;  4MY6 A;  2UVM A;  5D3Y A;  3AU4 A;  2Q13 A;  1SGH A;  2DKQ A;  4DX8 A;  4TKN A;  1NU2 A;  4KHB B;  1WJM A;  1XCG A;  3SUZ A;  2CAY A;  2QKM A;  1F5X A;  2I5C A;  2KCJ A;  2Y8G A;  2IYB A;  4A6K A;  1V89 A;  3SO6 A;  2YS3 A;  4F7U P;  3FEH A;  3SNH A;  1Q67 A;  4NSW A;  1RRP B;  1UPQ A;  3ML4 A;  3D8E A;  1I2H A;  3ODW A;  4A6H A;  3F0W A;  3NSU A;  1K5G B;  1U5G A;  2NZ8 B;  3A8P A;  2AL6 A;  2RUK B;  3ZDT A;  2I1K A;  2KGX B;  1IRS A;  1J19 A;  1OMW A;  1WI1 A;  4WSF A;  2COA A;  4KVG B;  2R0D A;  1BTN A;  1MIX A;  2YF0 A;  3F5R A;  3WA0 A;  1V5M A;  5J3Y A;  1TJ6 A;  2GS0 A;  2AEH A;  2L2I A;  2DYQ A;  1U2B A;  1FGZ A;  5CLL B;  1X11 A;  1KZ7 A;  2G35 A;  3DXD A;  4B6H A;  3RCP A;  2J0J A;  1OY2 A;  1AQC A;  4HAW B;  2ROZ B;  2P8V A;  1LW3 A;  2DN6 A;  1K5D B;  4KAX B;  2W2X D;  4CHM A;  4GN1 A;  2K00 A;  3VIA A;  1WG7 A;  3P6A A;  1ZSQ A;  1OQN A;  2Y8F A;  2VRW B;  1DYN A;  3QBV B;  4IOY X;  2YVC A;  5JHG A;  3ODX A;  1XOD A;  2I1J A;  4XWX A;  1ISN A;  1P3R A;  4CHJ A;  5JP4 A;  1TXD A;  5FI1 A;  2BCJ A;  2OQB A;  3A98 B;  3X23 A;  4TYZ A;  2FJL A;  2Y7B A;  1P6S A;  1BY1 A;  4HAZ B;  3U7D A;  5D3W A;  1M7E A;  2D4Q A;  1P5T A;  2GCJ A;  3U8Z A;  4K2P A;  2Z0P A;  4NY0 A;  2D9X A;  3PP2 A;  1FHO A;  2J0K A;  3N7C A;  4A6F A;  1PMS A;  1EGX A;  2D9Y A;  3SYX A;  1UNQ A;  2D10 A;  4BBK A;  1XKE A;  2DFK A;  5J3Q A;  3HQC A;  3TCA A;  1U5E A;  4ZRK A;  1UPR A;  2LOZ A;  1U27 A;  2DA0 A;  3VOQ A;  3QIJ A;  4CYE A;  2DX1 A;  2DTC A;  1GC6 A;  5DIF B;  3PG7 A;  2UZS A;  3EO2 A;  4HAU B;  5HE3 A;  4DBB A;  4A6F B;  3ZVR A;  2RSG A;  4D0O A;  4HDO A;  4EKU A;  1MK9 B;  2J0M A;  3KRX A;  1QQG A;  2D2Q A;  1ZVR A;  2GJY A;  1GG3 A;  2E2X A;  5C79 A;  1LB1 A;  1V88 A;  1UNP A;  3WYF B;  4HB0 B;  4DXA B;  4C0A A;  1X1F A;  4K2O A;  2DHK A;  5D3X A;  3LJU X;  1GC7 A;  2H7D A;  4WVF B;  2W2W A;  5EFX A;  2CY4 A;  2DYN A;  1I7A A;  2COD A;  4PNK A;  5C6R A;  3AU5 A;  4GMX B;  2YS1 A;  3QWM A;  2MKR A;  3ULB A;  4MT7 A;  5DH9 B;  1BTK A;  3M1I B;  3IVF A;  2D11 A;  2LKO A;  5DHA B;  1X05 A;  4ZRJ A;  3TO1 A;  1EVH A;  2RVB B;  1DRO A;  2I5F A;  3P7Z A;  1XR0 B;  4L6E A;  4GZU A;  2P0D A;  3D8D A;  2Z0O A;  4DX9 0;  4HAV B;  1FB8 A;  4GYV A;  3AJ4 A;  2L1C A;  3HK0 A;  3TFM A;  2EMS A;  1NTV A;  2R09 A;  2YSZ A;  4Z2M B;  2DLW A;  2CY5 A;  2V76 A;  3TW1 A;  5C5B A;  3ULC A;  3PVU A;  5HE1 A;  1PLS A;  2YRY A;  2UZR A;  5JHH A;  1DDV A;  2LOX A;  3BJI A;  1WVH A;  1ZC3 B;  4WJ7 A;  2ZPY A;  4IFS A;  3GYO A;  1AWE A;  4YL8 A; 
#chains in the Genus database with same CATH topology
 2FJU B;  1NTY A;  1EF1 A;  3KSY A;  1X1G A;  2Z0Q A;  4GPT B;  1M7R A;  3A8Q A;  1XX0 A;  1BWN A;  1N3H A;  2D9W A;  1WJ1 A;  1DDM A;  5DI9 B;  1KI1 B;  2N23 A;  5C5B B;  2LYD A;  3OAN A;  4A5K A;  2H7E A;  2DHJ A;  5KQ1 A;  4HAT B;  4QXA B;  2Z4D A;  1RJ2 A;  4GMV A;  2LUL A;  5DHF B;  4GOU A;  2MWN B;  5J3T A;  2VKI A;  1U29 A;  4EMO A;  2DHI A;  1MIZ B;  4K81 A;  5LOP B;  1EAZ A;  2JP2 A;  1DBH A;  1DDW A;  2COC A;  3T06 A;  5I2M A;  2HTH B;  4K17 A;  4MK0 A;  3CIK A;  1V61 A;  4GXB A;  2KIE A;  3DXC A;  4KHA A;  2HE7 A;  5HE0 A;  1WGU A;  2VSZ A;  1KZG A;  4EJN A;  2N0Y A;  5FI0 A;  4ZRI A;  5C16 A;  2YT0 A;  1MAI A;  3O96 A;  1E5W A;  1V5U A;  3D8F A;  2PZ1 A;  1TQZ A;  3PSC A;  3GYP A;  1WGQ A;  1Y19 B;  3G9W A;  2RLO A;  1NI2 A;  3KRW A;  1BAK A;  2KUQ A;  4PQ0 A;  3DXE A;  2YT1 A;  4HHV A;  1UEF A;  1UNR A;  2RNR B;  4F7H A;  4HAY B;  3TVV A;  1FGY A;  1QC6 A;  2QKL A;  4YON A;  5GOW B;  2J59 M;  2P0H A;  2MDX A;  1MK7 B;  2COF A;  2XQN M;  1U5D A;  2K2J A;  3FM8 C;  1W1D A;  1X86 A;  3NWF A;  3KZ1 A;  2NMB A;  5JLJ B;  3GF9 A;  2DKP A;  2LG1 A;  1PFJ A;  1B55 A;  2D9Z A;  5LG4 B;  1ZM0 A;  1FAO A;  1FOE A;  4Y94 A;  5D27 A;  4Z2N A;  2ROV A;  2P0F A;  1MKE A;  1Y5O A;  3ODO A;  2X18 A;  2ELB A;  2NBV A;  1FHX A;  3PVW A;  1H4R A;  2GCL A;  4HB4 B;  3KY9 A;  3SV1 A;  2K2U A;  2EJ8 A;  2ELA A;  1Z87 A;  1XD4 A;  3HW2 B;  4CSQ A;  5HE2 A;  2EMT A;  2M14 A;  1ZYI A;  2IFS A;  3FSS A;  2M38 A;  5L81 A;  5KQ4 A;  2KR9 A;  4D0N B;  3V5W A;  3PVL A;  1SHC A;  1FHW A;  2CRF A;  5D3V A;  3BIN A;  3MDB C;  2W2X C;  4IAP A;  2OTX A;  3PEG A;  1W1H A;  4KHB A;  5CLQ B;  3MPX A;  1V5P A;  1W1G A;  4F7G A;  2DX5 A;  2EC1 A;  1J0W A;  4HDQ A;  3CXB B;  2RGN B;  3PZD A;  1MPH A;  4KHO A;  4P7I A;  5KCV A;  2KUP A;  3JV3 A;  1U5F A;  4HB3 B;  1H10 A;  5I2S A;  2ADZ A;  4HB2 B;  2D9V A;  4HAX B;  3UZT A;  5LON B;  2YS5 A;  2MFQ A;  4H8S A;  1ZC4 B;  4MY6 A;  2UVM A;  3U12 A;  3OHM B;  5D3Y A;  2R2Y A;  3AU4 A;  2Q13 A;  4OSN A;  1SGH A;  2DKQ A;  4DX8 A;  4TKN A;  1NU2 A;  4KHB B;  1WJM A;  1XCG A;  3SUZ A;  2CAY A;  2QKM A;  1F5X A;  2I5C A;  2KCJ A;  2Y8G A;  2IYB A;  4A6K A;  1V89 A;  3SO6 A;  2YS3 A;  3A58 A;  4F7U P;  3FEH A;  3SNH A;  1Q67 A;  4NSW A;  4GNK B;  1RRP B;  1UPQ A;  3ML4 A;  3D8E A;  1I2H A;  4OT1 A;  3ODW A;  4A6H A;  5IRS A;  3F0W A;  4HSI A;  3NSU A;  1K5G B;  1U5G A;  2NZ8 B;  3A8P A;  2AL6 A;  2RUK B;  3ZDT A;  2I1K A;  2KGX B;  3FVC A;  1IRS A;  1J19 A;  1OMW A;  1WI1 A;  3NW8 A;  4WSF A;  2Z14 A;  2COA A;  4KVG B;  2R0D A;  1BTN A;  1MIX A;  1T77 A;  2YF0 A;  3DCX A;  3F5R A;  3WA0 A;  1V5M A;  5J3Y A;  1TJ6 A;  2GS0 A;  2AEH A;  2L2I A;  2DYQ A;  1U2B A;  1FGZ A;  5CLL B;  1X11 A;  1KZ7 A;  2G35 A;  3DXD A;  4B6H A;  3RCP A;  2KIG A;  2J0J A;  1OY2 A;  4QJ5 B;  4QJ4 B;  1AQC A;  4HAW B;  2ROZ B;  2GUM A;  2P8V A;  1LW3 A;  5M4Y B;  2DN6 A;  1K5D B;  4KAX B;  2W2X D;  4CHM A;  4GN1 A;  2Z59 A;  2K00 A;  3VIA A;  1WG7 A;  3P6A A;  1ZSQ A;  4L1R A;  1OQN A;  2Y8F A;  2VRW B;  1DYN A;  3QBV B;  4IOY X;  2YVC A;  5JHG A;  3ODX A;  1XOD A;  2I1J A;  4XWX A;  1ISN A;  1P3R A;  4CHJ A;  5JP4 A;  1TXD A;  5FI1 A;  2BCJ A;  2OQB A;  3A98 B;  3X23 A;  2KR0 A;  4TYZ A;  2FJL A;  2Y7B A;  1P6S A;  1BY1 A;  4HAZ B;  3U7D A;  5D3W A;  1M7E A;  2D4Q A;  1P5T A;  2GCJ A;  3U8Z A;  4K2P A;  2Z0P A;  2Z13 A;  4QJ3 B;  4NY0 A;  2D9X A;  3PP2 A;  1FHO A;  2J0K A;  3N7C A;  3HIE A;  4A6F A;  1PMS A;  1EGX A;  2D9Y A;  3SYX A;  1UNQ A;  2D10 A;  4BBK A;  1XKE A;  2DFK A;  5J3Q A;  3HQC A;  2RRF A;  3TCA A;  4DIX A;  1U5E A;  2K49 A;  4ZRK A;  1UPR A;  2LOZ A;  1U27 A;  2DA0 A;  3VOQ A;  3QIJ A;  4CYE A;  2DX1 A;  2DTC A;  1GC6 A;  5DIF B;  3PG7 A;  2UZS A;  3EO2 A;  4HAU B;  5HE3 A;  4DBB A;  4A6F B;  3ZVR A;  2RSG A;  4D0O A;  4HDO A;  4EKU A;  1MK9 B;  2J0M A;  3KRX A;  1QQG A;  2D2Q A;  1ZVR A;  2GJY A;  1GG3 A;  2E2X A;  5C79 A;  1LB1 A;  2ZKM X;  1V88 A;  1UNP A;  3NWD A;  4HB0 B;  3WYF B;  4DXA B;  4C0A A;  1X1F A;  4K2O A;  2DHK A;  5D3X A;  3LJU X;  1GC7 A;  2H7D A;  4WVF B;  2W2W A;  5EFX A;  2CY4 A;  2DYN A;  1I7A A;  2COD A;  4PNK A;  5C6R A;  3AU5 A;  4GMX B;  2YS1 A;  3QWM A;  2MKR A;  3ULB A;  4MT7 A;  5DH9 B;  3HSA A;  1BTK A;  3M1I B;  3IVF A;  2D11 A;  2LKO A;  5DHA B;  1X05 A;  4ZRJ A;  3TO1 A;  1EVH A;  2RVB B;  1DRO A;  2I5F A;  3P7Z A;  1XR0 B;  4L6E A;  4GZU A;  2P0D A;  2YT2 A;  3D8D A;  2Z0O A;  4DX9 0;  4HAV B;  1FB8 A;  4GYV A;  3NWA A;  3AJ4 A;  1MI1 A;  2L1C A;  3B77 A;  3HK0 A;  3TFM A;  2EMS A;  1NTV A;  2R09 A;  2YSZ A;  4Z2M B;  4D6W A;  2DLW A;  2CY5 A;  2V76 A;  3TW1 A;  5C5B A;  3ULC A;  2K8E A;  3PVU A;  5HE1 A;  1PLS A;  2YRY A;  2UZR A;  5JHH A;  1DDV A;  2LOX A;  3BJI A;  1WVH A;  1ZC3 B;  4WJ7 A;  2ZPY A;  4IFS A;  3GYO A;  1AWE A;  4YL8 A; 
#chains in the Genus database with same CATH homology
 1NTY A;  1EF1 A;  3KSY A;  1X1G A;  2Z0Q A;  4GPT B;  1M7R A;  3A8Q A;  1XX0 A;  1BWN A;  1N3H A;  2D9W A;  1WJ1 A;  1DDM A;  5DI9 B;  1KI1 B;  2N23 A;  5C5B B;  2LYD A;  3OAN A;  4A5K A;  2H7E A;  2DHJ A;  5KQ1 A;  4HAT B;  1RJ2 A;  4GMV A;  2LUL A;  5DHF B;  4GOU A;  2MWN B;  5J3T A;  2VKI A;  1U29 A;  4EMO A;  2DHI A;  1MIZ B;  4K81 A;  5LOP B;  1EAZ A;  2JP2 A;  1DBH A;  1DDW A;  2COC A;  3T06 A;  2HTH B;  4K17 A;  4MK0 A;  3CIK A;  1V61 A;  4GXB A;  3DXC A;  4KHA A;  2HE7 A;  5HE0 A;  1WGU A;  2VSZ A;  1KZG A;  4EJN A;  2N0Y A;  5FI0 A;  4ZRI A;  5C16 A;  2YT0 A;  1MAI A;  3O96 A;  1E5W A;  1V5U A;  3D8F A;  2PZ1 A;  1TQZ A;  3PSC A;  3GYP A;  1WGQ A;  1Y19 B;  3G9W A;  2RLO A;  1NI2 A;  3KRW A;  1BAK A;  4PQ0 A;  3DXE A;  2YT1 A;  4HHV A;  1UEF A;  1UNR A;  2RNR B;  4F7H A;  4HAY B;  3TVV A;  1FGY A;  1QC6 A;  2QKL A;  4YON A;  5GOW B;  2J59 M;  2P0H A;  2MDX A;  1MK7 B;  2COF A;  2XQN M;  1U5D A;  2K2J A;  3FM8 C;  1W1D A;  1X86 A;  3KZ1 A;  2NMB A;  5JLJ B;  3GF9 A;  2DKP A;  2LG1 A;  1PFJ A;  1B55 A;  2D9Z A;  1ZM0 A;  1FAO A;  1FOE A;  4Y94 A;  5D27 A;  4Z2N A;  2ROV A;  2P0F A;  1MKE A;  1Y5O A;  3ODO A;  2X18 A;  2ELB A;  1FHX A;  3PVW A;  1H4R A;  2GCL A;  4HB4 B;  3KY9 A;  3SV1 A;  2K2U A;  2EJ8 A;  2ELA A;  1Z87 A;  1XD4 A;  3HW2 B;  5HE2 A;  2EMT A;  2M14 A;  2IFS A;  3FSS A;  2M38 A;  5L81 A;  5KQ4 A;  2KR9 A;  4D0N B;  3V5W A;  3PVL A;  1SHC A;  1FHW A;  2CRF A;  5D3V A;  3BIN A;  3MDB C;  2W2X C;  4IAP A;  2OTX A;  3PEG A;  1W1H A;  5CLQ B;  3MPX A;  1V5P A;  1W1G A;  4F7G A;  2DX5 A;  2EC1 A;  1J0W A;  4HDQ A;  3CXB B;  2RGN B;  3PZD A;  1MPH A;  4KHO A;  4P7I A;  5KCV A;  2KUP A;  3JV3 A;  1U5F A;  4HB3 B;  1H10 A;  2ADZ A;  4HB2 B;  2D9V A;  4HAX B;  3UZT A;  5LON B;  2YS5 A;  2MFQ A;  4H8S A;  1ZC4 B;  4MY6 A;  2UVM A;  5D3Y A;  3AU4 A;  2Q13 A;  1SGH A;  2DKQ A;  4DX8 A;  4TKN A;  1NU2 A;  4KHB B;  1WJM A;  1XCG A;  3SUZ A;  2CAY A;  2QKM A;  1F5X A;  2I5C A;  2KCJ A;  2Y8G A;  2IYB A;  4A6K A;  1V89 A;  3SO6 A;  2YS3 A;  4F7U P;  3FEH A;  3SNH A;  1Q67 A;  4NSW A;  1RRP B;  1UPQ A;  3ML4 A;  3D8E A;  1I2H A;  3ODW A;  4A6H A;  3F0W A;  3NSU A;  1K5G B;  1U5G A;  2NZ8 B;  3A8P A;  2AL6 A;  2RUK B;  3ZDT A;  2I1K A;  2KGX B;  1IRS A;  1J19 A;  1OMW A;  1WI1 A;  4WSF A;  2COA A;  4KVG B;  2R0D A;  1BTN A;  1MIX A;  2YF0 A;  3F5R A;  3WA0 A;  1V5M A;  5J3Y A;  1TJ6 A;  2GS0 A;  2AEH A;  2L2I A;  2DYQ A;  1U2B A;  1FGZ A;  5CLL B;  1X11 A;  1KZ7 A;  2G35 A;  3DXD A;  4B6H A;  3RCP A;  2J0J A;  1OY2 A;  1AQC A;  4HAW B;  2ROZ B;  2P8V A;  1LW3 A;  2DN6 A;  1K5D B;  4KAX B;  2W2X D;  4CHM A;  4GN1 A;  2K00 A;  3VIA A;  1WG7 A;  3P6A A;  1ZSQ A;  1OQN A;  2Y8F A;  2VRW B;  1DYN A;  3QBV B;  4IOY X;  2YVC A;  5JHG A;  3ODX A;  1XOD A;  2I1J A;  4XWX A;  1ISN A;  1P3R A;  4CHJ A;  5JP4 A;  1TXD A;  5FI1 A;  2BCJ A;  2OQB A;  3A98 B;  3X23 A;  4TYZ A;  2FJL A;  2Y7B A;  1P6S A;  1BY1 A;  4HAZ B;  3U7D A;  5D3W A;  1M7E A;  2D4Q A;  1P5T A;  2GCJ A;  3U8Z A;  4K2P A;  2Z0P A;  4NY0 A;  2D9X A;  3PP2 A;  1FHO A;  2J0K A;  3N7C A;  4A6F A;  1PMS A;  1EGX A;  2D9Y A;  3SYX A;  1UNQ A;  2D10 A;  4BBK A;  1XKE A;  2DFK A;  5J3Q A;  3HQC A;  3TCA A;  1U5E A;  4ZRK A;  1UPR A;  2LOZ A;  1U27 A;  2DA0 A;  3VOQ A;  3QIJ A;  4CYE A;  2DX1 A;  2DTC A;  1GC6 A;  5DIF B;  3PG7 A;  2UZS A;  3EO2 A;  4HAU B;  5HE3 A;  4DBB A;  4A6F B;  3ZVR A;  2RSG A;  4D0O A;  4HDO A;  4EKU A;  1MK9 B;  2J0M A;  3KRX A;  1QQG A;  2D2Q A;  1ZVR A;  2GJY A;  1GG3 A;  2E2X A;  5C79 A;  1LB1 A;  1V88 A;  1UNP A;  3WYF B;  4HB0 B;  4DXA B;  4C0A A;  1X1F A;  4K2O A;  2DHK A;  5D3X A;  3LJU X;  1GC7 A;  2H7D A;  4WVF B;  2W2W A;  5EFX A;  2CY4 A;  2DYN A;  1I7A A;  2COD A;  4PNK A;  5C6R A;  3AU5 A;  4GMX B;  2YS1 A;  3QWM A;  2MKR A;  3ULB A;  4MT7 A;  5DH9 B;  1BTK A;  3M1I B;  3IVF A;  2D11 A;  2LKO A;  5DHA B;  1X05 A;  4ZRJ A;  3TO1 A;  1EVH A;  2RVB B;  1DRO A;  2I5F A;  3P7Z A;  1XR0 B;  4L6E A;  4GZU A;  2P0D A;  3D8D A;  2Z0O A;  4DX9 0;  4HAV B;  1FB8 A;  4GYV A;  3AJ4 A;  2L1C A;  3HK0 A;  3TFM A;  2EMS A;  1NTV A;  2R09 A;  2YSZ A;  4Z2M B;  2DLW A;  2CY5 A;  2V76 A;  3TW1 A;  5C5B A;  3ULC A;  3PVU A;  5HE1 A;  1PLS A;  2YRY A;  2UZR A;  5JHH A;  1DDV A;  2LOX A;  3BJI A;  1WVH A;  1ZC3 B;  4WJ7 A;  2ZPY A;  4IFS A;  3GYO A;  1AWE A;  4YL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...