3ODXA

Crystal structure of an n-terminally truncated linker-dh/ph domains of p115-rhogef
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
355
structure length
336
Chain Sequence
PKSQVKRQEVISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLDELIEVHSLFLDRLMKRRQESIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPLSEFKNLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSLRPVLRLTSAMTREVATDHKAFYVLFTEAQIYELVAQTVSERKNWCALITETAGSLKVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Modulation of a GEF switch: Autoinhibition of the intrinsic guanine nucleotide exchange activity of p115-RhoREF
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rho guanine nucleotide exchange factor 1
total genus 124
structure length 336
sequence length 355
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
A PF17838 PH_16 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 3odxA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3odxA02
1SGHA 2QKLA 2VSZA 1XCGA 2Y7BA 2Z0PA 2D11A 4HAXB 2MFQA 1U27A 3O96A 3U8ZA 4HAYB 2D9XA 4PQ0A 4YONA 3WYFB 2VKIA 2X18A 4KHAA 5J3QA 1XD4A 2W2XC 4K17A 5DHAB 5JHGA 3VOQA 2ADZA 2D9YA 1EVHA 2MWNB 4KAXB 3CIKA 2Y8GA 2H7EA 1PLSA 1ZC4B 1WGQA 1QQGA 2P0FA 1MIXA 3QWMA 5FI1A 4CHJA 4MY6A 2OQBA 1X11A 1GC7A 3QBVB 1DDVA 2DN6A 3FEHA 1GC6A 1XODA 1UEFA 3D8FA 1UNPA 3KSYA 1DROA 3PVLA 3DXEA 4GXBA 2ELBA 4NSWA 3A8QA 5FI0A 4EJNA 1UNQA 2YS5A 2H7DA 1BWNA 2CY4A 4HAVB 4WVFB 1V61A 4GMXB 5J3YA 1M7RA 1U5EA 3JV3A 1U5GA 2E2XA 1RRPB 2AL6A 4F7UP 1XR0B 2ROVA 4ZRKA 1B55A 5EFXA 1FHXA 5D3VA 2ROZB 3X23A 4HHVA 4Z2MB 4HDOA 2MDXA 4A6HA 3HK0A 2UZRA 1FHOA 3AJ4A 3N7CA 4MK0A 1H10A 4NY0A 1WVHA 1I7AA 1Z87A 2RSGA 2PZ1A 2DX5A 5DIFB 1NTYA 1K5GB 1X86A 2P0DA 1J19A 2RUKB 5DI9B 1UPRA 5D3YA 1NTVA 5CLLB 2D9ZA 2ELAA 1ZVRA 2P8VA 2YRYA 2EC1A 4HB4B 1P3RA 2AEHA 2RVBB 4KHOA 1V5UA 1KI1B 5D27A 1Y19B 2YS3A 1OMWA 5KCVA 2DFKA 3TW1A 1ZC3B 5LONB 4H8SA 1OQNA 1X1FA 4D0NB 1XX0A 2J59M 4DBBA 3KRXA 4DX8A 5D3XA 3ZDTA 1TXDA 2NZ8B 2R0DA 2Q13A 1WG7A 2RNRB 2D2QA 5C79A 4GMVA 1BTNA 4WJ7A 3RCPA 1NI2A 1OY2A 1EGXA 1Q67A 1NU2A 1U5DA 1UNRA 3TVVA 1F5XA 2LG1A 3VIAA 2R09A 3IVFA 1W1HA 3PEGA 3MPXA 3SO6A 1LW3A 2P0HA 5HE2A 4D0OA 2OTXA 4HDQA 2KUPA 1K5DB 4YL8A 2CODA 4F7GA 2CY5A 1WGUA 3DXDA 1AWEA 2D9VA 4GN1A 2NMBA 3A98B 4HAUB 4GOUA 3KRWA 4PNKA 3DXCA 3PVUA 3HQCA 2COFA 2RLOA 1WI1A 1WJMA 2Z0QA 5HE0A 5C6RA 1EF1A 2YVCA 1V5PA 1TQZA 2CAYA 3ODOA 2DKPA 4HB3B 1DDMA 1PFJA 4HB2B 1AQCA 3KY9A 3WA0A 4BBKA 2YT0A 2COCA 1M7EA 1FHWA 3FSSA 2J0KA 3TO1A 1SHCA 1Y5OA 4DX90 1MKEA 2DA0A 1X1GA 3P6AA 1X05A 2DLWA 4HAWB 3QIJA 5D3WA 2QKMA 4GPTB 2LULA 2M14A 5C5BB 5HE1A 3AU5A 5L81A 5C16A 3P7ZA 4MT7A 3G9WA 1PMSA 3ML4A 5KQ1A 3TCAA 2GCJA 4ZRIA 1P6SA 1IRSA 2LKOA 1N3HA 2HE7A 5J3TA 2KGXB 4HAZB 2YS1A 4GZUA 1E5WA 4P7IA 2K2JA 5C5BA 1BAKA 4ZRJA 4A5KA 1QC6A 1MAIA 2CRFA 3OANA 1MK7B 4A6FB 2N0YA 4CHMA 3M1IB 2EMTA 3PG7A 2I5CA 2LYDA 1BY1A 1J0WA 3F0WA 2LOZA 3ODXA 3GYOA 5DH9B 1FB8A 3V5WA 2K2UA 4XWXA 2IYBA 5GOWB 3GF9A 4EKUA 1LB1A 3SNHA 2DHJA 2XQNM 1RJ2A 2DYQA 1TJ6A 3T06A 2GS0A 2DYNA 2COAA 2W2WA 3SUZA 1ZM0A 4DXAB 1FOEA 2EMSA 2DTCA 2FJLA 2DHIA 3D8DA 4TYZA 4K2PA 1I2HA 4A6FA 2I1JA 3KZ1A 3AU4A 3LJUX 2L2IA 2LOXA 4CYEA 2UVMA 3HW2B 2G35A 5KQ4A 2DKQA 1DDWA 2DHKA 4EMOA 5JLJB 2ZPYA 2DX1A 1FAOA 4IAPA 4TKNA 4Y94A 1XKEA 3BJIA 3SV1A 1H4RA 3ODWA 2HTHB 1V5MA 2UZSA 2YT1A 4IFSA 2YF0A 1KZGA 4B6HA 2J0JA 3MDBC 3ZVRA 3A8PA 1U5FA 4KHBB 5HE3A 1W1GA 3FM8C 3PVWA 4KVGB 5JP4A 2GJYA 2IFSA 3GYPA 2N23A 1U2BA 3ULCA 1V89A 1WJ1A 1W1DA 5LOPB 3PP2A 2Z0OA 3PZDA 2MKRA 2W2XD 4WSFA 1ISNA 1KZ7A 1GG3A 3CXBB 2M38A 4K2OA 2K00A 3NSUA 2Y8FA 1ZSQA 1EAZA 2I5FA 4HB0B 4HATB 3F5RA 3SYXA 2J0MA 3PSCA 2BCJA 1U29A 3EO2A 4K81A 1FGYA 2D9WA 2EJ8A 4F7HA 5JHHA 1FGZA 3TFMA 1V88A 2D4QA 1DBHA 2D10A 2L1CA 3BINA 1DYNA 4L6EA 2VRWB 2I1KA 2KR9A 5CLQB 3ULBA 1P5TA 2JP2A 2V76A 3UZTA 4IOYX 3U7DA 1MIZB 2RGNB 1MK9B 2KCJA 1UPQA 5DHFB 1BTKA 1MPHA 4C0AA 2YSZA 3D8EA 2GCLA 4Z2NA 4GYVA 4A6KA
chains in the Genus database with same CATH superfamily
1SGHA 2QKLA 2VSZA 1XCGA 2Y7BA 2Z0PA 2D11A 4HAXB 2MFQA 1U27A 3O96A 3U8ZA 4HAYB 2D9XA 4PQ0A 4YONA 3WYFB 2VKIA 2X18A 4KHAA 5J3QA 2RRFA 1XD4A 2W2XC 4K17A 5DHAB 3NWFA 5JHGA 3VOQA 2ADZA 2D9YA 1EVHA 2MWNB 4KAXB 3CIKA 2Y8GA 2H7EA 1PLSA 1ZC4B 1WGQA 1QQGA 2P0FA 1MIXA 3QWMA 5FI1A 4CHJA 4MY6A 2OQBA 1X11A 1GC7A 3QBVB 1DDVA 2DN6A 3FEHA 1GC6A 1XODA 1UEFA 3D8FA 1UNPA 3KSYA 1DROA 3PVLA 3DXEA 4GXBA 4OT1A 2ELBA 4NSWA 3A8QA 5FI0A 4EJNA 1T77A 1UNQA 2YS5A 2H7DA 1BWNA 2CY4A 4HAVB 4DIXA 4WVFB 1V61A 4GMXB 5J3YA 1M7RA 1U5EA 3JV3A 1U5GA 2E2XA 1RRPB 2AL6A 4F7UP 1XR0B 2ROVA 4ZRKA 1B55A 5EFXA 1FHXA 5D3VA 2ROZB 3X23A 4HHVA 4Z2MB 4HDOA 2MDXA 4A6HA 3HK0A 2UZRA 1FHOA 3AJ4A 3N7CA 4MK0A 1H10A 4NY0A 1WVHA 4OSNA 1I7AA 1Z87A 1MI1A 2RSGA 2PZ1A 2DX5A 5DIFB 1NTYA 1K5GB 1X86A 4QJ5B 2P0DA 1J19A 2RUKB 5DI9B 1UPRA 3NWDA 5D3YA 1NTVA 3NW8A 5CLLB 2D9ZA 2Z4DA 4CSQA 2ELAA 3OHMB 1ZVRA 2P8VA 2YRYA 2EC1A 4HB4B 1P3RA 2AEHA 5I2MA 3FVCA 2RVBB 4KHOA 1V5UA 1KI1B 5D27A 1Y19B 2YS3A 1OMWA 5KCVA 2DFKA 3TW1A 1ZC3B 5LONB 4H8SA 1OQNA 1X1FA 4D0NB 1XX0A 2J59M 4DBBA 3KRXA 4DX8A 5D3XA 3ZDTA 1TXDA 2NZ8B 2KUQA 2R0DA 2Q13A 1WG7A 2RNRB 2D2QA 5C79A 4GMVA 1BTNA 4WJ7A 3RCPA 1NI2A 1OY2A 3HIEA 1EGXA 1Q67A 1NU2A 1U5DA 1UNRA 3TVVA 1F5XA 2LG1A 3VIAA 2NBVA 2R09A 3IVFA 1W1HA 3PEGA 3MPXA 3SO6A 1LW3A 2P0HA 5HE2A 4D0OA 2OTXA 4HDQA 2KUPA 1K5DB 4YL8A 2CODA 4F7GA 2CY5A 3NWAA 1WGUA 3DXDA 1AWEA 2D9VA 4GN1A 2NMBA 2GUMA 3A98B 4HAUB 4GOUA 5IRSA 3KRWA 4PNKA 3DXCA 3B77A 3PVUA 3HQCA 2COFA 2RLOA 1WI1A 1WJMA 2Z0QA 1ZYIA 5HE0A 5C6RA 1EF1A 2YVCA 1V5PA 1TQZA 2CAYA 2YT2A 3ODOA 2DKPA 2Z59A 4HB3B 1DDMA 1PFJA 4HB2B 1AQCA 3KY9A 2Z14A 3WA0A 4BBKA 2YT0A 2COCA 1M7EA 1FHWA 3FSSA 4L1RA 2J0KA 3TO1A 1SHCA 1Y5OA 4DX90 1MKEA 2DA0A 1X1GA 3P6AA 1X05A 2DLWA 4HAWB 3QIJA 5D3WA 2QKMA 4GPTB 2LULA 2M14A 5C5BB 5HE1A 3AU5A 5L81A 5C16A 3P7ZA 4MT7A 3G9WA 1PMSA 3ML4A 5KQ1A 3TCAA 2GCJA 4ZRIA 1P6SA 1IRSA 2LKOA 1N3HA 2HE7A 5J3TA 2KGXB 4QXAB 2K49A 4HAZB 2YS1A 4GZUA 1E5WA 4P7IA 2K2JA 5C5BA 1BAKA 4ZRJA 4A5KA 1QC6A 1MAIA 2CRFA 3OANA 1MK7B 4A6FB 2N0YA 4CHMA 3M1IB 2EMTA 3PG7A 2I5CA 2LYDA 1BY1A 1J0WA 3F0WA 2LOZA 3ODXA 3GYOA 5DH9B 1FB8A 3V5WA 2K2UA 4XWXA 2IYBA 5GOWB 3GF9A 4EKUA 1LB1A 3SNHA 2DHJA 2XQNM 1RJ2A 2DYQA 1TJ6A 3T06A 2KIGA 2GS0A 3U12A 2DYNA 2COAA 2W2WA 3SUZA 2KR0A 1ZM0A 4DXAB 1FOEA 5M4YB 2EMSA 2DTCA 5LG4B 2FJLA 2DHIA 5I2SA 3D8DA 4TYZA 4K2PA 1I2HA 4A6FA 2I1JA 3HSAA 3KZ1A 4KHBA 3AU4A 3LJUX 2L2IA 2LOXA 4CYEA 2UVMA 3HW2B 2G35A 5KQ4A 2DKQA 1DDWA 2DHKA 4EMOA 5JLJB 2ZPYA 2DX1A 4HSIA 1FAOA 4IAPA 4TKNA 4Y94A 1XKEA 3BJIA 3SV1A 1H4RA 3ODWA 2HTHB 1V5MA 2UZSA 2YT1A 4IFSA 2YF0A 1KZGA 4B6HA 2J0JA 3MDBC 3ZVRA 3A8PA 1U5FA 4KHBB 5HE3A 4D6WA 1W1GA 3FM8C 3PVWA 4KVGB 5JP4A 2GJYA 2IFSA 3GYPA 2N23A 1U2BA 3ULCA 1V89A 1WJ1A 1W1DA 5LOPB 3PP2A 2Z0OA 3PZDA 2MKRA 2W2XD 4WSFA 1ISNA 1KZ7A 1GG3A 3CXBB 2M38A 4K2OA 2K00A 3NSUA 4GNKB 2Y8FA 2K8EA 2KIEA 1ZSQA 1EAZA 2I5FA 2R2YA 4HB0B 3DCXA 4HATB 3F5RA 3SYXA 2J0MA 3PSCA 2BCJA 1U29A 3EO2A 4K81A 1FGYA 2D9WA 2EJ8A 2ZKMX 4F7HA 5JHHA 1FGZA 3TFMA 1V88A 2D4QA 1DBHA 2D10A 2L1CA 2FJUB 2Z13A 3BINA 1DYNA 4L6EA 2VRWB 2I1KA 2KR9A 5CLQB 4QJ3B 3ULBA 1P5TA 3A58A 2JP2A 2V76A 3UZTA 4IOYX 3U7DA 1MIZB 2RGNB 1MK9B 2KCJA 1UPQA 5DHFB 1BTKA 1MPHA 4QJ4B 4C0AA 2YSZA 3D8EA 2GCLA 4Z2NA 4GYVA 4A6KA
chains in the Genus database with same CATH topology
1SGHA 2QKLA 2VSZA 1XCGA 2Y7BA 2Z0PA 2D11A 4HAXB 2MFQA 1U27A 3O96A 3U8ZA 4HAYB 2D9XA 4PQ0A 4YONA 3WYFB 2VKIA 2X18A 4KHAA 5J3QA 1XD4A 2W2XC 4K17A 5DHAB 5JHGA 3VOQA 2ADZA 2D9YA 1EVHA 2MWNB 4KAXB 3CIKA 2Y8GA 2H7EA 1PLSA 1ZC4B 1WGQA 1QQGA 2P0FA 1MIXA 3QWMA 5FI1A 4CHJA 4MY6A 2OQBA 1X11A 1GC7A 3QBVB 1DDVA 2DN6A 3FEHA 1GC6A 1XODA 1UEFA 3D8FA 1UNPA 3KSYA 1DROA 3PVLA 3DXEA 4GXBA 2ELBA 4NSWA 3A8QA 5FI0A 4EJNA 1UNQA 2YS5A 2H7DA 1BWNA 2CY4A 4HAVB 4WVFB 1V61A 4GMXB 5J3YA 1M7RA 1U5EA 3JV3A 1U5GA 2E2XA 1RRPB 2AL6A 4F7UP 1XR0B 2ROVA 4ZRKA 1B55A 5EFXA 1FHXA 5D3VA 2ROZB 3X23A 4HHVA 4Z2MB 4HDOA 2MDXA 4A6HA 3HK0A 2UZRA 1FHOA 3AJ4A 3N7CA 4MK0A 1H10A 4NY0A 1WVHA 1I7AA 1Z87A 2RSGA 2PZ1A 2DX5A 5DIFB 1NTYA 1K5GB 1X86A 2P0DA 1J19A 2RUKB 5DI9B 1UPRA 5D3YA 1NTVA 5CLLB 2D9ZA 2ELAA 1ZVRA 2P8VA 2YRYA 2EC1A 4HB4B 1P3RA 2AEHA 2RVBB 4KHOA 1V5UA 1KI1B 5D27A 1Y19B 2YS3A 1OMWA 5KCVA 2DFKA 3TW1A 1ZC3B 5LONB 4H8SA 1OQNA 1X1FA 4D0NB 1XX0A 2J59M 4DBBA 3KRXA 4DX8A 5D3XA 3ZDTA 1TXDA 2NZ8B 2R0DA 2Q13A 1WG7A 2RNRB 2D2QA 5C79A 4GMVA 1BTNA 4WJ7A 3RCPA 1NI2A 1OY2A 1EGXA 1Q67A 1NU2A 1U5DA 1UNRA 3TVVA 1F5XA 2LG1A 3VIAA 2R09A 3IVFA 1W1HA 3PEGA 3MPXA 3SO6A 1LW3A 2P0HA 5HE2A 4D0OA 2OTXA 4HDQA 2KUPA 1K5DB 4YL8A 2CODA 4F7GA 2CY5A 1WGUA 3DXDA 1AWEA 2D9VA 4GN1A 2NMBA 3A98B 4HAUB 4GOUA 3KRWA 4PNKA 3DXCA 3PVUA 3HQCA 2COFA 2RLOA 1WI1A 1WJMA 2Z0QA 5HE0A 5C6RA 1EF1A 2YVCA 1V5PA 1TQZA 2CAYA 3ODOA 2DKPA 4HB3B 1DDMA 1PFJA 4HB2B 1AQCA 3KY9A 3WA0A 4BBKA 2YT0A 2COCA 1M7EA 1FHWA 3FSSA 2J0KA 3TO1A 1SHCA 1Y5OA 4DX90 1MKEA 2DA0A 1X1GA 3P6AA 1X05A 2DLWA 4HAWB 3QIJA 5D3WA 2QKMA 4GPTB 2LULA 2M14A 5C5BB 5HE1A 3AU5A 5L81A 5C16A 3P7ZA 4MT7A 3G9WA 1PMSA 3ML4A 5KQ1A 3TCAA 2GCJA 4ZRIA 1P6SA 1IRSA 2LKOA 1N3HA 2HE7A 5J3TA 2KGXB 4HAZB 2YS1A 4GZUA 1E5WA 4P7IA 2K2JA 5C5BA 1BAKA 4ZRJA 4A5KA 1QC6A 1MAIA 2CRFA 3OANA 1MK7B 4A6FB 2N0YA 4CHMA 3M1IB 2EMTA 3PG7A 2I5CA 2LYDA 1BY1A 1J0WA 3F0WA 2LOZA 3ODXA 3GYOA 5DH9B 1FB8A 3V5WA 2K2UA 4XWXA 2IYBA 5GOWB 3GF9A 4EKUA 1LB1A 3SNHA 2DHJA 2XQNM 1RJ2A 2DYQA 1TJ6A 3T06A 2GS0A 2DYNA 2COAA 2W2WA 3SUZA 1ZM0A 4DXAB 1FOEA 2EMSA 2DTCA 2FJLA 2DHIA 3D8DA 4TYZA 4K2PA 1I2HA 4A6FA 2I1JA 3KZ1A 3AU4A 3LJUX 2L2IA 2LOXA 4CYEA 2UVMA 3HW2B 2G35A 5KQ4A 2DKQA 1DDWA 2DHKA 4EMOA 5JLJB 2ZPYA 2DX1A 1FAOA 4IAPA 4TKNA 4Y94A 1XKEA 3BJIA 3SV1A 1H4RA 3ODWA 2HTHB 1V5MA 2UZSA 2YT1A 4IFSA 2YF0A 1KZGA 4B6HA 2J0JA 3MDBC 3ZVRA 3A8PA 1U5FA 4KHBB 5HE3A 1W1GA 3FM8C 3PVWA 4KVGB 5JP4A 2GJYA 2IFSA 3GYPA 2N23A 1U2BA 3ULCA 1V89A 1WJ1A 1W1DA 5LOPB 3PP2A 2Z0OA 3PZDA 2MKRA 2W2XD 4WSFA 1ISNA 1KZ7A 1GG3A 3CXBB 2M38A 4K2OA 2K00A 3NSUA 2Y8FA 1ZSQA 1EAZA 2I5FA 4HB0B 4HATB 3F5RA 3SYXA 2J0MA 3PSCA 2BCJA 1U29A 3EO2A 4K81A 1FGYA 2D9WA 2EJ8A 4F7HA 5JHHA 1FGZA 3TFMA 1V88A 2D4QA 1DBHA 2D10A 2L1CA 3BINA 1DYNA 4L6EA 2VRWB 2I1KA 2KR9A 5CLQB 3ULBA 1P5TA 2JP2A 2V76A 3UZTA 4IOYX 3U7DA 1MIZB 2RGNB 1MK9B 2KCJA 1UPQA 5DHFB 1BTKA 1MPHA 4C0AA 2YSZA 3D8EA 2GCLA 4Z2NA 4GYVA 4A6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGH A;  2QKL A;  2VSZ A;  1XCG A;  2Y7B A;  2Z0P A;  2D11 A;  4HAX B;  2MFQ A;  1U27 A;  3O96 A;  3U8Z A;  4HAY B;  2D9X A;  4PQ0 A;  4YON A;  3WYF B;  2VKI A;  2X18 A;  4KHA A;  5J3Q A;  1XD4 A;  2W2X C;  4K17 A;  5DHA B;  5JHG A;  3VOQ A;  2ADZ A;  2D9Y A;  1EVH A;  2MWN B;  4KAX B;  3CIK A;  2Y8G A;  2H7E A;  1PLS A;  1ZC4 B;  1WGQ A;  1QQG A;  2P0F A;  1MIX A;  3QWM A;  5FI1 A;  4CHJ A;  4MY6 A;  2OQB A;  1X11 A;  1GC7 A;  3QBV B;  1DDV A;  2DN6 A;  3FEH A;  1GC6 A;  1XOD A;  1UEF A;  3D8F A;  1UNP A;  3KSY A;  1DRO A;  3PVL A;  3DXE A;  4GXB A;  2ELB A;  4NSW A;  3A8Q A;  5FI0 A;  4EJN A;  1UNQ A;  2YS5 A;  2H7D A;  1BWN A;  2CY4 A;  4HAV B;  4WVF B;  1V61 A;  4GMX B;  5J3Y A;  1M7R A;  1U5E A;  3JV3 A;  1U5G A;  2E2X A;  1RRP B;  2AL6 A;  4F7U P;  1XR0 B;  2ROV A;  4ZRK A;  1B55 A;  5EFX A;  1FHX A;  5D3V A;  2ROZ B;  3X23 A;  4HHV A;  4Z2M B;  4HDO A;  2MDX A;  4A6H A;  3HK0 A;  2UZR A;  1FHO A;  3AJ4 A;  3N7C A;  4MK0 A;  1H10 A;  4NY0 A;  1WVH A;  1I7A A;  1Z87 A;  2RSG A;  2PZ1 A;  2DX5 A;  5DIF B;  1NTY A;  1K5G B;  1X86 A;  2P0D A;  1J19 A;  2RUK B;  5DI9 B;  1UPR A;  5D3Y A;  1NTV A;  5CLL B;  2D9Z A;  2ELA A;  1ZVR A;  2P8V A;  2YRY A;  2EC1 A;  4HB4 B;  1P3R A;  2AEH A;  2RVB B;  4KHO A;  1V5U A;  1KI1 B;  5D27 A;  1Y19 B;  2YS3 A;  1OMW A;  5KCV A;  2DFK A;  3TW1 A;  1ZC3 B;  5LON B;  4H8S A;  1OQN A;  1X1F A;  4D0N B;  1XX0 A;  2J59 M;  4DBB A;  3KRX A;  4DX8 A;  5D3X A;  3ZDT A;  1TXD A;  2NZ8 B;  2R0D A;  2Q13 A;  1WG7 A;  2RNR B;  2D2Q A;  5C79 A;  4GMV A;  1BTN A;  4WJ7 A;  3RCP A;  1NI2 A;  1OY2 A;  1EGX A;  1Q67 A;  1NU2 A;  1U5D A;  1UNR A;  3TVV A;  1F5X A;  2LG1 A;  3VIA A;  2R09 A;  3IVF A;  1W1H A;  3PEG A;  3MPX A;  3SO6 A;  1LW3 A;  2P0H A;  5HE2 A;  4D0O A;  2OTX A;  4HDQ A;  2KUP A;  1K5D B;  4YL8 A;  2COD A;  4F7G A;  2CY5 A;  1WGU A;  3DXD A;  1AWE A;  2D9V A;  4GN1 A;  2NMB A;  3A98 B;  4HAU B;  4GOU A;  3KRW A;  4PNK A;  3DXC A;  3PVU A;  3HQC A;  2COF A;  2RLO A;  1WI1 A;  1WJM A;  2Z0Q A;  5HE0 A;  5C6R A;  1EF1 A;  2YVC A;  1V5P A;  1TQZ A;  2CAY A;  3ODO A;  2DKP A;  4HB3 B;  1DDM A;  1PFJ A;  4HB2 B;  1AQC A;  3KY9 A;  3WA0 A;  4BBK A;  2YT0 A;  2COC A;  1M7E A;  1FHW A;  3FSS A;  2J0K A;  3TO1 A;  1SHC A;  1Y5O A;  4DX9 0;  1MKE A;  2DA0 A;  1X1G A;  3P6A A;  1X05 A;  2DLW A;  4HAW B;  3QIJ A;  5D3W A;  2QKM A;  4GPT B;  2LUL A;  2M14 A;  5C5B B;  5HE1 A;  3AU5 A;  5L81 A;  5C16 A;  3P7Z A;  4MT7 A;  3G9W A;  1PMS A;  3ML4 A;  5KQ1 A;  3TCA A;  2GCJ A;  4ZRI A;  1P6S A;  1IRS A;  2LKO A;  1N3H A;  2HE7 A;  5J3T A;  2KGX B;  4HAZ B;  2YS1 A;  4GZU A;  1E5W A;  4P7I A;  2K2J A;  5C5B A;  1BAK A;  4ZRJ A;  4A5K A;  1QC6 A;  1MAI A;  2CRF A;  3OAN A;  1MK7 B;  4A6F B;  2N0Y A;  4CHM A;  3M1I B;  2EMT A;  3PG7 A;  2I5C A;  2LYD A;  1BY1 A;  1J0W A;  3F0W A;  2LOZ A;  3ODX A;  3GYO A;  5DH9 B;  1FB8 A;  3V5W A;  2K2U A;  4XWX A;  2IYB A;  5GOW B;  3GF9 A;  4EKU A;  1LB1 A;  3SNH A;  2DHJ A;  2XQN M;  1RJ2 A;  2DYQ A;  1TJ6 A;  3T06 A;  2GS0 A;  2DYN A;  2COA A;  2W2W A;  3SUZ A;  1ZM0 A;  4DXA B;  1FOE A;  2EMS A;  2DTC A;  2FJL A;  2DHI A;  3D8D A;  4TYZ A;  4K2P A;  1I2H A;  4A6F A;  2I1J A;  3KZ1 A;  3AU4 A;  3LJU X;  2L2I A;  2LOX A;  4CYE A;  2UVM A;  3HW2 B;  2G35 A;  5KQ4 A;  2DKQ A;  1DDW A;  2DHK A;  4EMO A;  5JLJ B;  2ZPY A;  2DX1 A;  1FAO A;  4IAP A;  4TKN A;  4Y94 A;  1XKE A;  3BJI A;  3SV1 A;  1H4R A;  3ODW A;  2HTH B;  1V5M A;  2UZS A;  2YT1 A;  4IFS A;  2YF0 A;  1KZG A;  4B6H A;  2J0J A;  3MDB C;  3ZVR A;  3A8P A;  1U5F A;  4KHB B;  5HE3 A;  1W1G A;  3FM8 C;  3PVW A;  4KVG B;  5JP4 A;  2GJY A;  2IFS A;  3GYP A;  2N23 A;  1U2B A;  3ULC A;  1V89 A;  1WJ1 A;  1W1D A;  5LOP B;  3PP2 A;  2Z0O A;  3PZD A;  2MKR A;  2W2X D;  4WSF A;  1ISN A;  1KZ7 A;  1GG3 A;  3CXB B;  2M38 A;  4K2O A;  2K00 A;  3NSU A;  2Y8F A;  1ZSQ A;  1EAZ A;  2I5F A;  4HB0 B;  4HAT B;  3F5R A;  3SYX A;  2J0M A;  3PSC A;  2BCJ A;  1U29 A;  3EO2 A;  4K81 A;  1FGY A;  2D9W A;  2EJ8 A;  4F7H A;  5JHH A;  1FGZ A;  3TFM A;  1V88 A;  2D4Q A;  1DBH A;  2D10 A;  2L1C A;  3BIN A;  1DYN A;  4L6E A;  2VRW B;  2I1K A;  2KR9 A;  5CLQ B;  3ULB A;  1P5T A;  2JP2 A;  2V76 A;  3UZT A;  4IOY X;  3U7D A;  1MIZ B;  2RGN B;  1MK9 B;  2KCJ A;  1UPQ A;  5DHF B;  1BTK A;  1MPH A;  4C0A A;  2YSZ A;  3D8E A;  2GCL A;  4Z2N A;  4GYV A;  4A6K A; 
#chains in the Genus database with same CATH topology
 1SGH A;  2QKL A;  2VSZ A;  1XCG A;  2Y7B A;  2Z0P A;  2D11 A;  4HAX B;  2MFQ A;  1U27 A;  3O96 A;  3U8Z A;  4HAY B;  2D9X A;  4PQ0 A;  4YON A;  3WYF B;  2VKI A;  2X18 A;  4KHA A;  5J3Q A;  2RRF A;  1XD4 A;  2W2X C;  4K17 A;  5DHA B;  3NWF A;  5JHG A;  3VOQ A;  2ADZ A;  2D9Y A;  1EVH A;  2MWN B;  4KAX B;  3CIK A;  2Y8G A;  2H7E A;  1PLS A;  1ZC4 B;  1WGQ A;  1QQG A;  2P0F A;  1MIX A;  3QWM A;  5FI1 A;  4CHJ A;  4MY6 A;  2OQB A;  1X11 A;  1GC7 A;  3QBV B;  1DDV A;  2DN6 A;  3FEH A;  1GC6 A;  1XOD A;  1UEF A;  3D8F A;  1UNP A;  3KSY A;  1DRO A;  3PVL A;  3DXE A;  4GXB A;  4OT1 A;  2ELB A;  4NSW A;  3A8Q A;  5FI0 A;  4EJN A;  1T77 A;  1UNQ A;  2YS5 A;  2H7D A;  1BWN A;  2CY4 A;  4HAV B;  4DIX A;  4WVF B;  1V61 A;  4GMX B;  5J3Y A;  1M7R A;  1U5E A;  3JV3 A;  1U5G A;  2E2X A;  1RRP B;  2AL6 A;  4F7U P;  1XR0 B;  2ROV A;  4ZRK A;  1B55 A;  5EFX A;  1FHX A;  5D3V A;  2ROZ B;  3X23 A;  4HHV A;  4Z2M B;  4HDO A;  2MDX A;  4A6H A;  3HK0 A;  2UZR A;  1FHO A;  3AJ4 A;  3N7C A;  4MK0 A;  1H10 A;  4NY0 A;  1WVH A;  4OSN A;  1I7A A;  1Z87 A;  1MI1 A;  2RSG A;  2PZ1 A;  2DX5 A;  5DIF B;  1NTY A;  1K5G B;  1X86 A;  4QJ5 B;  2P0D A;  1J19 A;  2RUK B;  5DI9 B;  1UPR A;  3NWD A;  5D3Y A;  1NTV A;  3NW8 A;  5CLL B;  2D9Z A;  2Z4D A;  4CSQ A;  2ELA A;  3OHM B;  1ZVR A;  2P8V A;  2YRY A;  2EC1 A;  4HB4 B;  1P3R A;  2AEH A;  5I2M A;  3FVC A;  2RVB B;  4KHO A;  1V5U A;  1KI1 B;  5D27 A;  1Y19 B;  2YS3 A;  1OMW A;  5KCV A;  2DFK A;  3TW1 A;  1ZC3 B;  5LON B;  4H8S A;  1OQN A;  1X1F A;  4D0N B;  1XX0 A;  2J59 M;  4DBB A;  3KRX A;  4DX8 A;  5D3X A;  3ZDT A;  1TXD A;  2NZ8 B;  2KUQ A;  2R0D A;  2Q13 A;  1WG7 A;  2RNR B;  2D2Q A;  5C79 A;  4GMV A;  1BTN A;  4WJ7 A;  3RCP A;  1NI2 A;  1OY2 A;  3HIE A;  1EGX A;  1Q67 A;  1NU2 A;  1U5D A;  1UNR A;  3TVV A;  1F5X A;  2LG1 A;  3VIA A;  2NBV A;  2R09 A;  3IVF A;  1W1H A;  3PEG A;  3MPX A;  3SO6 A;  1LW3 A;  2P0H A;  5HE2 A;  4D0O A;  2OTX A;  4HDQ A;  2KUP A;  1K5D B;  4YL8 A;  2COD A;  4F7G A;  2CY5 A;  3NWA A;  1WGU A;  3DXD A;  1AWE A;  2D9V A;  4GN1 A;  2NMB A;  2GUM A;  3A98 B;  4HAU B;  4GOU A;  5IRS A;  3KRW A;  4PNK A;  3DXC A;  3B77 A;  3PVU A;  3HQC A;  2COF A;  2RLO A;  1WI1 A;  1WJM A;  2Z0Q A;  1ZYI A;  5HE0 A;  5C6R A;  1EF1 A;  2YVC A;  1V5P A;  1TQZ A;  2CAY A;  2YT2 A;  3ODO A;  2DKP A;  2Z59 A;  4HB3 B;  1DDM A;  1PFJ A;  4HB2 B;  1AQC A;  3KY9 A;  2Z14 A;  3WA0 A;  4BBK A;  2YT0 A;  2COC A;  1M7E A;  1FHW A;  3FSS A;  4L1R A;  2J0K A;  3TO1 A;  1SHC A;  1Y5O A;  4DX9 0;  1MKE A;  2DA0 A;  1X1G A;  3P6A A;  1X05 A;  2DLW A;  4HAW B;  3QIJ A;  5D3W A;  2QKM A;  4GPT B;  2LUL A;  2M14 A;  5C5B B;  5HE1 A;  3AU5 A;  5L81 A;  5C16 A;  3P7Z A;  4MT7 A;  3G9W A;  1PMS A;  3ML4 A;  5KQ1 A;  3TCA A;  2GCJ A;  4ZRI A;  1P6S A;  1IRS A;  2LKO A;  1N3H A;  2HE7 A;  5J3T A;  2KGX B;  4QXA B;  2K49 A;  4HAZ B;  2YS1 A;  4GZU A;  1E5W A;  4P7I A;  2K2J A;  5C5B A;  1BAK A;  4ZRJ A;  4A5K A;  1QC6 A;  1MAI A;  2CRF A;  3OAN A;  1MK7 B;  4A6F B;  2N0Y A;  4CHM A;  3M1I B;  2EMT A;  3PG7 A;  2I5C A;  2LYD A;  1BY1 A;  1J0W A;  3F0W A;  2LOZ A;  3ODX A;  3GYO A;  5DH9 B;  1FB8 A;  3V5W A;  2K2U A;  4XWX A;  2IYB A;  5GOW B;  3GF9 A;  4EKU A;  1LB1 A;  3SNH A;  2DHJ A;  2XQN M;  1RJ2 A;  2DYQ A;  1TJ6 A;  3T06 A;  2KIG A;  2GS0 A;  3U12 A;  2DYN A;  2COA A;  2W2W A;  3SUZ A;  2KR0 A;  1ZM0 A;  4DXA B;  1FOE A;  5M4Y B;  2EMS A;  2DTC A;  5LG4 B;  2FJL A;  2DHI A;  5I2S A;  3D8D A;  4TYZ A;  4K2P A;  1I2H A;  4A6F A;  2I1J A;  3HSA A;  3KZ1 A;  4KHB A;  3AU4 A;  3LJU X;  2L2I A;  2LOX A;  4CYE A;  2UVM A;  3HW2 B;  2G35 A;  5KQ4 A;  2DKQ A;  1DDW A;  2DHK A;  4EMO A;  5JLJ B;  2ZPY A;  2DX1 A;  4HSI A;  1FAO A;  4IAP A;  4TKN A;  4Y94 A;  1XKE A;  3BJI A;  3SV1 A;  1H4R A;  3ODW A;  2HTH B;  1V5M A;  2UZS A;  2YT1 A;  4IFS A;  2YF0 A;  1KZG A;  4B6H A;  2J0J A;  3MDB C;  3ZVR A;  3A8P A;  1U5F A;  4KHB B;  5HE3 A;  4D6W A;  1W1G A;  3FM8 C;  3PVW A;  4KVG B;  5JP4 A;  2GJY A;  2IFS A;  3GYP A;  2N23 A;  1U2B A;  3ULC A;  1V89 A;  1WJ1 A;  1W1D A;  5LOP B;  3PP2 A;  2Z0O A;  3PZD A;  2MKR A;  2W2X D;  4WSF A;  1ISN A;  1KZ7 A;  1GG3 A;  3CXB B;  2M38 A;  4K2O A;  2K00 A;  3NSU A;  4GNK B;  2Y8F A;  2K8E A;  2KIE A;  1ZSQ A;  1EAZ A;  2I5F A;  2R2Y A;  4HB0 B;  3DCX A;  4HAT B;  3F5R A;  3SYX A;  2J0M A;  3PSC A;  2BCJ A;  1U29 A;  3EO2 A;  4K81 A;  1FGY A;  2D9W A;  2EJ8 A;  2ZKM X;  4F7H A;  5JHH A;  1FGZ A;  3TFM A;  1V88 A;  2D4Q A;  1DBH A;  2D10 A;  2L1C A;  2FJU B;  2Z13 A;  3BIN A;  1DYN A;  4L6E A;  2VRW B;  2I1K A;  2KR9 A;  5CLQ B;  4QJ3 B;  3ULB A;  1P5T A;  3A58 A;  2JP2 A;  2V76 A;  3UZT A;  4IOY X;  3U7D A;  1MIZ B;  2RGN B;  1MK9 B;  2KCJ A;  1UPQ A;  5DHF B;  1BTK A;  1MPH A;  4QJ4 B;  4C0A A;  2YSZ A;  3D8E A;  2GCL A;  4Z2N A;  4GYV A;  4A6K A; 
#chains in the Genus database with same CATH homology
 1SGH A;  2QKL A;  2VSZ A;  1XCG A;  2Y7B A;  2Z0P A;  2D11 A;  4HAX B;  2MFQ A;  1U27 A;  3O96 A;  3U8Z A;  4HAY B;  2D9X A;  4PQ0 A;  4YON A;  3WYF B;  2VKI A;  2X18 A;  4KHA A;  5J3Q A;  1XD4 A;  2W2X C;  4K17 A;  5DHA B;  5JHG A;  3VOQ A;  2ADZ A;  2D9Y A;  1EVH A;  2MWN B;  4KAX B;  3CIK A;  2Y8G A;  2H7E A;  1PLS A;  1ZC4 B;  1WGQ A;  1QQG A;  2P0F A;  1MIX A;  3QWM A;  5FI1 A;  4CHJ A;  4MY6 A;  2OQB A;  1X11 A;  1GC7 A;  3QBV B;  1DDV A;  2DN6 A;  3FEH A;  1GC6 A;  1XOD A;  1UEF A;  3D8F A;  1UNP A;  3KSY A;  1DRO A;  3PVL A;  3DXE A;  4GXB A;  2ELB A;  4NSW A;  3A8Q A;  5FI0 A;  4EJN A;  1UNQ A;  2YS5 A;  2H7D A;  1BWN A;  2CY4 A;  4HAV B;  4WVF B;  1V61 A;  4GMX B;  5J3Y A;  1M7R A;  1U5E A;  3JV3 A;  1U5G A;  2E2X A;  1RRP B;  2AL6 A;  4F7U P;  1XR0 B;  2ROV A;  4ZRK A;  1B55 A;  5EFX A;  1FHX A;  5D3V A;  2ROZ B;  3X23 A;  4HHV A;  4Z2M B;  4HDO A;  2MDX A;  4A6H A;  3HK0 A;  2UZR A;  1FHO A;  3AJ4 A;  3N7C A;  4MK0 A;  1H10 A;  4NY0 A;  1WVH A;  1I7A A;  1Z87 A;  2RSG A;  2PZ1 A;  2DX5 A;  5DIF B;  1NTY A;  1K5G B;  1X86 A;  2P0D A;  1J19 A;  2RUK B;  5DI9 B;  1UPR A;  5D3Y A;  1NTV A;  5CLL B;  2D9Z A;  2ELA A;  1ZVR A;  2P8V A;  2YRY A;  2EC1 A;  4HB4 B;  1P3R A;  2AEH A;  2RVB B;  4KHO A;  1V5U A;  1KI1 B;  5D27 A;  1Y19 B;  2YS3 A;  1OMW A;  5KCV A;  2DFK A;  3TW1 A;  1ZC3 B;  5LON B;  4H8S A;  1OQN A;  1X1F A;  4D0N B;  1XX0 A;  2J59 M;  4DBB A;  3KRX A;  4DX8 A;  5D3X A;  3ZDT A;  1TXD A;  2NZ8 B;  2R0D A;  2Q13 A;  1WG7 A;  2RNR B;  2D2Q A;  5C79 A;  4GMV A;  1BTN A;  4WJ7 A;  3RCP A;  1NI2 A;  1OY2 A;  1EGX A;  1Q67 A;  1NU2 A;  1U5D A;  1UNR A;  3TVV A;  1F5X A;  2LG1 A;  3VIA A;  2R09 A;  3IVF A;  1W1H A;  3PEG A;  3MPX A;  3SO6 A;  1LW3 A;  2P0H A;  5HE2 A;  4D0O A;  2OTX A;  4HDQ A;  2KUP A;  1K5D B;  4YL8 A;  2COD A;  4F7G A;  2CY5 A;  1WGU A;  3DXD A;  1AWE A;  2D9V A;  4GN1 A;  2NMB A;  3A98 B;  4HAU B;  4GOU A;  3KRW A;  4PNK A;  3DXC A;  3PVU A;  3HQC A;  2COF A;  2RLO A;  1WI1 A;  1WJM A;  2Z0Q A;  5HE0 A;  5C6R A;  1EF1 A;  2YVC A;  1V5P A;  1TQZ A;  2CAY A;  3ODO A;  2DKP A;  4HB3 B;  1DDM A;  1PFJ A;  4HB2 B;  1AQC A;  3KY9 A;  3WA0 A;  4BBK A;  2YT0 A;  2COC A;  1M7E A;  1FHW A;  3FSS A;  2J0K A;  3TO1 A;  1SHC A;  1Y5O A;  4DX9 0;  1MKE A;  2DA0 A;  1X1G A;  3P6A A;  1X05 A;  2DLW A;  4HAW B;  3QIJ A;  5D3W A;  2QKM A;  4GPT B;  2LUL A;  2M14 A;  5C5B B;  5HE1 A;  3AU5 A;  5L81 A;  5C16 A;  3P7Z A;  4MT7 A;  3G9W A;  1PMS A;  3ML4 A;  5KQ1 A;  3TCA A;  2GCJ A;  4ZRI A;  1P6S A;  1IRS A;  2LKO A;  1N3H A;  2HE7 A;  5J3T A;  2KGX B;  4HAZ B;  2YS1 A;  4GZU A;  1E5W A;  4P7I A;  2K2J A;  5C5B A;  1BAK A;  4ZRJ A;  4A5K A;  1QC6 A;  1MAI A;  2CRF A;  3OAN A;  1MK7 B;  4A6F B;  2N0Y A;  4CHM A;  3M1I B;  2EMT A;  3PG7 A;  2I5C A;  2LYD A;  1BY1 A;  1J0W A;  3F0W A;  2LOZ A;  3ODX A;  3GYO A;  5DH9 B;  1FB8 A;  3V5W A;  2K2U A;  4XWX A;  2IYB A;  5GOW B;  3GF9 A;  4EKU A;  1LB1 A;  3SNH A;  2DHJ A;  2XQN M;  1RJ2 A;  2DYQ A;  1TJ6 A;  3T06 A;  2GS0 A;  2DYN A;  2COA A;  2W2W A;  3SUZ A;  1ZM0 A;  4DXA B;  1FOE A;  2EMS A;  2DTC A;  2FJL A;  2DHI A;  3D8D A;  4TYZ A;  4K2P A;  1I2H A;  4A6F A;  2I1J A;  3KZ1 A;  3AU4 A;  3LJU X;  2L2I A;  2LOX A;  4CYE A;  2UVM A;  3HW2 B;  2G35 A;  5KQ4 A;  2DKQ A;  1DDW A;  2DHK A;  4EMO A;  5JLJ B;  2ZPY A;  2DX1 A;  1FAO A;  4IAP A;  4TKN A;  4Y94 A;  1XKE A;  3BJI A;  3SV1 A;  1H4R A;  3ODW A;  2HTH B;  1V5M A;  2UZS A;  2YT1 A;  4IFS A;  2YF0 A;  1KZG A;  4B6H A;  2J0J A;  3MDB C;  3ZVR A;  3A8P A;  1U5F A;  4KHB B;  5HE3 A;  1W1G A;  3FM8 C;  3PVW A;  4KVG B;  5JP4 A;  2GJY A;  2IFS A;  3GYP A;  2N23 A;  1U2B A;  3ULC A;  1V89 A;  1WJ1 A;  1W1D A;  5LOP B;  3PP2 A;  2Z0O A;  3PZD A;  2MKR A;  2W2X D;  4WSF A;  1ISN A;  1KZ7 A;  1GG3 A;  3CXB B;  2M38 A;  4K2O A;  2K00 A;  3NSU A;  2Y8F A;  1ZSQ A;  1EAZ A;  2I5F A;  4HB0 B;  4HAT B;  3F5R A;  3SYX A;  2J0M A;  3PSC A;  2BCJ A;  1U29 A;  3EO2 A;  4K81 A;  1FGY A;  2D9W A;  2EJ8 A;  4F7H A;  5JHH A;  1FGZ A;  3TFM A;  1V88 A;  2D4Q A;  1DBH A;  2D10 A;  2L1C A;  3BIN A;  1DYN A;  4L6E A;  2VRW B;  2I1K A;  2KR9 A;  5CLQ B;  3ULB A;  1P5T A;  2JP2 A;  2V76 A;  3UZT A;  4IOY X;  3U7D A;  1MIZ B;  2RGN B;  1MK9 B;  2KCJ A;  1UPQ A;  5DHF B;  1BTK A;  1MPH A;  4C0A A;  2YSZ A;  3D8E A;  2GCL A;  4Z2N A;  4GYV A;  4A6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...