3ODXA

Crystal structure of an n-terminally truncated linker-dh/ph domains of p115-rhogef
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
355
structure length
336
Chain Sequence
PKSQVKRQEVISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLDELIEVHSLFLDRLMKRRQESIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPLSEFKNLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSLRPVLRLTSAMTREVATDHKAFYVLFTEAQIYELVAQTVSERKNWCALITETAGSLKVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho guanine nucleotide exchange factor 1
publication title Modulation of a GEF switch: Autoinhibition of the intrinsic guanine nucleotide exchange activity of p115-RhoREF
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 124
structure length 336
sequence length 355
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00621 RhoGEF RhoGEF domain
A PF17838 PH_16 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.900.10 Mainly Alpha Up-down Bundle Dbl Homology Domain; Chain A Dbl homology (DH) domain 3odxA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3odxA02
3X23A 3KRWA 5CLQB 1K5DB 1TXDA 2LKOA 1GG3A 1U5DA 5JP4A 3LJUX 2L1CA 1DDVA 1PMSA 2AEHA 4ZRJA 2QKLA 3D8EA 4WVFB 1U2BA 5LOPB 2Q13A 1U29A 2RGNB 5KQ4A 5D3YA 3SUZA 3G9WA 5LONB 3HQCA 1UPQA 3PVUA 1XR0B 3CXBB 4HAXB 1Q67A 4IAPA 1OQNA 1GC7A 5C6RA 3U7DA 2J0MA 2COAA 3KSYA 1DDMA 1F5XA 2W2WA 1V5UA 4DBBA 1U5EA 1ZC4B 5DH9B 3A8QA 3D8FA 2NZ8B 2MKRA 2KUPA 3ODWA 3D8DA 2DHIA 2Z0PA 1X05A 3N7CA 1H10A 2XQNM 2YT0A 1K5GB 1MIXA 3PZDA 4CHJA 5L81A 3QBVB 3IVFA 1BTNA 2BCJA 2LYDA 3MPXA 4HB3B 3ZDTA 3BINA 2CAYA 2L2IA 2VSZA 2LOXA 4EMOA 1DYNA 4HB2B 2YS1A 1KI1B 3PG7A 4YL8A 5DIFB 4IOYX 2YS5A 2DHJA 1V61A 3P7ZA 1E5WA 1WGQA 3TCAA 2YT1A 2RVBB 1KZGA 1W1GA 5DI9B 3QWMA 3ULCA 1MKEA 2W2XD 1XODA 4Z2MB 3SV1A 5GOWB 3VIAA 1AQCA 3HW2B 2HTHB 4HAUB 2RLOA 3GYOA 1ZSQA 4HAYB 2RUKB 2Y7BA 4GPTB 1J19A 4GYVA 4KAXB 3TVVA 2DTCA 3RCPA 2DN6A 1U27A 2CY5A 5JLJB 3SYXA 2P0DA 4B6HA 4WJ7A 4HAVB 1FHOA 1I2HA 1FGYA 5JHHA 3FSSA 3QIJA 2MDXA 2LULA 1IRSA 2I1JA 1FHXA 2LG1A 2N0YA 2JP2A 2J59M 3O96A 1NTVA 1Y19B 3A8PA 2D9ZA 1Z87A 2D9WA 1FGZA 2DX1A 2EMSA 5DHAB 4HHVA 3TW1A 2Y8GA 3PVLA 2UZSA 5C16A 2VKIA 1X11A 2YSZA 1P5TA 3VOQA 2QKMA 4CHMA 1XCGA 1PFJA 5FI1A 2V76A 4F7UP 1X1GA 1EGXA 2DX5A 1XX0A 4HB0B 2I5CA 2I5FA 2CRFA 4PQ0A 1X86A 4WSFA 2DKPA 4IFSA 2D9YA 1BY1A 1I7AA 1ZM0A 1QC6A 2ROVA 5EFXA 4HAWB 2W2XC 1U5GA 4H8SA 4K17A 2DHKA 1B55A 3A98B 4EJNA 4GMVA 1U5FA 2DA0A 2YVCA 2DYNA 2P8VA 3TFMA 3F5RA 2ROZB 1XKEA 2AL6A 4D0OA 5HE2A 4GOUA 4CYEA 3UZTA 2ELBA 4YONA 2G35A 4HAZB 1EVHA 2UVMA 1UPRA 4KVGB 1TJ6A 2COCA 3ZVRA 1MAIA 4MK0A 1V89A 1MK7B 1OY2A 4L6EA 4Y94A 3HK0A 1RJ2A 2D2QA 5KQ1A 2J0JA 2KGXB 4HDOA 1QQGA 1TQZA 1N3HA 2GCLA 2OQBA 4A6KA 5FI0A 2K2UA 2OTXA 4ZRKA 5D3XA 3AU4A 3DXDA 2COFA 4GZUA 3MDBC 3AJ4A 2FJLA 3FEHA 3P6AA 5C79A 1V5PA 1P6SA 1MK9B 2KR9A 3AU5A 1M7RA 2D10A 3M1IB 1WG7A 5D3WA 2ZPYA 4DXAB 1X1FA 4NSWA 3GF9A 5KCVA 4K81A 1W1HA 2I1KA 3GYPA 4KHOA 2CY4A 4DX90 2ELAA 2PZ1A 2R0DA 5J3QA 2DLWA 2LOZA 1SHCA 3SNHA 2YRYA 3CIKA 1EF1A 2P0HA 1KZ7A 3KY9A 4MT7A 2VRWB 2EJ8A 2IFSA 5C5BB 3KZ1A 1MPHA 2K00A 3ULBA 1WJMA 3WYFB 4MY6A 5HE1A 2N23A 1AWEA 5CLLB 2E2XA 3ODOA 1FB8A 3PP2A 3KRXA 2YS3A 2DFKA 2YF0A 2UZRA 1FOEA 4TYZA 4HB4B 5J3YA 1Y5OA 1W1DA 5C5BA 1BAKA 2D9VA 4KHBB 3U8ZA 4F7GA 1UEFA 2Y8FA 2J0KA 2R09A 2MFQA 4C0AA 5HE0A 3OANA 2K2JA 5D27A 2RSGA 2KCJA 1ZVRA 2D4QA 4KHAA 1DDWA 2X18A 1J0WA 5JHGA 2P0FA 4NY0A 2DKQA 2EC1A 2Z0OA 1V88A 4DX8A 5D3VA 4K2OA 4XWXA 3ML4A 2IYBA 4GMXB 1M7EA 3BJIA 3V5WA 1SGHA 4GXBA 4Z2NA 1FHWA 2DYQA 4A5KA 4BBKA 4GN1A 3T06A 1EAZA 2ADZA 2HE7A 3WA0A 1LB1A 3DXEA 1LW3A 1MIZB 3NSUA 4TKNA 2MWNB 4EKUA 3PVWA 3JV3A 1UNQA 1FAOA 1WVHA 2D11A 4HATB 4PNKA 2H7DA 1DBHA 1UNRA 2NMBA 2EMTA 3PEGA 5J3TA 3ODXA 4F7HA 1PLSA 2GCJA 1BTKA 3EO2A 1GC6A 4A6FB 2GS0A 1OMWA 2M14A 1ISNA 3FM8C 3TO1A 4HDQA 1WI1A 4A6HA 1V5MA 1P3RA 2H7EA 1NTYA 2M38A 2GJYA 5HE3A 1ZC3B 1UNPA 2Z0QA 4P7IA 2CODA 1NI2A 2D9XA 2RNRB 3DXCA 3SO6A 1WGUA 4D0NB 1RRPB 4A6FA 3F0WA 4ZRIA 1H4RA 5DHFB 1XD4A 1DROA 1BWNA 3PSCA 1NU2A 1WJ1A 4K2PA
chains in the Genus database with same CATH superfamily
3X23A 3KRWA 5CLQB 1K5DB 1TXDA 2LKOA 1GG3A 1U5DA 5JP4A 3LJUX 2L1CA 1DDVA 1PMSA 3A58A 2AEHA 4ZRJA 2QKLA 3D8EA 4WVFB 4D6WA 1U2BA 5LOPB 2Q13A 1U29A 2RGNB 5KQ4A 5D3YA 3SUZA 3G9WA 5LONB 3HQCA 1UPQA 3PVUA 2Z4DA 1XR0B 3CXBB 4HAXB 1Q67A 4IAPA 1OQNA 1GC7A 5C6RA 3U7DA 2J0MA 2COAA 3KSYA 1DDMA 1F5XA 2W2WA 1V5UA 4DBBA 1U5EA 1ZC4B 5DH9B 3A8QA 3D8FA 2NZ8B 2MKRA 2KUPA 3ODWA 3D8DA 2DHIA 2Z0PA 1X05A 3N7CA 1H10A 2XQNM 2YT0A 1K5GB 1MIXA 3PZDA 4CHJA 5L81A 3QBVB 3IVFA 1BTNA 2BCJA 2LYDA 3MPXA 4HB3B 3ZDTA 3BINA 3HSAA 2CAYA 2L2IA 2VSZA 2LOXA 4EMOA 1DYNA 4HB2B 2YS1A 1KI1B 4QXAB 3PG7A 4YL8A 5DIFB 4IOYX 2YS5A 2DHJA 1V61A 5I2SA 3P7ZA 1E5WA 1WGQA 3TCAA 2YT1A 2RVBB 1KZGA 1W1GA 5DI9B 3QWMA 3ULCA 1MKEA 2W2XD 1XODA 4Z2MB 2Z13A 3SV1A 5GOWB 3VIAA 1AQCA 3HW2B 2HTHB 4HAUB 2RLOA 3GYOA 1ZSQA 4HAYB 2RUKB 2Y7BA 3NW8A 4GPTB 1J19A 4GYVA 4KAXB 3TVVA 2DTCA 3RCPA 2DN6A 1U27A 2CY5A 5JLJB 3SYXA 2P0DA 4B6HA 4WJ7A 2FJUB 4HAVB 1FHOA 1I2HA 1FGYA 5JHHA 3FSSA 3QIJA 2MDXA 3NWFA 2LULA 1IRSA 2I1JA 2K8EA 1FHXA 2LG1A 2N0YA 2JP2A 2J59M 2KUQA 3O96A 1NTVA 1Y19B 3A8PA 2D9ZA 1Z87A 2KIGA 4QJ5B 2D9WA 1FGZA 2DX1A 4CSQA 2EMSA 5DHAB 4HHVA 3TW1A 2Y8GA 3PVLA 3NWDA 3B77A 2UZSA 5C16A 2VKIA 1X11A 2YSZA 1P5TA 3VOQA 2QKMA 4CHMA 1XCGA 1PFJA 5FI1A 2V76A 4F7UP 1X1GA 1EGXA 2DX5A 1XX0A 4HB0B 2I5CA 2I5FA 2CRFA 4PQ0A 1X86A 4WSFA 1ZYIA 2DKPA 4IFSA 2D9YA 1BY1A 1I7AA 1ZM0A 1QC6A 2ROVA 5EFXA 4HAWB 2W2XC 1U5GA 4H8SA 5LG4B 4K17A 2DHKA 1B55A 3A98B 4EJNA 4GMVA 1U5FA 2DA0A 2YVCA 2DYNA 2P8VA 3TFMA 2K49A 3F5RA 2ROZB 1XKEA 2AL6A 4D0OA 2ZKMX 4GOUA 2GUMA 5HE2A 4CYEA 3UZTA 2ELBA 4QJ4B 4YONA 2G35A 2Z14A 1EVHA 2UVMA 1UPRA 4HAZB 1TJ6A 2COCA 4KVGB 1MAIA 3ZVRA 4MK0A 1V89A 1MK7B 1OY2A 4L6EA 4Y94A 3HK0A 1RJ2A 2D2QA 5KQ1A 2J0JA 2KGXB 4HDOA 1QQGA 1TQZA 1N3HA 2GCLA 2OQBA 4L1RA 4A6KA 5FI0A 2K2UA 2OTXA 4ZRKA 3HIEA 4QJ3B 5D3XA 3AU4A 3DXDA 2COFA 4GZUA 2NBVA 3MDBC 3AJ4A 2FJLA 3FEHA 3P6AA 5C79A 1V5PA 1P6SA 1MK9B 2KR9A 3AU5A 1M7RA 2D10A 3M1IB 1WG7A 5D3WA 4DIXA 2ZPYA 4DXAB 1X1FA 1T77A 4NSWA 3GF9A 5KCVA 4K81A 2R2YA 1W1HA 2I1KA 3GYPA 4KHOA 4HSIA 2CY4A 4DX90 2ELAA 2PZ1A 2R0DA 5J3QA 2DLWA 2LOZA 1SHCA 3SNHA 2KIEA 2YRYA 3CIKA 1EF1A 2P0HA 1KZ7A 3KY9A 5IRSA 4MT7A 2VRWB 2EJ8A 2IFSA 4OSNA 5I2MA 3NWAA 5C5BB 3KZ1A 1MPHA 2K00A 3ULBA 1WJMA 3WYFB 4MY6A 5HE1A 2N23A 1AWEA 5CLLB 2E2XA 3ODOA 1FB8A 3U12A 3PP2A 3KRXA 2YS3A 2DFKA 2YF0A 2UZRA 1FOEA 4TYZA 4HB4B 5J3YA 1Y5OA 1W1DA 3OHMB 5C5BA 1BAKA 2D9VA 4KHBB 3U8ZA 4F7GA 1UEFA 1MI1A 2Y8FA 2J0KA 2R09A 2MFQA 4C0AA 5HE0A 3OANA 2K2JA 5D27A 2RSGA 2KCJA 1ZVRA 4GNKB 2D4QA 4KHAA 1DDWA 2X18A 1J0WA 5JHGA 2P0FA 4NY0A 2RRFA 2DKQA 2EC1A 2Z0OA 1V88A 4DX8A 5D3VA 4K2OA 4XWXA 4KHBA 3ML4A 2IYBA 2YT2A 4GMXB 1M7EA 3BJIA 3V5WA 1SGHA 4GXBA 4Z2NA 1FHWA 2DYQA 4A5KA 4BBKA 4GN1A 3T06A 1EAZA 2ADZA 2HE7A 3WA0A 1LB1A 3DXEA 1LW3A 1MIZB 3NSUA 4TKNA 2MWNB 4EKUA 3PVWA 3JV3A 1UNQA 1FAOA 1WVHA 2D11A 4HATB 4PNKA 5M4YB 2H7DA 1DBHA 1UNRA 2NMBA 2EMTA 3PEGA 5J3TA 3ODXA 4F7HA 1PLSA 2GCJA 1BTKA 3EO2A 1GC6A 4A6FB 2GS0A 1OMWA 2M14A 1ISNA 3FM8C 3TO1A 4HDQA 1WI1A 4A6HA 1V5MA 1P3RA 2H7EA 1NTYA 2M38A 2Z59A 2GJYA 5HE3A 1ZC3B 1UNPA 2Z0QA 4P7IA 2CODA 1NI2A 2D9XA 2RNRB 3DXCA 3SO6A 1WGUA 4D0NB 1RRPB 3DCXA 4A6FA 3F0WA 4OT1A 4ZRIA 2KR0A 1H4RA 5DHFB 1XD4A 1DROA 1BWNA 3PSCA 1NU2A 1WJ1A 3FVCA 4K2PA
chains in the Genus database with same CATH topology
3X23A 3KRWA 5CLQB 1K5DB 1TXDA 2LKOA 1GG3A 1U5DA 5JP4A 3LJUX 2L1CA 1DDVA 1PMSA 2AEHA 4ZRJA 2QKLA 3D8EA 4WVFB 1U2BA 5LOPB 2Q13A 1U29A 2RGNB 5KQ4A 5D3YA 3SUZA 3G9WA 5LONB 3HQCA 1UPQA 3PVUA 1XR0B 3CXBB 4HAXB 1Q67A 4IAPA 1OQNA 1GC7A 5C6RA 3U7DA 2J0MA 2COAA 3KSYA 1DDMA 1F5XA 2W2WA 1V5UA 4DBBA 1U5EA 1ZC4B 5DH9B 3A8QA 3D8FA 2NZ8B 2MKRA 2KUPA 3ODWA 3D8DA 2DHIA 2Z0PA 1X05A 3N7CA 1H10A 2XQNM 2YT0A 1K5GB 1MIXA 3PZDA 4CHJA 5L81A 3QBVB 3IVFA 1BTNA 2BCJA 2LYDA 3MPXA 4HB3B 3ZDTA 3BINA 2CAYA 2L2IA 2VSZA 2LOXA 4EMOA 1DYNA 4HB2B 2YS1A 1KI1B 3PG7A 4YL8A 5DIFB 4IOYX 2YS5A 2DHJA 1V61A 3P7ZA 1E5WA 1WGQA 3TCAA 2YT1A 2RVBB 1KZGA 1W1GA 5DI9B 3QWMA 3ULCA 1MKEA 2W2XD 1XODA 4Z2MB 3SV1A 5GOWB 3VIAA 1AQCA 3HW2B 2HTHB 4HAUB 2RLOA 3GYOA 1ZSQA 4HAYB 2RUKB 2Y7BA 4GPTB 1J19A 4GYVA 4KAXB 3TVVA 2DTCA 3RCPA 2DN6A 1U27A 2CY5A 5JLJB 3SYXA 2P0DA 4B6HA 4WJ7A 4HAVB 1FHOA 1I2HA 1FGYA 5JHHA 3FSSA 3QIJA 2MDXA 2LULA 1IRSA 2I1JA 1FHXA 2LG1A 2N0YA 2JP2A 2J59M 3O96A 1NTVA 1Y19B 3A8PA 2D9ZA 1Z87A 2D9WA 1FGZA 2DX1A 2EMSA 5DHAB 4HHVA 3TW1A 2Y8GA 3PVLA 2UZSA 5C16A 2VKIA 1X11A 2YSZA 1P5TA 3VOQA 2QKMA 4CHMA 1XCGA 1PFJA 5FI1A 2V76A 4F7UP 1X1GA 1EGXA 2DX5A 1XX0A 4HB0B 2I5CA 2I5FA 2CRFA 4PQ0A 1X86A 4WSFA 2DKPA 4IFSA 2D9YA 1BY1A 1I7AA 1ZM0A 1QC6A 2ROVA 5EFXA 4HAWB 2W2XC 1U5GA 4H8SA 4K17A 2DHKA 1B55A 3A98B 4EJNA 4GMVA 1U5FA 2DA0A 2YVCA 2DYNA 2P8VA 3TFMA 3F5RA 2ROZB 1XKEA 2AL6A 4D0OA 5HE2A 4GOUA 4CYEA 3UZTA 2ELBA 4YONA 2G35A 4HAZB 1EVHA 2UVMA 1UPRA 4KVGB 1TJ6A 2COCA 3ZVRA 1MAIA 4MK0A 1V89A 1MK7B 1OY2A 4L6EA 4Y94A 3HK0A 1RJ2A 2D2QA 5KQ1A 2J0JA 2KGXB 4HDOA 1QQGA 1TQZA 1N3HA 2GCLA 2OQBA 4A6KA 5FI0A 2K2UA 2OTXA 4ZRKA 5D3XA 3AU4A 3DXDA 2COFA 4GZUA 3MDBC 3AJ4A 2FJLA 3FEHA 3P6AA 5C79A 1V5PA 1P6SA 1MK9B 2KR9A 3AU5A 1M7RA 2D10A 3M1IB 1WG7A 5D3WA 2ZPYA 4DXAB 1X1FA 4NSWA 3GF9A 5KCVA 4K81A 1W1HA 2I1KA 3GYPA 4KHOA 2CY4A 4DX90 2ELAA 2PZ1A 2R0DA 5J3QA 2DLWA 2LOZA 1SHCA 3SNHA 2YRYA 3CIKA 1EF1A 2P0HA 1KZ7A 3KY9A 4MT7A 2VRWB 2EJ8A 2IFSA 5C5BB 3KZ1A 1MPHA 2K00A 3ULBA 1WJMA 3WYFB 4MY6A 5HE1A 2N23A 1AWEA 5CLLB 2E2XA 3ODOA 1FB8A 3PP2A 3KRXA 2YS3A 2DFKA 2YF0A 2UZRA 1FOEA 4TYZA 4HB4B 5J3YA 1Y5OA 1W1DA 5C5BA 1BAKA 2D9VA 4KHBB 3U8ZA 4F7GA 1UEFA 2Y8FA 2J0KA 2R09A 2MFQA 4C0AA 5HE0A 3OANA 2K2JA 5D27A 2RSGA 2KCJA 1ZVRA 2D4QA 4KHAA 1DDWA 2X18A 1J0WA 5JHGA 2P0FA 4NY0A 2DKQA 2EC1A 2Z0OA 1V88A 4DX8A 5D3VA 4K2OA 4XWXA 3ML4A 2IYBA 4GMXB 1M7EA 3BJIA 3V5WA 1SGHA 4GXBA 4Z2NA 1FHWA 2DYQA 4A5KA 4BBKA 4GN1A 3T06A 1EAZA 2ADZA 2HE7A 3WA0A 1LB1A 3DXEA 1LW3A 1MIZB 3NSUA 4TKNA 2MWNB 4EKUA 3PVWA 3JV3A 1UNQA 1FAOA 1WVHA 2D11A 4HATB 4PNKA 2H7DA 1DBHA 1UNRA 2NMBA 2EMTA 3PEGA 5J3TA 3ODXA 4F7HA 1PLSA 2GCJA 1BTKA 3EO2A 1GC6A 4A6FB 2GS0A 1OMWA 2M14A 1ISNA 3FM8C 3TO1A 4HDQA 1WI1A 4A6HA 1V5MA 1P3RA 2H7EA 1NTYA 2M38A 2GJYA 5HE3A 1ZC3B 1UNPA 2Z0QA 4P7IA 2CODA 1NI2A 2D9XA 2RNRB 3DXCA 3SO6A 1WGUA 4D0NB 1RRPB 4A6FA 3F0WA 4ZRIA 1H4RA 5DHFB 1XD4A 1DROA 1BWNA 3PSCA 1NU2A 1WJ1A 4K2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X23 A;  3KRW A;  5CLQ B;  1K5D B;  1TXD A;  2LKO A;  1GG3 A;  1U5D A;  5JP4 A;  3LJU X;  2L1C A;  1DDV A;  1PMS A;  2AEH A;  4ZRJ A;  2QKL A;  3D8E A;  4WVF B;  1U2B A;  5LOP B;  2Q13 A;  1U29 A;  2RGN B;  5KQ4 A;  5D3Y A;  3SUZ A;  3G9W A;  5LON B;  3HQC A;  1UPQ A;  3PVU A;  1XR0 B;  3CXB B;  4HAX B;  1Q67 A;  4IAP A;  1OQN A;  1GC7 A;  5C6R A;  3U7D A;  2J0M A;  2COA A;  3KSY A;  1DDM A;  1F5X A;  2W2W A;  1V5U A;  4DBB A;  1U5E A;  1ZC4 B;  5DH9 B;  3A8Q A;  3D8F A;  2NZ8 B;  2MKR A;  2KUP A;  3ODW A;  3D8D A;  2DHI A;  2Z0P A;  1X05 A;  3N7C A;  1H10 A;  2XQN M;  2YT0 A;  1K5G B;  1MIX A;  3PZD A;  4CHJ A;  5L81 A;  3QBV B;  3IVF A;  1BTN A;  2BCJ A;  2LYD A;  3MPX A;  4HB3 B;  3ZDT A;  3BIN A;  2CAY A;  2L2I A;  2VSZ A;  2LOX A;  4EMO A;  1DYN A;  4HB2 B;  2YS1 A;  1KI1 B;  3PG7 A;  4YL8 A;  5DIF B;  4IOY X;  2YS5 A;  2DHJ A;  1V61 A;  3P7Z A;  1E5W A;  1WGQ A;  3TCA A;  2YT1 A;  2RVB B;  1KZG A;  1W1G A;  5DI9 B;  3QWM A;  3ULC A;  1MKE A;  2W2X D;  1XOD A;  4Z2M B;  3SV1 A;  5GOW B;  3VIA A;  1AQC A;  3HW2 B;  2HTH B;  4HAU B;  2RLO A;  3GYO A;  1ZSQ A;  4HAY B;  2RUK B;  2Y7B A;  4GPT B;  1J19 A;  4GYV A;  4KAX B;  3TVV A;  2DTC A;  3RCP A;  2DN6 A;  1U27 A;  2CY5 A;  5JLJ B;  3SYX A;  2P0D A;  4B6H A;  4WJ7 A;  4HAV B;  1FHO A;  1I2H A;  1FGY A;  5JHH A;  3FSS A;  3QIJ A;  2MDX A;  2LUL A;  1IRS A;  2I1J A;  1FHX A;  2LG1 A;  2N0Y A;  2JP2 A;  2J59 M;  3O96 A;  1NTV A;  1Y19 B;  3A8P A;  2D9Z A;  1Z87 A;  2D9W A;  1FGZ A;  2DX1 A;  2EMS A;  5DHA B;  4HHV A;  3TW1 A;  2Y8G A;  3PVL A;  2UZS A;  5C16 A;  2VKI A;  1X11 A;  2YSZ A;  1P5T A;  3VOQ A;  2QKM A;  4CHM A;  1XCG A;  1PFJ A;  5FI1 A;  2V76 A;  4F7U P;  1X1G A;  1EGX A;  2DX5 A;  1XX0 A;  4HB0 B;  2I5C A;  2I5F A;  2CRF A;  4PQ0 A;  1X86 A;  4WSF A;  2DKP A;  4IFS A;  2D9Y A;  1BY1 A;  1I7A A;  1ZM0 A;  1QC6 A;  2ROV A;  5EFX A;  4HAW B;  2W2X C;  1U5G A;  4H8S A;  4K17 A;  2DHK A;  1B55 A;  3A98 B;  4EJN A;  4GMV A;  1U5F A;  2DA0 A;  2YVC A;  2DYN A;  2P8V A;  3TFM A;  3F5R A;  2ROZ B;  1XKE A;  2AL6 A;  4D0O A;  5HE2 A;  4GOU A;  4CYE A;  3UZT A;  2ELB A;  4YON A;  2G35 A;  4HAZ B;  1EVH A;  2UVM A;  1UPR A;  4KVG B;  1TJ6 A;  2COC A;  3ZVR A;  1MAI A;  4MK0 A;  1V89 A;  1MK7 B;  1OY2 A;  4L6E A;  4Y94 A;  3HK0 A;  1RJ2 A;  2D2Q A;  5KQ1 A;  2J0J A;  2KGX B;  4HDO A;  1QQG A;  1TQZ A;  1N3H A;  2GCL A;  2OQB A;  4A6K A;  5FI0 A;  2K2U A;  2OTX A;  4ZRK A;  5D3X A;  3AU4 A;  3DXD A;  2COF A;  4GZU A;  3MDB C;  3AJ4 A;  2FJL A;  3FEH A;  3P6A A;  5C79 A;  1V5P A;  1P6S A;  1MK9 B;  2KR9 A;  3AU5 A;  1M7R A;  2D10 A;  3M1I B;  1WG7 A;  5D3W A;  2ZPY A;  4DXA B;  1X1F A;  4NSW A;  3GF9 A;  5KCV A;  4K81 A;  1W1H A;  2I1K A;  3GYP A;  4KHO A;  2CY4 A;  4DX9 0;  2ELA A;  2PZ1 A;  2R0D A;  5J3Q A;  2DLW A;  2LOZ A;  1SHC A;  3SNH A;  2YRY A;  3CIK A;  1EF1 A;  2P0H A;  1KZ7 A;  3KY9 A;  4MT7 A;  2VRW B;  2EJ8 A;  2IFS A;  5C5B B;  3KZ1 A;  1MPH A;  2K00 A;  3ULB A;  1WJM A;  3WYF B;  4MY6 A;  5HE1 A;  2N23 A;  1AWE A;  5CLL B;  2E2X A;  3ODO A;  1FB8 A;  3PP2 A;  3KRX A;  2YS3 A;  2DFK A;  2YF0 A;  2UZR A;  1FOE A;  4TYZ A;  4HB4 B;  5J3Y A;  1Y5O A;  1W1D A;  5C5B A;  1BAK A;  2D9V A;  4KHB B;  3U8Z A;  4F7G A;  1UEF A;  2Y8F A;  2J0K A;  2R09 A;  2MFQ A;  4C0A A;  5HE0 A;  3OAN A;  2K2J A;  5D27 A;  2RSG A;  2KCJ A;  1ZVR A;  2D4Q A;  4KHA A;  1DDW A;  2X18 A;  1J0W A;  5JHG A;  2P0F A;  4NY0 A;  2DKQ A;  2EC1 A;  2Z0O A;  1V88 A;  4DX8 A;  5D3V A;  4K2O A;  4XWX A;  3ML4 A;  2IYB A;  4GMX B;  1M7E A;  3BJI A;  3V5W A;  1SGH A;  4GXB A;  4Z2N A;  1FHW A;  2DYQ A;  4A5K A;  4BBK A;  4GN1 A;  3T06 A;  1EAZ A;  2ADZ A;  2HE7 A;  3WA0 A;  1LB1 A;  3DXE A;  1LW3 A;  1MIZ B;  3NSU A;  4TKN A;  2MWN B;  4EKU A;  3PVW A;  3JV3 A;  1UNQ A;  1FAO A;  1WVH A;  2D11 A;  4HAT B;  4PNK A;  2H7D A;  1DBH A;  1UNR A;  2NMB A;  2EMT A;  3PEG A;  5J3T A;  3ODX A;  4F7H A;  1PLS A;  2GCJ A;  1BTK A;  3EO2 A;  1GC6 A;  4A6F B;  2GS0 A;  1OMW A;  2M14 A;  1ISN A;  3FM8 C;  3TO1 A;  4HDQ A;  1WI1 A;  4A6H A;  1V5M A;  1P3R A;  2H7E A;  1NTY A;  2M38 A;  2GJY A;  5HE3 A;  1ZC3 B;  1UNP A;  2Z0Q A;  4P7I A;  2COD A;  1NI2 A;  2D9X A;  2RNR B;  3DXC A;  3SO6 A;  1WGU A;  4D0N B;  1RRP B;  4A6F A;  3F0W A;  4ZRI A;  1H4R A;  5DHF B;  1XD4 A;  1DRO A;  1BWN A;  3PSC A;  1NU2 A;  1WJ1 A;  4K2P A; 
#chains in the Genus database with same CATH topology
 3X23 A;  3KRW A;  5CLQ B;  1K5D B;  1TXD A;  2LKO A;  1GG3 A;  1U5D A;  5JP4 A;  3LJU X;  2L1C A;  1DDV A;  1PMS A;  3A58 A;  2AEH A;  4ZRJ A;  2QKL A;  3D8E A;  4WVF B;  4D6W A;  1U2B A;  5LOP B;  2Q13 A;  1U29 A;  2RGN B;  5KQ4 A;  5D3Y A;  3SUZ A;  3G9W A;  5LON B;  3HQC A;  1UPQ A;  3PVU A;  2Z4D A;  1XR0 B;  3CXB B;  4HAX B;  1Q67 A;  4IAP A;  1OQN A;  1GC7 A;  5C6R A;  3U7D A;  2J0M A;  2COA A;  3KSY A;  1DDM A;  1F5X A;  2W2W A;  1V5U A;  4DBB A;  1U5E A;  1ZC4 B;  5DH9 B;  3A8Q A;  3D8F A;  2NZ8 B;  2MKR A;  2KUP A;  3ODW A;  3D8D A;  2DHI A;  2Z0P A;  1X05 A;  3N7C A;  1H10 A;  2XQN M;  2YT0 A;  1K5G B;  1MIX A;  3PZD A;  4CHJ A;  5L81 A;  3QBV B;  3IVF A;  1BTN A;  2BCJ A;  2LYD A;  3MPX A;  4HB3 B;  3ZDT A;  3BIN A;  3HSA A;  2CAY A;  2L2I A;  2VSZ A;  2LOX A;  4EMO A;  1DYN A;  4HB2 B;  2YS1 A;  1KI1 B;  4QXA B;  3PG7 A;  4YL8 A;  5DIF B;  4IOY X;  2YS5 A;  2DHJ A;  1V61 A;  5I2S A;  3P7Z A;  1E5W A;  1WGQ A;  3TCA A;  2YT1 A;  2RVB B;  1KZG A;  1W1G A;  5DI9 B;  3QWM A;  3ULC A;  1MKE A;  2W2X D;  1XOD A;  4Z2M B;  2Z13 A;  3SV1 A;  5GOW B;  3VIA A;  1AQC A;  3HW2 B;  2HTH B;  4HAU B;  2RLO A;  3GYO A;  1ZSQ A;  4HAY B;  2RUK B;  2Y7B A;  3NW8 A;  4GPT B;  1J19 A;  4GYV A;  4KAX B;  3TVV A;  2DTC A;  3RCP A;  2DN6 A;  1U27 A;  2CY5 A;  5JLJ B;  3SYX A;  2P0D A;  4B6H A;  4WJ7 A;  2FJU B;  4HAV B;  1FHO A;  1I2H A;  1FGY A;  5JHH A;  3FSS A;  3QIJ A;  2MDX A;  3NWF A;  2LUL A;  1IRS A;  2I1J A;  2K8E A;  1FHX A;  2LG1 A;  2N0Y A;  2JP2 A;  2J59 M;  2KUQ A;  3O96 A;  1NTV A;  1Y19 B;  3A8P A;  2D9Z A;  1Z87 A;  2KIG A;  4QJ5 B;  2D9W A;  1FGZ A;  2DX1 A;  4CSQ A;  2EMS A;  5DHA B;  4HHV A;  3TW1 A;  2Y8G A;  3PVL A;  3NWD A;  3B77 A;  2UZS A;  5C16 A;  2VKI A;  1X11 A;  2YSZ A;  1P5T A;  3VOQ A;  2QKM A;  4CHM A;  1XCG A;  1PFJ A;  5FI1 A;  2V76 A;  4F7U P;  1X1G A;  1EGX A;  2DX5 A;  1XX0 A;  4HB0 B;  2I5C A;  2I5F A;  2CRF A;  4PQ0 A;  1X86 A;  4WSF A;  1ZYI A;  2DKP A;  4IFS A;  2D9Y A;  1BY1 A;  1I7A A;  1ZM0 A;  1QC6 A;  2ROV A;  5EFX A;  4HAW B;  2W2X C;  1U5G A;  4H8S A;  5LG4 B;  4K17 A;  2DHK A;  1B55 A;  3A98 B;  4EJN A;  4GMV A;  1U5F A;  2DA0 A;  2YVC A;  2DYN A;  2P8V A;  3TFM A;  2K49 A;  3F5R A;  2ROZ B;  1XKE A;  2AL6 A;  4D0O A;  2ZKM X;  4GOU A;  2GUM A;  5HE2 A;  4CYE A;  3UZT A;  2ELB A;  4QJ4 B;  4YON A;  2G35 A;  2Z14 A;  1EVH A;  2UVM A;  1UPR A;  4HAZ B;  1TJ6 A;  2COC A;  4KVG B;  1MAI A;  3ZVR A;  4MK0 A;  1V89 A;  1MK7 B;  1OY2 A;  4L6E A;  4Y94 A;  3HK0 A;  1RJ2 A;  2D2Q A;  5KQ1 A;  2J0J A;  2KGX B;  4HDO A;  1QQG A;  1TQZ A;  1N3H A;  2GCL A;  2OQB A;  4L1R A;  4A6K A;  5FI0 A;  2K2U A;  2OTX A;  4ZRK A;  3HIE A;  4QJ3 B;  5D3X A;  3AU4 A;  3DXD A;  2COF A;  4GZU A;  2NBV A;  3MDB C;  3AJ4 A;  2FJL A;  3FEH A;  3P6A A;  5C79 A;  1V5P A;  1P6S A;  1MK9 B;  2KR9 A;  3AU5 A;  1M7R A;  2D10 A;  3M1I B;  1WG7 A;  5D3W A;  4DIX A;  2ZPY A;  4DXA B;  1X1F A;  1T77 A;  4NSW A;  3GF9 A;  5KCV A;  4K81 A;  2R2Y A;  1W1H A;  2I1K A;  3GYP A;  4KHO A;  4HSI A;  2CY4 A;  4DX9 0;  2ELA A;  2PZ1 A;  2R0D A;  5J3Q A;  2DLW A;  2LOZ A;  1SHC A;  3SNH A;  2KIE A;  2YRY A;  3CIK A;  1EF1 A;  2P0H A;  1KZ7 A;  3KY9 A;  5IRS A;  4MT7 A;  2VRW B;  2EJ8 A;  2IFS A;  4OSN A;  5I2M A;  3NWA A;  5C5B B;  3KZ1 A;  1MPH A;  2K00 A;  3ULB A;  1WJM A;  3WYF B;  4MY6 A;  5HE1 A;  2N23 A;  1AWE A;  5CLL B;  2E2X A;  3ODO A;  1FB8 A;  3U12 A;  3PP2 A;  3KRX A;  2YS3 A;  2DFK A;  2YF0 A;  2UZR A;  1FOE A;  4TYZ A;  4HB4 B;  5J3Y A;  1Y5O A;  1W1D A;  3OHM B;  5C5B A;  1BAK A;  2D9V A;  4KHB B;  3U8Z A;  4F7G A;  1UEF A;  1MI1 A;  2Y8F A;  2J0K A;  2R09 A;  2MFQ A;  4C0A A;  5HE0 A;  3OAN A;  2K2J A;  5D27 A;  2RSG A;  2KCJ A;  1ZVR A;  4GNK B;  2D4Q A;  4KHA A;  1DDW A;  2X18 A;  1J0W A;  5JHG A;  2P0F A;  4NY0 A;  2RRF A;  2DKQ A;  2EC1 A;  2Z0O A;  1V88 A;  4DX8 A;  5D3V A;  4K2O A;  4XWX A;  4KHB A;  3ML4 A;  2IYB A;  2YT2 A;  4GMX B;  1M7E A;  3BJI A;  3V5W A;  1SGH A;  4GXB A;  4Z2N A;  1FHW A;  2DYQ A;  4A5K A;  4BBK A;  4GN1 A;  3T06 A;  1EAZ A;  2ADZ A;  2HE7 A;  3WA0 A;  1LB1 A;  3DXE A;  1LW3 A;  1MIZ B;  3NSU A;  4TKN A;  2MWN B;  4EKU A;  3PVW A;  3JV3 A;  1UNQ A;  1FAO A;  1WVH A;  2D11 A;  4HAT B;  4PNK A;  5M4Y B;  2H7D A;  1DBH A;  1UNR A;  2NMB A;  2EMT A;  3PEG A;  5J3T A;  3ODX A;  4F7H A;  1PLS A;  2GCJ A;  1BTK A;  3EO2 A;  1GC6 A;  4A6F B;  2GS0 A;  1OMW A;  2M14 A;  1ISN A;  3FM8 C;  3TO1 A;  4HDQ A;  1WI1 A;  4A6H A;  1V5M A;  1P3R A;  2H7E A;  1NTY A;  2M38 A;  2Z59 A;  2GJY A;  5HE3 A;  1ZC3 B;  1UNP A;  2Z0Q A;  4P7I A;  2COD A;  1NI2 A;  2D9X A;  2RNR B;  3DXC A;  3SO6 A;  1WGU A;  4D0N B;  1RRP B;  3DCX A;  4A6F A;  3F0W A;  4OT1 A;  4ZRI A;  2KR0 A;  1H4R A;  5DHF B;  1XD4 A;  1DRO A;  1BWN A;  3PSC A;  1NU2 A;  1WJ1 A;  3FVC A;  4K2P A; 
#chains in the Genus database with same CATH homology
 3X23 A;  3KRW A;  5CLQ B;  1K5D B;  1TXD A;  2LKO A;  1GG3 A;  1U5D A;  5JP4 A;  3LJU X;  2L1C A;  1DDV A;  1PMS A;  2AEH A;  4ZRJ A;  2QKL A;  3D8E A;  4WVF B;  1U2B A;  5LOP B;  2Q13 A;  1U29 A;  2RGN B;  5KQ4 A;  5D3Y A;  3SUZ A;  3G9W A;  5LON B;  3HQC A;  1UPQ A;  3PVU A;  1XR0 B;  3CXB B;  4HAX B;  1Q67 A;  4IAP A;  1OQN A;  1GC7 A;  5C6R A;  3U7D A;  2J0M A;  2COA A;  3KSY A;  1DDM A;  1F5X A;  2W2W A;  1V5U A;  4DBB A;  1U5E A;  1ZC4 B;  5DH9 B;  3A8Q A;  3D8F A;  2NZ8 B;  2MKR A;  2KUP A;  3ODW A;  3D8D A;  2DHI A;  2Z0P A;  1X05 A;  3N7C A;  1H10 A;  2XQN M;  2YT0 A;  1K5G B;  1MIX A;  3PZD A;  4CHJ A;  5L81 A;  3QBV B;  3IVF A;  1BTN A;  2BCJ A;  2LYD A;  3MPX A;  4HB3 B;  3ZDT A;  3BIN A;  2CAY A;  2L2I A;  2VSZ A;  2LOX A;  4EMO A;  1DYN A;  4HB2 B;  2YS1 A;  1KI1 B;  3PG7 A;  4YL8 A;  5DIF B;  4IOY X;  2YS5 A;  2DHJ A;  1V61 A;  3P7Z A;  1E5W A;  1WGQ A;  3TCA A;  2YT1 A;  2RVB B;  1KZG A;  1W1G A;  5DI9 B;  3QWM A;  3ULC A;  1MKE A;  2W2X D;  1XOD A;  4Z2M B;  3SV1 A;  5GOW B;  3VIA A;  1AQC A;  3HW2 B;  2HTH B;  4HAU B;  2RLO A;  3GYO A;  1ZSQ A;  4HAY B;  2RUK B;  2Y7B A;  4GPT B;  1J19 A;  4GYV A;  4KAX B;  3TVV A;  2DTC A;  3RCP A;  2DN6 A;  1U27 A;  2CY5 A;  5JLJ B;  3SYX A;  2P0D A;  4B6H A;  4WJ7 A;  4HAV B;  1FHO A;  1I2H A;  1FGY A;  5JHH A;  3FSS A;  3QIJ A;  2MDX A;  2LUL A;  1IRS A;  2I1J A;  1FHX A;  2LG1 A;  2N0Y A;  2JP2 A;  2J59 M;  3O96 A;  1NTV A;  1Y19 B;  3A8P A;  2D9Z A;  1Z87 A;  2D9W A;  1FGZ A;  2DX1 A;  2EMS A;  5DHA B;  4HHV A;  3TW1 A;  2Y8G A;  3PVL A;  2UZS A;  5C16 A;  2VKI A;  1X11 A;  2YSZ A;  1P5T A;  3VOQ A;  2QKM A;  4CHM A;  1XCG A;  1PFJ A;  5FI1 A;  2V76 A;  4F7U P;  1X1G A;  1EGX A;  2DX5 A;  1XX0 A;  4HB0 B;  2I5C A;  2I5F A;  2CRF A;  4PQ0 A;  1X86 A;  4WSF A;  2DKP A;  4IFS A;  2D9Y A;  1BY1 A;  1I7A A;  1ZM0 A;  1QC6 A;  2ROV A;  5EFX A;  4HAW B;  2W2X C;  1U5G A;  4H8S A;  4K17 A;  2DHK A;  1B55 A;  3A98 B;  4EJN A;  4GMV A;  1U5F A;  2DA0 A;  2YVC A;  2DYN A;  2P8V A;  3TFM A;  3F5R A;  2ROZ B;  1XKE A;  2AL6 A;  4D0O A;  5HE2 A;  4GOU A;  4CYE A;  3UZT A;  2ELB A;  4YON A;  2G35 A;  4HAZ B;  1EVH A;  2UVM A;  1UPR A;  4KVG B;  1TJ6 A;  2COC A;  3ZVR A;  1MAI A;  4MK0 A;  1V89 A;  1MK7 B;  1OY2 A;  4L6E A;  4Y94 A;  3HK0 A;  1RJ2 A;  2D2Q A;  5KQ1 A;  2J0J A;  2KGX B;  4HDO A;  1QQG A;  1TQZ A;  1N3H A;  2GCL A;  2OQB A;  4A6K A;  5FI0 A;  2K2U A;  2OTX A;  4ZRK A;  5D3X A;  3AU4 A;  3DXD A;  2COF A;  4GZU A;  3MDB C;  3AJ4 A;  2FJL A;  3FEH A;  3P6A A;  5C79 A;  1V5P A;  1P6S A;  1MK9 B;  2KR9 A;  3AU5 A;  1M7R A;  2D10 A;  3M1I B;  1WG7 A;  5D3W A;  2ZPY A;  4DXA B;  1X1F A;  4NSW A;  3GF9 A;  5KCV A;  4K81 A;  1W1H A;  2I1K A;  3GYP A;  4KHO A;  2CY4 A;  4DX9 0;  2ELA A;  2PZ1 A;  2R0D A;  5J3Q A;  2DLW A;  2LOZ A;  1SHC A;  3SNH A;  2YRY A;  3CIK A;  1EF1 A;  2P0H A;  1KZ7 A;  3KY9 A;  4MT7 A;  2VRW B;  2EJ8 A;  2IFS A;  5C5B B;  3KZ1 A;  1MPH A;  2K00 A;  3ULB A;  1WJM A;  3WYF B;  4MY6 A;  5HE1 A;  2N23 A;  1AWE A;  5CLL B;  2E2X A;  3ODO A;  1FB8 A;  3PP2 A;  3KRX A;  2YS3 A;  2DFK A;  2YF0 A;  2UZR A;  1FOE A;  4TYZ A;  4HB4 B;  5J3Y A;  1Y5O A;  1W1D A;  5C5B A;  1BAK A;  2D9V A;  4KHB B;  3U8Z A;  4F7G A;  1UEF A;  2Y8F A;  2J0K A;  2R09 A;  2MFQ A;  4C0A A;  5HE0 A;  3OAN A;  2K2J A;  5D27 A;  2RSG A;  2KCJ A;  1ZVR A;  2D4Q A;  4KHA A;  1DDW A;  2X18 A;  1J0W A;  5JHG A;  2P0F A;  4NY0 A;  2DKQ A;  2EC1 A;  2Z0O A;  1V88 A;  4DX8 A;  5D3V A;  4K2O A;  4XWX A;  3ML4 A;  2IYB A;  4GMX B;  1M7E A;  3BJI A;  3V5W A;  1SGH A;  4GXB A;  4Z2N A;  1FHW A;  2DYQ A;  4A5K A;  4BBK A;  4GN1 A;  3T06 A;  1EAZ A;  2ADZ A;  2HE7 A;  3WA0 A;  1LB1 A;  3DXE A;  1LW3 A;  1MIZ B;  3NSU A;  4TKN A;  2MWN B;  4EKU A;  3PVW A;  3JV3 A;  1UNQ A;  1FAO A;  1WVH A;  2D11 A;  4HAT B;  4PNK A;  2H7D A;  1DBH A;  1UNR A;  2NMB A;  2EMT A;  3PEG A;  5J3T A;  3ODX A;  4F7H A;  1PLS A;  2GCJ A;  1BTK A;  3EO2 A;  1GC6 A;  4A6F B;  2GS0 A;  1OMW A;  2M14 A;  1ISN A;  3FM8 C;  3TO1 A;  4HDQ A;  1WI1 A;  4A6H A;  1V5M A;  1P3R A;  2H7E A;  1NTY A;  2M38 A;  2GJY A;  5HE3 A;  1ZC3 B;  1UNP A;  2Z0Q A;  4P7I A;  2COD A;  1NI2 A;  2D9X A;  2RNR B;  3DXC A;  3SO6 A;  1WGU A;  4D0N B;  1RRP B;  4A6F A;  3F0W A;  4ZRI A;  1H4R A;  5DHF B;  1XD4 A;  1DRO A;  1BWN A;  3PSC A;  1NU2 A;  1WJ1 A;  4K2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...