3OE5A

Rat catechol o-methyltransferase in complex with a catechol-type, pyridylsulfanyl-containing inhibitor - humanized form
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Molecular Recognition at the Active Site of Catechol-O-methyltransferase (COMT): Adenine Replacements in Bisubstrate Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 70
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3oe5A01
3TFWA 1R6AA 1JG1A 2CWWA 2ZWAA 3LDGA 3BZBA 3OZSA 1R8YA 4PONA 2IH5A 3E7PA 3L8DA 2XVMA 4LWPA 4GEKA 3FYCA 4HSGA 3BWCA 5FUBA 1KYZA 3KKZA 4BP1A 3A7DA 2PY6A 3HVIA 1RI2A 4E2XA 5E2AA 3SXJA 4U7PB 2ONZA 5C0OE 3HNRA 2FCAA 2K4MA 3ELDA 1WY7A 1EJ0A 3KQTA 3UJ9A 3DLIA 4GQBA 2FRXA 2P7HA 2B2CA 3PT9A 2EX4A 4ATNA 2GH1A 1L1EA 2Q41A 3EVBA 3KPUA 3KPYA 4V0QA 3UJ8A 5EZQA 4RTOA 1NW3A 4HGZA 1SG9A 2VDWA 2YXLA 2ZFUA 2UYOA 4HGYA 5CM2Z 5IH3A 5CCXA 1KHHA 4QQKA 2YTZA 2FPOA 5F2OA 3BUSA 3HM2A 2PSSA 3G5LA 3KQPA 4EK9A 1BHJA 2BR4A 4FSXA 2HWKA 5DM0A 2I62A 1N2XA 3CC8A 1F3LA 4RVDA 10MHA 3PFGA 2ZULA 2YR0A 2HR1A 1XDZA 5E9QA 4BLUA 1EIZA 3HP7A 5CD1A 3G8AA 4HRAA 4XUEA 5EG5A 1G8SA 1L3BA 3C6MA 1D2GA 3GGDA 3ERCA 1MHTA 4EMSA 5ICCA 3BWYA 4GOLD 4RTNA 1I4WA 4IV8A 2CL5A 4RTKA 1X1BA 3LDFA 1EQAA 3M6WA 3G2PA 2QYOA 5C9ZA 3KR1A 3UA3A 4PGHA 5FTWA 3VC1A 2NP6A 9MHTA 5K05A 2ZZMA 1YZHA 1XCJA 3D2LA 2PX8A 4QPPA 5DTRA 4GUAA 1D2CA 3KQWA 3DMFA 2B9EA 5E8RA 2GLUA 5T6BA 3KHKA 4BLWA 4YMGA 1RI3A 5U4XA 4FGZA 3TOSA 3UA4A 3UJCA 2GPYA 5BW4A 3MHTA 3KQVA 5M5BA 4RVGA 1DUSA 1ZGAA 3LBYA 2BR5A 1SQFA 2IH4A 4F84A 5DM4A 1AF7A 3THSA 3GDHA 5K09A 2PXAA 1NE2A 4KW7A 3PFHA 4QVKA 5CVJA 1X1DA 5CUQA 1ORHA 4RTJA 1Q0TA 4FSDA 3X0DA 4OQEA 2PX2A 3GXOA 1N7JA 3P8ZA 4GF5A 3M70A 1JSXA 4PYMA 4C08A 5K01A 3KQYA 3TLJA 3FTDA 1RI1A 4MWZA 4CKBA 2QRVA 5E1BA 5BXYA 3I53A 4OX9Y 1U2ZA 3EMDA 1JQEA 1EJ6A 5FA5A 4YMHA 3R0QA 4PWYA 4K6MA 3V97A 2EFJA 3Q7EA 2CMHA 3BGVA 3I64A 4IKPA 3DUWA 4A6EA 4CWAA 3B3JA 4E32A 4XUDA 5ICEA 2PXCA 5GIOE 3HCFA 4ER6A 5KQSA 3EEYA 2JHAA 3DMGA 3P71T 2ZWVA 3HA3A 3OZRA 2NXNA 1RJFA 5EEHA 3NTVA 3SM3A 1UIRA 3C3YA 3FTFA 4HTFA 3DP7A 2AZTA 3CGGA 5EIWA 3FUWA 3EVZA 3DXZA 2ESRA 2WA1A 2YX1A 4LECA 3TM5A 5FCDA 3MTEA 5DXJA 4WVLA 4PINA 4GOMD 3BGIA 4ISCA 5E9JA 5CCBA 3JWIA 5DXAA 3MCTA 2WK1A 2JG3A 3QOXA 3BKWA 1FP2A 3REOA 3KQOA 4ER5A 2AOXA 2B78A 3HA7A 2GB4A 2PV0A 3CKKA 4V0RA 3KR9A 2BR3A 5EGSA 4DZRA 1P1CA 2IPXA 4YUWA 1ZGJA 5K0FA 4H0NA 4F86A 1NW7A 2UYQA 3P2EA 4PYOA 4ZTBA 2OXTA 5HIKA 3T7TA 2H11A 2Z6QA 4O29A 4OBWA 4RYLA 4YV0A 4FS8A 2DULA 2IIPA 2JJQA 3FUXA 5D1HA 2PBFA 5HEKA 1UWVA 1YUBA 3OE4A 3G7UA 3G88A 1M6YA 4OA5A 5EVJA 5CIYA 5D1NA 5DRYA 2OZVA 4E70A 2O07A 2AOWA 2EG5A 3GNLA 3KPWA 3M4XA 2G8NA 4RSRA 5DPMA 4DF3A 5MHTA 5LQUA 3ER9A 3H2BA 2V7EA 4PYKA 4FT2A 2Y1XA 5LQCA 3JWGA 4YUVA 2PXXA 4C04A 3UFBA 4BLVA 1KPIA 4Y2HA 4PNEA 5K8VA 5EPEA 4X63A 3BKXA 1V39A 1WXWA 4NECA 1HNNA 1AV6A 1R8XA 1VE3A 3HCAA 4E30A 1KR5A 2IP2A 5EC8A 1NW5A 4B17A 3BT7A 3LL7A 5DRTA 3TMAA 4C05A 4YV1A 3G5TA 4HTFB 3G2OA 3TPZA 4C03A 4EKIA 3SSOA 4FZVA 3PX3A 4KDCA 3R3HA 2YXEA 2PWYA 2IDJA 5HFJA 1NT2A 7MHTA 4G56A 1VP9A 2ZZKA 3OU7A 4PYIA 2UYHA 2QM3A 4GC9A 4QDKA 3FRIA 3UJDA 4QPNA 1DL5A 3GWZA 2PKWA 4BY9E 4X60A 1ZKDA 2P41A 4OBXA 4XUCA 5CVDA 3NMUF 5GP1A 3G8BA 1EAMA 4R6XA 1UFKA 3GRVA 4KIFA 4RTRA 5E8JA 1XXLA 1EG2A 3A26A 5HIIA 3RODA 1R18A 2ZZNA 1AQIA 2PX4A 3AXTA 3FUTA 4IV0A 5LR6A 1I1NA 1QZZA 2P3LA 3QV2A 4M7RA 3WSTA 3IYLW 2IDKA 1SUSA 1XVAA 3CJQA 3LPMA 4M38A 1WZNA 3A27A 3DULA 4PCLA 3ME5A 4HG2A 3TM4A 5CVUA 4YUXA 4QQNA 2BM8A 2IFTA 5CVVA 5DM2A 3LBFA 2ZCJA 4DMGA 5JUWA 4MHTA 5DX8A 5K0GA 3KPVA 2IH2A 1RI4A 2ORED 4AUKA 3ORHA 2IBSA 2OB2A 4AX8A 2IGTA 2LD4A 5T64A 3VYWA 3P2IA 4C06A 2AOUA 4CKEA 3CVOA 3LKZA 5EQJB 1RJEA 2R6ZA 5HOQA 1JQDA 2ZIFA 4KDRA 2PWPA 5EOVA 1AQJA 3K6RA 2H1RA 2ZBQA 4GBED 1XDSA 2ERCA 2P3QA 3PS9A 1WXXA 4CTKA 1ZQ9A 3GCZA 2C7OA 1QANA 4DA4A 3F4KA 2P35A 3B3FA 4E2YA 4Y30A 3ANXA 4E31A 3NDJA 3P9IA 3AXSA 3GRZA 3EGVA 5E1MA 3HCDA 3DLCA 1QAOA 5E9WA 3FPGA 5DX0A 1QAMA 1KIAA 4M36A 3O7WA 3KR2A 3ER8A 3M6VA 4RV9A 1SVUA 3DR5A 1G60A 1M0EA 4E2ZA 3B89A 2F8LA 2OBFA 2PX5A 3CJTA 4MQ4A 5FQNA 4KIGA 2P7IA 4ER7A 3BGDA 2OKCA 5E1DA 1ZHFA 2E5WA 3E8SA 3KQQA 2P40A 1VLMA 1YB2A 1XTPA 3HEMA 4LWOA 1QYRA 3OCJA 5DLYA 1JTFA 5FADA 3ELYA 5GM2A 3KR0A 1YFJA 1YF3A 1P91A 3THRA 3AY0A 1SUIA 3DXYA 3GIWA 4QDJA 2H00A 2JH8A 4U7TB 4M37A 1SKMA 4GC5A 1BOOA 3A7EA 3OE5A 1N7IA 4P7KA 3A4TA 2AS0A 2ZLBA 3P2KA 4MTLA 4OA8A 2XYQA 3B7PA 1RJGA 5EMLA 5KQRA 5C1IA 3P9CA 2O57A 2PLWA 4MIKA 3FYDA 1JQ3A 2C7PA 3AJDA 4E33A 3HTXA 4A6DA 2DPMA 5DM1A 2AOUB 5B1SA 1FJXA 5DT2A 2R3SA 1G8AA 5GM1A 3SMQA 1WS6A 2G72A 3FUUA 2EJTA 5BP7A 3EVDA 1SQGA 1OR8A 2BM9A 2QY6A 2VDVE 3EGEA 1YZ3A 3A25A 3EGIA 3P9NA 4RVHA 1TPYA 3ID6C 5KVAA 2FK7A 1P39A 3MCZA 1O9GA 1VIDA 2JHCA 5ICGA 1JSZA 2Z6AA 4ER3A 5K0LA 4RTLA 3TKAA 1JG4A 2CMGA 1L3IA 1PRYA 2FHPA 3PX2A 3PLAE 5FWDA 3M6XA 3BXOA 3I9FA 4ER0A 5KYGA 5FA8A 1TW2A 2I9KA 1XJ5A 2QRVB 4X61A 4AZWA 1FPQA 1QAQA 2HMYB 5HZMA 2AVDA 5FULA 3HVHA 3S68A 5GIPE 3AWIA 2Z6UA 1L3CA 1MJFA 2AN5A 5HIMA 3SR4A 2OB1A 2VP3A 3LCUA 4PYLA 3DXXA 3EEOA 3K0BA 4PGGA 1KYWA 1NV9A 4RTMA 1KP9A 5LQNA 3OZTA 4RTQA 1F38A 1PJZA 1NW8A 2UYCA 3GRYA 1X1AA 3UJBA 3IV6A 2AN3A 3LECA 3BWBA 2EJUA 3MERA 4AZVA 2JH9A 4EKGA 2VDUE 3E05A 3NVKI 1I9GA 3UJ7A 3FTEA 2WA2A 4FP9A 2YQZA 5GWXA 3GRUA 5EKUA 2IBTA 4P7GA 3FZGA 3G2QA 2G71A 2NYUA 3EMBA 4RWZA 2QE6A 2ZBPA 3PTAA 8MHTA 3JWHA 5DTMA 2O05A 1HMYA 1NV8A 1T43A 4QTUB 5DX1A 3JWJA 5FWAA 3B3GA 2V74B 1G38A 5HILA 3OU6A 3C6KA 2ZIEA 1X1CA 2FYTA 1DCTA 5BW5A 2OYRA 5DTQA 4GOND 3TR6A 2HNKA 3OU2A 4EQZA 2FK8A 4IWNA 1Z3CA 2KW5A 2OO3A 3HVJA 3LSTA 3SVZA 5K0JA 2P1DA 2G1PA 1KPGA 1P1BA 3FTCA 1VP3A 5K0NA 3HA5A 4YV2A 4DQ0A 5GINE 2BH2A 2ZVJA 4RTSA 1JTEA 5EHIA 5IKMA 4RTPA 4PCAA 1BKYA 3R9XB 2OY0A 4R8SA 5HIJA 3RW9A 4DM3A 3G89A 4WXHA 2I7CA 2AVNA 2C7RA 3UBTA 4P7JA 5T67A 3ELUA 4RVFA 1VL5A 3FPEA 2P8JA 5LQRA 2YXDA 1XCLA 2XVAA 3LCVB 3KU1A 1BC5A 3LGAA 2ZIGA 4RX1A 1ZG3A 1O9HA 3R24A 1ORIA 3MQ2A 5DWQA 5G02A 3DOUA 2B25A 2NNWB 3DMHA 5H02A 2ZTHA 4QVGA 5EMJA 1JG2A 2HV9A 5EMKA 3VSEA 5EZSA 4C4AA 3MGGA 3EVFA 4PYJA 5K0CA 5LQJA 2O06A 4UOEA 5K0BA 3CJRA 5LQKA 3LDUA 3G2MA 4PYQA 5ERGB 5FHRA 3RIEA 2B3TA 2ONYA 3FPFA 1D2HA 5DSXA 3LHDA 3GO4A 2XYRA 3PVCA 3C0KA 4YUYA 2O0LA 2AN4A 3OFJA 5E1OA 4DCMA 3I5UA 5FQOA 3HCCA 1FP1D 3LX6A 2I6GA 2JHPA 1XDUA 1JR4A 2AOTA 3NWBA 4KRGA 3TRKA 2Y1WA 3NJRA 5EHGA 1WG8A 1IXKA 4P7FA 2YUIA 5CVEA 1TW3A 3FRHA 5E2BA 1KPHA 3R6TA 3SGLA 2VS1A 4XCXA 3SX0A 5K0EA 5EMMA 3HVKA 3DH0A 3MB5A 3UWPA 4EVIA 1IM8A 2ZSUA 4R6WA 4FT4A 3EVEA 3I58A 3O31A 4CXMA 1M6EX 3EVAA 3LCCA 4OQDA 1RI5A 1IY9A 3FPJA 3FUVA 4LG1A 3EVGA 2CKDA 3NW9A 3GRRA 2PVCA 3IHTA 3NWEA 4YUZA 4DKJA 3HCBA 2NXCA 5ICFA 3NDIA 3ELWA 3FPHA 3U81A 1X19A 3UJ6A 3MTIA 5F2KA 4Z2YA 2HTEA 1NBHA 4AZTA 4R05A 3T7SA 4CKCA 4POOA 3CBGA 3QOWA 3NVMB 5LSAA 2G70A 2GS9A 4F85A 3UZUA 2ADMA 2PGXA 1G55A 1NBIA 2NXJA 5JR3A 4PIPA 1VQ1A 1VPTA 3B5IA 4R8RA 4DCGA 1R00A 2N47A 3TQSA 1O54A 2AOVA 3C3PA 1R74A 2AR0A 5P8WA 2GAFA 1Y8CA 3TKYA 1KXZA 3OPNA 4L7VA 3GU3A 3T7RA 5F2NA 2UZ4A 3KQSA 2VZ9A 2XYVA 2ZBRA 3P97A 2NXEA 3M6UA 4X41A 1L9KA 2ZW9A 3DTNA 2P3OA 4AZSA 4KVZA 2XBMA 3EVCA 3Q87B 2C7QA 2OPBA 3CCFA 5FHQA 4PIMA 4JXJA 3E23A 3KPJA 3V8VA 1VBFA 2YVLA 5GOZA 1INLA 3PB3A 5KS2A 5LQAA 1NKVA 5DSTA 4CTJA 3T0IA 5EKXA 3SSMA 2NP7A 1RJDA 1JG3A 2AOTB 1B42A 2BZGA 2PJDA 3LKDA 3VC2A 5K03A 5EEGA 3MAGA 1G6Q1 1Q0SA 4FR0A 4P58A 4PYNA 3IEIA 4X1OA 1H1DA 3GJYA 4HH4A 5EIFA 2A14A 4E2WA 4C07A 3M33A 1YFLA 3BWMA 3EPPA 3KQMA 3OFKA 4KWCA 2GA9A 2PT9A 4HC4A 3UJAA 4BP3A 1NW6A 1FBNA 3O4FA 3P9KA 3SSNA 2PT6A 4QTTB 4GOOD 3HCEA
chains in the Genus database with same CATH superfamily
4JOQA 4EEXA 3FDFA 1D1QA 3IB3A 3LDGA 1Q2XA 1UBOS 1J20A 5G4KB 3F8SA 1Z5GA 4BQEA 3H6KA 1WHTA 2GUWA 2XEDA 2FMXA 4DREA 4GEKA 1ZLXA 2CDCA 1P81A 2YZKA 5CRIA 3Q0TA 4BX3A 3GJTA 4IIJF 1Y5IA 4L2IA 4UTRA 3TX6A 4WOCA 5BR8B 3MZ0A 1HLGA 4H27A 1YS9A 5JFOA 4QWMA 3FI0A 4BN0A 1RW4A 2NYAA 4GMHA 2HJGA 1GD1O 2O9JA 2PZ8A 4J0HA 5JZVA 3K9LA 1Z5UA 4WESA 3H1EA 2BT4A 2EBFX 2HMVA 1FRVA 4I1VA 2NUBA 2XCOA 3OFNA 2QVXX 1X1SA 2CLKB 1IULA 3H2SA 2Y68A 1LVUA 2L0XA 2JLQA 2YL2A 3ORRA 4M9RA 1C30A 3R6WA 5KKCA 2YXLA 2ZFUA 2QN2A 3PFKA 5TQ2B 1OYOA 3SF0A 2JLAA 2PSSA 4BO2A 1OXVA 3W6ZA 5L4LA 5BW5A 1NG9A 2HBQA 1WZEA 4NENB 5JATA 2Z3WA 5T5QA 1OAOC 3IAM6 4HFMA 2UVDA 1G16A 1II9A 1CE8B 1LSSA 4LJ7A 3V8EA 5CD1A 5G0VA 5K45A 2DTXA 3R3WA 1D2GA 3H1AA 4KQWA 3M5CA 4EMSA 3B52X 4PFQA 3W3AD 5CA1B 2NU7B 3NOOA 1I24A 3IPLA 3K31A 4PGFA 2IP4A 4ZU1X 1C1HA 2UZ0A 2G8LA 4UJ3A 1FFCA 1KA9H 3BE6A 4MWEA 4B5KA 2AD1A 2NAPA 5C9ZA 4DJDC 2HZ7A 3B9BA 3F1KA 2NU9B 1DBRA 3NC4A 3FLMA 3VC1A 4CMGA 4O0LA 2JFVA 5D3QA 1W96A 2R6FA 3WGNA 3B53X 4LOAA 2GN9A 4LHYA 3QIAA 5G40A 2DG2A 1GPDG 1ZN7A 1R6UA 1MC4A 2VBGA 5KU7A 1U3DA 4D4GA 1LLUA 5KWEA 3BMQA 3CRW1 4IDCA 2Z2YA 3LKBA 3RS9A 1A8QA 2R11A 1A2QA 1ULBA 1GPWB 3SR0A 3T9DA 2ZVDA 2I99A 1ONSA 1Q2UA 1ZVJA 3U7EB 3VNQA 3PPWA 2LIVA 3ZXYA 1JEQB 1UXHA 1Z26A 3OF5A 3C74A 4WI1A 3RJ5A 1JMYA 1ACJA 3RSHA 2I29A 3D8TA 5U4QA 1Z0ZA 3IIEA 3LY9A 5DM4A 3NBXX 9LDBA 4GXNA 3FKQA 1DKLA 1QVWA 3H5WA 3PR3A 4QVKA 4URFA 3AFOA 2PMFA 3AR2A 1Z9BA 3IODA 4P35A 4UASA 3SR3A 1ZM2A 1PYGA 2WWIA 1JECA 4O4IB 5FFFA 2FW6A 3C8HA 3IR6A 4RHEA 3MLEA 2X4IA 4Q9HA 4KG7A 5EXEA 3T3NA 4Z51A 2CLMB 2XB8A 4UQOA 4RELA 1T36A 5D5QA 3M3DA 3DD1A 4TSRA 4ZYTA 4KNYA 2X13A 4HAYA 3WKAA 1O6GA 2CLSA 4MTCA 4YMHA 1E3TA 2H2AA 2W93A 1NQVA 1YVUA 3BF8A 3GA0A 3V80A 4CV1A 1HM5A 2FFRA 2AQKA 1WPGA 3E1KA 1NPTO 4V2IA 2X0EA 3N8KA 3T4PA 3IV7A 2P3SA 3PIDA 4XIYA 4UUOA 5TPWA 1SPXA 5IJ9A 4KPEC 2HT6A 2UV8A 3VSDA 1E1CA 1PFGA 3MQFA 4HTFA 4C9BA 4OREX 4E0BA 5ADWA 1Z8HA 5H8WA 5LWQA 3AVUA 4KZKA 2RAVA 4GRIA 3TM5A 1EIWA 3PNMA 1Y5MA 2PH3A 1UK8A 2PWZA 2ILTA 2TRSB 3NZEA 3OAAD 3SJAA 2ZRGA 1JVSA 3X1MA 3L40A 3FWNA 3WGOA 4MULA 4AJ2A 2DKFA 3E7WA 1I13A 3QVTA 2BDTA 3W4JA 1IUPA 1DBSA 1G6KA 3DUFB 4HDKB 2QR2A 4TXHA 4IXDA 1ZDMA 3I9OA 1DIAA 1NN3A 1DFHA 1HQYE 1X14A 4M0PA 5FRDA 4H7DA 1W52X 3JXEA 1VTKA 2Q9BA 4ESVA 4H31A 2XNDD 4UBIA 1T9DA 3CGWA 3K3PA 4OQZA 2DC1A 2ON6A 2YZGA 1VSQA 3IBSA 4FD3A 2H31A 3AEQB 1E9SA 2B1QA 2B4RO 4TKZA 5CPFA 4NFYA 1FK8A 5HTOA 1Q21A 2P0YA 2XD4A 5D1NA 1E64A 1PD1A 3UWDA 2SICE 1IG0A 1RC1A 4F8YA 4RW0A 4YRIA 3E18A 1FE8A 3HV0A 4JJAA 1YXMA 3QIVA 3W5JA 5LQCA 1U9JA 3JWGA 3LX8A 5L95A 1GA6A 1AKQA 2QGFA 2VT6A 5DGTA 4Q9DA 1UOOA 2WZBA 3QRWA 1H22A 3IUPA 3G5UA 1WXWA 5NULA 4KQHA 3ZLUA 1QLJA 1U99A 2PUVA 2O8CA 3WY9A 2ABWA 1XD8A 1QHIA 4TT8A 1P80A 2IP2A 1MU0A 2WSSA 3C3WA 3GDFA 3K5PA 3HCWA 3R3YA 4PIVA 1F0PA 2XE8A 3KVYA 3TMAA 4C05A 5ALWA 1FFGA 3DKRA 1RYEA 4C03A 1WZ2A 2GO7A 3BG5A 3Q85A 4LXYA 5AFSA 2WILA 3T61A 1VPLA 3JASB 1J90A 3I05A 3MJSA 1OLXA 2OGWA 1H1LA 1JHRA 1VP9A 3DFUA 4Y2TA 3RSFA 4LC0A 4WXMA 5K5EA 1GZ3A 2JD1A 3FCAA 4ZOEA 5FTKA 1IK6A 1A1SA 1OBCA 2HJWA 1YHNA 4OBXA 4QBGB 3IDFA 2CMDA 2FN9A 3WB0A 4KIFA 5JZBA 2ZRPA 5JMPA 1IBCA 3RWOA 5JJLA 2QSYA 1G9XA 3W34A 5CK5A 2Q2VA 2AN9A 2H2WA 5DBFA 2GYYA 4H59A 4JI7B 1QOPB 2WM8A 5TIIA 2ZDHA 3W4KA 3UG7A 4X6XA 3B2NA 5D5PA 2QM8A 4YMSA 4U00A 5AW6A 5BV1A 4YBZA 4KMOA 1T5SA 4MJ3A 3U2QA 4BMPB 5JDIA 1NSYA 2GD1O 2C9BA 1MVNA 4MUGA 4AO6A 1PFWA 2ZTVA 1NBOA 3CUSA 2F90A 5CHEA 2A5DA 4QL3A 5DNCA 3ESBA 1FJGB 1XYVA 2GEBA 2BP7A 1KS2A 2OO5C 8ADHA 2JLYA 3KEOA 1SKBA 4EVRA 4BJ5A 2R96A 4UTXA 4MQEB 2Y76A 1O89A 3AC0A 16PKA 1WTAA 2W2VA 4X85A 4KR3A 5JJBA 3RG8A 2ZBQA 1QHGA 2VP2A 1T9CA 1UJ4A 1P5FA 1UK9A 1YCFA 2ERCA 3DE0X 3EH1A 3MWDB 1WXXA 1EM8A 4L3VA 4BV8A 5ITSA 1JW9B 4X1YA 5BPHA 4WZBA 4EMTA 5AW0A 2GUGA 3AHHA 1UH5A 5G3ZA 3ONVA 121PA 1WZIA 2XDYA 4RKFA 1FPMA 5E1MA 4MUKA 2HLDD 4KB5A 3KTFA 4M6WA 3GFTA 2YZMA 1OA0A 5A6SB 1L5WA 1SVUA 2GPJA 1G60A 2D1RA 1N1DA 4BDTA 2DWUA 2ZIXA 3DYVA 3HY3A 4QXOA 1GAEO 1GCAA 4HATA 5BQ5A 3C3DA 2P7IA 4HB3A 5TS3A 3WWCA 1ULTA 1VKHA 4M8LA 1QO9A 5E1DA 2ZUDA 4DLLA 3CX6A 1EFUA 1ENOA 1SXQA 4GPBA 3ONNA 1U2GC 2IWHA 1U0JA 5CT6A 3UUEA 2BGLA 1TYCA 4FLFA 3AYXB 3VISA 1RKBA 1P91A 2WHQA 3EGDA 4CV2A 5JO0A 2WE7A 2H00A 5JSHA 1QU2A 1SKMA 5HQ3B 4OLAA 1N2CA 1SN7A 4QOHA 3ANTA 4EOGA 1JB9A 3PD0A 4QBHA 4MTLA 5L4SA 1KY2A 3EQ6A 2QJFA 5ELLA 5C1IA 3YASA 5IFLA 3P9CA 3Q10A 5FPHA 2JIZD 2BLLA 3AJDA 4TSFD 4GMFA 1Z4NA 1G41A 1M1NA 4KLAA 5LJIA 4EUEA 1Q11A 3HCOA 1KFJB 4HXYA 1W0CA 3K09C 3IJPA 3W2GA 4NBNA 2PUGA 2BFAA 1UKVY 3G85A 1JFSA 4UULA 4AKEA 3OE1A 1YNSA 5AQ1A 1XXHE 3EQ9A 2XUPA 3G17A 3HUEA 4DQXA 1HTBA 1B0AA 2IQ5A 1T2EA 1UEJA 2ORYA 3R3ZA 5GMOA 1RAFA 4C3OB 5JSUA 2PZGA 1YI1A 2IDMA 5ELXA 4G0NA 1LBIA 3KV3O 4NYIR 2C2GA 3U4AA 1IH8A 4B7UA 5IT5A 2FZLA 4HV4A 5CFQA 1HYEA 1X42A 2J46A 2Q2WA 4U2FA 5AI4A 2MJLA 3QPUA 4ARZA 4DN6A 2C78A 4YMIA 1TNDA 5C7IO 3WZLA 5MN6A 1SWWA 5G4LA 4ITRC 5F33A 4EJSA 5K3DA 1V6SA 3L0BA 4FW9A 4LI0A 3WA6A 3A6EA 3KYCA 4D5EA 3M4ZA 3NUQA 2PMWB 2PS0A 1XLWA 3GJQA 3BRCA 3PE3A 1UK6A 3PQ3A 4PS1A 3GQVA 5FFNA 4F1KA 3B1XA 1QR2A 1HLPA 3OURA 3DBOB 4FBMA 3VPXA 1H8HD 2VTVA 1Z4LA 5HDBB 4ARBA 2JLUA 4MDEA 1KIMA 2OPHA 3EXFB 1PX2A 4EPVA 3FIJA 5IS2A 1V8OA 1LBHA 1C7IA 1JVNA 4UPEA 1HYHA 2FGJA 2ZBVA 3JYNA 2VKTA 3I04M 5AR1A 2X8BA 2WIDA 3D8NA 1SQ0A 3OFVA 4I50F 3TPCA 1IQPA 1HK7A 1AO3A 5IM4F 2VCYA 2QZPA 4IXTA 2BAGA 5B3JA 3JWHA 4X3PA 3MYYA 4MVJA 4C0HA 4BO4A 2OBYA 4FFPA 2R85A 1B4DA 3PXXA 1L8QA 4DR6B 1KRHA 4HTAA 1G2OA 4AYTA 3FMOB 1PL7A 5HILA 3PWKA 5THQA 5JANA 2ZIEA 1FDWA 1V16B 2ZUCA 3AFHA 3T7JA 1CDOA 4Z4CA 5CFRA 1S2GA 2LR0A 2FK8A 2W6OA 5AI5A 2Q4EA 1DCKA 2P62A 2O7NA 1S3GA 4OHCA 1MORA 1WIWA 1LBEA 4DDTA 3D3KA 1FP6A 3CEAA 4L28A 3FZYA 4RTSA 4NCBA 1MEOA 1MOQA 3AP1A 1NTOA 1TLTA 2QTVB 2NTJA 1TZCA 3QFTA 4IDDA 4MS1B 4OHOA 4CMIA 1RPAA 1YMQA 4JEMA 5AD1A 2X1VA 2ZK7A 3H65A 3LHIA 1CP3A 4K05A 4N41A 3WXBA 1NMSA 4DCNA 2BFPA 2QZZA 2JBAA 5IANA 1KEEB 5DNUA 1MW9X 1OY1A 1DPFA 2KWIA 2H5IA 3OMXA 4RV5A 5FWNA 1GEEA 4EPWA 1MEEA 3MIZA 4GDMA 2Z5GA 3NJ8A 3TL3A 3DL2A 5LFAA 2HO5A 3E9ZA 2D2FA 4GXTA 4K2AA 4QVGA 3LH5A 4BZXA 5COAA 3TGLA 3JAWA 4H4CA 3N87A 1HNWB 1DG9A 2IYXA 3LIPA 1NVBA 1REQA 1SC9A 1V8ZA 4NV3A 4RD3A 4PYQA 2F2TA 3RIEA 3OI7A 2RONA 2ISQA 3EF3A 2EEZA 3KEMA 3KX2A 2OAGA 4A2CA 4OXYA 1R12A 4WWHA 1GQRA 2H9IA 3FUCA 1Y5RA 2H4ZA 3ABIA 3BMCB 5B6IA 1E0JA 1WP9A 2CBXA 2FG5A 1OC2A 1JT9A 1O0BA 1TF5A 1ZVKA 3B3QA 3G8DA 4N3AA 1FUKA 3KYDA 2BFEB 2OC9A 5MGBA 2IDZA 4L3OA 3M1IA 2ERXA 1DQYA 3O21A 4OQLA 3EQ8A 5ALDA 1SCJA 3GH1A 1SVLA 3C39A 5DHTA 3UWPA 3Q2KA 4EVIA 3H99A 2CNNA 3L92A 4KQ6A 4CXMA 3CINA 3PENA 4OQDA 4PCUA 2LBPA 3OF3A 4FYPA 1B93A 1PG2A 1ZJYA 2CKDA 4TTSA 4PX2A 1BIFA 3QBJA 1HUQA 4C78A 1ZGZA 2WUFA 3MUNA 5F2KA 1QHSA 1TM2A 3ENKA 3WNCA 4F85A 1JHVA 1TI7A 2PGXA 5LLTA 4K0KB 4V0NA 2CW5A 4R8RA 2YWEA 1XA0A 1PHRA 2CHUA 2CLFB 2OV6A 3D4OA 1DC7A 4XYBA 1SCDA 2BGTA 1LBSA 2ETVA 2ZBEA 3IT3A 1FBTA 5HRCA 6LDHA 4U8HA 3ZY5A 4OFBA 2HWUA 1ZI9A 5FOTA 4KXWA 1UMCA 1FDOA 3I4LA 4X94A 4BFZA 2XYVA 3N8IA 2AF3C 3L0ZA 4UMFA 3CF6R 2WAXA 2V3VA 3ODPA 3GPLA 1QKIA 3I8SA 4I66A 3PZRA 3WB2A 3AX6A 2CCJA 2I7VA 3GUCA 3QY9A 3G2IA 4GI3A 3VC7A 4PIMA 4EUSA 1PZFA 1U8AA 4JXJA 2B6NA 3TTSA 3WA7A 3BILA 3SX2A 1SBNE 5AM2A 1G6HA 3W5CA 1IZ9A 2WJIA 5JG7A 1Z7WA 4LXXA 2O19A 4HYTA 3ND9A 1Q0RA 3W2EA 2E2WA 1RLOA 5AVYA 2O1WA 2YY7A 3FNQA 4HUTA 5EE0A 4NMXB 1ZRSA 3PDHA 4P0PB 2C3YA 5FIUA 3CH5A 1D9ZA 4V0MA 1U7OA 1O97C 5EWMA 2J45A 2OD7A 3E9MA 4M46A 4PZZA 5DB4A 5LYJA 4S12A 2QDXA 1DOAA 3CFYA 4LNHA 4QTTB 4IIUA 2GO1A 3IJRA 4DEYA 1YS6A 3S7ZA 5TPZD 1Z45A 3BZBA 4OHWA 4CLOA 3UMMA 2QN6A 2I2WA 1MV5A 3IQFA 3PF8A 5COQA 1USVA 2YXNA 3INYA 4YA6A 1P7VA 3ZU6A 2AI1A 2B20A 1X39A 2BIFA 3W8NA 5DTIA 4KK4A 2GRUA 2ONZA 4DA9A 1FVOA 2I67A 3Q0IA 4JHXA 4MDHA 4DQKA 3DJFA 4ZO9A 5E6RB 1AVTA 1QS0B 4MYUA 4AQYB 2B7CA 1LY1A 1GNTA 2PZFA 5TT1A 3ELBA 2EJBA 4RTOA 2HSEA 3A3OA 5JD3A 4OU5A 4OHRA 1YR1A 5C4GB 5CCXA 4O2LA 4ZYWA 3GVXA 5EZ5A 2BKXA 2ID8A 1DPGA 4TYWA 3DYIA 4JVNA 1TCUA 1G7CA 4PO8A 1GM5A 5EP1A 2XW6A 1BTOA 2HWKA 5E3JA 2GD6A 3ZLBA 1F3LA 1QCDA 3Q7IA 3EC1A 4L4RA 2HR1A 3ETDA 2M2IA 3QUAA 4IHQA 5HFNA 4OI2A 2NACA 4JMPA 1ZY2A 3E2MA 3F3SA 4O2AF 3WRXA 3ZS8A 2B4QA 1YOBA 1VOTA 5ARCA 2FW8A 1FFYA 1KSGA 1Z5OA 2PSJA 1CZUA 1PR6A 3CH6A 5C31A 5IXYA 4CMJA 3OQVA 2VUTA 1X80A 3PNYA 3KLPX 4UD6A 1H93A 2JVIA 2P79A 2EF0A 3DHYA 4TYQA 2X6TA 3AFMA 3V32A 4B4UA 2IYZA 1S3SA 3VHQA 1N6RA 2XI4A 3ZDYB 2XPCA 3PQ8A 1AA6A 4CKWA 1TF7A 4MAFA 4R1QA 4YH1A 3A14A 3IAUA 4RV4A 4DJAA 1JP7A 1IC6A 3S1LA 3EFHA 2Q99A 3BWDD 1OX6A 5B3LA 3AH8A 2J0QA 1OX4A 1DTWB 4IL5A 4M1YA 1E9RA 3QYJA 4KQ2A 4FUQA 3ZWKA 2XMGA 4HUQA 2P78A 1GGJA 3FKSA 3GDHA 7YASA 2V4MA 2H7CA 4GX5A 1TAQA 1O95C 4MNTA 1ORHA 3JPWA 1PFVA 4CQMB 1QYXA 1KAEA 3KCNA 3NIDB 4JC0A 3GP8A 2NADA 1N7JA 1Y1PA 2Q6TA 2F1IA 4BKQA 4UMEA 5AK4A 2B61A 2FX5A 2P2YA 3KSAC 2QRVA 1Y8ZA 1IN7A 3NNSA 3N2ZB 2YIJA 2CJXA 2EVWX 2RGUA 5H59A 5AVWA 1Q20A 2QV7A 3HU5A 4IYJA 1GA4A 1J0AA 2W90A 4M0FA 2XWBF 3HCPA 2IWRA 3WV5A 3W5DA 3AYZB 2VYCA 3QX8A 3ZE8A 2WTNA 4P31A 3N2EA 3IDZA 5CNIA 2C77A 3V7FA 4POAA 3OZRA 4L8GA 1RWXA 4RPHA 2RI1A 5B2EA 3C3YA 1EUCB 3CGGA 2ZRBA 5KX5F 5F23A 4MW6A 1E3JA 3RC7A 4UUAA 5IM5A 1SU4A 5DEOA 1UDBA 2X5KO 3GQBA 4C0WA 5EA2A 3WGIA 1B8VA 1EVJA 1TADA 2Z5LA 1BX3A 4XWOA 4L4SA 3HC7A 3T7KA 4KC0A 1FU8A 3LT2A 5LNK6 4C0SA 2BGJA 2XYPA 2GPAA 2IEZA 4JP8A 3REOA 4ENTA 1G9SA 1CRQA 3CKKA 3WLMA 3MOGA 5EWLB 3TVYA 4MI1A 3Q88A 5SZJA 4EITA 2ODAA 1X7YA 3KJFA 2H17A 1KI7A 2J0SA 1VSBA 4IJKA 2OOKA 2FI1A 4NZOA 4JT9A 3IX7A 4WCFB 2PRSA 4IJ5A 4J29A 3RSZA 2BHNA 3FNIA 3UK1A 2CLOB 4BKMA 4KWHA 4D9NA 1QX4A 2AJTA 2JIMA 2BFFA 1EKXA 2G36A 3CONA 3MELA 3OE4A 1C0IA 4HPJB 4JLNA 3VVCA 4HNHA 3CLTC 2MR5A 3G7SA 5LCXA 3RVLA 3RSLA 1P8JA 3HADA 2ZYUX 3BGSA 3TBFA 3GNLA 3M4XA 2FE4A 5KJ6A 4Y1EA 4DLTA 4YQYA 1W8IA 2QT1A 3KVVA 1ZYUA 4QOJA 5J2UF 4S1NA 4DTIA 3W6UA 4PVDA 2QRUA 4BUZA 3UXEA 1K2VN 5JNSA 1RTTA 4IEEA 1V39A 1P7YA 2C9ZA 3BXGA 4YRFA 1COZA 1A98A 4LRWA 4QGFA 2E0IA 3NHRA 1ID1A 2PNJA 3KFVA 5BSHA 1MZVA 2W42A 2ZYRA 3USZA 1MABA 1STOA 4B8WA 1WU8A 1IBSA 2EHJA 3FNEA 2CK3A 3EA0A 5U1PA 3IT1A 3HDQA 3P9QA 5DI3B 2VJNA 4OK3A 4S2EA 5DU2A 1F8UA 2C8KA 5JPDA 3GFSA 3BJEA 4W8HA 2P69A 3OSUA 4OQXA 4J49A 2CBZA 3ND5A 4OJYA 4FOSA 1YQEA 2AD5A 2UZ1B 2V59A 2YOFA 4QGAA 3B70A 4QPJC 4E88A 5KNDH 4ZVMA 1XR3A 4FJ0A 2JFYA 4I50B 4I1PA 1YZNA 5EE9A 4PWZA 1SC4A 3HJTA 2O1EA 3L4BA 1WCIB 1L5KA 3V1MA 4UEOA 1QIIA 2GNOA 4IGFA 3JYQA 1FTGA 1Z47A 1L7EA 3EZLA 4BUJA 4Y1RB 4IDEA 1JIKA 3MJDA 3SIWA 1Z56C 1A72A 5ED0A 1L5SA 1CDZA 4HVAA 5GVRA 1XVAA 1MRZA 3PEVA 4PM4A 1DINA 2XE6A 3CHYA 4PCLA 4C6RA 2FQ1A 3RS7A 4MK4A 2NIPA 5D3MA 4YUXA 5IAKA 4D9EA 2PMDA 2VUSA 3M89A 3X1XA 2GD2A 1K8ZB 3OZDA 4KXQA 4N7MA 3QXHA 3Q8KA 4G0WA 1RLTA 4F6CA 3EXG1 1VKZA 3CKYA 4AB1A 5HGXA 5CM8B 4PLWA 1FFBA 2XUDA 3Q9SA 2X4DA 1E2GA 2H4YA 3FMVA 1T2CA 1RM0A 2CVZA 3MJ4A 4RC9A 1T2FA 1GN8A 2QP3A 3A9RA 1NVDA 2QX6A 3T7AA 4EUNA 1IXRC 1ZGGA 1J6UA 5DXFA 5BNFA 1TL7C 3IA7A 3SFVA 1H0KA 2P35A 1J39A 3EY4A 3FOCA 1OLUA 5F77A 1RRVA 5AP9A 2A6PA 3GRZA 3GJRA 2WVAA 5EYPA 3RF6A 4MW1A 4Q9JA 5AHKA 3B7WA 1DO8A 5E9WA 3AEYA 3AI7A 4KO3S 4GEGA 1EYZA 4BVLA 4LYEA 4DIMA 4JJ8A 3VPDA 2NO7A 2NVWA 5C5IA 4EO4A 1VC2A 5AJUA 2RGEA 4MV7A 3N58A 4FE3A 1E6CA 1YR6A 2YZ2A 4OQYA 1F51E 2GXQA 4UD2A 4WLOA 2BMDA 1PNRA 3KM0A 5KTYA 2E5WA 1T0JB 5IN5A 3WHIA 2YRFA 1PR9A 4JLAA 4A5OA 1EDBA 3BAFA 4YRAA 3NDBB 4G1FA 4ZAWA 1RRFA 2V1XA 2X2PA 4JBGA 3WIVA 1GSOA 4ENSA 2PMEA 3THRA 5JNWA 4QQFA 3BIWA 3QV1A 4WUVA 1E32A 4HWSA 3W3ZB 2FP3A 2VF5X 3U80A 3EN0A 4G5GA 4AN1A 1HR0B 2D2VA 3P2KA 1QIGA 4WFJA 3CNHA 4XWAA 1IHYA 2C07A 3NETA 4W7IA 2HIHA 3LFTA 4C4RA 3B3AA 1BDHA 1YAJA 2D7JA 4BO6A 4KREA 2H3HA 2OZLA 2HCJB 4KE8A 1C9EA 1I4DD 1DMRA 4Z8XA 5FLKA 4BX2A 1WUJS 2ID4A 3PUXA 1FP4A 3RSSA 4B2YA 3ZCQA 2MWMA 3SXPA 5KSPA 1DZIA 4GBJA 1T2UA 1SJ9A 1VFPA 1D6MA 4NBVA 1TEZA 2D6FA 4B7XA 4ZCRA 3HGTA 3ZEIA 3JW8A 5LXTB 1C1YA 1I4OA 5CMLA 4B35A 3S44A 3C3MA 4C4SA 1QNFA 4F1WA 1DLIA 5CFLA 3EPHA 1O9GA 3ASUA 2GN4A 3W5AA 2ZT6A 4WNYA 1T8PA 3WYNA 4FI3C 3Q7SA 4OHUA 3LUHA 5K0LA 5IHPA 1XFDA 2CUNA 4Y6QA 4JQSA 2AZ4A 2G3YA 2P77A 3TKAA 4C88A 3AOEC 1AUQA 2WJAA 3M6XA 4YRCA 3VNRA 4WZ6A 3LC7O 5J5VA 4ER0A 3DLBA 5FA8A 3A6PC 4ZQHA 1NVVR 3CR7A 3GLKA 3IV9A 1EXMA 5H3LA 2BW0A 4X61A 4U02A 1NYQA 3CLUC 3CPHA 2I4RA 3GZ4A 3VDNB 3DW3X 3J81A 3H5OA 2CFCA 3K35A 2MSLA 5EAIA 1Q6YA 3E5RA 1H1TA 5HIMA 1DEXA 4CNBA 3EEOA 3SVTA 1FQWA 2R6HA 1JYFA 4QDXA 3H9EO 2P90A 2RHTA 3LM8A 4QYWA 3WSWA 1DOHA 2NO6A 2R4QA 1J2JA 3LECA 3R74A 2Q6IA 3BWBA 4PR3A 3AZPA 3SPXA 2QMOA 1Z5VA 3ZXIA 1FJ2A 2QNRA 5EP4A 5IK2D 4J3NA 5LC1A 3UGKA 2GAIA 4JP5A 2HGSA 2BFMA 1OKKA 1XDGA 3GARA 5DNWA 3F1LA 5TGTA 3L1UA 3VUEA 3EMBA 1EESA 1JX6A 2PFGA 1PHPA 2EFYA 4Q39A 5DULA 1J25A 2YOHA 4KU4A 2HN9A 1VLZA 1HMYA 2GF2A 2XDQB 3D6JA 4XDGA 3U0BA 5GTDA 5LWHA 3LIIA 1BWQA 5IG2A 3KJEA 3AHEA 3H9CA 3MJTA 3MTJA 5I3ZA 3EXG2 2H4WA 3INGA 5JV5A 1RRCA 3K1YA 4NBWA 3HU1A 2B2NA 3PBKA 4YJ3F 1QV7A 1I36A 5AK0A 2PGJA 2HXGA 2XB4A 1U28A 1GDDA 1R7RA 2JDIA 2VC2B 3DDUA 3FSGD 1SGWA 3GZNA 4D8WA 1Y9EA 2XKJE 2X14A 4D9JA 2AXEA 1EFLA 3DHVA 1L9XA 2C98A 2ZPUA 3FOAA 4EJMA 5KO2A 4ISBA 3P4XA 1VP3A 3BMXA 4UFNA 3TI7A 4D0LB 2VIIA 1C9KA 2HHCA 3TLAA 1QTQA 1A4XA 1E7RA 5AJVB 1JQKA 2C5FA 1H2BA 4LZNA 1JSLA 1R8SA 1VPWA 1OXXK 4G0QA 2WB4A 2W11A 1B8OA 1HQKA 1N1MA 2EZ8A 2GEDA 1KJWA 1L0BA 3WZ2A 2P2LA 1F8GA 1RQ2A 4ZT2A 1SVMA 1E7MA 2AHOA 2FR0A 4O2AB 4Y6SA 1VA4A 5C1OA 1E9CA 1VL0A 2I66A 2AR7A 5A71A 2VUIB 2DQYA 2WDZA 3AF5A 2P6RA 2G1UA 2ZRAA 4GH5A 4LF7B 3W9BA 2NO0A 1T0HB 3WISA 1QE5A 2HCBA 3RUAA 2GHTA 2KE5A 4WPGA 5K0CA 4N3BA 2HBRA 4AUNA 2XH8A 1Z6XA 3BD7A 3O91A 3M8KA 3D9QX 2JRLA 2FSGA 4M49A 4NOKA 1N8TA 1RVV1 3EEIA 3FPFA 4J16C 5TX7A 4AY5A 3FI9A 3THYB 3R7DA 2OHJA 4UUBA 2ZT8A 5H68A 1Y1RA 3NYWA 1ZK0A 1W85B 2W6NA 1UPXA 4CCAA 2FSVC 1BX0A 2FRVA 2ZAOA 5AKKA 1TCBA 2GBGA 3EC7A 221PA 3OTIA 1WXHA 2RHOA 1CUUA 4RQBA 4UUQA 5FOWA 4OY3A 5LU8A 3DL0A 4JITA 4XOUA 2RGNA 3FRHA 4TQ9A 1VM6A 4NY1A 4FNMA 2EGUA 4EB6B 4NZYA 1NJGA 3PJDA 2Q0HA 1HF3A 2YJ3A 2FMHA 4MA5A 1EX1A 2RBKA 1K0FA 3QG1A 4OBBA 3UATA 3C16C 4DDMA 1TO2E 5KSWB 1T4MA 5JROA 1ZL2A 2WYOA 3V8PA 4UM9B 5BYJA 3GC6A 2DQZA 1GAQA 3UMSA 3UJHA 2IOFK 3UJ6A 4WBXC 3WQQA 4Z2YA 1DRVA 2ZQZA 3DJYA 5DE3A 4GG1A 3OIGA 3TDMA 1PV4A 1FNBA 2UYYA 3UZUA 1NBIA 3RAEC 2BBTA 4PIPA 3JARA 4FMCF 2C3PA 2AJBA 4ZANA 2GAAA 4G1VA 3UHPA 4UNRA 3EGXB 3O84A 3GCWA 5F64A 3VNBA 3Q7PA 4BIMA 2OSBA 5B7QA 1O5OA 1V7ZA 2AR0A 3GLSA 2GAFA 3RKUA 4J1SA 4A0HA 2GRAA 1FFEA 1KXZA 3EXIB 4RABA 1WEKA 4ZREA 1M54A 3FKJA 2RB5A 4B6QA 2HLNA 5L3ZA 3WICA 5J47A 4JT2A 3RI3A 1RXWA 3SF8B 4R40A 1LZLA 5EE1A 2VZ9A 1W88B 1EP1B 2DRIA 2XITA 4UZEA 5CAEA 4WZZA 5JHHB 3U3JA 3DA8A 1ATZA 3VU3A 4AZSA 3FLEA 3QPCA 1YASA 3EVCA 3OPQA 2OP1A 3BM5A 4XX1A 3MFYA 1VJRA 2OPBA 2X9NA 4J2HA 4UFPA 1C9JA 1DJPA 5M29A 3MTAA 3MPUA 1FTWA 4D0SA 2BY4A 3OCZA 4CTJA 4MXDA 3IBFA 1M2JA 4HNRA 1KDTA 3AF6A 1LS6A 5KVCA 1B42A 2BGIA 2Q5FA 2QJTA 5EIEA 5K03A 4PC2A 1Q0SA 3COYA 1B0PA 2CFIA 3KYJB 2W2OA 3IEIA 1SIOA 3DE5X 3UCXA 1AHPA 3LQKA 3SQDA 1D9XA 3B8HA 1KFBB 3IT0A 4PVCA 4C5AA 2GA9A 4HC4A 1TZKA 4CFSA 4EA9A 1JHQA 4PRKA 4QYIA 1N78A 1VFNA 2EBUA 1AUPA 1RYZA 1LK7A 1HDOA 2HPAA 2B3DA 2VF8A 2XHEA 4J7CA 2QWXA 4XA8A 4CF6A 1QTNA 1K3TA 1WTCA 4O63O 1UMBA 4QTZA 1RT9A 3RDPA 1M0WA 3ZGZA 4HDSB 4MRAA 3DBRB 1F6DA 1M83A 3OCWA 1U8EA 1W75A 1CU1A 4NBUA 5J2UB 4RACA 4F04A 3ELDA 2JZOA 2XUOA 4TWJA 4AD8A 4IQ0A 3HUFA 1GGFA 1U6KA 1XD2B 1YJXA 2EIHA 3DQQA 1LU9A 2C00A 2B34A 2IF0A 4FYYA 4HI0E 4OSPA 1EFCA 1QH9A 2X0IA 4NH4A 5DCWA 1LZKA 3C6YA 1E5QA 4JEUA 3M1YA 1E5VA 4IF4A 1ZNWA 2WU3A 3I1FA 1R4AA 4LTNA 2OWEA 4I4TF 2FPOA 1NHWA 4JZKA 4KIJA 1R3DA 4IDAA 4HXGA 3GRAA 2Z1MA 4GICA 3WTBA 1N2SA 3CC8A 4BMXA 4F96A 4QGSA 5KQGA 3D6AA 2XUZA 5E9QA 4BLUA 5JWRA 4XH9B 5EGNA 5K8UA 1UIMA 1ST2A 2PQ0A 2V5UA 4OMUA 1L3BA 3MJHA 2JFXA 5E7MA 4BMOB 5AO9A 1M6VA 2WABA 5JECA 3RSGA 1TT5B 4RTNA 1PDVA 2Q3HA 3JQDA 4GOXA 4Y1FA 3LHSA 1ESCA 3R76A 1H23A 4PBSA 1RRGA 2JGFA 3WL3A 2HU5A 3WNDA 4Q4AA 2FMKA 1FRNA 4ENVA 1T1GA 1W4AA 3I09A 3L1KA 1E1RA 3QHAA 2ZRMA 4N3CA 3Q5EA 1YZHA 3V5NA 4B46A 1M2WA 3UPTA 4LXHA 4Z1MA 2Q5IA 1Z5PA 2QQGA 3HYSA 1TMKA 1C81A 5LA6F 2BEWB 3P9SA 4LJ4A 4A03A 1Y6ZA 4B4WA 4CNQA 5E8RA 4Y2RA 2GLUA 4CMEA 2WU0A 4H1WA 4MEBA 4D3ZA 4EBFA 2P1ZA 3WK4A 2HCTA 1TVKA 1VGQA 2WB2A 2MSDB 1FU4A 1W59A 2I7TA 4JS0A 1GUAA 1MD9A 1K3UB 2BR5A 3RVOA 3S29A 3TCNA 5BQFA 1FJHA 1SIBE 3PITA 5KYWB 5IBQA 2I0FA 3TLKA 4KW7A 2WV7A 1LK0A 3QY0A 5CVJA 3QPBA 2ENUA 4F4UA 1NZFA 2P5YA 4HVTA 3QFCA 1WB4A 5E6UA 1G3MA 1PV1A 3H0CA 3NIGB 3PE4A 4RIIA 4NCNA 1OGIA 5F5XA 5BN3A 1J49A 2QRJA 1Q16A 4J2OA 4BLPA 1GADO 2RFLA 4F71A 2WM2A 4QPDA 2BHRA 4BB0A 5GOTA 2I9PA 1YUMA 5KOHA 1Z29A 3R0QA 3F3YA 4LRQA 3W8RA 4LHVA 4P5EA 3IJEB 1MVOA 3PICA 2HV8A 4Y98A 3U61B 4HH0A 4HYQA 4G1CA 5JVDA 2J3KA 2EZUA 1K7FB 1IZ8A 2JI9A 1G98A 2JGDB 3LO5A 3O4HA 2JFHA 4FNAA 1CP2A 4AP9A 1AHIA 1QH1A 4A92A 3T9FA 1CEQA 1DBQA 4UEKA 2Z2JA 2FU5C 1QZXA 4ZGBA 3ZHZA 3PTLA 3IALA 4DEVA 1GAXA 2K87A 2O2ZA 3GEGA 2Z98A 3N8HA 2F1OA 1KKUA 4LSGA 1P18A 3PDJA 5HCNA 3AF2A 1T3LA 5LOVF 2IT1A 3FOBA 3WMGA 1K98A 3OY2A 3EDMA 4MUYA 2EZ4A 1Y4ZA 3WFJA 1Z17A 5BR7A 2XXJA 5L45A 1BSVA 2XCLA 1FY2A 1G8FA 2XUJA 3T9EA 1N57A 4EKDA 4ER5A 5AM3A 1TKRA 4FI3F 2ZAIA 3UIEA 2RHHA 3ETLA 3AZQA 5DCLA 1W2HA 2O8VA 2QRQA 2UKDA 1YZTA 3DVAB 3I12A 1NP3A 4KQEA 4MS3B 1EVLA 3HI4A 4IVNA 5FAXA 3U4CA 2A5FA 2V7TA 2CV2A 1UKBA 5J5CA 1KOLA 3T5DA 1WB9A 4I55A 2DULA 2IIPA 2R4UA 3OECA 4XR4A 5D1HA 3TNDA 1U7PA 4Y6PA 3EMKA 1RQXA 3MF4A 1XPRA 3EIOA 2HPZA 1DLJA 1FYFA 5B4TA 1OFVA 4DSUA 2H1OA 1XRPA 2C2KA 2OORC 4X44A 2OA0A 1CZHA 3HU2A 4RKYA 1R3UA 1G5TA 1N2JA 5DP1A 1H5UA 4MMZB 4RM2A 5BN5A 2IQIA 3PVZA 1UFQA 1YVPA 4Y9RA 4Z9XA 1BU5A 4TMYA 5D84A 3RQIA 4X63A 1OI2A 3F97A 5BSEA 2YFKA 1CQIB 1QFZA 3JQCA 3WLLA 3HM9A 2XBUA 2QLJA 3NBUA 5EIXA 4J03A 4KQFA 2ODPA 4YV1A 4ILEA 1ISMA 5HKLA 3T5MA 4BO5A 4EKIA 3JAMA 1N5DA 2L19A 4NX2A 3GMSA 1PI3A 2JL1A 3PUYA 5EUQB 2X9QA 5F1OA 4FGKA 1YRLA 1UP6A 1RP7A 2QDKA 2ZUUA 2QX9A 1L5HB 3W79A 2DBZA 3TNFA 1Y9ZA 2VJMB 1T9HA 2H0RA 2XQGA 2XODA 3LQ2A 4HYYA 3DNFA 4WN9B 3EZXA 1ZNXA 3CWZA 2UYHA 2ZUTA 2ZSIA 1JT2A 2C1EA 4US1R 1DT3A 3C6BA 4M22A 3TL6A 2O3QA 3AP3A 3GEIA 4LYGA 4QA9A 1I2AA 2C5AA 4R6XA 2J3QA 1R18A 2Q49A 2EJWA 2EL9A 3FUTA 3GLIE 3WLFA 1TYBE 4W5HA 2FGKA 3EG9A 3F2VA 4KQCA 1YDMA 4M7RA 1LK5A 1HBJA 3OJWA 3LHKA 5FNVF 3RTEA 2CXPA 3UHAA 2XOXA 3UWKA 2GCGA 4TV8A 5KMGA 4R4JA 4YJ3B 4EG6A 3JQFA 3LBFA 3NWOA 2HRQA 4FFBB 1EXWA 4CMAA 1JLMA 1P2VA 2AG8A 4KE6A 4XWGA 1PF7E 3SFTA 4Q19A 3UMBA 5K0GA 3BD8A 1IN6A 2Q5EA 2OB2A 3P0EA 1PT7A 2CXQA 2BELA 2DPGA 2LD4A 3S8MA 2FJ0A 4AX8A 1UJ5A 1GNSA 4NK4A 4QFCA 4BO3A 1HNZB 4DJFC 4UE6A 5JZMA 1CUEA 1I6MA 2CNWD 5FD8A 4U6SA 1SVOA 2G6BA 4I1IA 4PICA 1CHDA 1T9ZA 3L7LA 3UXHA 4GSYA 2BFBB 3TQFA 4FJ1A 4D43A 4HQRA 1HL3A 2IU4A 1H2AS 4XPIB 4FW8A 5CURA 2WBLC 5FOQA 4RPJA 5JJ5A 1OE0A 4R31A 1YZQA 3LC1O 3QEMB 4JELA 4W1QA 4EP1A 3GJ3A 1K2WA 1JAZA 5C46F 4FZJA 1RLIA 4BC1A 4PXAA 4EY8A 1LJ8A 1QAMA 3QKRB 3MN1A 4D6XA 3ZDAA 3ES9A 3M6VA 2R79A 4RL4A 4Q4JA 4Z4HA 1QF7A 4UZFA 2B35A 1M0EA 1VJ5A 1XAGA 1TYAE 1BXRA 2H48A 2R1VB 2C7VA 3AIKA 4FCVA 1M5RA 4MQ6A 2JLVA 3HK2A 3NCTA 4OHPA 3GLGB 1PWXA 1UZUA 1JKMA 4XKJA 2HHHB 3PQ6A 3D5EA 1DO0A 1KFEB 3TRFA 1SVNA 1X8LA 4P36A 3EUFA 2D4AA 3G1WA 2PL5A 1P2FA 2ZITA 4ZPXA 4ARCA 1ZHFA 3DYBA 5EE3A 2X5JO 3KVNA 1JIJA 1Z35A 4MUBA 1EG7A 4AFNA 4EG0A 4HMPA 2AIRA 13PKA 4QEKA 3JAKA 2IJGX 3RNOA 5BW8A 2C4HA 4GPEA 1JTFA 3ELYA 3RRNA 4ZYVA 5F7OA 1WMFA 4YRKA 4ZODA 5IPFA 3QLUC 2OHXA 4X95A 4Z7NB 1RYMA 4RLSA 1YH3A 3SZMA 4CQMD 4M37A 2Q5JA 4MS4B 1N7IA 5CB6A 2AC4A 3I6YA 4R1NA 1DEOA 3KXKA 1F7UA 2BEKA 1NI4B 2LCFA 4O4LB 5DHQA 4GECA 3U1VA 2H7VA 2EWVA 2OL4A 4KXLA 4MWDA 4AF7A 2R8PA 2NTNA 1CR1A 3AI3A 1GUBA 3C41J 3FHJA 4U7HA 2ZUFA 3N2GA 4EQ6B 1HDEA 5FUYA 5A4JA 5DT2A 2E37A 1N5MA 3RFFA 5ERXA 3TO5A 1V96A 3TOVA 5FV4A 2FP4A 5C7YA 3DHNA 4LSZA 1Y82A 2BM9A 2QY6A 4AURA 4BQNA 5J23A 3A2KA 3I83A 2RI0A 3HN2A 2W98A 4NH0A 5ECGC 3W7BA 1XL0A 2IK8A 5CLFA 2Q1XA 2Q1YA 4DPMA 1L4EA 2HSZA 4J1QA 4PXSA 4X8MA 2DETA 1RMYA 2OK7A 2AMJA 2WU4A 1U2DC 2C54A 1E2MA 1Z7BA 1H8EA 1VA5A 4ER3A 2YVQA 3STTA 3RREA 1SUEA 3TB6A 5LMNB 2E89A 4Q82A 5CLJA 5FTNA 3SIPA 1NKSA 2XSZA 3EUEA 4CT0A 2C2ZA 2D1YA 2P30A 2PA0A 3KJZA 2ET6A 2Q4TA 1Z5ZA 1YE3A 4QM7A 1QC5B 5BRAA 3LQ4A 1NN1A 1VXRA 3JQGA 3PC2A 3G02A 3S68A 2ZI6A 1Z6AA 4YECA 3RROA 4CBVA 3I34X 2BCEA 2GRJA 3PGA1 5E4FA 3DXXA 5IJ0B 3FVRA 3K0BA 4XTRA 1YRQA 4H7PA 4MB6A 3VBEA 2W58A 4LWQA 4TM7A 3ZX5A 1KP9A 2JKVA 3QEJA 1E9EA 1TZ2A 5IC5A 3UJBA 1JXOA 4QULA 3L79A 4OSEA 4ZOLA 2DUUA 4I5EA 2NU8A 2REBA 4CM8A 1ZUHA 3T15A 4B71A 2ZBGA 3TZBA 3ROPA 1A77A 3DQZA 4OQMA 1MB4A 1EZ1A 2J9FB 2V3WA 2C58A 3G2QA 3TLYA 2N3ZA 2IHVA 4MUAA 5FKJA 3EFOA 3AUYA 1SG6A 3E7FA 1RJ9B 4ZMBA 1PVOA 4YDHB 4NARA 3BHNA 2C8JA 4F2DA 3KZCA 2PUJA 3LLSA 1SBCA 1NV8A 3WK7A 3A4VA 2B83A 3UT6A 3DTVB 4DA6A 2HF9A 4LZLA 4B0OA 1R4NA 1ZW6A 4EO7A 1QVAA 1M6HA 3X1JA 2EATA 1I3CA 1YC5A 3NTUA 1CY0A 4BNMA 4GOND 3K0HA 3VDRA 5ITZB 1GHTA 1COWD 3P5SA 4AAYA 2O7SA 5LZ8A 1CX9B 1ZN8A 4WJKB 4MPJA 1WL8A 4F2PA 4YUAA 3OX3A 2EARA 1LV8A 1RAHA 2PJUA 3Q40A 1KZGB 1J42A 2BFOA 3T52A 3VXKA 3R9XB 3RW9A 4I4TB 2QN7A 2XV1A 2G08A 1C5KA 4WFKA 2JI6A 1OTXA 3PXUA 4H0FA 1EA5A 1R27A 4JLSA 4ABYA 5DOVA 1A5ZA 3S2UA 1VL5A 3BQ9A 1L4MA 3PHHA 4LTDA 3F96A 3GYBA 2V55B 3LLMA 3ZWBA 4NMMA 3L7DA 3ZWOA 3MMSA 3NX4A 4XGIA 3UG6A 4QLOA 2VVTA 4D3YA 1XXHA 2QA5A 4U9UA 2Y2UA 4JI0B 1TQ8A 4IMJB 2Q5QA 1WMBA 1KOJA 1QFYA 3KJGA 2I6TA 3BSSA 3TD9A 4EG3A 1E3IA 2B0JA 4C22A 2DERA 1E77A 4L51A 4RSGA 4LXTA 4UAGA 3TTTA 5KUTA 1YA6A 1RZRD 2XF8A 3FTPA 3HLYA 4O33A 5DSXA 3RUPA 2DFLA 1SZDA 1IQUA 2AN1A 2Q07A 1QFJA 2ASVA 1OYYA 3GO4A 3HH8A 1Q91A 5LA6B 3TXAA 3ZS9A 2O0LA 2ERYA 3HL0A 5HG0A 3W6OA 3UYKA 1FUUA 1ZCAA 4RVNA 4RS4A 3E4DA 1HXHA 1XDUA 2AOTA 4CMKA 1ZUNA 2H6EA 3O8QA 4UEQA 4Y2GA 5IASA 3VDMA 2PS1A 3IKTA 1RHJA 1WSAA 2FEAA 5CVEA 4IRUB 2NVUB 2FA9A 3OZ7A 3V2GA 3FJOA 2X41A 5K4HA 1K6JA 2E4UA 2WYWA 3ZWWA 4ARAA 5LSAA 3NGXA 2TMGA 3DO6A 2WHPB 4FCTA 3QKUA 4WNAA 4EKYA 1YONA 3G2HA 1RWNA 3FSRA 4UXJA 1Q74A 5CT8A 3L06A 4L76A 2J5XA 4YCCA 2C99A 2AFHE 4ND5A 2V7XA 1R4ZA 3HFJA 2AFVA 3L8YA 2F64A 1YRWA 1Z73A 2CB9A 4PG7A 3THOA 5FBWB 3RHSA 3WP1B 4AZTA 3FHCB 3ZKAA 3OCUA 3PXBA 2D1TA 2F3SA 2YWRA 3VAYA 2BEVA 2VWHA 3O0TA 7REQA 1QLHA 3N2IA 4X8LA 3GNTA 3PI6A 5H0IA 4HFJA 1FMLA 2QORA 1Y6FA 5JC8A 1IHOA 2HA3A 3DEAA 3JWPA 1Z7YA 2ODNA 3CVUA 2YCBA 3BH6A 3R5HA 4UOQA 3G2KA 3NBFA 3NM6B 3T7RA 1L7XA 2F9FA 1SRQA 2OFOA 3OLCX 2R4TA 4CUKA 3ZHQA 5FAKA 3C97A 2QHXA 5C8YB 3C98A 4KVGA 3V6LA 3ZDDA 1Y8QA 3AUXA 4DLWA 1TM7E 2CFSA 3P97A 4RWEA 3TS1A 4D9FA 2P3OA 4R2JA 2AMYA 2I6SA 1SFRA 2W8BA 4TRRA 5LOVB 2VPIA 4XM2A 2VCEA 2XCRB 3LXRA 4KXUA 1AK1A 4YJHA 2PH7A 4EB8A 3QW2A 2VZLA 1DXOA 1JYSA 1RKXA 2B8JA 2YWFA 1HG0A 5I7OA 3LKDA 3DDSA 3QVMA 4RZ2A 1TJ3A 2LZ0A 3K70C 1H1DA 4JHLA 2PL1A 2CLIB 3KE8A 4GPTA 3QE9Y 1P7PA 3P9PA 5KOJA 1TVMA 3RVKA 3A6FA 1H2WA 1GIAA 4MGKR 3KAJA 2CWWA 5EUBA 3Q8MA 1Q0QA 3E7PA 3UWMA 5AESA 2ZGVA 3GNSA 4Z0PA 2QVBA 4L8WB 4O2RA 4WBNA 5GVSA 2AEMA 4RTQA 2OLEA 3IP6A 1W5TA 4RY0A 1CS0B 3VKVA 4MUFA 1U5BA 4A0RA 1OHHA 3TEFA 1DKPA 1CF4A 1MB2A 4R41A 2G9QA 1NG1A 4H1HA 3D3QA 1VL1A 1POXA 2J08A 4IRXA 4MV5A 1L8LA 3B5JA 1TFRA 1X2BA 4JYMA 3BORA 1G5IA 1T1EA 4XQ0A 3FHLA 3ZJTA 2GBPA 4TWZA 3DLIA 2A9FA 2FRXA 2IXAA 1BE8A 3C24A 4PPQA 5FLYA 4EX6A 1M7HA 3D0KA 1HE3A 4DAOA 3QI7A 1VE1A 1YVDA 3PF9A 1SKYE 3NC0C 4K46A 4HGZA 1VYVA 4TYPA 3PYLA 2WUGA 2XUFA 1XNGA 4F1JA 4DV0B 1WXIA 3G1TA 5ALMA 3P0JA 1UMKA 3OOSA 2G9ZA 3H5NA 4BFYA 2IPAB 4RNCA 2CLDX 3RVJA 2JLZA 1JI3A 1M3SA 1WE2A 4ASUD 1CUAA 4X20A 2POQX 1SXGA 1LJLA 4GGPA 3MWGA 2V4UA 2C57A 4G2NA 3G8AA 2XWSA 4P84A 1Y3BE 2VDMB 4BVBA 1JILA 5JZSA 2JGEA 4M4SA 1K86A 1KMQA 4G0PA 1CNFA 3G0HA 5I9MA 3OE7A 4C14A 2ZXUA 3N8GA 3INRA 3LDFA 1W9HA 3M6WA 4D9CA 2D2IA 3NP7A 4PZCA 1C8KA 5LN1A 3U7JA 1N9GA 5F3DA 1EMDA 5FNVB 5I7VA 2E6KA 5K05A 4QHSA 2WG2A 1FLDA 3L84A 3L02A 3USES 3K20A 2Q27A 2IV3A 4ALJA 4A73A 2J3LA 3KLNA 1D2CA 3LKVA 1WV0A 2ZVQX 4MVJF 3SS8A 3UUGA 3WR5A 2B21A 1WHTB 1XA4A 5BQXA 2B99A 3SBEA 2Y1GA 5AW5A 5T6BA 3BBPA 3MK31 1HDRA 3F2IA 2GPYA 3AF1A 2X2EA 2W2XA 4RD1A 4HR7A 1YDEA 5CIWA 1SUCA 4ZC8A 3QEAZ 1G3UA 1A96A 3H87A 3N7TA 3ZG6A 2CLCX 3PQFA 2O8NA 1SXJC 3H6GA 4L5BA 4MA0A 1H0SA 4WESB 3RIGA 4BN4A 2B98A 4D42A 2P9TA 1PVVA 3PFHA 3PV0A 1XVLA 1FP7A 3A1UA 4UFOA 4XIIA 1C30B 5SYMA 4F91B 5JFGA 4RTJA 2QUZA 2PAAA 2ODQA 1NMZA 2GWRA 4Q7JB 4QUDA 5P21A 4MR7A 4DYVA 4QODA 4CHTA 2JIQA 3EGWA 4BLQA 1G66A 1R0BA 1RI1A 1T10A 1DIOB 3O92A 3QHPA 4HO1X 4EX7A 2CHFA 3E82A 3V6MA 1N2IA 3G5MA 1XN1A 1CQXA 1FDSA 1P0PA 4BX0A 3BWXA 4KTTE 1THZA 4WK6A 2EFJA 1N7HA 1YCHA 4QUAA 2ECQA 4PC6A 5C8DA 2WOOA 4BVJA 3TDKA 4IX9A 4P80A 4L5YA 1FRQA 3FVQA 3DKVA 4B3GA 5D86A 1PLJA 4Z1OA 2QGZA 1TVEA 2DWPA 1LW7A 4J0IA 4JYPA 5B12A 1DTSA 5TJHA 1KTIA 4LVCA 3VR3A 1F6WA 2G09A 3DP7A 4K9NA 1GUDA 5TC4A 5LIPA 1B16A 2ZPAA 1OAAA 4DXDA 3DXZA 3HR8A 4LECA 1NQXA 1BS9A 1E92A 1MO6A 2R1UA 2XOKA 3QBEA 4TUYA 1AB5A 4OLJA 2PFKA 4YC7A 3ZLTA 1E6UA 1G1AA 1V8DA 1XJCA 4KFSA 4WVLA 4XARA 2JGLA 1MH1A 4UM9D 3SC2A 1WBBA 1MN6A 2X15A 3LU1A 2NPFA 1SUBA 2QN3A 3WADA 2VOJA 1HPLA 5K8IA 3RVSA 4OB6A 3OJXA 1FNMA 2HXSA 4IIXA 1OD6A 4JC4A 4OB8A 3AV3A 4DC0A 1KP2A 9LDTA 3SXUB 1WZUA 5FA6A 5BQPA 2GM4A 2XMDA 4DZRA 3F5QA 4HY3A 2XAAA 1HG1A 3HXQA 3I28A 5ALFA 1QFSA 3ADOA 4J7AA 3EFBA 3T7TA 1WPXA 3RAJA 2IVFA 3MNFA 1TU3A 5FBLB 2J7PA 1C2TA 4BQFA 2W2LA 2PUTA 4WNCA 3SYMA 5I9LA 3T0FA 2WUWE 3GEPA 4QXRA 3OM8A 2EG5A 1C1XA 1UC9A 2EC5A 3QU7A 1T36B 2Z5VA 4DF3A 2YY6A 4ND3A 1LDNA 4Q4HA 1LDGA 1QMPA 5A2GA 5K6TA 4PHGA 3RFTA 2GARA 1ZM9A 4OXIA 3VPGA 5DLPA 2BM0A 4ZQBA 4LVOA 4QJIA 3PKZA 3JQRA 3ITNA 2OXRA 3BKXA 3JYHA 3AQIA 2A35A 1VE3A 5FXMA 3Q5GA 4EHIA 3NHWA 5LP6A 3FZQA 3HKEB 5F76A 5TPWB 4C4YA 5IJ9B 1TUBA 4WGFA 1GNVA 4B17A 4AKSA 4YMUA 1E1CB 1NYLA 1J21A 3R3UA 4HTFB 3AUFA 5DNAA 4ZT4A 4XYEA 3SSOA 4LOJA 4GQAA 2FG7C 4RVSA 1LF5A 1RQNA 2OQRA 4NS4A 3MRVA 4I4IA 4DANA 3CF4A 1ABBA 5EY5B 3M5DA 5T8KA 1GOTA 3I39X 4DG5A 2OD9A 5HVNA 2OFWA 5HNKA 2PSFA 3H8JA 1RWBA 4LISA 4HWTA 1D0IA 4QDKA 4QHYA 3FHOA 1DL5A 2A78A 2PKWA 1A9SA 3DEZA 4Z99A 4X60A 4JLKA 1DX4A 3MJFA 4LOHA 3WV4A 4P4SA 3UK2A 3I1JA 1GV0A 2FFHA 3IVRA 3A9SA 4XIFA 5K3BA 3ZX4A 3UGJA 1GTMA 3V7YA 1HDGO 3RADC 3D43A 3ZCVA 4QE3A 5GJBA 1A71A 1HT2E 2NV0A 2ANCA 2OEPA 3L01A 3GVCA 4PLFA 1DEKA 5LYJF 4OYLA 1PQYA 2VK4A 3NM5A 1I3NA 3S2GA 2J07A 1WETA 3PD1A 4JX8A 4WASA 2PKXA 1J9GA 4JC8A 2M6RA 2RH5A 4P8RA 4Q37A 3GA5A 2W2MA 3M6LA 1KMMA 2IH2A 3QG5A 2A1TS 4TT3D 4EYSA 1MEJA 2MINB 2VK2A 4BJ3A 7ABPA 1P0CA 3OEHD 4JH0A 2OT3B 2J09A 4RMHA 4W99A 3RVBA 4KGXA 1XTIA 2J4FA 3IA2A 3PC6A 1CYDA 5HBRA 1RXCA 1IZ7A 2DFTA 3EE6A 4IILA 1P3JA 5EIBC 4ZJYA 5HOQA 1M8PA 4YCNA 3K6RA 2I8LA 4JFRA 2O8CB 1QPZA 2F8TA 2Y1CA 3WQBA 4AF6A 2ZSHA 1WJGA 2XNSA 4EHBA 3JZMA 2GETA 2QW0X 4IGKA 4IIEA 5FP0A 5AICA 2WFLB 1RM3A 4QQ8A 4WK4B 1ZH4A 3S7TA 3LXUX 4XZ3A 3L18A 5BSGA 1OLXB 4L08A 5BT8A 3T6KA 2FN7A 3RHZA 2PZBA 1ZLYA 3X1WA 4BNYA 1ZKMA 4ZKDA 4DA7A 3K4QA 4UCFA 3A6ZA 5ALEA 3JVVA 2V6BA 3KVOA 4KX3A 1OFIA 3D1LA 2X5NA 3PT5A 2HF7A 4RKQA 4LYFA 1XTPA 4CIYA 4JBHA 1CUGA 3HEMA 1QYRA 1TEXA 1QFXA 3OIWA 5DLYA 5H80A 3TE7A 4P3NA 4OK6A 2VSFA 2J0UB 3DGFC 5D00A 1R6XA 3E8MA 4L27A 3LBIA 1I4LD 1SUDA 3OC0A 5EJAA 1W30A 3Q6NA 3H1PA 3TXXA 3T5BA 3GUZA 5HQTA 3IUYA 1DKQA 4P7KA 3QX7A 4ZCIA 4IP0A 3FFBA 3NHFA 1PNTA 3LUAA 3WS7A 1A1VA 2HOQA 1ORVA 4Y9SA 3PJFA 3PJRA 2ZI3A 3ICPA 3GL9A 4N5DA 3AESA 5BOSA 1AMUA 5BWMA 2KSQA 5GM1A 1ZD1A 1OYVA 5A3SA 3PYXA 1UINA 4KGVA 3PEYA 3G0OA 5AHRA 2VG8A 3EVDA 4GU5A 4QJ4A 2BYTA 1KK0A 3ILSA 3F9CA 2ONKA 2WZCA 4MROA 3VR4A 4B3MB 2YASA 2Q3LA 4WY5A 1EM8B 1C9NA 4AP6A 3BHIA 5GONA 1YMUA 3AVQA 3MCZA 3SHQA 3NFYA 2BSAA 3UBMA 2PGOA 4AWAA 1ZJ5A 3GYGA 3RWBA 4A1FA 4U63A 4EI7A 1JL3A 2GTPA 4EHJA 2AHRA 5JRZA 1BVUA 1F0YA 2C5LA 1EFVB 2MIIA 2FKAA 4M6WB 4UE2A 4G5OA 5AKLA 4ZV4A 1J22A 4J1TC 4BVHA 2X9VA 3RJ9A 2MDTA 2BMJA 1ZN9A 3NYQA 3N28A 3H5TA 4NENA 3F49S 3KFLA 2IZ7A 4ZO7A 5BQOA 4ESOA 1RACA 2P2NA 4Q7EA 4XD7A 4NOJA 2LDXA 1PFUA 2ZUSA 3C5EA 4OH1A 2J87A 3HVHA 4EG4A 1N0HA 3WYGA 5GIPE 1X77A 2OB1A 3KKKA 3O9VA 4G1MB 3H1BA 4PYLA 3C14C 2DPHA 4JODA 1NJ5A 3ZU4A 4UXHA 2GASA 4TLDA 1UBRS 4UNQA 1JQBA 2V58A 2JCSA 4XVHA 4LW8A 1K8QA 2EU8A 3CIFA 2NU9A 1YTLA 2HJSA 2QJOA 2QUAA 1TKBA 2OESA 3EGDB 1PT9A 1T2DA 1L7VC 3KTDA 3DNMA 4PAGA 5TMBA 3GJ6A 1RLMA 3WLEA 1IVYA 3SFZA 1I9GA 2ZSJA 4X64B 1ITZA 1NQTA 1OMOA 2XTAA 3DMRA 5ILGA 3W06A 4P7GA 3SYTA 5KTKA 3FCOA 4KN8A 4B44A 4CFYA 4B87A 3BFKA 3KRTA 5JH7F 3DFZA 1NBMD 4BU1A 1ZCFA 1QO7A 1LDBA 3IHWA 1JEQA 2C1ZA 2O5VA 2XB9A 2R00A 2ZB7A 1EX7A 2MSKA 4GP9A 1T29A 5ENZA 1G64A 4WERA 1D2NA 1OH6A 1TLFA 2PH5A 4M1OA 1XPUA 3GP3A 1Q7GA 3L0PA 4K03A 5TXGA 3U9TA 3BB1A 3W2IA 1G38A 2FVXA 1MNQA 4M0EA 3OQMA 1H9AA 4IIDA 1UZMA 4B73A 2QXTA 4UHKA 4WTOA 1Z3CA 3WLTA 3QTLA 4OM7A 1KPGA 1GCGA 3OX1A 3FVTA 4O4IA 4AJLA 3WIBA 3LUBA 4DR4B 3E15A 4ZT5A 4RHCA 1CZNA 5DVZA 3AL3A 2VNAA 4ARZB 4EENA 5IKMA 4LA4A 1PD0A 1TO1E 1QZUA 2VEOA 1UDAA 3FNHA 3KSZO 1TJ5A 1O3YA 2Q4BA 1PJQA 4I4LA 4LRUA 4CTOA 4Q4CA 3DP9A 3B1JA 1QHYA 1Y0BA 2A4MA 3KYCB 1EDDA 3LX4A 1GL9B 3OQPA 4UBOA 1SOMA 3WYDA 1ODSA 4BS9A 1O6CA 1CJKC 3PSAA 4IJVA 4IHJB 2OBMA 5HHTA 5KC9A 1HDYA 3V4LA 3DC2A 4DCPA 1E20A 1BDBA 3L8FA 4UDYX 1KNXA 3E27A 4HKTA 3KALA 4OGLA 621PA 3DZFA 1PWEA 5BSRA 2YZNA 4EEZA 3S8YA 2JJ2D 2FH5B 1XP8A 3HKDA 4MLZA 4Q7MB 1Q0ZA 3DZ8A 2ATEA 5A2QA 1VBMA 3DUFA 3I2GA 4NDNE 3KVRA 4F4IA 4HDKA 3VHLB 3HY4A 2VZ8A 2Q2NA 5KAMA 4XDYA 1YIAA 1I2BA 3OFJA 4IH9A 1Z37A 2YYSA 1B3BA 1Z0IA 2VJBA 1CVLA 1JR4A 3EMVA 4DUPA 1OH5A 1KJJA 1GTRA 4W8GA 1RC8A 3VV3A 5AWFC 1XRQA 2KMLA 4W9NC 3F73A 1A7AA 1Z2PX 2C92A 2JHFA 3R6TA 1LGYA 2IYOA 1QORA 4O4HB 3IKVA 4Q18A 5E7IA 2A9PA 4KNWA 3SJ7A 5BV7A 2R86A 2WUDA 3L8MA 3P2JA 3EVTA 4EI9A 2WT9A 2OAQ1 1IY9A 4YJFA 1JIUA 1W0KD 4AY2A 5KOYA 1E96A 4GM4A 1JLHA 3P9RA 1RR6A 3RIMA 4YIKA 1F9AA 4CMIB 3U81A 1X19A 2LCIA 3MTIA 2PO5A 1VDZA 1MENA 3EHDA 3IGFA 4M9CA 3CNOA 1GG8A 4G5HA 4QTYA 1AS0A 2HNBA 3TAXA 2VQDA 1L7BA 1OZFA 2VYVD 4ETWA 4PEVA 1XFAA 3IR7A 2FFAA 2BMEA 4QUIA 1E79D 1O54A 4N7BA 3C3PA 4JXXA 2JLBA 2YJGA 4OHMA 1P1IA 1U3GA 3LDAA 1N0WA 3I37X 4QATA 4JUCA 4R7TA 3HYRA 3ZZMA 3PEWA 4LOLA 4TZ6A 1QV6A 1DTEA 3HABA 3JAWB 2UUCB 1DWPA 2E7ZA 1OT5A 4PR0A 2DFVA 2OAP1 1D04A 1B00A 1REQB 1BG6A 1NJ2A 2WR8A 4I8IA 4K7JA 3EIUA 2KBEA 4PAQA 1KF0A 4A15A 4S24A 2XBMA 3HXMA 4RY2A 2CD7A 1Y42X 4PSKA 4IUCS 5TS2A 4KV9A 3DONA 3IBCA 4CYMA 1U1DA 3QJ5A 2BI4A 5JRDS 4FOPA 3ZH9B 3KYDB 3U6KA 2RCYA 5IABA 1LLDA 2FVYA 5AHWA 4IW3B 4X1OA 4KQMA 4I1UA 3HP4A 1EA7A 3L7YA 4G0ZA 4LYYA 1QCYA 3HJCA 3VRHA 1ZJZA 3QSGA 3K8YA 3WHLA 2BD0A 4MINA 3QFSA 4CDMA 2ZWAA 3H3FA 2WUEA 4JCOA 5HUJA 4TTAA 4A0SA 3LP6A 1X7DA 4A82A 3AVYA 3ZNQA 3P45A 4CT4B 3HVIA 4MQEA 3VAZA 3F67A 5FPKA 4I4CA 4JU8A 1O87A 1VI5A 2A9VA 521PA 4ACAA 1XZLA 5A5DA 1GFZA 1SXIA 3GFOA 3DZIA 3QXJA 4ZXFA 1KJYA 3JD4A 2ECPA 3WI7A 2JA1A 5AXAA 3IPCA 3DV0A 3MGAA 4K9OA 1Z12A 4BLTA 2P7HA 4BFLA 3C8DA 2G63A 2CHGA 3TW8B 5AKXA 4EW2A 3UJ8A 1OILA 2D0DA 3GJ8A 3PXEA 2R6GA 1CC1S 5F73A 4Z5XA 2VDWA 4G25A 1FIUA 5CBPA 4P38A 1UMCB 4QQKA 3E84A 2F00A 4X6UA 2AJ8A 4NU0A 1SBIA 3CLSD 4IUYA 2DT5A 3JQPA 3KAKA 1PQ4A 3ZPXA 4FGLA 3UAGA 4A0GA 4PFSA 1XDZA 3FAKA 4IOMA 1UJBA 3VZBA 5C51B 4H18A 4I3GA 4TM8A 5CJJA 3RLIA 1XNJA 3DTVD 4Z4QA 4NESA 4ZI7A 2B8NA 1RS0A 1U02A 1K68A 3NNNA 3GD5A 3WGZA 3WQRA 2X1HA 1WLSA 4D9HA 5L7WA 4RTKA 5A4IS 3HG7A 4X54A 1EQAA 1QDUA 3HDHA 4P4LA 1Y6QA 2CVHA 5HQ3A 2O59A 5EWMB 5FI0B 3DAOA 4AJOA 3PFWO 4F4DA 1RM5A 1VZ3A 2XMRA 1SCIA 3IRUA 3M1LA 4DILA 3ZE9A 1N75A 4X00A 3QXCA 5I9BA 4EFLA 5ARBA 1NWCA 2E4VA 1SQ5A 1PDOA 3FSJX 4QU0A 4L50A 3H1GA 2X0DA 4LKRA 1JDSA 3Q8WA 4RADA 5JCOA 3WKEA 4PAOA 1L6IA 2HB6A 3WLPA 3EASA 3IIJA 5BNWA 1C7QA 2XDAA 2BKEA 3K9HA 1PZEA 3O1LA 2I2XB 4M1WA 4UU0A 1K6EA 2ZUWA 4LOKA 4Q9KA 1NY6A 1JQJC 1GL6A 4V0SA 1EUDA 2VQ3A 1RPNA 1C2YA 4AT1A 2BOVA 4MUMA 1DQSA 1X1DA 2E4XA 2O7QA 1UQUA 5D6OA 3QVKA 4MW9A 4RH0A 1JWBB 2AKEA 1KXJA 4FSDA 4QD3A 3MCUA 1GTZA 1MB9A 1N8KA 4L57A 4P98A 2J6CA 4EB0A 3ZE7A 2O3UA 4E5YA 1NUHA 3FTDA 4GI7A 1XZGA 4QDZA 4O0MA 3U39A 1P6XA 4RLQA 2ZRIA 2ZI5A 2IUSA 1Q5PA 3O3CA 2E9SA 4C7BA 1T5LA 1I9CA 3L4SO 4W63A 4EGQA 1UZLA 3FYUC 3I64A 4OMDA 4CWAA 1UEXC 3I76A 4MR9B 3PPVA 4WUTA 2QPOA 5CH3A 1N3LA 4XUDA 3QF4A 2C0CA 3TD6A 4EECA 5GIOE 3HCFA 4I9GA 4JQOA 4QOEA 2JJMA 1QVRA 3IQDB 5HA5A 3AB7A 1X80B 3WDLA 1ORDA 4ED9A 1WY5A 2EFEB 2VHEA 3AINA 3L93A 4BWYA 1XELA 3A04A 3DXFA 4NNOA 3ILVA 4KXXA 5DXJA 3S55A 1ZMOA 5FH9A 3AVXA 1E4VA 2AE1A 2Z95A 3FF1A 2OQVA 5IVDA 1GGHA 1ZNZA 3BGIA 4ISCA 3HMQA 3WJAA 4N8SA 3OCVA 4M1EA 3ENZA 3QEKA 4YJKA 4Y0AA 2ETXA 1PR1A 5TMDA 2AOXA 1SY7A 1AKRA 4RK5A 5ALGA 1F8XA 1S2LA 2CFOA 1OX4B 2ZE5A 1IHPA 4PCVA 5FUQA 3GIDA 1EDEA 5CA0F 1NOKA 3UPDA 3TDNA 4F86A 5HIKA 2R8EA 1HI9A 2A30A 2H4XA 4JUBA 2X8LA 3K8QA 2PSHA 2Z4TA 4IDOA 3I30X 3THXA 1GJRA 4KFTA 2XQIA 1S2OA 1X7GA 2GA8A 5EVJA 1M6YA 2EXXA 4RL6A 5FL3A 5C3UA 3RO7A 4U2KA 3VHXA 1QRRA 1R5JA 1X13A 2PVSA 3EFEA 4NYIQ 4E70A 2X4LA 1AT1A 4Y2VA 4DV3B 1BFDA 3B20A 3ROFA 1VG1A 4RMNA 2GZRA 1M2VA 1VPDA 2V96A 2Z8YM 3TZQA 1A9PA 1EVIA 1N92A 4B8ZA 3V1UA 5HOEA 4YCLA 1OXSC 3BSWA 1HNXB 3K70B 3MWJA 3WGHA 1ZCJA 1AKYA 1Z22A 3CTMA 3LT1A 2PUWA 4MYDA 3KL2A 2WEKA 1J9ZA