3OE5A

Rat catechol o-methyltransferase in complex with a catechol-type, pyridylsulfanyl-containing inhibitor - humanized form
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Molecular Recognition at the Active Site of Catechol-O-methyltransferase (COMT): Adenine Replacements in Bisubstrate Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 70
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3oe5A01
3TKYA 4RTNA 5GM2A 3KQOA 3UJCA 3RW9A 3I53A 1X1BA 3CJQA 5IH3A 5DRYA 3SGLA 3TQSA 5LQUA 1JG4A 5DLYA 1M6YA 1JTEA 1ZGJA 1U2ZA 4IKPA 3GCZA 5K8VA 2NXJA 4P7FA 5DWQA 3KPYA 3LPMA 2PWPA 5EMMA 4RVFA 4DCMA 2GAFA 4PCAA 2IFTA 2IH4A 1FPQA 3KPJA 5CCBA 4QVKA 4P7JA 2JH8A 4ISCA 5EPEA 1NW6A 1X1AA 3R6TA 3BGVA 3KQYA 4KRGA 5K05A 2PT6A 3UWPA 3QOXA 4ZTBA 2AN3A 4OX9Y 2GH1A 1NV9A 1SQFA 2H11A 2C7OA 3FUUA 1NW7A 2DULA 2P40A 3SSOA 2BR4A 4KIFA 2ZLBA 3A27A 1PJZA 3G2OA 3BGDA 3OU2A 4C06A 4RTKA 1YZ3A 3EVCA 3I64A 3EMDA 3KQSA 4BY9E 3NWBA 3ANXA 5DRTA 5E1DA 4YMGA 2R3SA 2Y1WA 1RI4A 2ZZKA 1ZGAA 3DULA 1YUBA 3B7PA 2KW5A 3THRA 3FUTA 4CXMA 4HTFB 2FPOA 5EEGA 2ORED 2EX4A 3CJRA 5EMLA 5EHIA 4PYNA 3B3FA 1RJFA 2PGXA 3CVOA 3MQ2A 2DPMA 2VDUE 4PYKA 4IWNA 3BKWA 3DMGA 3G88A 1V39A 2PX5A 3K6RA 4X63A 3UBTA 2HNKA 2IDKA 2ADMA 3KR2A 4HSGA 3X0DA 5GWXA 3HA7A 4PONA 3E8SA 2ONYA 2IBTA 2PXCA 2EFJA 3EPPA 4C04A 1XXLA 4GC9A 5EC8A 1YFLA 3NTVA 2IGTA 3DXYA 3BKXA 4QQKA 5C1IA 3M4XA 5EQJB 3NJRA 4GC5A 1UIRA 2O06A 2PBFA 3Q7EA 3TPZA 1P1BA 2ZBPA 4RVDA 2ZTHA 4RTOA 4QDJA 4GQBA 2GS9A 3UA4A 2LD4A 3HA3A 3DUWA 4IV8A 2HTEA 5K01A 3FZGA 2QYOA 3G2PA 1G6Q1 1JG2A 4OA5A 2NXEA 4DZRA 2P3LA 3FPHA 5KQRA 5EKXA 3R9XB 1O9HA 1VIDA 3GDHA 3VC1A 3KPUA 5FTWA 5FULA 2UYOA 3KQWA 5EGSA 1YZHA 2IH2A 1TW2A 2GPYA 2PJDA 3EVGA 3BWBA 3LBFA 3MTEA 3A4TA 4LECA 3M33A 1VQ1A 1IY9A 4AZVA 1DUSA 2AN5A 3OZSA 1NT2A 2ZW9A 3BUSA 1Q0TA 1NV8A 3FTCA 2O57A 3AJDA 3KQMA 2FK7A 2AN4A 2UZ4A 2P7HA 2YVLA 3SM3A 1YFJA 3NDJA 3NDIA 4WVLA 4K6MA 3VC2A 3SX0A 3HVIA 3G7UA 5C0OE 5KQSA 5EHGA 2O0LA 1R74A 2OY0A 3AY0A 2IPXA 2B25A 2CKDA 3ORHA 3FRIA 3O7WA 2HWKA 3BXOA 1QZZA 5K0CA 3RIEA 5K09A 2XYVA 1R00A 3HVHA 4XUCA 1FJXA 2K4MA 1TPYA 4E2WA 1XCJA 4HG2A 4YUVA 3LDFA 4DKJA 1G8SA 3PVCA 4QTUB 4C03A 2C7QA 3OFKA 2G70A 5FADA 1AV6A 3HVJA 5EOVA 1DL5A 4AZSA 5DTRA 2BR5A 3HCBA 2ZWAA 2OXTA 4BP3A 1JR4A 1VPTA 1FP1D 3A7DA 5M5BA 4BLWA 3L8DA 3P9IA 4QPPA 1INLA 2BR3A 2P35A 4R8RA 1I1NA 2ZVJA 2QE6A 5ICCA 1QAQA 1NE2A 4YUWA 1ZHFA 3EVDA 2AZTA 1BC5A 3BWYA 1B42A 5HFJA 3UJ7A 5KYGA 1SQGA 1EG2A 3ID6C 5E1MA 3KPVA 3JWJA 4RVHA 5DXJA 3FTFA 5E2AA 5IKMA 3MGGA 5E9QA 4RV9A 1N2XA 3JWIA 3OFJA 2GLUA 3DXXA 4OQDA 3NVKI 2H00A 1SG9A 2YX1A 3CCFA 1RI3A 5EIWA 5EZSA 3SXJA 3T7RA 3EGEA 2JHPA 5HIMA 4BP1A 3TM5A 5GOZA 2UYHA 4HGYA 1T43A 4V0RA 3P71T 2G72A 3LECA 1RJDA 4P7GA 2F8LA 1ZKDA 5FQNA 1HNNA 4YUYA 1NKVA 3C3PA 2G71A 3DMFA 4B17A 4CTKA 5K03A 2B2CA 3A26A 1AF7A 2P41A 4XUEA 2QY6A 4R8SA 1KPGA 3IEIA 4BLVA 3OCJA 2R6ZA 1BOOA 2V7EA 3EVFA 3MB5A 4CWAA 3EGVA 4X41A 1R8XA 3ELDA 3PX2A 4PCLA 3DMHA 1NW8A 4OA8A 2ZSUA 4YUZA 1SKMA 4GEKA 1WS6A 3LDGA 5E9JA 2EG5A 5EKUA 1OR8A 1UWVA 4M7RA 4BLUA 4EK9A 5D1HA 2ZBQA 1G38A 1HMYA 3LBYA 3MTIA 5EVJA 2OYRA 5CIYA 4Y30A 1AQJA 2E5WA 2XVMA 4AUKA 1X19A 3KQTA 4WXHA 3KQVA 5KVAA 2I62A 4F86A 5K0GA 1JSXA 3FPEA 2AOTA 2IIPA 4DF3A 2Q41A 2IDJA 1I4WA 3GNLA 3UJDA 4ER5A 3TLJA 3FYDA 3GGDA 4JXJA 1WXXA 1JG3A 1NBIA 1KHHA 3UJBA 2WK1A 3EEOA 4FT2A 1YF3A 2FK8A 1VL5A 2AVDA 3B5IA 2OKCA 2VDVE 5DM1A 2ESRA 3P2EA 3QOWA 5FA5A 4OBXA 3GO4A 5HIIA 3PLAE 5BW5A 4V0QA 4KW7A 4DM3A 3P2KA 1JSZA 4MTLA 3R3HA 5DTMA 1DCTA 2OO3A 3Q87B 3HNRA 3FPFA 5C9ZA 2YTZA 3M6WA 4UOEA 4RWZA 2ZZNA 2FCAA 4PYMA 3LCCA 5HEKA 1KYWA 4EKIA 4RTPA 2PVCA 2CL5A 3V97A 3HA5A 5T67A 5F2OA 2OPBA 1SUSA 5GIPE 5MHTA 4QTTB 5GINE 4CKBA 4EKGA 2AOUB 3EVEA 2WA2A 4PNEA 1F38A 4KVZA 5GP1A 1KIAA 5FQOA 2NYUA 5CVJA 5B1SA 2C7RA 3KR0A 2VZ9A 5K0BA 3DP7A 3CGGA 1WZNA 2ZBRA 3GRUA 3PT9A 3MCZA 5CUQA 3KHKA 4FZVA 3THSA 1NW3A 1D2GA 1ZQ9A 3BT7A 3NMUF 5E8RA 1EQAA 5LSAA 3HCCA 4C07A 3KPWA 3C6KA 1H1DA 5ICEA 1VP3A 3G2MA 1JQEA 3ELYA 3TOSA 1WG8A 2FHPA 5BP7A 1FP2A 2ERCA 4E32A 5K0NA 5LQCA 3D2LA 4HRAA 3U81A 1XDZA 1D2CA 1YB2A 2JJQA 2GB4A 4AZWA 1KXZA 2PX2A 1RJEA 1X1CA 4P7KA 5E8JA 4EMSA 1IXKA 3ELUA 1P39A 2AVNA 3G5TA 2P8JA 3M6VA 5FUBA 4HGZA 3PFHA 3C3YA 1L9KA 5DXAA 2YUIA 3HVKA 2EJTA 1PRYA 1L3CA 3MERA 4FP9A 2Z6QA 3UZUA 2HV9A 2AOTB 2OB2A 1N7IA 3I9FA 3IYLW 1Y8CA 5CVVA 5DM0A 4EVIA 1M0EA 3GRRA 5FA8A 8MHTA 2WA1A 3OZRA 1SUIA 3FUXA 3PB3A 5T64A 2V74B 3HTXA 2C7PA 3LKDA 5DX8A 1VLMA 3T7SA 4F84A 1G55A 1WXWA 4A6DA 3RODA 1R8YA 1TW3A 3FPJA 3NW9A 4O29A 5CVDA 3TMAA 3UJ9A 3P9KA 4X60A 2PXAA 4CTJA 4ER3A 5E2BA 5CD1A 5CCXA 4PIPA 4R6XA 2BM8A 1KP9A 3GWZA 1O54A 1R18A 4FR0A 5DTQA 5EMJA 4YMHA 3PTAA 1AQIA 5HOQA 5H02A 3DH0A 2AOXA 2NNWB 2I7CA 1VP9A 4PYJA 3LKZA 3FRHA 3OE4A 1ORIA 1XVAA 1RI5A 3B3GA 3KR1A 3EVZA 3KU1A 2AOUA 4KDRA 4YV0A 1O9GA 2A14A 4KDCA 3KQQA 3OZTA 1VBFA 2PX8A 3PFGA 1KYZA 2YXDA 2ZFUA 4YV1A 3HCAA 2P1DA 2CMHA 3UFBA 5LQKA 9MHTA 4OBWA 4R6WA 5DSTA 1KPHA 3GU3A 3GIWA 4H0NA 5GIOE 3REOA 2JHCA 1G8AA 2Z6AA 3GRYA 1QAMA 2P7IA 3DR5A 4E2ZA 5ERGB 3SSNA 3T0IA 2PKWA 4C08A 3QV2A 1L3BA 5DSXA 5FWDA 1JTFA 2EJUA 3HCFA 2CMGA 4PINA 1Z3CA 2ZIEA 2JH9A 4XCXA 2BM9A 1X1DA 2PLWA 3I58A 4PGHA 4DCGA 2AOVA 2AOWA 3UJAA 4LWOA 4Y2HA 3LDUA 3TKAA 2AR0A 4E2YA 1EAMA 3KR9A 2XBMA 4DMGA 5FCDA 3O4FA 4RTJA 5K0EA 5HILA 5EMKA 1KR5A 3I5UA 2Y1XA 3E7PA 3JWGA 4CKEA 3UJ6A 4HC4A 4M36A 2I6GA 3EVAA 3B89A 5JR3A 5U4XA 3EVBA 2G8NA 1JQ3A 3FUWA 3TFWA 5DX1A 3ME5A 3VYWA 2JG3A 3B3JA 4PIMA 4RTQA 2ZULA 2IP2A 3C6MA 3FYCA 1RJGA 3FUVA 3HCDA 3OPNA 3OU6A 1QANA 3FTDA 4GOLD 4QVGA 3V8VA 4FGZA 1BKYA 4X1OA 1UFKA 4IV0A 5ICFA 3M6UA 5LQJA 5HIKA 3T7TA 2QRVB 3LCUA 1XCLA 1FBNA 3G2QA 4PYLA 4ER7A 5LQRA 2CWWA 3BGIA 1MJFA 1Q0SA 2UYQA 3KKZA 4GOOD 3G5LA 1ZG3A 2YXEA 1N7JA 3HCEA 5ICGA 4GBED 2ZIFA 3BWCA 3HP7A 1F3LA 2ZCJA 3LX6A 1SVUA 2HMYB 1M6EX 2PV0A 3BZBA 4DQ0A 3M70A 4G56A 2AS0A 3M6XA 4P58A 3OE5A 3HM2A 3UA3A 1NW5A 1ORHA 5LQNA 2NP6A 3DLIA 4FT4A 3E23A 2B9EA 4E31A 4GOMD 2NXNA 3IV6A 3LL7A 3GRZA 3P8ZA 2VS1A 3OU7A 3LCVB 4GOND 4R05A 4HH4A 2ONZA 4LWPA 3DTNA 4PYOA 4AZTA 2HR1A 2PT9A 4NECA 3VSEA 1XDSA 2QM3A 2YXLA 2VDWA 3BWMA 4RX1A 5D1NA 4E30A 1RI2A 2B78A 5KS2A 4QPNA 4YV2A 2G1PA 3AXTA 4GUAA 4RTRA 3NWEA 5DM2A 4E33A 5DM4A 1I9GA 2XYQA 1L3IA 4F85A 3FPGA 4C4AA 5G02A 3JWHA 3C0KA 3P97A 4LG1A 1XJ5A 2ZIGA 3GJYA 3P9CA 3EEYA 2FYTA 5E1OA 4AX8A 4X61A 3F4KA 4QDKA 2N47A 3AXSA 5FHRA 3EMBA 10MHA 5EZQA 2P3QA 4FSDA 2O07A 4RYLA 5HIJA 3NVMB 4KIGA 5DX0A 4EQZA 5K0JA 3ER8A 1NBHA 3ELWA 2YR0A 3P2IA 4U7PB 2I9KA 2ZZMA 3R0QA 3GRVA 3UJ8A 2XYRA 2P3OA 2GA9A 3R24A 2NP7A 3FTEA 2JHAA 2PX4A 4RSRA 1QYRA 5EEHA 5HZMA 4E2XA 4MHTA 3DLCA 3TRKA 5BW4A 3O31A 3PX3A 1RI1A 3MHTA 2OZVA 5DPMA 5F2KA 2PWYA 1R6AA 5P8WA 1EJ6A 3ERCA 1WY7A 3MAGA 5E9WA 4PYQA 4PWYA 3K0BA 4CKCA 4RTMA 3EGIA 4FSXA 2UYCA 3G8BA 2BH2A 1JG1A 3P9NA 2QRVA 1P91A 2PSSA 5GM1A 3S68A 5EIFA 2NXCA 2YQZA 1KPIA 3KQPA 5T6BA 5F2NA 3E05A 4MWZA 7MHTA 2ZWVA 2OB1A 3SR4A 2BZGA 3CC8A 3LHDA 2IBSA 4GF5A 3TM4A 2XVAA 3CBGA 2OBFA 2FRXA 4PYIA 4DA4A 1MHTA 4MIKA 3G89A 3DOUA 5JUWA 5E1BA 1XDUA 5LR6A 4E70A 4A6EA 4HTFA 3WSTA 4YUXA 4ER0A 3HEMA 5CM2Z 4PGGA 4ER6A 3LSTA 4C05A 4ATNA 4MQ4A 5EG5A 4XUDA 3AWIA 4OQEA 1EJ0A 5BXYA 3SSMA 2B3TA 1BHJA 4QQNA 3CKKA 3TR6A 3H2BA 2PY6A 4RTSA 3LGAA 1L1EA 2IH5A 3CJTA 1IM8A 4RTLA 5LQAA 1EIZA 5K0FA 4Z2YA 5DT2A 5CVEA 3IHTA 5FHQA 3SVZA 4L7VA 1VE3A 5CVUA 3A7EA 4FS8A 1G60A 2Z6UA 1P1CA 4U7TB 4M37A 2PXXA 1D2HA 2VP3A 3A25A 4M38A 3ER9A 4POOA 5FWAA 3MCTA 4RVGA 3SMQA 3GXOA 2O05A 4KWCA 3G8AA 1QAOA 5K0LA 3PS9A 1JQDA 3DXZA 1XTPA 2H1RA
chains in the Genus database with same CATH superfamily
4ZQGA 2IY7A 3KQOA 1RWPA 1UJNA 2VEDA 5DM70 4LEIA 1EA7A 2V5VA 4C3UA 3AB7A 2I9PA 1GVHA 4ZI7B 3AUYA 5CX4A 1JYEA 3WHPA 1XXHB 2Q1WA 2QQFA 2ODWA 4D8WA 4EGAA 1OHHA 2FWMX 3L18A 1JEJA 4OP2A 2GAFA 2J3JA 1JJBA 3RC3A 5C7YA 1TVCA 4B6JA 2LKDA 1OV6A 4RV5A 1GGVA 3OSZA 2H4ZA 4Q4JB 3CVWA 3S2SA 1G0NA 2JH8A 2VPZA 3DWGA 3DZJA 1CY7A 3MD9A 4BIIA 4FWIB 2NVUB 5K05A 4JBHA 2Z04A 3T3OA 5ELLA 5T57A 4GMDA 4IJKA 3AVOA 3W05A 3E2IA 4I8XA 1E79A 2FPGA 1VYVA 3NT2A 1HEIA 4UAGA 4D2IA 4CLOB 4U5QA 4LOKA 3MJSA 2VHJA 4MI3A 5AW9A 3RARA 1VGQA 2A1UB 4LMBA 1E79D 5JYEA 2ZRPA 3W0LB 3R7WB 4BMSA 1N5OX 5IMBA 3EVCA 3KQSA 3Q1KA 4AXBA 2KJQA 4Y18A 2G77B 1X8XA 4HNAA 5DHRA 5DRTA 5FUVA 2OYCA 3T7AA 5ITSA 4RLQA 1TK3A 2DTXA 3PSHA 4IJMA 4JUIA 3GFVA 4TXLA 4CXMA 2P5TB 4FFLA 4IIJB 5GQSA 1E2HA 2JLWA 1DO0A 1NX9A 2XT0A 3HXKA 4PYNA 1MOZA 3EDYA 1W76A 2OVFA 3VTAA 5CEEA 5KYXB 2G25A 2QRUA 3I1JA 1D2AA 2XADA 4U7JA 2GNPA 2PX5A 3UMBA 1FCJA 5C1BA 5H0IA 3E9MA 4FBLA 4QA9A 5E7MA 4KKVA 3K9NA 4LCJA 4BFCA 5BV2P 1RXWA 3MTDA 3NR2A 1YHNA 5F9HA 3GP3A 3ZHSA 1JYFA 4YREA 5KYTA 4NPHA 1DHRA 1CJCA 2ZRHA 3GFBA 2R6CA 1DWPA 3G85A 1NURA 5DNEA 1L7OA 1Y48E 5FBZA 3O8DA 3FNGA 5AM2A 2PUGA 1E1DA 5DEOA 3UMMA 1A7KA 4HMOA 1XAHA 1G2IA 1Y8RB 2C5HA 3LGXA 4KYUA 3WKDA 2ZTHA 1OXVA 3OIUA 2COEA 4QHYA 3K9GA 3Q3VA 2OPHA 4WJKB 1RCFA 1Z0JA 2OHOA 2XMRA 5GZ3A 2F3UA 3O94A 4DMHA 1BH2A 1K06A 1TEXA 1THZA 3MB8A 1RABA 3DVSX 4Z9AA 3AR3A 4YP7A 1E9AA 1UFOA 3RRXA 4BN4A 1AHPA 1GZ3A 2WM3A 3BIWA 3JAKB 3PYXA 4JLDA 5JV5A 5KTRA 3AJ9A 3NKFA 2Y1DA 1QH1A 1VQ1A 3M33A 5ARCA 1CUZA 4AW9A 2XEXA 4GYKA 2VFAA 221PA 3DE3X 4UDNA 1Q3TA 3FTCA 4FXPA 4G4IA 4A2PA 3IMEA 1OFUX 4ZVUA 2HDWA 2R84A 1EFKA 3S2GA 2X5KO 2HPVA 1X1QA 1QF7A 3ZNOA 3SX0A 2C5EA 3WFIA 1XROA 3HVIA 3PF8A 4YEDA 4BKQA 3MIIA 2QPOA 4J1NA 4D82A 1OX5A 4EGQA 1YACA 2SICE 4BIMA 4FI3C 5JMWA 4HT3B 3KXDA 2YV5A 2D1FA 1BIFA 1C41A 2GAIA 5DYTA 3AMVA 5D85A 2ZJ5A 4QOIA 1GPH1 3NANA 4HLDA 5B2EA 1OB2A 1OH6A 4P4LA 2J0VA 4GE3A 1USKA 1PG5A 5A5FA 3EA4A 2GCOB 1BW9B 2C94A 5B2ZA 3RB8A 1MG5A 3A14A 1WUTA 4QNMA 2IXBA 2BGNA 4B3BA 3KQNA 1JAZA 4RNDB 2RH4A 1ZA1A 4PX3A 2M6LA 1R15A 3VU8A 4MVJM 1E4EB 1UBSB 3ETGA 3CCBA 1E3LA 2FXIA 2XRMA 2CB9A 3I6YA 3KKKA 4OK6A 1I1NA 1ZD4A 2QE6A 1NUTA 1R0CA 3BRQA 4QU5A 4CDGA 3OY2A 4AYTA 3C98A 4TZ6A 3DEKA 3S2UA 2C82A 1AGRA 1ZHFA 3B7WA 3WYAA 3AF1A 4U9IS 3VPFA 3ZBQA 1BC5A 4I1SA 1VLLA 2FZVA 1M67A 2HK7A 1N8TA 3GW8A 3VO1A 2B0JA 4BP8A 5HTOA 1D4OA 1IXZA 1MABB 5AYVA 1IHYA 1L7MA 3ZXSA 5CEFA 2VT7A 1YI8A 1ECCA 4HMQA 4AQYB 4GYWA 1OPXA 2OD9A 3WK5A 2P77A 4BFXA 4HNSA 2UYHA 1ABFA 4PFSA 4V0RA 5FWYB 2WRZA 4AAYA 2GCGA 4OFXA 1V5GA 3R9XA 3LECA 1K9SA 3EBLA 4MYCA 1X94A 4TQ9A 1I01A 2HA6A 1TYCA 3RSCA 2EZUA 2HLHA 1CG6A 1LI4A 3GLQA 2ZJOA 4C6SA 1XEFA 2BE9A 2VDOB 3K5PA 2P41A 4FZJA 5JC1A 1W94A 2XJ4A 4LHXA 3IEIA 4FVTA 1Z5NA 1R5NA 2Z5LA 3DA8A 2R6ZA 3LOUA 2DSTA 2V7EA 4RF5A 3T3PB 3WK8A 5K4HA 3CVXA 2A35A 2YHAA 4Q6BA 2R00C 3RSLA 4CQMA 4PCLA 4FU0A 4PLVA 2GCIA 1NW8A 3SMVA 1RJ9B 1NM5C 3CPEA 3EC7A 1GILA 3LDGA 4NI5A 5K6AC 2V97A 1ESZA 3BTSA 2V03A 3UPTA 1KRXA 2IA5A 1C9DB 3MT9A 2EW2A 2J9ZB 4PR0A 3KDPA 4OHRA 4AF7A 2MIIA 1F9AA 3H8SA 1SPXA 1JVSA 1R5JA 5KVAA 4DV1B 1T6ZA 4CHGA 1TYEB 2O1SA 4DF3A 5FOQA 1TMOA 2B92A 5EWJB 1SOAA 3PC8A 4HJRA 2D0PB 3SP1A 3U7EB 4A8JA 1H2HA 1IZZA 3OUUA 5H7XA 3U4CA 3QUAA 3CV3A 1T5HX 5DP1A 3QX7A 2VRCA 3OX2A 1JS1X 4LHZA 4B6SA 1WZCA 2ILTA 5AKJA 2EJCA 2XMSA 1SOMA 3NASA 3THXB 2NU9B 1G8YA 2TMGA 2VRCD 2J4CA 1JKJA 1PF7E 3Q0IA 2FGJA 3K1JA 3THOA 1KZ4A 2CXPA 1T10A 4LQCA 2DM6A 3ND8A 3FBWA 4ESEA 5BW5A 5CXQA 2VQDA 4HLUA 4PSVA 4AK9A 4C7MA 3ILSA 1JHQA 2AJLI 2RHRA 1IVYA 3U6BA 2JFXA 1NJ2A 4A3SA 4N01A 4BQPA 3ML1A 2VQ6A 1QCDA 4MICA 1UT8A 1FXWF 2BMWA 3QTLA 4EZBA 1FP4B 5GIPE 2ZVDA 2A3NA 4RMGA 1JEYB 1KKMA 4HD8A 3RYHB 4WA7A 3U48A 4J1TA 1FMJA 5LA6B 4A0FA 3LC7O 4PZLA 4YT4A 4XTRA 3N0XA 4RVCA 5D3ZA 1E6LA 4TWRA 2GO7A 1M8JA 4NS4A 2ZBRA 4EY7A 3PT9A 1FUYB 5G4KB 4QQFA 2Q3MA 3BD7A 3M7IA 2QX8A 4JL6A 4BVJA 1MNAA 4AJPA 3GARA 4NBLA 3PV0A 2KWIA 1HE5A 3TOVA 1M1YA 5B4VA 3C3CA 3H7AA 4NYJQ 3U17A 4RO0A 5BP7A 1NUAA 2Q0SA 3NV7A 3H9JA 4TLLB 5K0NA 2C3MA 3D7LA 2QN3A 3LS2A 3VI4B 1K6XA 1WWKA 4PGFA 4XIGS 1L5QA 4GI1A 3ZJYA 4J6FA 4HGQA 1MF7A 4BNNA 4Q7JB 5LQDA 1HLPA 1BWRA 4KIJA 5EJ7A 5K6AA 4C2BA 1RXUA 4ZO9A 1TCAA 5I7FA 2WFZA 2ZDQA 3EFOA 4A36A 4XYLA 1V1MB 3V55A 3C43A 3VUFA 4N8SA 3AHGA 1RAIA 4FFPA 1E7MA 1RPNA 3MCVA 4JP5A 4EPVA 1OXKB 5CNJA 2A94A 9LDTA 5IWAB 1C30B 1EWVA 3U7HB 2Q27A 4ADSG 4EI2A 3BFJA 4EVIA 4MEJA 2XDWA 2IS4A 4ED9A 4UVEA 4BVBA 1GLVA 3L8CA 3W5UA 3TCKA 1K8QA 3BOSA 1VLMA 4WUVA 3DFFA 3RHSA 1UDAA 2BHSA 1ECBA 4MIOA 3QE4A 4UFOA 3DL2A 5CHYA 1JHZA 3ETNA 2X3UA 4WXMA 4UPEA 4RK7A 4MO2A 1DEXA 1DIAA 4JKIA 4BFSA 5LZ9A 3IP9A 4FR0A 1KY3A 4EARA 3TEMA 1AQIA 4ND8B 4WCDA 4KQEA 1H2ZA 1C14A 1H65A 4FLMA 4ZQCB 4DNQA 1QFJA 1RU3A 2J9FA 1FSZA 2O50A 3PGVA 5KPJA 2ECPA 2QPAA 5LWQA 3KU1A 2IYLD 3GEBA 3MD0A 4WNCA 4WFJA 1UM9A 2A14A 3KQQA 4LJ9A 4UJ3A 3KRTA 3L4JA 1WXGA 2P78A 2YXDA 4RNCA 1KYQA 3JZIA 3QVTA 1CDOA 4MGKR 4H31A 4HNHA 4CU5A 2CMHA 2HX1A 2Q49A 2CYAA 3OP4A 2WT9A 1ECPA 2QSUA 3NALA 4R6WA 1C7ZA 3E58A 3NXKA 5I51A 1PNTA 5L51A 1Q74A 5BSFA 1G8AA 1XZFA 2H7YA 1JU9A 2A5DA 1H22A 2ZB7A 3OFNA 2QT1A 1IXYA 1Z5VA 1WE2A 3VR3A 1LA2A 2EX1A 4DPKA 2QTCA 3FMIA 1E8MA 3NTRA 1KRHA 3HCFA 3OT1B 3I9JA 4P3PA 3AR8A 4WZ6A 2DJ5A 2DGDA 4MKHA 1BTOA 4KFUA 5F12A 1NVVR 1B8NA 2X0RA 2Y66A 3W9UA 2AOVA 2V8BA 3C7DB 1NJGA 4PLCA 3PNBA 2II6A 1GL3A 2P9QA 3I1IA 1E3QA 2XMQA 2DT5A 5I4KA 3W6OA 2WOOA 1VIAA 4KB5A 1USVA 1QVZA 5CIWA 3R4CA 3EVBA 1RIIA 2F55A 5FI3A 3A10A 3B3JA 3L4EA 3RS8A 3U0BA 5A4MS 4K3VA 3OPNA 1RQ7A 1D8TA 4NG5A 4UJ5A 5AKGA 3WA6A 2AD5A 3V8VA 3VKWA 3NUQA 3BXGA 5ALOA 4EI8A 2O8EB 3DEJA 3X44A 3M6UA 4JR1A 1GGEA 3H05A 4MW7A 5HQTA 3OHPA 1SM4A 2JS7A 2OV8A 3GJZA 3LCUA 4Y3UA 3UMFA 1SH7A 5E3JA 3BGIA 1Q0SA 5D51S 4DDUA 1QV6A 1V1JA 2YXBA 4HX9A 3ZIAA 2Q6VA 1T1GA 1SPBS 4XJSA 2X76A 2X8WA 2DC1A 1G21E 2F62A 2C2MA 3ZIAD 4P58A 1PFGA 1PZMA 3AUKA 3LQKA 4IO0A 4QULA 3W5SA 4D9MA 4IFBA 5KNCA 1ORHA 4CT5A 2P6NA 3DLIA 4HDRA 3C8MA 4D81A 4IIEA 1V9LA 3LCVB 2BLNA 3KB8A 2A86A 4FEYA 4JEHA 1KAMA 3HSYA 2QMEA 1QHGA 4HNGA 5FBHA 4L3OA 3WLFA 1Z0KA 4CNQA 4E15A 2J07A 2OM2A 2CDCA 2HT6A 1A27A 1SU4A 2C4MA 1ZRSA 4BXOB 4BNKA 2N1MA 4YVFA 5SZJA 5F5LA 3TW8A 4YAUA 4WK4B 5FI5A 1D0IA 4IH9A 5AKEA 3ZHBA 4FFSA 3UT5A 4F5YA 1J4AA 1E6CA 1I9GA 1PUXA 2Q7OE 4BMDA 2I1QA 5G02A 4E5KA 5ADWA 3KLNA 3ZTYA 4U0KA 1G2OA 4QBKA 1J1IA 4TVOA 1WP4A 3SD7A 5HOEA 3TWOA 3MJRA 2V6IA 1PR1A 1KI9A 4MVJG 3A6EA 3HZZA 4KSCA 3TX2A 1V5EA 3HYLA 5K0JA 3BF7A 3KT8A 2EOAA 5B7NA 3P2IA 3CEPB 4ZI7A 3QGMA 621PA 3L0OA 2ZBFA 3GI1A 1ZGBA 4MSUA 2OGZA 2VEOA 3E3AA 2PX4A 4G0XA 4JVSB 5BN3B 3T7CA 1N8KA 5FUYA 4FYYA 3TTSA 4GGMX 1MH1A 3V34A 4HWTA 1R6VA 4Q4JA 3T5CA 1QK5A 2GHQA 3RQSA 2H57A 1AXEA 3D8UA 3H1EA 3HB4X 3NWOA 3LC1O 4IRMA 2D3TA 5G3YA 2A57A 1ZBQA 3H16A 1U9CA 1D9XA 2OBNA 4JLWA 3H3XA 2O2ZA 3RV4A 4D9IA 2A2ZA 2DKOA 1EWKA 3GBSA 1U2DC 4PWYA 4AZ3B 4K03A 1R6TA 3F7MA 4RQAA 1NRJB 2OO5C 4Y0VA 4RZXA 1LLQA 4Y1FA 3SS7X 3T52A 1JG1A 3TLYA 4CLOA 1M6WA 4UTVA 3HFSA 3EODA 4ZVVA 1E9DA 2A1UA 1ZI8A 3DZIA 1QG4A 2ZWVA 2DFTA 3ABSB 4J4TA 2WMOB 4RGYA 3WP1B 3IXQA 1BVHA 4BO7A 3T4UA 5TEVA 1ZM9A 4K9PA 4ND5A 4ZARA 5CFZA 2WD7A 1TA4A 2WQZA 5EJ6A 1RXCA 3L7JA 2CUKA 1JKXA 3IPCA 2CUTA 3TW0A 4OH1A 1EXMA 3ZCVA 3PCRB 3CUSA 3WGIA 2G63A 4COKA 1M74A 5J4VA 3KBOA 3PWTA 1QCYA 1RYYA 2OCBA 4X1KB 5GMOA 5AK4A 3DWEX 3B2QA 5F2EA 2IV3A 2HRCA 2XLCA 3FSGD 4KR3A 2C5FA 1OJLA 4D99A 4YY3B 4EEZA 1ZGCA 2L18A 5DIFA 3TVYA 3KALA 2X4LA 1OXUA 5CURA 5DT2A 1C8VB 5EMNA 2BUCA 1TZKA 1TT5B 1YA4A 3A1VA 4N0MA 5CT6A 3U3OA 4C7VA 2R96A 1Z8DA 1R0KA 5LN1A 1QRRA 4KQFA 4R4JA 1L5OA 4ZJUA 2YV2A 3WNZA 3W4KA 1D1PA 1EFTA 5FUQA 4WFKA 5AI5A 2ENUA 2FZCA 3EA0A 3M3PA 4G41A 4O0MA 4ICIA 4Z4FA 2SKDA 1KZ9A 4L73A 4RD0A 1CETA 1J21A 4NZ9A 4QATA 4MINA 4QRDA 2VYFA 3IS3A 2H9AA 2L19A 2W70A 1EK1A 4HBGA 2NPFA 3H2YA 4RTNA 1U3VA 3CLHA 3AI2A 2XRYA 3UXEA 3FDXA 1Q2UA 2DBYA 4MGEA 3H13A 2XOEA 3TQSA 5BRAA 2P27A 5G53C 2VI5A 4RHTA 3HN2A 4EF6A 5JVDA 5EAIA 2X3YA 1D6NA 3PNMA 3KPYA 5KNBA 1ONOA 3FLMA 2QD5A 4OGKA 3OZIA 1MDBA 2IFTA 3TAXA 3FHOA 4W8GA 1EINA 5EJ2A 2YQ4A 5E7JA 3KPJA 4G1BA 1OIWA 3UT0A 1P2TA 1RQLA 4HNUA 4NDZA 2Q5QA 4YCJA 4LC9A 1T91A 5KVCA 1HEYA 3KQYA 3ET4A 5CLQA 4CKCB 1XZHA 3C15C 4JI1B 1ZITA 5FAXA 3TMYA 3UO8B 5JAMA 1WUIS 1Z2DA 5MFZA 4UVHA 1P7WA 4KJZA 4BBPA 3TD2A 2Z8YA 2MJLA 4R84A 5AWFC 2NZYA 3G2OA 4C4OA 4EW1A 2O8FB 3GYBA 1VSUA 4MX8A 4U8HA 4C06A 1JI3A 3EX7C 4BY9E 1EI9A 5DBIA 1FX1A 4EAAA 1T9BA 2Y4OA 3L04A 1NNUA 3BA6A 4NF2A 3RIGA 1A4IA 2EG9A 4QTZA 3THRA 2YVKA 2OVBA 4L6AA 4ARBA 4WOKA 1NKTA 3PUIA 3UWDA 4BU1A 1FTGA 3MTAA 3WMRA 1HT1E 1FQOA 1M7BA 2Y1KA 5KWVA 3G1TA 4YGYA 2EGUA 4W7HA 4NCJA 2DPMA 5CFMA 2WB2A 3U5TA 3WMFA 5ITZA 2G9VA 3OZAA 2BMFA 1KJIA 1MNQA 2IDKA 1VB3A 4QNRA 2OK8A 2VK8A 3E8SA 1MP0A 4K46A 2WTAA 4NOKA 2ICAA 2HQ1A 2R79A 3FX2A 4Q48A 4UUOA 4YO7A 3JTEA 4QPZA 4ENSA 2ZSKA 3OIGA 4KR0A 3HO8A 2JASA 3LVRE 4TXNA 5IK2A 3PE3A 2CJFA 4M0KA 4EJFA 6REQB 1Q1GA 1HH4A 5A04A 1CS0A 4EHLA 4YHHB 3Q7EA 4Z8XA 4BMCA 4EYOA 3DTYA 1XEWY 1F1BA 1G5IA 5TV2A 1U0SY 2Q1XA 5ALVA 4D9KA 2BLLA 2ONJA 3EXIB 5JQGF 1U6JA 1IUKA 1C7QA 1KI8A 1ZD9A 2WYVA 3OIFA 1UJ5A 4AIRA 3VPBA 4IHJB 1XRLA 4F2HA 1SG6A 4D6XA 5HYVA 3OICA 4D4MA 2NN3C 4MOWA 4BLPA 2UYOA 1QVVA 4GUDA 4JDUA 5JIBA 1D2RA 2B1JA 3N86A 1HTTA 1SC9A 3IPLA 2QLFA 3N74A 1D1TA 4JASB 4QXPA 4XIYA 3JYNA 4BL5A 2IUTA 1C1YA 3ADKA 1V4NA 2GD1O 2FK7A 4OO3A 3GR6A 2A4MA 1JEAA 3GJQA 4K6MA 2AV6A 3OLXA 2Q8PA 1KQFA 4MI6A 1Z4MA 3PDHA 4LZNA 3IQZA 1LBQA 1L7XA 2CC2A 2I2DA 1WNTA 1R74A 4KXYA 5JCJD 1WHTA 1JDPA 3U31A 3ORHA 2IPXA 1JP7A 2Y6VA 2CBXA 1TEHA 4WK2B 4Q9IA 1XA0A 2HXYA 4B45A 3OOEA 1QKIA 1CUGA 4KPGA 3R9WA 3NVAA 2HCFA 2ZUCA 3GNQA 2E3JA 1LPAB 2C7BA 1Q1AA 2G4LA 3KSUA 3RIEA 2XD9A 1EWRA 4C6TB 1D2MA 4YRGA 4QVIA 5AQ1A 3BMOB 1ML3A 4RPKA 4Q1FA 4X90A 1GZUA 2A33A 2IT1A 1UCFA 3DE5X 2ORYA 3EJWA 3Q85A 3VVBA 4Z5XA 1BDHA 1PTJA 2QZZA 3PRJA 2PK3A 4P4UA 1SVIA 3A1TA 3HVJA 4HYEA 4RD2A 4UBJA 5DTRA 4AZSA 4B47A 3THXA 4RUKA 3RSSA 2ZUDA 2ISCA 4WXYB 1EQ2A 4BLWA 2BHTA 2XKJE 2WV9A 5JTUA 1F48A 2PWZA 2W6NA 2ZB3A 2PTGA 4RY9A 5EJ9A 1OOEA 1T6NA 1NF8A 2QW1A 4BLVA 5K3OA 2UYGA 3WL3A 4AROA 3AK4A 1E7RA 3TGLA 1B42A 5IAGA 3BF8A 3CU5A 2KE5A 1D1QA 2GWHA 5JCXA 1RYZA 1ZH6A 1WTCA 2C77A 2X9VA 4ODIA 1SBCA 5GONB 2NSYA 3RYHA 3VPGA 5IHXA 2O54A 2ZUFA 2JEOA 3C24A 4DPMA 3BD9A 2NPOA 5JDCC 2B34A 3A37A 3OQHA 3RVSA 4C3VA 4BNDA 2G72A 3COYA 3HL4A 3PPYA 2PBZA 3PUXA 1S8FA 3JD3A 4G0ZA 5ENDA 1RAHA 3AM1A 5B6PA 1ACLA 4IH4A 3BZWA 1X7GA 2A30A 3LUFA 5CFNA 1DQPA 1M9NA 4QGAA 4EVSA 2ZTSA 3RSFA 4DNXA 4CR7A 4MEAA 3IURA 2JA2A 2WYWA 1L5GB 3WFJA 1IEQA 4XI9A 3A31A 5CPBA 4LJ5A 4QDUA 2IHKA 2ZRLA 3NKVA 2P75A 4CWAA 4X3OA 3EGVA 4XWOA 1L8LA 1RRCA 2VT3A 3OUTA 3WQHA 1G0OA 4GL4A 3CMMA 3AGPA 4GPAA 4CLXA 4S24A 4MV3A 4ABYA 3B85A 1Q92A 4F71A 3NDBB 4UHFA 5JYDA 1L5RA 1BH6A 2G5PA 3PR3A 5AJZA 5EIOA 2CNWD 3KQVA 4L7QA 1USWA 3UVEA 4A6PA 4DBVO 4Z51A 1IK6A 3PI7A 3SFTA 1P19A 4D8XA 2Q41A 4LJ4A 2VF7A 5DISB 3FSRA 2QPLA 2AEMA 1U1DA 4HGPA 4CMAA 4P0PB 2O20A 1NBEA 1Q17A 2ID8A 2X19A 4TWAA 2YQ5A 4QSHA 2FWIA 4DSNA 2W5UA 2WTUA 1ZK3A 4HTAA 2POCA 1SRQA 4W5HA 4AD8A 1PI3A 1W0JD 1WR8A 4DAEA 2PYZA 2YC2C 1NPYA 4OBXA 3RF7A 3PFIA 1PDOA 2ZJ4A 1NI5A 2QDKA 4KW7A 1ZU5A 2C0PA 1H85A 2MOKA 4ZI2A 2IE8A 4N0EA 3VPSA 2OO3A 3NBXX 1SVKA 2QRPA 2C78A 2Z43A 3IDAA 5IZCA 5TARA 3O8NA 2ZZNA 4Y2GA 4GMGA 1S1MA 5COQA 5A5EA 1GGJA 2PVCA 2ZUTA 3PUZA 4NWIA 1PJ4A 5D7BA 5F2OA 3FJ1A 2H16A 4JC4A 2ZEJA 3I6MA 2H1SA 2OPBA 2Q2VA 4IUDS 4FBGA 4LJLA 4CFSA 1GD1O 2I6SA 2YJ4A 4CL3A 3UUFA 2LIPA 3KBBA 3V1NA 3B2NA 2YL2A 1F38A 2QUHA 2WWFA 4BO6A 3TX6A 4L15A 5JPIA 5GVRA 5ILGA 2HKIA 1HZZC 4JLAA 1XK6A 1MJGM 4UXJA 1PBNA 3X1ZA 3R3VA 3U13A 1FTSA 1O94C 1VPEA 3KHKA 4GH5A 1CV2A 2M6RA 3E1SA 4JSYA 4PC2A 1WY5A 2O8CB 5LSAA 1JIKA 4YMWA 3CLUD 1LFDB 4MW1A 1DBQA 2YIDA 1L4BA 1FYFA 2FKNA 3JQDA 1K6MA 3DOJA 3OT1A 2N42A 2W83A 3OEHD 5JRJA 3LLSA 3KWLA 3O2NA 3Q1LA 3LE8A 5ALWA 4E03A 1WG8A 3W9SA 1W25A 1PJRA 4DWVA 3WL7A 5EIEA 2QMZA 1U3TA 4U7FA 1D2CA 3OVMA 5GY7A 4Z54A 4TV8B 3B78A 2O7NA 4MUBA 1JKIA 2VYVD 3B1XA 2QZPA 3F6CA 3FKSD 1ODKA 2QN8A 3QWAA 1I4TD 1RWKA 5FUBA 5JCOA 1BMTA 1B1AA 3HLYA 1KYYA 4CPDA 1ZMOA 2YUIA 5BN1A 4TYWA 1WTAA 2V45A 2OO5A 2VL7A 1L3CA 4PTLA 2OZLA 3CXUA 1GCOA 1I6WA 2P2LA 3ZE7A 4NEHB 3PFBA 1Y8CA 1I0LA 1YL5A 4ZFNA 2O8EA 3DQPA 4U2KA 5DWDA 2GARA 2P62A 4L0DA 1LW6E 2AHOA 2GCNA 2D4HA 3KTOA 4LY0A 5ED4A 3UCFA 4G1EB 3VZPA 3N70A 4ZU3A 2C5LA 4DGQA 2QUKA 1YS6A 2TMYA 3V8RA 3CE9A 3F7TA 4A6DA 1BRTA 1SG0A 4IJVA 5TGZA 2PMEA 1OMOA 2PRKA 4Y6OA 3SZRA 4WY2A 1EFAA 1E2DA 2W22A 2OA0A 4CTJA 4TMKA 3LNTA 2J9RA 3EGXB 4AJ2A 2BJWA 4CKXA 1GTMA 5JS8A 1U5AA 5IAKA 2J6CA 3GY0A 3PF9A 4KIWA 4LTDA 3I72A 2DUJA 4OQZA 2F43B 2YWHA 1I3KA 3B3GA 4OGGA 3OLZA 1DC8A 5AI4A 1PT6A 1D4FA 3DV2A 4HYYA 4OKIA 2RGNA 2YICA 5JALA 3OM8A 2HSDA 3QW4B 9MHTA 4K6KA 1VMEA 3DAYA 4DBZA 2QXYA 3OE7D 1BGVA 4Q9DA 3DOHA 1SOVA 2A9JA 2B8WA 1ZNZA 2OXCA 2VDWB 4MB0A 4BNTA 3BMXA 1CUCA 1SC1A 3PLNA 4QXRA 3A0RB 5FRDA 4H0FA 2FSSA 4DHWA 3A9CA 3H5AA 5GVSA 3SSNA 5DM4A 3RPEA 2VSQA 4ZDKA 5DSXA 1PV2A 2JW5A 1PR9A 2RI0A 4TYNA 1KRWA 4FN4A 4D41A 4ZT7A 4EYQA 5AUPB 3HVUA 1T0JB 1PZFA 4G3XA 1B23P 3GH1A 1TXGA 1PYDA 4GX2A 4HNRA 4NPCA 3U7RA 3L0PA 1D5CA 1U0GA 4FDMA 1PL0A 4PN3A 3LUBA 2E48A 2HF9A 5TF0A 1IYZA 1YBVA 4FGUA 1Q84A 4J6EA 3CFYA 3L84A 3MZ0A 4TL6A 4YLEA 5KPDA 1Z68A 3E7PA 1VYTA 2UXCB 2NP7A 3T9EA 5JD6A 2KMLA 1KJYA 5JR3A 1V4BA 2HMAA 3F71A 3FDJA 1K6JA 4B2LA 3QVJA 4AZ3A 3P9XA 4S05A 1J2UA 3K0EA 1Z37A 3B6KA 3IB6A 2IP2A 4ZEMA 4YRMA 1FSSA 3QXJA 4I2NA 1KC3A 1WF6A 4E5SA 1F8XA 4EG6A 5THKA 2ZBUA 4RZ2A 1EEXB 4M1KA 2B1RA 3GVIA 1F0PA 4TZTA 3ONFA 1ONNA 3DDSA 1VKHA 2BHLA 2O2IA 1GPLA 3TJMA 3IMCA 4JH0A 1W85A 4QYIB 4YQYA 4YMUA 4O8CA 1F7UA 3X3HA 2UZ1B 3B1JA 3JAMA 1THGA 5I7EA 3CQ9A 3D7MA 3ZIDA 4XGNA 4TRMA 2NUPB 3WWDA 1XVTA 2Q5HA 2ZKIA 3U40A 1FFXA 2AG1A 3MBIA 1MV5A 2ID7A 4ZQBA 2HHHB 3G2IA 4KMMA 1X38A 2OLJA 3E23A 1ADJA 3MBKA 4C5BA 4XVUA 3DZCA 5I3ZA 5LDDC 3ZJUA 2VS1A 5HWSA 4QBGB 4ZVLA 2QY9A 3BYZA 2IZ5A 3ZKWB 3L6OO 1XZCA 4KR7A 1DELA 4OU5A 1GZ5A 3N9IA 4D8VA 4JVOA 1DAFA 3D64A 2YXLA 4TS4A 1P9NA 1OCEA 3DFZA 4OXKA 4XM0A 3W2GA 2VIIA 5KS2A 4JIMA 1K3FA 4D4KA 1C1XA 1GQYA 4PQRA 4X62B 2XYQA 1G8MA 4YPVA 3WQBA 2FEAA 4ZT3A 1DTSA 5B64A 3DE2X 3THWB 3P9CA 5AHWA 1RM4A 4G81A 4AX8A 4MVWA 4QXQA 2V98A 3VTFA 1SD2A 1GXSB 1P2BA 4FSDA 1J8QA 2O07A 1H6BA 3AUTA 4RYLA 5CLIA 5CH5A 3UJNA 3X2EA 3ER8A 2FFRA 4DDTA 3PQ8A 1OI4A 1OH5A 5ADVA 1LZKA 3VAYA 3KP1A 1E6KA 1XCPA 3OBBA 3KE9A 2EP5A 1L4LA 3QYJA 3R24A 4JL8A 4KLCA 1NC1A 4YI3A 3WGQA 4BMYA 5KSYA 1OFGA 2YWRA 3L77A 3GCXA 1A77A 3WYBA 4F06A 1M34B 3TI7A 1RI1A 3LX8A 5CJ2A 5FR1A 3ZOKA 5KNDD 4DN6A 2HK9A 4LS3A 4UBOA 1OZ0A 1HE4A 1T2FA 2W2VA 1LDBA 4MUNA 4FJ1A 3FYHA 4X3PA 4YT5A 3CEAA 1JH8A 3T41A 4CKCA 4POAA 1F2VA 1HY3A 4G67A 4E1BA 3PHHA 2JFGA 4QICA 2IPAB 3VBEA 2WJPA 3S68A 1UXJA 2YW9A 3WL4A 1KPIA 4J7XA 2QJOA 2O8FA 2DBZA 2JGMA 5F7JA 5BOVA 3QPWA 5EXPA 3FVVA 3HUTA 1V7CA 4GF5A 4WADA 3RSZA 4HGNA 2N9UA 3ZK9A 3AHCA 3NUZA 1JG6A 1U2PA 2GFHA 3N3BC 4BC1A 5IDWA 1BFDA 1HWYA 3BDAA 5TB5A 2DTDA 1CJVC 2WIGA 5JUWA 1C9KA 4MWSA 3HLTA 5HIAA 4XR4A 2XNKA 3HEMA 4Q0MA 2ORVA 4GSLA 1Z6PA 4KLNA 4K28A 5HE9A 4ATNA 4B7ZA 3AIMA 1ZEMA 2VPQA 2EGHA 3PSAA 4QRHA 4ARCA 3EF3A 1T0UA 1N3YA 3NJ8A 3D6FA 2RGGA 1YIOA 1E3WA 2DUNA 2WNSA 2YYZA 5FYQA 1AGXA 2EWWA 2GX6A 2C00A 3IHTA 3HR4A 1HA3A 1RE1A 2BP7B 1TL7C 2JGAA 4L7VA 5B3AA 3G8YA 2H29A 1Z0SA 4EHIA 3WK4A 4CL0A 2C8VA 3JQAB 1G60A 1BVRA 1NUQA 3QEJA 1K0FA 4U7TB 4Y2TA 1ESNA 4EHBA 4FZ5A 5AVRA 4UE2A 2Z6UA 1GOTA 2WUGA 3UKJA 4K6CA 1Y5NA 3ADOA 4G4GA 4LXQA 3TQHA 1ZHOA 4N8EA 1MX9A 5JDCA 4GR9A 1G18A 1QPZA 1GJRA 3PDUA 1US8A 3SMQA 4KWCA 4OL9A 4CMCA 2R9VA 3WGHA 3SC3A 1AKQA 4JUAA 1L9KA 3TR0A 3RW9A 1JJ7A 4KR9A 4IHJA 5DSZA 2QN2A 3RVQA 4ZAFA 2F59A 1E3TA 4TTQA 3C7TA 5K6RA 1JG4A 4RV4A 2EFDB 2I2BA 1R12A 3BIXA 2OAEA 5FI0B 1T4MA 3I5AA 3RAJA 8AT1A 2VAPA 1JJAA 2X2EA 3WV4A 2JJMA 4CGZA 1MH9A 1SCUB 1UPAA 2GZDA 1ZQ1A 5EPOA 3RWMB 2JCBA 1UIMA 3QNWA 1K8XB 3QJ5A 3TEFA 4BO0A 5F78A 4MITA 3GN1A 2ZBVA 3D0QA 1SKYB 3ILYA 1EAYA 1HE2A 5MGBA 3PQ4A 3UWPA 3EPJA 1ODIA 2QQ0A 1L4YA 2XGSA 3EA5A 3AB8A 1ZD2P 2I6FA 5JS2A 4ZQIA 1KIFA 1WKVA 1SQFA 1TECE 2JVJA 3I12A 2GOYA 4U02A 1HKUA 1DIRA 1DUIA 2CE7A 1T3SA 2VNIA 4Z4HA 4DDHA 3VZRA 5KI6A 4BYMA 1XR3A 3VSCA 4C6TA 3B6MA 3EMDA 4OMFG 4AJIA 4YDQA 1BAPA 3NHSA 2BD0A 5T3UA 1QP4A 2YBEA 4TYPA 2H1HA 1CR2A 5IC6A 2B2XA 1WULS 1R0XA 1N1MA 2YIVX 2JIZA 3G9XA 1X77A 4RAOA 4REMA 5CNKA 5J2TB 2Y1CA 2XR1A 2OE2A 1TA9A 4Q9LA 3CLTD 1ULAA 2IYVA 4DLYA 2GFQA 2WSIA 5FL7D 5LP6A 3BKWA 4F5ZA 4ME6A 3C8DA 2PGDA 5JNWA 1Y9AA 3BL6A 2IX9A 4QL3A 3I6BA 4QM7A 1FA9A 3MBOA 3PDJA 4M0LA 3S2FA 1TYAE 1P44A 3U7IA 1NW4A 2GASA 3WGMA 1R9MA 1XXLA 4Z9YA 3DYVA 5GONA 1BXGB 3QPVA 5C1IA 1PEKE 1LVGA 3NJRA 1R1DA 1UIRA 5BNTA 4V1CA 3LP5A 2HSEA 3WLMA 1WB5A 4E2FA 1QTRA 1SUDA 4WBNF 1E94E 1A97A 1H6DA 1F9EA 3OZWA 4I8DA 1O87A 1P1JA 1O94A 3HA3A 3DUWA 3ZKAA 3AZQA 3BA1A 2G08A 1BXRA 4DY6A 4J49A 3IKJA 4XB6B 5BSVA 4OYYA 5CYGA 1SELA 1F1JA 2C1XA 1UKVY 3HBAA 1W9HA 1L0BA 5F51A 3TPFA 2PJDA 2JZCA 2QK4A 2VP2A 3A4TA 3KK0A 3NYQA 2E1PA 1QUEA 421PA 3R6WA 2AN5A 3E82A 1EFLA 1HPLA 2GJ9A 5EE9A 5IJAA 3WE7A 1Q12A 1GN9A 1CDZA 4K2HA 1KP2A 1Q11A 1TU0A 5C46F 2FWBA 2E18A 5GV7A 1JDUA 4LFCB 1BJRE 1YDWA 3NT5A 2GN9A 3TUZC 4DT1A 1A7AA 3G0DA 3KU4A 4B4DA 1TYZA 2AB0A 1Z7BA 2R62A 3RHTA 4HP8A 3G7SA 1I0ZA 5FLKA 1WXHA 3ZCPA 4XDHA 1FK8A 1K98A 1CZHA 3DB2A 1HT0A 4TXHA 1BMFA 2CBZA 4V39A 2KPOA 1Z36A 3MGAA 3T1OA 4LNUB 3MJTA 3SR3A 1N3LA 3C6QA 4QTUB 1BMFD 1S8OA 2ZWAA 1IUNA 2RGBA 2JIRA 3EUFA 3Q7QA 3RREA 1NLZA 2GBIA 2DG2A 1ONPA 1YQEA 2JKYA 4I5IA 4JELA 3HUEA 4F6RA 1I13A 5JAUA 3NEAA 2D8MA 2WHQA 1EFVB 3FRJA 3R5HA 1Q95A 4IGIA 4EA8A 3L4SO 4MYDA 4FB5A 4YUWA 5BVHA 4YAOA 2F3TA 3E8XA 3ID6C 3FFBA 4K7JA 5E1MA 3JWJA 1J8VA 3PQ5A 1P74A 3U0VA 1PJBA 1S3IA 4OEHA 1U4SA 1PS0A 5JJIA 4JYPA 2XVXA 5E9QA 2CJYA 3TXAA 3ZCSA 1U1FA 3SVTA 4ESHA 3AY3A 2Q9CA 3FE2A 5CT4A 5HIMA 1XJ0A 1C1HA 4UUQA 4I5FA 1LCIA 3KWFA 4GIBA 5IJXA 4EI9A 2O8CA 3ITEA 1USUA 2NUTB 1DX6A 4DLZA 2GAOA 1KZHA 3TMAA 4G0UA 2ZSDA 4UM8B 2Z56A 9ABPA 1X42A 3I0ZA 2X0JA 4MDHA 3ET5A 2CHUA 4LVNA 3FOEC 5DEIA 4ZCSA 4HFRA 3JW8A 4R8SA 1Z4JA 2DZDA 5SV2A 1BOOA 3I4CA 3WIDA 4PXAA 3EQ7A 5FIUA 4B3XA 4BMOB 1BCRB 2F1OA 3COZA 1VB5A 2L2QA 3L41A 4H7JA 3I32A 4RK5A 4YWJA 1O03A 2QX4A 3OLWA 4QU8A 1M2FA 4WHMA 1NWHA 3ZC3A 4AQ7A 4XD7D 5EVJA 2OYRA 5CIYA 4D4HA 4YMTA 1SXJC 3GAZA 3QYPA 3JQ8B 3K3PA 3M4JA 1XA3A 4M9UA 3LT4A 2I8LA 3PYLA 4L51A 4U4AA 5B12A 3EVTA 4KWTA 4P0TA 2F48A 3WXMA 3SLKA 2GJKA 4RIGA 2G36A 3AKDA 3KO8A 4PX5A 3EEOA 1HT3A 4D42A 1VL5A 5B3JA 4G2TA 3QBTA 4NAVA 1OFVA 5C8VA 1DQYA 1RE0A 1T5LA 3DOIA 4N7RA 4G5HA 4EOGA 1E1RA 3RABA 4ZCRA 5C4MA 3AFMA 3RRNA 1WZEA 1Y5MA 1RAFA 3EGXA 4TTVA 1Y6ZA 1EK5A 1RHJA 5A02A 1VSQA 3P2KA 3RLIA 2YFKA 4G0VA 3VMMA 4B2YA 5DTMA 4HOYA 4TSFA 3EZ2A 4KO8A 4M1QA 1E99A 4R7TA 1Y80A 4M1EA 4YYEA 4HJXA 3OF5A 1UQRA 5LLTA 2AN9A 1KO7A 1Y7TA 2RGWA 2ZJ2A 3BH7A 1KH3A 3G5AA 3OG9A 2O2JA 2B1QA 3PIRA 5DN6A 5BR4A 1H0KA 1SJ9A 2XW6A 4KUHA 1IRXA 2D13A 1D6JA 3Q5DA 1FUKA 2OFPA 3DBLB 3O03A 2R7MA 3H5IA 5FTNA 2WSSD 5MFPA 5F52A 5EKSA 1ISPA 4RPCA 4G8DA 1QPGA 3KZXA 4YAKA 5KX5B 3ISJA 1VHDA 4E5PA 1H94A 4MGZR 1TKAA 4N40A 5FPTA 3D31A 1H2AS 2QUAA 3THSA 2XVYA 2CJPA 2CCKA 4CM8B 3QIVA 3EBOA 2B7LA 2Q2NA 5ESRA 4CR6A 5ES4B 1YOVB 3RIYA 4CG2A 2FEMA 2RHDA 3KKOA 2IV2X 2Q6TA 4KK3A 2P2GA 3ELYA 4RJIA 3SS9X 5TIIA 1FP2A 3PXAA 1UMKA 4HZIA 1YE8A 1QFMA 1O6FA 1XZKA 3MLEA 4TQGA 3ILHA 2PD3A 2X1HA 3BRCA 3CTPA 2X4IA 1UK9A 2VDMB 1NQAO 1FY2A 1RJWA 3CZMA 1Z0IA 1KK1A 1UBGA 2BFOA 2L0XA 3AV3A 1YQDA 2P8JA 3FB1A 4LV5B 3KOXA 4ZRNA 5CFLA 5LZ4A 1NL3A 1HI9A 1TTQB 1EG7A 1PZXA 2GKOA 2YHIB 3HP4A 2FJ0A 5I6DA 1KNQA 3FHTA 1MV8A 3IDFA 5HXAA 1PZGA 5P21A 2AQIA 4OFZA 1FMLA 4YK7A 3RK4A 1RC1A 4DC9A 3RRMA 4OI2A 1X14A 1IY8A 2IHZA 2QJFA 1SUIA 3WKAA 1MT3A 3S5JA 1GHTA 3P9PA 4P33A 3LKDA 2GPSA 1H2FA 3UV3A 5AI9A 2X6TA 1TM5E 2D54A 2PJRA 2FZGA 1L4HA 5K2OA 2G04A 5JS1A 5DHQA 4F3YA 3EHEA 4D3SA 4U0JA 4NQZA 1W6RA 1ZD3A 3FYUC 1OT3A 4EFMA 4EKYA 2O7QA 5M2QA 5B30A 1V5WA 2PIAA 4HS4A 4JP8A 1G5FA 4OQPA 4OXYA 2HCTA 3S1AB 4UW9A 2ZXEA 1USGA 3DL7A 4RBNA 1SA0B 3V1TC 3AIOA 1JDBB 1T0IA 2I1WA 3HKBA 4QDXA 3WK6A 1BQ4A 4CKWB 3EVZA 3WGZA 2AOUA 4DQDA 3RTBA 1RZUA 1MJNA 3P0RA 3ZKWA 3GJXC 2Z9DA 3HB0A 1NJ6A 1C7RA 2CF5A 2I8CA 2ZSIA 3FLEA 3TRHA 3ZWXA 2RGRA 5KNCH 3N6RA 1O8CA 1DAGA 3LCRA 1ADBA 1SWVA 1Z4IA 4M6WB 2R6FA 4RJKA 3EFEA 1PS8A 3ZE0B 3THWA 5JOQA 2RHMA 2JI8A 4ZZ3A 1QAMA 3A70A 3BEOA 4E2ZA 4K9KA 2GFIA 5KYNA 1IWBB 1QLHA 1GA4A 1GXSA 2PKWA 3AKYA 3NHJA 1N2GA 1GRCA 1CRLA 4AT1A 4EL0A 5K2MA 5LYJA 2ZIEA 3H5TA 3GLFB 3GQBA 3VR2D 3UGQA 3ZDRA 4OHUA 4JU9A 3SC6A 1Q1ZA 3GPCA 4GVXA 2G4VA 3TKAA 1NXQA 4H1VA 1ZSVA 1IXSB 1G19A 1M34A 2ETVA 3N2KB 3PE4A 1MQ9A 4RACA 5FEMA 1KR5A 3D6AA 2H5JA 3EW7A 1JPJA 1V11A 4Z9FA 1YU6A 1RTTA 1Z0ZA 1LVUA 1MQAA 2Y93A 3EQ6A 4YNBA 4HATA 2PA0A 3H5WA 4M60A 3KVNA 1V0JA 2BELA 4UMFA 4WPGA 4RJ2A 3RKSA 1W4BA 1T1RA 4OHZA 5HK9A 5HZHA 5L4LA 2O3UA 2WIDA 4HO1X 4GMXA 5LQJA 1J00A 4C14A 4OOEA 1MIOB 2OHIA 5GPBA 1CZKA 2Z6VA 5HS6A 3S2ZA 2WHXA 3G2NA 5K6TA 1YKSA 8ADHA 3HEBA 1EVEA 3BWCA 1VLVA 3GFPA 4H1UA 4BVHA 1TJ5A 1VFPA 4E4RA 1FQJA 2E21A 1HE1C 1SVUA 2QTZA 4I9GA 3G2LA 3A1CA 2BDEA 3HGQA 2BFCA 4N0QA 4PQGA 2FX5A 2OFFA 1LNZA 5JS6A 4LF8B 1OF1A 4AYWA 4PLYA 3ZW9A 2WVJA 2PSDA 1PGJA 2FZWA 3IMKA 4B4WA 1OH8A 4GOMD 2NXNA 4J3NA 1GRQA 3HPQA 4UTOA 3O4IA 3N2EA 2OL4A 4PYOA 4IXWA 3CSUA 3ZDFA 2EAUA 2VJAA 4BQNA 2CUNA 5H68A 1R4NA 3QUQA 4V02A 5CD1A 3R6LA 2GHRA 5ITWA 1NA5A 2W2LA 4DDWA 1D9ZA 2Z0MA 3OBIA 3VSAA 1KVTA 4LTNA 1H2BA 2Q8QA 4KGVA 1NVWQ 5DM2A 3UFXB 2GLTA 2H4YA 1ABEA 4KUGA 2EJVA 2Z5FA 4TS1A 3B38A 3QE0A 1L9XA 5AKZA 3IPRA 4F85A 2A1TS 4IW3B 1XPUA 1XJ5A 5DGDA 1PX2A 5CBPB 3GLKA 2HI0A 4X61A 3F4KA 2F6RA 10MHA 2M2IA 1H9CA 3IUPA 4PEVA 2ET6A 4URHA 3NGXA 2UXBB 3D5QA 3SJ7A 1EM8B 1UMCA 1VDMA 2WG0A 1HC7A 1FB5A 1MRZA 2EP8A 1FMCA 1R6BX 1CTQA 3PUYA 4XYEA 1CK4A 4O2BF 3F8TA 5HZMA 3FMGA 3W4IA 1SCUA 4QODA 3KAKA 2IU0A 2EW8A 1MAWA 3M34A 3PKZA 1S3GA 5ER6A 1ESEA 4Q3OA 4WMLA 2X1LA 2Z08A 1IJKA 1JA0A 1RYDA 1CRQA 3K0BA 1MMFB 3JSAA 4A03A 3G79A 3HRIA 3KSDO 3NCTA 4OLBA 3JD0A 4XM2A 4UNSA 2ZT5A 2R2GA 4WSOA 3R77A 3ASZA 3HP1A 3IKLA 4B44A 4BPBA 3GV0A 4QWMA 1GO2A 4F21A 2RJNA 1YS1X 2HMTA 4ZHQA 3GUYA 3UPUA 7MHTA 3CZ5A 1P1HA 4K88A 3HS3A 1V41E 3CC8A 3KUXA 4LYJA 3M9WA 4AJKA 3ROZA 1OAOA 4MRMB 4IZHA 1O4WA 3K0CC 2YINC 4JR0A 3W34A 2A59A 1BU8A 2PZLA 3PC4A 2GF2A 2EF0A 4NCHA 3VDQA 2X77A 4BQRA 3KEQA 1U81A 3WGTA 4C7OB 1YRLA 5J2UF 2A88A 1K66A 4P3NA 3G82C 3V2GA 3NXSA 1N6IA 4U9HS 5CW2A 1QYVA 5LQAA 3I28A 4G37A 4FTWA 1WRBA 1Q7RA 4RA6B 1YQUA 3SK0A 1PGOA 5H5JA 1NRWA 2HU8A 3C6YA 3MSXA 1G5QA 4QG7A 5A4AA 3MRVA 4DLPA 3Q12A 4W8HA 4R2IA 7ABPA 4LGCA 3GNTA 1BXGA 1XZ8A 5ISMA 3ER9A 3GZNB 1S9HA 1NUPA 5A9SA 3BHMA 3L8FA 1DRWA 1QHHB 3GUVA 3GCWA 4JYAB 3C6XA 1CRWG 3WL6A 1J25A 2W7TA 4M54A 4LRYA 1EYZA 3FN4A 4RHEA 1I2DA 4NXMB 2HRZA 2WTEA 1FX0A 2PYIA 2Y1LA 3BE5A 4B9EA 1T13A 4QUBA 3SHQA 1OZGA 1H93A 4LPSA 1ZESA 1H2WA 2B4KA 3DKVA 3RVNA 1W8DA 1XK7A 3O26A 2QQEA 5LC1A 2HSJA 3VH1A 4D79A 2FN4A 3B6ZA 2OFWA 5EMMA 1U0NA 2VSYA 3K2QA 1WUHS 1SC4A 1ICIA 2JCGA 4HPWA 4D9HA 5D7NA 4JJ7A 1JBQA 4ZVMA 3R5FA 2A0WA 1AKVA 2QOEA 1A5TA 1EDZA 3K73O 3H8WA 3N8IA 4S2EA 3KTFA 3BMNA 4OIFA 1E66A 2ZRDA 2AN3A 4B75A 4ARZB 1XNJA 2BI4A 4UCFA 1DTEA 1LLUA 4MR9B 4H1WA 3ROEA 1PEDA 4GBGA 3VOBA 3PRKE 1SXJD 4S1NA 1Y6JA 3SFZA 1DI0A 4B76A 3SSOA 4L8WB 4MV9A 1JZTA 4Q3EA 3RYIB 3TYXA 4DNOA 1SXJE 1Q16A 3P5BA 5IVIA 4RTKA 4JV5B 3SS8A 4L4UA 5ALTA 3ANXA 4X84A 2VTKA 1WPXA 3ZV4A 2ATEA 1Z56C 2A4KA 5E3HA 2GN2A 3FUTA 3QG5A 4L0CA 5JFGA 2NO4A 3KCNA 4FHCA 2EHJA 5LZ5A 1F2TB 4BPRA 5H4HA 3PKIA 1GR0A 4LXGA 3VBCA 3IALA 1DZIA 3OI7A 1DGQA 1SIUA 2PKRA 4IY1A 4AUNA 3WNBA 2HNKA 4HDNB 4ZOLA 4DSTA 3T12A 3K15A 4PONA 1EUDB 1MO3A 3DZKA 2LZ0A 2EFJA 4OYHA 3VHXB 4DNPA 2PV7A 4B2IA 5DI3B 1ZIYA 5JZBA 4JLPA 1ODTC 4J03A 4DZZA 1TK9A 4OQQA 2QTFA 3HCPA 1QH9A 2QR3A 3TDKA 3U61B 5KU1A 4HGRA 2J59A 3IAAA 5AK3A 3KLMX 3LVBA 2PBLA 4AMYA 4TOIA 1LD3A 4ND4A 1QX4A 1PP4A 1G5RA 4JUCA 1F12A 1FSGA 3UICA 2QZJA 2NUTA 4U2EA 1JF8A 2C2HA 2MSLA 4JLOA 3HRKA 2XZPA 3Q3JB 1DWOA 2B83A 1S0UA 4FFWA 3SYKA 3PFKA 3USZA 1EIWA 1I4EB 1NXOA 1XSEA 2WJZB 3A4VA 4QGSA 3GLIB 5TC4A 5T6MA 2ZYUX 1UP4A 5JCPA 4GM0A 5JRZA 3EZ6A 5EQFA 3OA2A 4GKKB 4F45A 4QIHA 3U37A 1ACMA 2M1XA 1KOJA 4BKPA 3ZLTA 1DXQA 2UZ4A 1DBVO 3TLGB 3P20A 2BFMA 4MVJD 3B1KA 4FWBA 4CKZA 4OHYA 1A82A 4GOXA 2NUBA 2IF0A 3COVA 3LQ4A 4EH1A 4Y1RB 5JDIC 4JODA 1XVVA 1TPZA 1A0OA 2XMPA 2CKDA 3QI7A 4M53A 4BX8A 2OP0A 1ZZGA 1KYXA 3LL4A 5AK0A 4OK5A 3LV8A 4XUCA 1JXMA 5J40A 1P2FA 2MTBA 4N5MA 5KTPA 2WTBA 3B9BA 3FBTA 3LT0A 3PHJA 1QRSA 2PH7A 3B1FA 1COWD 1GNQA 3PD7A 2C7VA 4KBGA 4PSUA 4QAQA 4OJNA 4QJ5A 1NJ8A 4H18A 5D3MB 4BX3A 5JMTA 2G82A 3FYUA 2IY8A 2AFIB 2PS3A 3EBPA 1HE8B 1U0OC 2O6LA 4MUGA 3FVQA 1INLA 2BR3A 2E49A 4ES6A 1ZC4A 1IZ9A 1WDKA 1QYXA 4PANA 2GZRA 1IQ0A 4IQ4A 1WBDA 1IUPA 3JZMA 1ORDA 2J5BA 1LSOA 1NMEA 4R1MA 1AC5A 3ZGZA 2Y8EA 1SN7A 2W6ZA 2CMDA 2ZUWA 4I3FA 5K3AA 2WV7A 3FDZB 3IUJA 4YXFA 3DBLA 2EEPA 1A4UA 2XNHA 4Y6QA 3F5MA 4TTIA 3GMDA 3BHJA 5KX5A 1K8ZB 1L4NA 2JLYA 1RZRD 2GSWA 2HQSA 4B6RA 2FEWB 3IIMA 4B43A 1LPOA 1H69A 1JWAB 3CBQA 2Y2UA 3DQQA 2JAXA 4TYYA 5FOVA 2RC5A 5AW8A 1C0EA 1DFIA 2ZE7A 1DBIA 1LF5A 1P5JA 5CTJA 2BOVA 2GZHA 4MWCA 5G1PA 4Z4CA 2XWJI 4K87A 1UPTA 4F9TA 1STOA 4E5DA 1XMQB 2QY6A 4K9NA 5DYNA 1XTQA 1GKUB 1I9CA 3NAGA 1WPQA 3WIOA 2B7CA 5I9MA 4BNJA 4FE3A 4IIHA 4S04A 1YTLA 4R3WA 3K70D 2ZSUA 1ZXBA 5JY1A 3IELA 5E9JA 3BK2A 5CB4F 2EG5A 1MOQA 1OR8A 4BYGA 1U28C 4EK9A 4P0QB 1GU7A 2IDMA 1C9MA 4X44A 1Y3IA 4IMIB 4PO8A 4EPTA 4EYGA 3CUVA 4PAWA 4II3A 1C1DB 4QUHA 2O2DA 3KUDA 4B5LA 1E0SA 2IOFK 2C7RA 2QUZA 1WZIA 2B69A 4A0RA 3VXKA 3G8DA 3ZLVA 4DUYB 3ZIUA 2BRUA 2I67A 1U2QA 1YL7A 4W6ZA 3QVGA 1SCNE 1H9AA 1D2NA 3DEYX 3EN0A 2DWQA 3GUZA 3K1YA 1DAPA 4I2VA 4NL4H 3ZGLA 4YJ2A 1ZVVA 4KPYA 3CKMA 4F3KA 2JD1A 2NG1A 5K8IA 1JR6A 3L1IA 4N12A 4LOJA 4M89A 3AL0C 1Y34E 1TD1A 1V45E 4EUEA 5I7WA 1GARA 2F90A 3ZJVA 3PLAE 2X5XA 3NI2A 3I37X 3HXQA 1UBLS 4WDQA 3JS5A 3W3ZB 1BYUA 3BC1A 1SA0A 1HEUA 4CKWA 2W2NA 4V3CA 3WJAA 3R4VA 4BQIA 5IKXA 4I3HA 2BGGA 1AKRA 1ZH8A 2GQ0A 4IWXA 3MWDB 3KZNA 3ICWA 2ZUBA 1XI2A 5D2CA 1GTSA 1X0VA 2Q28A 2GBLA 1PD0A 2H8KA 2AF4C 2WKQA 3A06A 3KVVA 3FCAA 5TLSA 1ZIXA 4UQOA 2OBYA 2XB2A 3KOZA 3HNOA 1JFTA 1M2KA 4ZODA 3CGGA 4ZXFA 3TL6A 1AO3A 3QPBA 1D2GA 1MX5A 1MBZA 1BX0A 2DPYA 4M0EA 3TJRA 2EGGA 4FSHA 1W9MA 4F3RA 1XXHE 3KPWA 1L6IA 2AZMA 2AN1A 3G2MA 4Q1EA 1SVNA 1RC0A 1JQEA 1BS2A 2CNBA 3EIQA 4H77A 4TXJA 4RTSA 4ARIA 4CR8A 1TNDA 1GRRA 2FHPA 4WY8A 4AJ9A 4DA7A 2FGKA 2W0MA 1W5FA 2NT3A 1YJAA 3SX4A 1A98A 4AZWA 2FZKA 3KJFA 1Q22A 4X92A 1OI3A 3N2KA 3ZVLA 1GTG1 1YVPA 3RS7A 4F4JA 2OMEA 1U7ZA 1JILA 1CZUA 4NESA 4Q9AA 2ZSHA 1YHZA 1QQ5A 1CZLA 4O1HA 1YJCA 2VDJA 4MVXA 3CPHA 3CGWA 3KQHA 1C3OA 3MRXA 4EJ0A 3EUAA 5TMBA 5K3FB 3FNBA 2O1XA 4RQBA 1AK1A 4IDQA 3BMQA 5TJ9A 2TRSB 4AL4A 5CVVA 1NJFA 3HJUA 4TTTS 3NCHA 4X3CA 5FA8A 2WZBA 1ISMA 4I4IA 3KHUA 5ALQA 3T4EA 1CZRA 3FUXA 5G0SA 3E22A 3R3XA 3DDWA 2V74B 1MIOA 3VU9B 3M2PA 1EGAA 3TSYA 4ITVA 2FUCA 3E9YA 1YZTA 2Q6IA 4M1OA 2UDPA 4F84A 5B3LA 3K0CA 4LF4B 3DAOA 3FPJA 4XARA 2AUMA 1MW8X 3CS3A 1U2GC 2VK4A 2AMYA 4R7ZA 2C8JA 4M1YA 5E3IA 5KQLA 4QYSA 4J8PA 2C9CA 2VLIA 4BRWA 2DRIA 3BHIA 1EHIA 2R4QA 2DBQA 1Y6RA 1TAGA 3LKZA 3UHPA 1QKKA 2VXCA 4TQAA 3BULA 1BGWA 4R0MA 2YJ5A 4EVQA 2HV8A 3IUNA 3QVUA 4HQNA 5ELXA 1YAJA 1OYWA 2OWEA 1HGXA 3ZCQA 3AVVA 5B7PA 2WWWA 3D5EA 1J23A 2PRZA 1SQ6A 3A28A 2XUGA 3EXFA 1Z7WA 3FOAA 2NIPA 5HCIA 3MINB 1ZNYA 1ZM4A 3GU3A 4F0JA 2I2AA 1RXVA 1MJ5A 3PXCX 1EGQA 1RWBA 3PQ7A 4KTVE 3PXGA 3ZBTA 4QYTA 2YJGA 5K9ZA 1PSWA 4LOAA 3OMXA 4KN8A 5ERGB 4BV8A 5BV7A 2QB5A 1DO2A 2AX3A 2HLNA 3T0IA 3CNHA 3DCJA 1JKMA 3NEJA 2HU2A 1JW9B 1PK8A 5CR9A 4Z4QA 1Q5PA 1B14A 2BT4A 1FSPA 2N46A 1T5BA 3M5PA 3LHSA 1PAUA 2HA7A 4HQOA 1T8SA 1UXOA 4QJ4A 3KR9A 2FFHA 3HSSA 1DRUA 4RHUA 5FTMA 4DMGA 4GMKA 3ZXIA 5BO5A 1AXRA 2W71A 2OTCA 2PXHA 3T4PA 2IUUA 1ZWKA 4BN0A 2P8SA 2WVGA 4WASA 4ZAWA 4ENWA 2O0MA 4LOIA 3CR3C 4FFDA 1GN8A 3NETA 4KGXA 4O33A 3AINA 3MTGA 4PIMA 4QPCA 1HM5A 3VYWA 5CNMA 1GPWB 4D7AA 4EQ6B 3H4TA 1Y5LA 2OORC 5KNDH 1CRPA 2VHWA 6PFKA 3U7FB 3MG9A 1WU7A 4LNAA 3T5DA 1FDRA 3J81A 2XBUA 3AUAA 1XNQB 3I23A 1RWQA 5ECGC 5JQGB 5AM0A 5EVCA 5K1ZA 2FP3A 4MRMA 1U3DA 3W77A 1ENZA 3CPJB 1ZG3A 3H1TA 1XTKA 3HCEA 4H0CA 3FLBA 4K5QA 4MYUA 1T6XA 4RZQA 4P2BA 3VX3A 2PL9A 1CJTC 2GKSA 2CFSA 5IT5A 3EQ8A 3TE6A 1I1HA 2XB8A 5AW7A 1BCSA 1UDBA 3HM2A 1ZJ4A 3ED5A 3UA3A 2H5LA 4QJIA 1JHOA 4GXQA 3C4VA 2WYHA 4QJBA 1PDVA 1EXWA 1NULA 1XL0A 3OE1A 1YOBA 2JLCA 4GOND 4JZKA 4B4KA 4K6HA 2C2OA 1LK7A 2OLKA 3FGPA 3OJCA 3REQB 3UAZA 2XKAA 2VAWA 2OAP1 1Z4PX 1A2BA 3LHFA 5G1OA 4LJ8A 4AG3A 2CFRA 1HG1A 4R98A 3GWGA 4RTRA 3GZNA 5AVUA 4XQEA 3AETA 1C9EA 3AG5A 4IQ8A 1P7CA 1QHHA 1V4VA 3FPGA 1E9RA 1FMTA 2PL1A 2Y99A 1ETHA 1NP6A 4FMCF 2YY7A 4KX3A 3JWHA 3QYAA 5EIAA 2TMDA 1XTBA 3BM5A 3CVYA 4EHKA 1L5LA 2JLVA 1I5EA 1CUBA 1DC7A 4QSMA 4ZZ2A 3W7VA 2XUFA 1E89A 1G5HA 3B9PA 3MM4A 1KSGA 2J67A 3KYDA 1VMKA 2JGLA 2FMXA 2I2CA 3VOAA 4P82A 3S1LA 5SZHB 4E6EA 3N58A 1XAJA 3C87A 9GPBA 4B87A 2MR5A 1VYUA 1PJTA 1QLWA 5JG7A 2PVPA 4MHTA 3DLCA 3NT4A 1WCV1 5BW4A 2FR1A 2OZPA 1XRQA 1DJMA 4IG4A 1V7ZA 4UARA 1IRIA 2PZGA 1B7GO 3BFPA 4YN3A 5IG2A 4Q03A 2GEKA 4B0OA 2WC1A 2R1TB 2YWDA 3OHSX 5EZYF 3ZCXA 2JD0A 4BLQA 5I4CA 4W5TA 4OLAA 3BB4A 3V3TA 2VF2A 2PZBA 4MR9A 4UTNA 3MEQA 4UHCA 3OEED 3PQ6A 1TEZA 3G7NA 4NOJA 4MQFB 2AT1A 4BS9A 4GQIA 4CMHA 2E85A 5EIFA 3ZEIA 3D0RA 1ZJ6A 3PIDA 1HYEA 1XJCA 2WM9B 3G9ZA 3RJ5A 4Z7QB 5CLJA 2OB1A 4BZWA 5FO0A 4WUTA 3I8OA 3B48A 3B53X 2Z4SA 3DFKA 3DGFC 3TEJA 1BVYF 2HIGA 2RGAA 2VYCA 3ZNQA 4F6LA 4A0HA 2C9ZA 4UQPA 5DVZA 4ZT5A 1CXZA 3KFVA 3L7NA 2ZR0A 4ZCIA 2JBHA 4IIGA 4QYMA 5JNTA 5A5VA 1CF2O 5KTKA 2RONA 2RHGB 2V7WA 4RDXA 3N7UA 4XQCA 3VR4A 2CNOA 1B8VA 4C7KA 2VXYA 3L5KA 1Q0ZA 1PWXA 3D4BA 1PNOA 2WHPA 1MN6A 3DVAA 4NBUA 4GQAA 3RSHA 2J9YB 3FYTA 4HDNA 3COSA 3VJRA 1U0JA 4G23A 4PTYA 3L8YA 2VPYA 4RC9A 3T7DA 4URZR 1O6BA 1OV4A 3VGPA 2HL6A 3VHXA 2VNSA 2IW3A 2BJHA 4NYMQ 4REQB 5DI3A 1QQ6A 4JI0B 3VHRA 1EGHA 3A25A 1N6HA 2VT2A 4Q93A 5TNXA 3HKEA 3IDOA 1QGYA 3GXOA 3Q98A 5L3RA 1CWUA 1P2VA 1UFQA 3P7MA 4PZ9A 1SVSA 2JAUA 1NN0A 3OTHA 2WF8A 5H1YA 3BIOA 3MCAA 3T3HA 1E9FA 1Q0UA 1B6RA 3E4CA 3DTVB 4R5MA 1FFSA 5F73A 3EYWA 3H5OA 4J3JA 5CAEB 3ROMA 1II8A 2HK6A 5DLYA 3I6ZA 4YWHA 4IKPA 3ZHQA 4I4TA 4H7PA 1EVLA 2YVAA 3HDYA 1TAQA 1BD4A 5BNIA 2V4MA 1NSTA 1AKMA 1KDOA 1PL6A 2C95A 2RK4A 3C8HA 4PLHA 1R8QA 2R25B 3GJ7A 3FGOA 1R6UA 3C3DA 1GTL1 3FPKA 3P9RA 3WQQA 1H3FA 4QVKA 4C7BA 1UUFA 3VZDA 2ZJYA 1KEVA 3E0XA 5EPEA 5HZGA 4ZVRA 3GLGE 1GFIA 3AGQA 1U28A 2EQBA 3HJGA 3QF4B 3ZU5A 4ALMA 5AUNB 4FMPA 5A0VA 1GY8A 1L4GA 4FHDA 2LXNA 4V0NA 1W19A 2IXGA 3IHWA 2TMKA 2WWGA 3PXEA 1TIKA 1TZBA 121PA 1HBJA 2GDZA 4W5WA 3TSZA 3WZ2A 1FNCA 1URPA 3B8EA 3PXUA 4R2JA 5TVKA 2BR4A 2KM1A 1G7RA 2NGRA 1N2IA 2VAXA 4JGBA 4O3MA 1YZ3A 4A4DA 4HXGA 3ETEA 4LX0A 5LNK1 3M0EA 1OAAA 4X66B 4TRJA 4E4TA 1R50A 2W8BA 4EDHA 5EINA 1PV4A 2X2PA 4WE3A 2VA9A 3M3DA 1QHFA 1ZEJA 4I4LA 4LJ6A 3R7SA 3W7BA 1Z07A 4RDHA 2C2BA 1OLOA 2XBLA 4S1PA 4MR7B 2R8XA 3R09A 4CMBA 2OD2A 2PQ0A 1B73A 1X6VA 1DRJA 1RQNA 1SEPA 3DZGA 3IT3A 3LUPA 4WINA 1GGNA 1POWA 1W48A 2EFHB 4Y9DA 4BBZA 5TQ0A 4Q02A 4M9QA 5HP4A 1M73E 4RQTA 3IH5A 2I34A 4GD3Q 4OOFA 4U6NA 3U49A 4E3WA 1Z5ZA 4WKOA 2VSNA 2YMMA 3KZOA 1LB1B 2AG6A 4ESVA 4Q39A 1T5DX 1ISSA 2O06A 2VHXA 2HEIA 5FTKA 3I4LA 4U5XA 3NO4A 3RVJA 1OBHA 4RVDA 7AT1A 5AVXA 5K0SA 2XMDA 5F98A 5JZVA 4PF1A 3SLGA 4LI0A 2XYHA 3WGUA 1CEQA 2WTMA 3SHFA 4LXHA 2JD2A 4FI3F 3K30A 3HDTA 4U39A 4DZRA 2Z6AA 1Z12A 1G66A 2XQIA 1HK7A 4BC0A 1MC8A 4MKFA 5TGDA 1ZUWA 4BUZA 1NF9A 2IH2A 1YNSA 4A27A 1U9JA 3W3AA 2QBYB 4M99A 5K51A 1DX9A 3LTEA 3T9DA 1IY9A 3IT0A 1XRMA 1KMNA 2YWXA 4N5LA 5D5HA 3RG2A 3LXRA 4K6OA 4PQFA 1QGAA 3LYAA 4TV9F 4BO1A 6AT1A 2UVPA 4XIFA 1QIHA 2AN4A 2RH9B 4PZ0A 3O3CA 5CD9A 1YFJA 3TNFA 4WTOA 3AIKA 3MT0A 2GSDA 4NJEB 4BQEA 2G1AA 3LRTA 3ZY2A 1C1DA 5CA1F 1EBBA 3AY0A 4I9UA 2B25A 1BN7A 3LXXA 2HWKA 2W4QA 3M1IA 3MS7A 2G17A 3F9RA 4NHOA 4WZBA 1N2CB 3WRXC 5K09A 1UP7A 3DHEA 3G9TA 3WSWA 3TGPA 4W5OA 1S02A 2FSIA 4E2WA 4NHEA 3SWWA 4J9UE 3I83A 2QBYA 5CXXA 1ECLA 3LDFA 4S3MA 3OIWA 4HAUA 4IGAA 3IQHX 4NCXA 4B09A 5CDFA 4JOSA 4BJ5A 4ZVKA 2WTXA 1LH0A 2FSHA 4XDZA 3F46A 3HJFA 1U2GA 4A23A 5DDIP 4LZOA 3KYCB 1N1DA 1NXTA 4AJHA 3ZHVA 4CE6A 2O3RA 4UPDA 1K63A 1VZ3A 1SBHA 1MGOA 2QZ4A 3IB3A 5JSZA 3RTDA 4PLWA 4FM9A 3NQ41 1QM5A 1OILA 2ZIZA 4Q4AB 3SIRA 2OXIA 5JVDF 3PPWA 1FU4A 2UXDB 3H9EO 4NCAA 2WNHA 3BWYA 4M7OA 1UXKA 1W88B 1JUDA 3GDGA 2B2NA 3IDZA 3E3OA 4PQYA 1CR6A 2JRCA 2GJSA 1N6KA 3TSWA 1WF3A 4OUDB 3KLPX 3DVQX 4PAQA 3TZQA 1LXCA 4HZGA 3QWFA 2PUBA 3P71T 4CKBB 1HLDA 4IRUB 3OTIA 1E2KA 1FRFS 1GG8A 1RJDA 5LPNA 2YXNA 5FQNA 4AWAA 5BSTA 4JLUA 4EY4A 5BWCA 3DZ8A 5HKBA 3RS4A 1CRZA 2HIAA 4P4NA 2A1IA 3F8WA 4KK4A 5AVWA 2IUFA 4G8CA 4MEBA 2VKQA 1AF7A 2HZBA 4Q9NA 1R5BA 2EFYA 2F4VB 1CIPA 4BHTA 5KWSA 1L4FA 3VVLA 4DV5B 2GNOA 1GUYA 2BEWB 3IQIX 1W4ZA 1YRYE 5DHTA 2DU8A 4KZPA 4CM9A 5K8JB 1GUAA 5I7AA 1ZR4A 4G9EA 5DOZA 3UEOA 1RPZA 3W6ZA 2WWVD 2ZRNA 4R68A 5B53A 2WFLA 1L2TA 1NTOA 2HJ9A 2Y0DA