3OEOA

The crystal structure e. coli spy
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
b'KDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIITSDTFDKVKAEAQIAKMEEQRKANMLAHMETQNKIYNILTPEQKKQFNANFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spheroplast protein Y
publication title The crystal structure Escherichia coli Spy.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 20
structure length 91
sequence length 91
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07813 LTXXQ LTXXQ motif family protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3oeoA00
2Y39A 3O39A 3ZG1A 2Y3GA 3OEOA 2Y3DA 2Y3BA 2Y3HA 3QZCA 3ITFA 3LAYA 3EPVA
chains in the Genus database with same CATH superfamily
1T6QA 1RKCA 2Q9BA 1FMWA 2YHSA 4NTBA 4YT4A 1R4TA 2CDQA 1MNDA 3AJMA 4I3MA 2J7PA 2QY9A 3DM9B 3DE8A 3U9JA 5KYYA 3FVYA 4NCQA 4DBQA 4JKVA 3U8PA 2G62A 2RD9A 4O6MA 4RD9A 3I5QA 1ZHXA 3AQBA 3IEEA 4YN0B 2J9VA 1V55C 3QW1A 4N6HA 4MS2A 5DS5A 2VASA 3K7DA 1QZXA 2KSFA 2NG1A 4NTFA 4Z9JA 3EG9B 5KYWA 2ZXRA 3DJUB 3HNJA 4O79A 2R7TA 2R03A 1SR2A 2W4MA 2XM0A 1EI7A 3EH2A 3RYLA 3FDQA 1ZW2A 4AK9A 3DAFA 2OJQA 2XXAA 1LS4A 2B0HA 2EPNA 2L7AA 5T3WA 3CAXA 3QVZA 4CJGA 1OW6A 1QQ3A 1W2WA 2PBEA 2YLIA 1IZMA 3FAPB 4AL0A 4CBEA 4WGZA 5CI8A 4FESA 3S90A 2DI3A 4LDRA 1ZHWA 3CQZA 1H6GA 1V4AA 1YDIA 5B1AC 3VAYA 1FNTc 4NTAA 2J45A 2OJED 4XLNF 4CS8C 4J7TA 2KNHA 3U5SA 4CJOA 1U0BB 3MYIA 4CDVA 4YL0A 2FAPB 1Z23A 2XLVA 1VLSA 2C04A 3H65A 2P61A 3IQ6A 3O6XA 4K0DA 4O7GA 3TOLA 1MMGA 2XLMA 3T6GB 4LERA 1A7VA 2LIGA 2QTVA 4GEHA 1C03A 3O39A 3O55A 2NUPA 4MVZA 1OW8A 2J7PD 5KYUB 3U2MA 2PX3A 3S9OA 1WOLA 2R7QA 3MYFA 4IWBA 4MVSA 4ZLCA 1HE1A 1YVIA 1WGWA 3FOPA 2OOCA 2OCCC 4J30B 4JE9A 3N24A 4U5BE 4ULVA 4G7ZF 2IBFA 3LNRA 4BEMJ 3LS0A 4E17A 2A6HF 5KYXB 3AOUA 3LUTB 1QLEC 3ZVRA 2KW3C 4PFPA 4D4XA 5F5HA 2VCBA 2VB6A 3UGPA 2EIMC 3QMKA 2W9YA 5DS4A 3LJBA 4XPXA 4U5GA 1JOGA 1CPQA 1HE9A 2J46A 3RVZA 2OEVA 1FTSA 5A6JA 4YJWA 1V54C 2GFHA 5COFA 2KQ9A 4E18A 2YZSA 5BUOA 2P6VA 1CGNA 2W4BA 1O3UA 2R02A 2LQGA 5L0JA 5L3QA 3V5XA 4I1OB 2CW0F 2BL2A 1G5ZA 5E3CA 1FFTC 5TJ5E 3DWWA 2Q7RA 3VM6A 4XLPF 2GWWA 1XWJA 1KNYA 1ZHTA 3KYJA 1A0BA 2L6HA 3POVA 1LVKA 1YA9A 2ICWG 4XWJA 2VCAA 1DOWA 4XEVA 4Q5SF 1K05A 2Y3DA 4KNVA 1JPJA 3DJNB 3ZC4A 3LNMB 1OCRC 1BR4A 3RW0A 3M4CA 3LLIA 4K1OA 1H9TA 3R2PA 2KYHA 2L6FA 1Z5ZA 1SYQA 4MW8A 4PFOA 2J9WA 4CIHA 5JS5A 2WZLA 2R9RB 1OR2A 4DVZA 4OIOF 4IAQA 4ZLDA 4RBNA 3ABKC 1Z7Qc 1YA7O 1S7ZA 2YKZA 5A6KA 1F1MA 2IOQA 3C62A 3G4XA 3MFNA 4CS9A 3ABMC 1QSPA 5JRAA 2EPKX 4DRIB 3SYNA 3TQOA 4EBJA 2ZXPA 1B68A 2HZ8A 4AE4B 1OKKA 1SMYF 5A6AA 3EFOB 3Q6MA 3R7CA 3EGXA 3LEVA 3S0XA 1UFBA 2YL0A 1XZQA 2YEVA 3LESA 3Q7LA 3FHDA 5E3AA 2B0JA 3O10A 4YT8A 4CIPA 3X1OA 1NZEA 3K66A 4D4NA 3T4RA 3BEHA 2IXOA 2MHRA 2OQMA 3DD7A 3W2VA 2J9BA 4HE8D 2NSGA 5KYXA 3JZ0A 4HEAJ 4F4BA 3EHMA 3QTHA 4IAOA 2LCHA 4BEJA 5DS6A 4YL1A 3VF0A 1EKYA 2YL7A 1D1AA 1RJ9B 4CS9C 4UDVA 3TOMA 2HFIA 3GODA 3X2QC 3DXJF 3AG2C 2WVNA 1TQGA 2EPOA 2UUHA 5HV9A 3B0UX 2A1DD 2LD6A 3ZTZA 1C17M 3RIPA 4E0HA 3US6A 2A0UA 2CNWA 3NYJA 3NRHA 1ZZPA 2VCCA 1HW2A 4BPMA 3GM2A 4JJFA 4JJGA 3W2WA 2ZPAA 2QLAA 1S05A 1TFOB 3EPVA 3ZTMA 1E85A 1I4YA 3KMIA 3PDMP 2KGOA 1K40A 5DQTA 1CGOA 3B29A 1TWCA 1CGME 3NYLA 4BJTA 3JYYA 2J0XA 1M2OA 1PD1A 2X51A 2HMZA 4YT2A 4LLCA 3G50A 2CGEA 3GANA 1K04A 5EHHA 1ZHZA 5JT4A 4NY3A 1OKKD 4CS8A 1D1CA 1U6HA 2GDCA 1OXKA 5AC5A 1WWPA 1BZ4A 1PV3A 1XZPA 2PF4E 5CIVA 1ORJA 4JTDB 2P7VA 1A7DA 3NMJA 2JX0A 2FGYA 3B0VC 1VYIA 5JLIA 3JRMO 2XLEA 4JC7A 2EPLX 1ORYA 2G3VA 4G7OF 4JTCB 1BDJB 2XL8A 1YARO 2XS1A 4ONSA 1TFKB 2QNLA 2J8WA 3HNIA 3IHUA 3M1CB 5BQGA 4JRZA 3C8GA 3W8IA 4E7SA 4AE4A 2HS5A 2XLWA 3ASNC 1NU7D 5FCLA 1VOMA 1Y6DA 2OEXA 3ITFA 4J32B 2ZXWC 3IPMO 4LACB 3JYHA 2AVKA 1TKNA 4U5FE 4DVYP 5IY5C 2XSEA 2XL6A 2QE9A 3K1IA 1ST6A 4XQ1A 1J8YF 2CNWD 3MBGA 2O9XA 2XLHA 3JRTA 1LI7A 1OXBA 4C3BA 3VYWA 1HMDA 2ZXOA 5D91A 1E83A 3W4YA 1GM5A 4KI2A 2R7UA 4PJJA 3V5YA 1M6TA 1DOVA 3UMIA 3SXMA 1HMOA 1E2XA 1KU2A 3V5ZA 3NMKA 4R32A 4E0IA 4YK5A 4YT5A 1D1BA 1Q0GA 1VLTA 1ZVZA 2AP3A 2D4UA 1AEPA 2Y69C 3M15A 2PP4A 4JCHA 5D92A 1NLXA 2QUPA 3KH2A 3L8IA 2FFHA 2NUTB 2NPUA 2XM4A 2GAQA 2ETSA 2LP4A 3HNLA 3HLZA 2GA0A 3FXHA 3K1IC 2JD3A 2YWAA 3QVYA 1C02A 3N2ZB 3KL4A 3TJ5A 1G4WR 5AGFA 5BQHA 1RCPA 3RQEA 2R7XA 3TD7A 1WASA 2BC5A 1GS9A 3S28A 5B3IA 4IARA 4FAPB 5F28E 4PK4A 2YLGA 3UR3C 1YYXA 4PJMA 2R7WA 1JAFA 3EH1A 3VRCA 4EBBA 4U5HA 3C8GD 4JEBA 3T6JA 1TWAA 3EG9A 4LDKA 1VB5A 1HW1A 4YL3A 1A7EA 3OA1A 2BE5F 1BBHA 3LS1A 4BJ6A 4JEAA 4JURI 2EIJC 4K7BA 2W45A 3F47A 4O6YA 1Q0DA 1AVOB 1BR2A 3EZIA 4JCZA 1QPUA 3B9QA 3GEHA 4Q7CA 1WTYA 1OR3A 1IW7F 2VH3A 4XPWA 1T9KA 3OWTA 3IQ5A 4IGGA 2CYDA 1RXQA 3NKEA 5L0DA 5HSWA 3DKAA 5L3VA 2I15A 4GYTA 5T1DB 1NU9C 2D5RB 1ZW3A 3SXZA 3PMRA 3C8ZA 3RH3A 1APCA 1O5HA 4N6CA 2H7BA 3L1MA 2PFDA 3EZHA 3TULA 3C18A 2WZGA 4KC9A 2V26A 4PR9A 2AU5A 2LSEA 1Q0KA 2Q9CA 3MLGA 1JPNA 3C7JA 2Q9AA 1L7CA 2HUJA 3AQCA 1RKEB 4BJ6C 3EQLF 4LLEA 5L0FA 1LS1A 256BA 2R7VA 2ASRA 2XLDA 2C03A 4DJ9A 2UUIA 4P6IC 4CDYA 2VC9A 2M4EA 4ANJA 1I4ZA 3U2LA 5DLJA 4MVQA 5KYUA 4BG0A 3DI5A 5JP7A 1LIHA 4EKWA 2A68F 1ZHYA 3L34A 3LLKA 2IXPA 3FAJA 3NYMA 4DRJB 2XRHA 3U9MA 1ZYRF 3WG7C 1WATA 2EILC 3DZAA 5EK0A 3AG4C 2G3KA 3GWLA 3RQFA 4EIYA 1E84A 1T6IA 4ER9A 4IJJA 1Z3IX 4FWVA 3HTKC 3FMSA 2XXAB 2Y3GA 4OINF 3UNGC 1JR8A 2DB4A 4IB4A 4BJ5A 1NSGB 4A2NB 3NKDA 4H54A 4MVMA 1T6UA 4MTGA 1GQAA 2HJ3A 3ZQYA 1Z6AA 1FAPB 3AG1C 4MVUA 1YJGA 1PD0A 3W8HA 5K0IA 4MVRA 4QDLA 3H2VA 3U3BA 4DOZA 3SXKA 1QVXA 2Y3BA 2R7SA 1OQCA 1Y4CA 4LDQA 1LM3B 4U5CE 5JVEA 2A69F 2HV7A 4U5DE 1YZAA 4P9FA 3NG1A 3NMIA 4O6NA 1TWGA 2EPMX 1FFHA 1M2VB 2XLOA 4BJ5C 1L3PA 4U5EE 4C3EA 4HFFB 3KPHA 1D0YA 3UMHA 4DXWA 4HFKB 5CI9A 2Y39A 5AC4A 2I8BA 2XL4A 1NFOA 2MWQA 4AX2A 3TK0A 2EINC 1YLMA 1YYJA 5L0IA 1T01A 1Q0FA 4BJ1A 1NG1A 2YL1A 4OIQF 1RKEA 2NSFA 2IXMA 1Q0MA 4JZAA 3J06A 4OIRF 3F46A 4OD4A 3S27A 3K1HA 3SZRA 2R05A 3S29A 3TJ6A 1T5OA 3E70C 2HSQA 1SZIA 1CPRA 2L81A 3EFOA 2HSBA 5T3TA 3PCVA 4OIPF 2Z15A 1EQ1A 2H7OA 4FX5A 2Q3TA 2WL8A 3C63A 4ULWA 2V3CC 1LPEA 1I5NA 4C3DA 3B0PA 3EJNA 3GM1A 2KJGA 3ABLC 3KKBA 1U89A 1WN0A 3FOOA 3HJCA 2DYRC 1J8MF 3IQTA 3U3FA 5BQIA 3L0IA 3M79A 4XEKA 5JUAA 1OW7A 1M56C 2WB7A 4MQ9F 1RJ9A 1MNEA 1A41A 1V74B 1D0XA 1R5ID 2IM8A 1MMNA 3GWNA 1UG7A 2H7VC 3E9VA 4H4KC 2R7RA 1Z63A 4WABA 1VK5A 3EHNA 4EBKA 1BR1A 3EGDB 1N1CA 1FR0A 2R7OA 1AUEA 5A6BA 3GEEA 4YWQA 4W8KA 4P9TA 3CEXA 1LE2A 1OCCC 1ZU4A 2PNOA 3QZCA 4XPYA 2J9UA 3IQCA 2JPUA 4PJNA 3N0TA 3I4UA 3H2UA 3KYIA 2OG2A 3ASOC 3I5PA 4G0HA 2ZD9A 1M57C 4E7ZA 3GEIA 3SP1A 1KTMA 1ORSC 2EIKC 3JTLO 3EGXB 5COGA 4Q4ZF 3T6BA 1HY5A 3ZG1A 5E2QA 1M2VA 3K6BA 2Y3HA 4CX9A 2IXNA 2YVKA 4OD5A 3CZ6A 3U8VA 3G4ZA 4C7OB 3ZSUA 1RMVA 4JVSA 1G8XA 1NFNA 3B71A 4L6RA 4N06A 2YL3A 2RSEB 3AGTA 4N4WA 3ZWIA 4CSAA 1JRAA 2HKVA 2Q00A 2A0BA 2R25A 2CCYA 4JTAB 3HNKA 4MW3A 4J7YA 5E33A 1MQVA 2KC3A 3V7OA 3BRJA 5DQZA 2LK4A 5EGYA 3LAYA 3A11A 3JCUQ 2X0CA 3SXYA 1MMDA 4NC3A 1ZU5A 3ZQVA 4I1MA 3JT1A 4W8PA 4U9EA 3AGUA 3OEOA 2DYSC 3M4BA 3RVYA 2DGJA 2A6EF 1TR2A 3CSKA 3DE9A 4G7HF 2AWYA 3WAQA 4G78A 2Q4FA 1LKXA 2HV6A 2KK1A 4IRUA 5KYYB 3T9OA 3PHF2 3DMDA 5A6BD 4A4AA 2MYSA 4QI2A 4PACA 1OCZC 4CSAC 4B6IA 4M63A 3K33A 5B1BC 4RDAA 2PX0A 3A9CA 4NQFA 3MX3A 3Q6NA 2HJMA 4XTKA 2YQYA 3U0CA 3RKOF 2H8AA 3AG3C 4PJLA 5L0GA 5KYWB 1GGQA 1EA8A 3DAGA 4KBLA 5COMA 5FZTA 3ZDLA 2E87A 4EUKB 4WJ0A 3EGDA 3Q7GA 5JSLA 3DM5A 2YRFA 5F5FA 4CDAA 1PCXA 5KYNA 2LFDA 5A69A 3LEOA 1VMAA 1O87A 3HKKA 2NUTA 3ZIBA 1OCOC 4XEFA 4CS7A 4Z9IA 2P1AA 1NBBA 2TMVP 3NDBB 3ATPA 3C8GB 2OKUA 2WVOA 2J0WA 1JMWA 1LE4A 3RFYA 4EWCA 1H7IA 2HMQA 1H9GA 1QKRA 2M64A 3GM3A 1FMVA 3SNHA 1VTMP 1VYKA 4KNWA 2P0NA 2XS8A 1LI5A 4I44A 3JSEO 2WVQA 3SEOA 3S84A 3WODF 4JIOA 2OU6A 3L8JA 2YLDA 4GQHA 4JW1A 4C7OA 2LFFA 4MNDA 2AWCA 4MVOA 4MTOA 1SF8A 4U9DA 2NUPB 3GORA 3JSZA 5B3SC 3QW0A 4MTFA 4WGYA 2IYLD 2L9JA 4X0RA 5GPGB 4DRHB 1E86A 1YAUO 1MMAA 1G4US 1D0ZA 1YZCA 1TWHA 2WZFA 3WHNA 4DBRA 3ECSA 5L0HA 5DVWA 3RQGA 2L6GA 3UMKA 3UGOA 5L0CA 4EHPA 2F22A 3RF3A 4Z9HA 4AL1A 4QI0A
chains in the Genus database with same CATH topology
2Q9BA 1FMWA 2YHSA 4YT4A 2CDQA 1MNDA 4I3MA 2J7PA 2QY9A 3DM9B 5KYYA 3FVYA 4DBQA 2G62A 4RD9A 4O6MA 3I5QA 1ZHXA 3AQBA 3IEEA 4YN0B 2J9VA 1V55C 5DS5A 2VASA 3K7DA 1QZXA 2NG1A 3EG9B 5KYWA 2ZXRA 3DJUB 4O79A 2R7TA 2W4MA 3EH2A 3RYLA 3FDQA 4AK9A 3DAFA 2XXAA 5T3WA 1W2WA 1IZMA 4CBEA 5CI8A 4FESA 1ZHWA 3CQZA 3VAYA 5B1AC 2J45A 4XLNF 4CS8C 2KNHA 1Z23A 2C04A 3H65A 3O6XA 4K0DA 4O7GA 1MMGA 4LERA 2QTVA 4GEHA 3O39A 2NUPA 2J7PD 5KYUB 2PX3A 2R7QA 4IWBA 4ZLCA 1WGWA 4J30B 2OCCC 3N24A 4U5BE 4G7ZF 3LNRA 3LS0A 2A6HF 5KYXB 1QLEC 3ZVRA 2KW3C 4PFPA 5F5HA 2VB6A 3UGPA 2EIMC 3QMKA 2W9YA 5DS4A 3LJBA 4U5GA 2J46A 1FTSA 4YJWA 1V54C 2GFHA 2KQ9A 2YZSA 5BUOA 2P6VA 2W4BA 5L3QA 4I1OB 2CW0F 5E3CA 1FFTC 4XLPF 1ZHTA 3POVA 1LVKA 4XWJA 4Q5SF 2Y3DA 4KNVA 1JPJA 3DJNB 3ZC4A 1OCRC 1BR4A 3LLIA 1Z5ZA 4CIHA 4PFOA 2J9WA 2WZLA 4DVZA 4OIOF 4ZLDA 4RBNA 3ABKC 1S7ZA 2IOQA 4CS9A 3ABMC 3SYNA 2ZXPA 4AE4B 1OKKA 1SMYF 3EFOB 3Q6MA 3EGXA 3LEVA 3S0XA 2YEVA 3LESA 3Q7LA 3FHDA 5E3AA 2B0JA 4YT8A 3X1OA 1NZEA 3K66A 3T4RA 2IXOA 3DD7A 3W2VA 4HE8D 5KYXA 4HEAJ 4F4BA 3EHMA 4IAOA 4BEJA 5DS6A 1D1AA 1RJ9B 4CS9C 3GODA 3X2QC 3DXJF 3AG2C 2WVNA 3B0UX 2A1DD 3RIPA 2CNWA 3NYJA 3NRHA 3W2WA 4JJFA 4JJGA 2ZPAA 3EPVA 3KMIA 2KGOA 5DQTA 1TWCA 3NYLA 4BJTA 2J0XA 1M2OA 1PD1A 2X51A 4YT2A 4LLCA 5EHHA 2CGEA 3GANA 1ZHZA 4NY3A 1OKKD 4CS8A 1D1CA 2PF4E 2P7VA 2FGYA 3B0VC 1VYIA 2G3VA 4G7OF 3M1CB 3W8IA 4E7SA 4AE4A 3ASNC 1NU7D 5FCLA 1VOMA 4LACB 3ITFA 4J32B 2ZXWC 4U5FE 5IY5C 3JYHA 4DVYP 1TKNA 4QI2A 2XSEA 1ST6A 1J8YF 2CNWD 2O9XA 3JRTA 4C3BA 2R7UA 3VYWA 5D91A 2ZXOA 4KI2A 4PJJA 3UMIA 1KU2A 4YT5A 1D1BA 2Y69C 5D92A 2PP4A 4JCHA 3KH2A 2FFHA 2NUTB 3HLZA 3K1IC 2JD3A 3N2ZB 3KL4A 2R7XA 3TD7A 3S28A 3UR3C 4PK4A 2R7WA 4PJMA 3EH1A 4EBBA 4U5HA 3T6JA 1TWAA 3EG9A 3OA1A 2BE5F 3LS1A 4BJ6A 4JURI 2EIJC 4K7BA 2W45A 3F47A 4O6YA 3EZIA 1BR2A 3B9QA 4Q7CA 1IW7F 2VH3A 3OWTA 5HSWA 3NKEA 5L3VA 4GYTA 5T1DB 1NU9C 2D5RB 3PMRA 3RH3A 1O5HA 2H7BA 2PFDA 3EZHA 2WZGA 4KC9A 2V26A 2LSEA 2Q9CA 3MLGA 1JPNA 2Q9AA 3AQCA 4BJ6C 3EQLF 4LLEA 1LS1A 2R7VA 2C03A 4P6IC 2M4EA 4ANJA 5DLJA 5KYUA 4BG0A 2A68F 1ZHYA 3L34A 3LLKA 2IXPA 3FAJA 3NYMA 2XRHA 1ZYRF 3WG7C 2EILC 3DZAA 3AG4C 2G3KA 4IJJA 1Z3IX 4FWVA 3HTKC 2XXAB 2Y3GA 4OINF 3UNGC 4BJ5A 4A2NB 3NKDA 1Z6AA 3AG1C 1PD0A 3W8HA 4QDLA 4DOZA 2Y3BA 2R7SA 4U5CE 2A69F 2HV7A 4U5DE 3NG1A 4O6NA 1TWGA 1FFHA 1M2VB 4BJ5C 4U5EE 4C3EA 4HFFB 1D0YA 3UMHA 4HFKB 5CI9A 2Y39A 2I8BA 2XL4A 2MWQA 4AX2A 2EINC 4BJ1A 1NG1A 4OIQF 2IXMA 4JZAA 4OIRF 3F46A 4OD4A 3S27A 3K1HA 3SZRA 3S29A 3E70C 1SZIA 2L81A 3EFOA 5T3TA 4OIPF 2Z15A 2H7OA 4FX5A 2Q3TA 2WL8A 4ULWA 2V3CC 4C3DA 3B0PA 3EJNA 2KJGA 3ABLC 3KKBA 3HJCA 2DYRC 1J8MF 3L0IA 2WB7A 1M56C 4MQ9F 1RJ9A 1MNEA 1D0XA 4H4KC 2R7RA 1MMNA 2H7VC 3E9VA 1Z63A 1VK5A 3EHNA 1BR1A 3EGDB 1N1CA 2R7OA 4YWQA 4W8KA 1OCCC 1ZU4A 3QZCA 2J9UA 4PJNA 3N0TA 3I4UA 2OG2A 3ASOC 3I5PA 4G0HA 1M57C 4E7ZA 3SP1A 2EIKC 3EGXB 4Q4ZF 3T6BA 3ZG1A 5E2QA 1M2VA 3K6BA 2Y3HA 2IXNA 4OD5A 3CZ6A 4C7OB 3ZSUA 4JVSA 1G8XA 4N06A 4CSAA 5E33A 3V7OA 5DQZA 5EGYA 3LAYA 3JCUQ 1MMDA 1ZU5A 4I1MA 3JT1A 3OEOA 2DYSC 2DGJA 2A6EF 1TR2A 3CSKA 4G7HF 4IRUA 1LKXA 2HV6A 3PHF2 5KYYB 3DMDA 2MYSA 1OCZC 4CSAC 4B6IA 4M63A 3K33A 5B1BC 4RDAA 2PX0A 3MX3A 3Q6NA 4XTKA 3RKOF 4PJLA 3AG3C 5KYWB 3DAGA 4KBLA 2E87A 4WJ0A 3EGDA 3Q7GA 3DM5A 5F5FA 1PCXA 5KYNA 3ZIBA 1VMAA 1O87A 2NUTA 1OCOC 4CS7A 3NDBB 2WVOA 2J0WA 3RFYA 4EWCA 1FMVA 3SNHA 1VYKA 4KNWA 4I44A 2WVQA 3SEOA 3WODF 4JW1A 4C7OA 4MNDA 1SF8A 2NUPB 3JSZA 5B3SC 2IYLD 2L9JA 4X0RA 1MMAA 1D0ZA 2WZFA 1TWHA 4DBRA 3ECSA 5DVWA 3UMKA 3UGOA 4QI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y39 A;  3O39 A;  3ZG1 A;  2Y3G A;  3OEO A;  2Y3D A;  2Y3B A;  2Y3H A;  3QZC A;  3ITF A;  3LAY A;  3EPV A; 
#chains in the Genus database with same CATH topology
 1T6Q A;  1RKC A;  2Q9B A;  1FMW A;  2YHS A;  4NTB A;  4YT4 A;  1R4T A;  2CDQ A;  1MND A;  3AJM A;  4I3M A;  2J7P A;  2QY9 A;  3DM9 B;  3DE8 A;  3U9J A;  5KYY A;  3FVY A;  4NCQ A;  4DBQ A;  4JKV A;  3U8P A;  2G62 A;  2RD9 A;  4O6M A;  4RD9 A;  3I5Q A;  1ZHX A;  3AQB A;  3IEE A;  4YN0 B;  2J9V A;  1V55 C;  3QW1 A;  4N6H A;  4MS2 A;  5DS5 A;  2VAS A;  3K7D A;  1QZX A;  2KSF A;  2NG1 A;  4NTF A;  4Z9J A;  3EG9 B;  5KYW A;  2ZXR A;  3DJU B;  3HNJ A;  4O79 A;  2R7T A;  2R03 A;  1SR2 A;  2W4M A;  2XM0 A;  1EI7 A;  3EH2 A;  3RYL A;  3FDQ A;  1ZW2 A;  4AK9 A;  3DAF A;  2OJQ A;  2XXA A;  1LS4 A;  2B0H A;  2EPN A;  2L7A A;  5T3W A;  3CAX A;  3QVZ A;  4CJG A;  1OW6 A;  1QQ3 A;  1W2W A;  2PBE A;  2YLI A;  1IZM A;  3FAP B;  4AL0 A;  4CBE A;  4WGZ A;  5CI8 A;  4FES A;  3S90 A;  2DI3 A;  4LDR A;  1ZHW A;  3CQZ A;  1H6G A;  1V4A A;  1YDI A;  5B1A C;  3VAY A;  1FNT c;  4NTA A;  2J45 A;  2OJE D;  4XLN F;  4CS8 C;  4J7T A;  2KNH A;  3U5S A;  4CJO A;  1U0B B;  3MYI A;  4CDV A;  4YL0 A;  2FAP B;  1Z23 A;  2XLV A;  1VLS A;  2C04 A;  3H65 A;  2P61 A;  3IQ6 A;  3O6X A;  4K0D A;  4O7G A;  3TOL A;  1MMG A;  2XLM A;  3T6G B;  4LER A;  1A7V A;  2LIG A;  2QTV A;  4GEH A;  1C03 A;  3O39 A;  3O55 A;  2NUP A;  4MVZ A;  1OW8 A;  2J7P D;  5KYU B;  3U2M A;  2PX3 A;  3S9O A;  1WOL A;  2R7Q A;  3MYF A;  4IWB A;  4MVS A;  4ZLC A;  1HE1 A;  1YVI A;  1WGW A;  3FOP A;  2OOC A;  2OCC C;  4J30 B;  4JE9 A;  3N24 A;  4U5B E;  4ULV A;  4G7Z F;  2IBF A;  3LNR A;  4BEM J;  3LS0 A;  4E17 A;  2A6H F;  5KYX B;  3AOU A;  3LUT B;  1QLE C;  3ZVR A;  2KW3 C;  4PFP A;  4D4X A;  5F5H A;  2VCB A;  2VB6 A;  3UGP A;  2EIM C;  3QMK A;  2W9Y A;  5DS4 A;  3LJB A;  4XPX A;  4U5G A;  1JOG A;  1CPQ A;  1HE9 A;  2J46 A;  3RVZ A;  2OEV A;  1FTS A;  5A6J A;  4YJW A;  1V54 C;  2GFH A;  5COF A;  2KQ9 A;  4E18 A;  2YZS A;  5BUO A;  2P6V A;  1CGN A;  2W4B A;  1O3U A;  2R02 A;  2LQG A;  5L0J A;  5L3Q A;  3V5X A;  4I1O B;  2CW0 F;  2BL2 A;  1G5Z A;  5E3C A;  1FFT C;  5TJ5 E;  3DWW A;  2Q7R A;  3VM6 A;  4XLP F;  2GWW A;  1XWJ A;  1KNY A;  1ZHT A;  3KYJ A;  1A0B A;  2L6H A;  3POV A;  1LVK A;  1YA9 A;  2ICW G;  4XWJ A;  2VCA A;  1DOW A;  4XEV A;  4Q5S F;  1K05 A;  2Y3D A;  4KNV A;  1JPJ A;  3DJN B;  3ZC4 A;  3LNM B;  1OCR C;  1BR4 A;  3RW0 A;  3M4C A;  3LLI A;  4K1O A;  1H9T A;  3R2P A;  2KYH A;  2L6F A;  1Z5Z A;  1SYQ A;  4MW8 A;  4PFO A;  2J9W A;  4CIH A;  5JS5 A;  2WZL A;  2R9R B;  1OR2 A;  4DVZ A;  4OIO F;  4IAQ A;  4ZLD A;  4RBN A;  3ABK C;  1Z7Q c;  1YA7 O;  1S7Z A;  2YKZ A;  5A6K A;  1F1M A;  2IOQ A;  3C62 A;  3G4X A;  3MFN A;  4CS9 A;  3ABM C;  1QSP A;  5JRA A;  2EPK X;  4DRI B;  3SYN A;  3TQO A;  4EBJ A;  2ZXP A;  1B68 A;  2HZ8 A;  4AE4 B;  1OKK A;  1SMY F;  5A6A A;  3EFO B;  3Q6M A;  3R7C A;  3EGX A;  3LEV A;  3S0X A;  1UFB A;  2YL0 A;  1XZQ A;  2YEV A;  3LES A;  3Q7L A;  3FHD A;  5E3A A;  2B0J A;  3O10 A;  4YT8 A;  4CIP A;  3X1O A;  1NZE A;  3K66 A;  4D4N A;  3T4R A;  3BEH A;  2IXO A;  2MHR A;  2OQM A;  3DD7 A;  3W2V A;  2J9B A;  4HE8 D;  2NSG A;  5KYX A;  3JZ0 A;  4HEA J;  4F4B A;  3EHM A;  3QTH A;  4IAO A;  2LCH A;  4BEJ A;  5DS6 A;  4YL1 A;  3VF0 A;  1EKY A;  2YL7 A;  1D1A A;  1RJ9 B;  4CS9 C;  4UDV A;  3TOM A;  2HFI A;  3GOD A;  3X2Q C;  3DXJ F;  3AG2 C;  2WVN A;  1TQG A;  2EPO A;  2UUH A;  5HV9 A;  3B0U X;  2A1D D;  2LD6 A;  3ZTZ A;  1C17 M;  3RIP A;  4E0H A;  3US6 A;  2A0U A;  2CNW A;  3NYJ A;  3NRH A;  1ZZP A;  2VCC A;  1HW2 A;  4BPM A;  3GM2 A;  4JJF A;  4JJG A;  3W2W A;  2ZPA A;  2QLA A;  1S05 A;  1TFO B;  3EPV A;  3ZTM A;  1E85 A;  1I4Y A;  3KMI A;  3PDM P;  2KGO A;  1K40 A;  5DQT A;  1CGO A;  3B29 A;  1TWC A;  1CGM E;  3NYL A;  4BJT A;  3JYY A;  2J0X A;  1M2O A;  1PD1 A;  2X51 A;  2HMZ A;  4YT2 A;  4LLC A;  3G50 A;  2CGE A;  3GAN A;  1K04 A;  5EHH A;  1ZHZ A;  5JT4 A;  4NY3 A;  1OKK D;  4CS8 A;  1D1C A;  1U6H A;  2GDC A;  1OXK A;  5AC5 A;  1WWP A;  1BZ4 A;  1PV3 A;  1XZP A;  2PF4 E;  5CIV A;  1ORJ A;  4JTD B;  2P7V A;  1A7D A;  3NMJ A;  2JX0 A;  2FGY A;  3B0V C;  1VYI A;  5JLI A;  3JRM O;  2XLE A;  4JC7 A;  2EPL X;  1ORY A;  2G3V A;  4G7O F;  4JTC B;  1BDJ B;  2XL8 A;  1YAR O;  2XS1 A;  4ONS A;  1TFK B;  2QNL A;  2J8W A;  3HNI A;  3IHU A;  3M1C B;  5BQG A;  4JRZ A;  3C8G A;  3W8I A;  4E7S A;  4AE4 A;  2HS5 A;  2XLW A;  3ASN C;  1NU7 D;  5FCL A;  1VOM A;  1Y6D A;  2OEX A;  3ITF A;  4J32 B;  2ZXW C;  3IPM O;  4LAC B;  3JYH A;  2AVK A;  1TKN A;  4U5F E;  4DVY P;  5IY5 C;  2XSE A;  2XL6 A;  2QE9 A;  3K1I A;  1ST6 A;  4XQ1 A;  1J8Y F;  2CNW D;  3MBG A;  2O9X A;  2XLH A;  3JRT A;  1LI7 A;  1OXB A;  4C3B A;  3VYW A;  1HMD A;  2ZXO A;  5D91 A;  1E83 A;  3W4Y A;  1GM5 A;  4KI2 A;  2R7U A;  4PJJ A;  3V5Y A;  1M6T A;  1DOV A;  3UMI A;  3SXM A;  1HMO A;  1E2X A;  1KU2 A;  3V5Z A;  3NMK A;  4R32 A;  4E0I A;  4YK5 A;  4YT5 A;  1D1B A;  1Q0G A;  1VLT A;  1ZVZ A;  2AP3 A;  2D4U A;  1AEP A;  2Y69 C;  3M15 A;  2PP4 A;  4JCH A;  5D92 A;  1NLX A;  2QUP A;  3KH2 A;  3L8I A;  2FFH A;  2NUT B;  2NPU A;  2XM4 A;  2GAQ A;  2ETS A;  2LP4 A;  3HNL A;  3HLZ A;  2GA0 A;  3FXH A;  3K1I C;  2JD3 A;  2YWA A;  3QVY A;  1C02 A;  3N2Z B;  3KL4 A;  3TJ5 A;  1G4W R;  5AGF A;  5BQH A;  1RCP A;  3RQE A;  2R7X A;  3TD7 A;  1WAS A;  2BC5 A;  1GS9 A;  3S28 A;  5B3I A;  4IAR A;  4FAP B;  5F28 E;  4PK4 A;  2YLG A;  3UR3 C;  1YYX A;  4PJM A;  2R7W A;  1JAF A;  3EH1 A;  3VRC A;  4EBB A;  4U5H A;  3C8G D;  4JEB A;  3T6J A;  1TWA A;  3EG9 A;  4LDK A;  1VB5 A;  1HW1 A;  4YL3 A;  1A7E A;  3OA1 A;  2BE5 F;  1BBH A;  3LS1 A;  4BJ6 A;  4JEA A;  4JUR I;  2EIJ C;  4K7B A;  2W45 A;  3F47 A;  4O6Y A;  1Q0D A;  1AVO B;  1BR2 A;  3EZI A;  4JCZ A;  1QPU A;  3B9Q A;  3GEH A;  4Q7C A;  1WTY A;  1OR3 A;  1IW7 F;  2VH3 A;  4XPW A;  1T9K A;  3OWT A;  3IQ5 A;  4IGG A;  2CYD A;  1RXQ A;  3NKE A;  5L0D A;  5HSW A;  3DKA A;  5L3V A;  2I15 A;  4GYT A;  5T1D B;  1NU9 C;  2D5R B;  1ZW3 A;  3SXZ A;  3PMR A;  3C8Z A;  3RH3 A;  1APC A;  1O5H A;  4N6C A;  2H7B A;  3L1M A;  2PFD A;  3EZH A;  3TUL A;  3C18 A;  2WZG A;  4KC9 A;  2V26 A;  4PR9 A;  2AU5 A;  2LSE A;  1Q0K A;  2Q9C A;  3MLG A;  1JPN A;  3C7J A;  2Q9A A;  1L7C A;  2HUJ A;  3AQC A;  1RKE B;  4BJ6 C;  3EQL F;  4LLE A;  5L0F A;  1LS1 A;  256B A;  2R7V A;  2ASR A;  2XLD A;  2C03 A;  4DJ9 A;  2UUI A;  4P6I C;  4CDY A;  2VC9 A;  2M4E A;  4ANJ A;  1I4Z A;  3U2L A;  5DLJ A;  4MVQ A;  5KYU A;  4BG0 A;  3DI5 A;  5JP7 A;  1LIH A;  4EKW A;  2A68 F;  1ZHY A;  3L34 A;  3LLK A;  2IXP A;  3FAJ A;  3NYM A;  4DRJ B;  2XRH A;  3U9M A;  1ZYR F;  3WG7 C;  1WAT A;  2EIL C;  3DZA A;  5EK0 A;  3AG4 C;  2G3K A;  3GWL A;  3RQF A;  4EIY A;  1E84 A;  1T6I A;  4ER9 A;  4IJJ A;  1Z3I X;  4FWV A;  3HTK C;  3FMS A;  2XXA B;  2Y3G A;  4OIN F;  3UNG C;  1JR8 A;  2DB4 A;  4IB4 A;  4BJ5 A;  1NSG B;  4A2N B;  3NKD A;  4H54 A;  4MVM A;  1T6U A;  4MTG A;  1GQA A;  2HJ3 A;  3ZQY A;  1Z6A A;  1FAP B;  3AG1 C;  4MVU A;  1YJG A;  1PD0 A;  3W8H A;  5K0I A;  4MVR A;  4QDL A;  3H2V A;  3U3B A;  4DOZ A;  3SXK A;  1QVX A;  2Y3B A;  2R7S A;  1OQC A;  1Y4C A;  4LDQ A;  1LM3 B;  4U5C E;  5JVE A;  2A69 F;  2HV7 A;  4U5D E;  1YZA A;  4P9F A;  3NG1 A;  3NMI A;  4O6N A;  1TWG A;  2EPM X;  1FFH A;  1M2V B;  2XLO A;  4BJ5 C;  1L3P A;  4U5E E;  4C3E A;  4HFF B;  3KPH A;  1D0Y A;  3UMH A;  4DXW A;  4HFK B;  5CI9 A;  2Y39 A;  5AC4 A;  2I8B A;  2XL4 A;  1NFO A;  2MWQ A;  4AX2 A;  3TK0 A;  2EIN C;  1YLM A;  1YYJ A;  5L0I A;  1T01 A;  1Q0F A;  4BJ1 A;  1NG1 A;  2YL1 A;  4OIQ F;  1RKE A;  2NSF A;  2IXM A;  1Q0M A;  4JZA A;  3J06 A;  4OIR F;  3F46 A;  4OD4 A;  3S27 A;  3K1H A;  3SZR A;  2R05 A;  3S29 A;  3TJ6 A;  1T5O A;  3E70 C;  2HSQ A;  1SZI A;  1CPR A;  2L81 A;  3EFO A;  2HSB A;  5T3T A;  3PCV A;  4OIP F;  2Z15 A;  1EQ1 A;  2H7O A;  4FX5 A;  2Q3T A;  2WL8 A;  3C63 A;  4ULW A;  2V3C C;  1LPE A;  1I5N A;  4C3D A;  3B0P A;  3EJN A;  3GM1 A;  2KJG A;  3ABL C;  3KKB A;  1U89 A;  1WN0 A;  3FOO A;  3HJC A;  2DYR C;  1J8M F;  3IQT A;  3U3F A;  5BQI A;  3L0I A;  3M79 A;  4XEK A;  5JUA A;  1OW7 A;  1M56 C;  2WB7 A;  4MQ9 F;  1RJ9 A;  1MNE A;  1A41 A;  1V74 B;  1D0X A;  1R5I D;  2IM8 A;  1MMN A;  3GWN A;  1UG7 A;  2H7V C;  3E9V A;  4H4K C;  2R7R A;  1Z63 A;  4WAB A;  1VK5 A;  3EHN A;  4EBK A;  1BR1 A;  3EGD B;  1N1C A;  1FR0 A;  2R7O A;  1AUE A;  5A6B A;  3GEE A;  4YWQ A;  4W8K A;  4P9T A;  3CEX A;  1LE2 A;  1OCC C;  1ZU4 A;  2PNO A;  3QZC A;  4XPY A;  2J9U A;  3IQC A;  2JPU A;  4PJN A;  3N0T A;  3I4U A;  3H2U A;  3KYI A;  2OG2 A;  3ASO C;  3I5P A;  4G0H A;  2ZD9 A;  1M57 C;  4E7Z A;  3GEI A;  3SP1 A;  1KTM A;  1ORS C;  2EIK C;  3JTL O;  3EGX B;  5COG A;  4Q4Z F;  3T6B A;  1HY5 A;  3ZG1 A;  5E2Q A;  1M2V A;  3K6B A;  2Y3H A;  4CX9 A;  2IXN A;  2YVK A;  4OD5 A;  3CZ6 A;  3U8V A;  3G4Z A;  4C7O B;  3ZSU A;  1RMV A;  4JVS A;  1G8X A;  1NFN A;  3B71 A;  4L6R A;  4N06 A;  2YL3 A;  2RSE B;  3AGT A;  4N4W A;  3ZWI A;  4CSA A;  1JRA A;  2HKV A;  2Q00 A;  2A0B A;  2R25 A;  2CCY A;  4JTA B;  3HNK A;  4MW3 A;  4J7Y A;  5E33 A;  1MQV A;  2KC3 A;  3V7O A;  3BRJ A;  5DQZ A;  2LK4 A;  5EGY A;  3LAY A;  3A11 A;  3JCU Q;  2X0C A;  3SXY A;  1MMD A;  4NC3 A;  1ZU5 A;  3ZQV A;  4I1M A;  3JT1 A;  4W8P A;  4U9E A;  3AGU A;  3OEO A;  2DYS C;  3M4B A;  3RVY A;  2DGJ A;  2A6E F;  1TR2 A;  3CSK A;  3DE9 A;  4G7H F;  2AWY A;  3WAQ A;  4G78 A;  2Q4F A;  1LKX A;  2HV6 A;  2KK1 A;  4IRU A;  5KYY B;  3T9O A;  3PHF 2;  3DMD A;  5A6B D;  4A4A A;  2MYS A;  4QI2 A;  4PAC A;  1OCZ C;  4CSA C;  4B6I A;  4M63 A;  3K33 A;  5B1B C;  4RDA A;  2PX0 A;  3A9C A;  4NQF A;  3MX3 A;  3Q6N A;  2HJM A;  4XTK A;  2YQY A;  3U0C A;  3RKO F;  2H8A A;  3AG3 C;  4PJL A;  5L0G A;  5KYW B;  1GGQ A;  1EA8 A;  3DAG A;  4KBL A;  5COM A;  5FZT A;  3ZDL A;  2E87 A;  4EUK B;  4WJ0 A;  3EGD A;  3Q7G A;  5JSL A;  3DM5 A;  2YRF A;  5F5F A;  4CDA A;  1PCX A;  5KYN A;  2LFD A;  5A69 A;  3LEO A;  1VMA A;  1O87 A;  3HKK A;  2NUT A;  3ZIB A;  1OCO C;  4XEF A;  4CS7 A;  4Z9I A;  2P1A A;  1NBB A;  2TMV P;  3NDB B;  3ATP A;  3C8G B;  2OKU A;  2WVO A;  2J0W A;  1JMW A;  1LE4 A;  3RFY A;  4EWC A;  1H7I A;  2HMQ A;  1H9G A;  1QKR A;  2M64 A;  3GM3 A;  1FMV A;  3SNH A;  1VTM P;  1VYK A;  4KNW A;  2P0N A;  2XS8 A;  1LI5 A;  4I44 A;  3JSE O;  2WVQ A;  3SEO A;  3S84 A;  3WOD F;  4JIO A;  2OU6 A;  3L8J A;  2YLD A;  4GQH A;  4JW1 A;  4C7O A;  2LFF A;  4MND A;  2AWC A;  4MVO A;  4MTO A;  1SF8 A;  4U9D A;  2NUP B;  3GOR A;  3JSZ A;  5B3S C;  3QW0 A;  4MTF A;  4WGY A;  2IYL D;  2L9J A;  4X0R A;  5GPG B;  4DRH B;  1E86 A;  1YAU O;  1MMA A;  1G4U S;  1D0Z A;  1YZC A;  1TWH A;  2WZF A;  3WHN A;  4DBR A;  3ECS A;  5L0H A;  5DVW A;  3RQG A;  2L6G A;  3UMK A;  3UGO A;  5L0C A;  4EHP A;  2F22 A;  3RF3 A;  4Z9H A;  4AL1 A;  4QI0 A; 
#chains in the Genus database with same CATH homology
 2Q9B A;  1FMW A;  2YHS A;  4YT4 A;  2CDQ A;  1MND A;  4I3M A;  2J7P A;  2QY9 A;  3DM9 B;  5KYY A;  3FVY A;  4DBQ A;  2G62 A;  4RD9 A;  4O6M A;  3I5Q A;  1ZHX A;  3AQB A;  3IEE A;  4YN0 B;  2J9V A;  1V55 C;  5DS5 A;  2VAS A;  3K7D A;  1QZX A;  2NG1 A;  3EG9 B;  5KYW A;  2ZXR A;  3DJU B;  4O79 A;  2R7T A;  2W4M A;  3EH2 A;  3RYL A;  3FDQ A;  4AK9 A;  3DAF A;  2XXA A;  5T3W A;  1W2W A;  1IZM A;  4CBE A;  5CI8 A;  4FES A;  1ZHW A;  3CQZ A;  3VAY A;  5B1A C;  2J45 A;  4XLN F;  4CS8 C;  2KNH A;  1Z23 A;  2C04 A;  3H65 A;  3O6X A;  4K0D A;  4O7G A;  1MMG A;  4LER A;  2QTV A;  4GEH A;  3O39 A;  2NUP A;  2J7P D;  5KYU B;  2PX3 A;  2R7Q A;  4IWB A;  4ZLC A;  1WGW A;  4J30 B;  2OCC C;  3N24 A;  4U5B E;  4G7Z F;  3LNR A;  3LS0 A;  2A6H F;  5KYX B;  1QLE C;  3ZVR A;  2KW3 C;  4PFP A;  5F5H A;  2VB6 A;  3UGP A;  2EIM C;  3QMK A;  2W9Y A;  5DS4 A;  3LJB A;  4U5G A;  2J46 A;  1FTS A;  4YJW A;  1V54 C;  2GFH A;  2KQ9 A;  2YZS A;  5BUO A;  2P6V A;  2W4B A;  5L3Q A;  4I1O B;  2CW0 F;  5E3C A;  1FFT C;  4XLP F;  1ZHT A;  3POV A;  1LVK A;  4XWJ A;  4Q5S F;  2Y3D A;  4KNV A;  1JPJ A;  3DJN B;  3ZC4 A;  1OCR C;  1BR4 A;  3LLI A;  1Z5Z A;  4CIH A;  4PFO A;  2J9W A;  2WZL A;  4DVZ A;  4OIO F;  4ZLD A;  4RBN A;  3ABK C;  1S7Z A;  2IOQ A;  4CS9 A;  3ABM C;  3SYN A;  2ZXP A;  4AE4 B;  1OKK A;  1SMY F;  3EFO B;  3Q6M A;  3EGX A;  3LEV A;  3S0X A;  2YEV A;  3LES A;  3Q7L A;  3FHD A;  5E3A A;  2B0J A;  4YT8 A;  3X1O A;  1NZE A;  3K66 A;  3T4R A;  2IXO A;  3DD7 A;  3W2V A;  4HE8 D;  5KYX A;  4HEA J;  4F4B A;  3EHM A;  4IAO A;  4BEJ A;  5DS6 A;  1D1A A;  1RJ9 B;  4CS9 C;  3GOD A;  3X2Q C;  3DXJ F;  3AG2 C;  2WVN A;  3B0U X;  2A1D D;  3RIP A;  2CNW A;  3NYJ A;  3NRH A;  3W2W A;  4JJF A;  4JJG A;  2ZPA A;  3EPV A;  3KMI A;  2KGO A;  5DQT A;  1TWC A;  3NYL A;  4BJT A;  2J0X A;  1M2O A;  1PD1 A;  2X51 A;  4YT2 A;  4LLC A;  5EHH A;  2CGE A;  3GAN A;  1ZHZ A;  4NY3 A;  1OKK D;  4CS8 A;  1D1C A;  2PF4 E;  2P7V A;  2FGY A;  3B0V C;  1VYI A;  2G3V A;  4G7O F;  3M1C B;  3W8I A;  4E7S A;  4AE4 A;  3ASN C;  1NU7 D;  5FCL A;  1VOM A;  4LAC B;  3ITF A;  4J32 B;  2ZXW C;  4U5F E;  5IY5 C;  3JYH A;  4DVY P;  1TKN A;  4QI2 A;  2XSE A;  1ST6 A;  1J8Y F;  2CNW D;  2O9X A;  3JRT A;  4C3B A;  2R7U A;  3VYW A;  5D91 A;  2ZXO A;  4KI2 A;  4PJJ A;  3UMI A;  1KU2 A;  4YT5 A;  1D1B A;  2Y69 C;  5D92 A;  2PP4 A;  4JCH A;  3KH2 A;  2FFH A;  2NUT B;  3HLZ A;  3K1I C;  2JD3 A;  3N2Z B;  3KL4 A;  2R7X A;  3TD7 A;  3S28 A;  3UR3 C;  4PK4 A;  2R7W A;  4PJM A;  3EH1 A;  4EBB A;  4U5H A;  3T6J A;  1TWA A;  3EG9 A;  3OA1 A;  2BE5 F;  3LS1 A;  4BJ6 A;  4JUR I;  2EIJ C;  4K7B A;  2W45 A;  3F47 A;  4O6Y A;  3EZI A;  1BR2 A;  3B9Q A;  4Q7C A;  1IW7 F;  2VH3 A;  3OWT A;  5HSW A;  3NKE A;  5L3V A;  4GYT A;  5T1D B;  1NU9 C;  2D5R B;  3PMR A;  3RH3 A;  1O5H A;  2H7B A;  2PFD A;  3EZH A;  2WZG A;  4KC9 A;  2V26 A;  2LSE A;  2Q9C A;  3MLG A;  1JPN A;  2Q9A A;  3AQC A;  4BJ6 C;  3EQL F;  4LLE A;  1LS1 A;  2R7V A;  2C03 A;  4P6I C;  2M4E A;  4ANJ A;  5DLJ A;  5KYU A;  4BG0 A;  2A68 F;  1ZHY A;  3L34 A;  3LLK A;  2IXP A;  3FAJ A;  3NYM A;  2XRH A;  1ZYR F;  3WG7 C;  2EIL C;  3DZA A;  3AG4 C;  2G3K A;  4IJJ A;  1Z3I X;  4FWV A;  3HTK C;  2XXA B;  2Y3G A;  4OIN F;  3UNG C;  4BJ5 A;  4A2N B;  3NKD A;  1Z6A A;  3AG1 C;  1PD0 A;  3W8H A;  4QDL A;  4DOZ A;  2Y3B A;  2R7S A;  4U5C E;  2A69 F;  2HV7 A;  4U5D E;  3NG1 A;  4O6N A;  1TWG A;  1FFH A;  1M2V B;  4BJ5 C;  4U5E E;  4C3E A;  4HFF B;  1D0Y A;  3UMH A;  4HFK B;  5CI9 A;  2Y39 A;  2I8B A;  2XL4 A;  2MWQ A;  4AX2 A;  2EIN C;  4BJ1 A;  1NG1 A;  4OIQ F;  2IXM A;  4JZA A;  4OIR F;  3F46 A;  4OD4 A;  3S27 A;  3K1H A;  3SZR A;  3S29 A;  3E70 C;  1SZI A;  2L81 A;  3EFO A;  5T3T A;  4OIP F;  2Z15 A;  2H7O A;  4FX5 A;  2Q3T A;  2WL8 A;  4ULW A;  2V3C C;  4C3D A;  3B0P A;  3EJN A;  2KJG A;  3ABL C;  3KKB A;  3HJC A;  2DYR C;  1J8M F;  3L0I A;  2WB7 A;  1M56 C;  4MQ9 F;  1RJ9 A;  1MNE A;  1D0X A;  4H4K C;  2R7R A;  1MMN A;  2H7V C;  3E9V A;  1Z63 A;  1VK5 A;  3EHN A;  1BR1 A;  3EGD B;  1N1C A;  2R7O A;  4YWQ A;  4W8K A;  1OCC C;  1ZU4 A;  3QZC A;  2J9U A;  4PJN A;  3N0T A;  3I4U A;  2OG2 A;  3ASO C;  3I5P A;  4G0H A;  1M57 C;  4E7Z A;  3SP1 A;  2EIK C;  3EGX B;  4Q4Z F;  3T6B A;  3ZG1 A;  5E2Q A;  1M2V A;  3K6B A;  2Y3H A;  2IXN A;  4OD5 A;  3CZ6 A;  4C7O B;  3ZSU A;  4JVS A;  1G8X A;  4N06 A;  4CSA A;  5E33 A;  3V7O A;  5DQZ A;  5EGY A;  3LAY A;  3JCU Q;  1MMD A;  1ZU5 A;  4I1M A;  3JT1 A;  3OEO A;  2DYS C;  2DGJ A;  2A6E F;  1TR2 A;  3CSK A;  4G7H F;  4IRU A;  1LKX A;  2HV6 A;  3PHF 2;  5KYY B;  3DMD A;  2MYS A;  1OCZ C;  4CSA C;  4B6I A;  4M63 A;  3K33 A;  5B1B C;  4RDA A;  2PX0 A;  3MX3 A;  3Q6N A;  4XTK A;  3RKO F;  4PJL A;  3AG3 C;  5KYW B;  3DAG A;  4KBL A;  2E87 A;  4WJ0 A;  3EGD A;  3Q7G A;  3DM5 A;  5F5F A;  1PCX A;  5KYN A;  3ZIB A;  1VMA A;  1O87 A;  2NUT A;  1OCO C;  4CS7 A;  3NDB B;  2WVO A;  2J0W A;  3RFY A;  4EWC A;  1FMV A;  3SNH A;  1VYK A;  4KNW A;  4I44 A;  2WVQ A;  3SEO A;  3WOD F;  4JW1 A;  4C7O A;  4MND A;  1SF8 A;  2NUP B;  3JSZ A;  5B3S C;  2IYL D;  2L9J A;  4X0R A;  1MMA A;  1D0Z A;  2WZF A;  1TWH A;  4DBR A;  3ECS A;  5DVW A;  3UMK A;  3UGO A;  4QI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...