3OEOA

The crystal structure e. coli spy
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
KDLNLTDAQKQQIREIMKGQRDQMKRPPLEERRAMHDIITSDTFDKVKAEAQIAKMEEQRKANMLAHMETQNKIYNILTPEQKKQFNANFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spheroplast protein Y
publication title The crystal structure Escherichia coli Spy.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 20
structure length 91
sequence length 91
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07813 LTXXQ LTXXQ motif family protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3oeoA00
3ITFA 3OEOA 2Y3BA 2Y3DA 3ZG1A 3O39A 2Y39A 2Y3GA 2Y3HA 3EPVA 3LAYA 3QZCA
chains in the Genus database with same CATH superfamily
5B3IA 2A6EF 4J7TA 1SYQA 3AG1C 4EWCA 3CAXA 1LS4A 2Y69C 3U9MA 1ZHTA 5L3VA 5JUAA 4LDKA 4RDAA 4G7ZF 5AGFA 4E7SA 5GPGB 2AVKA 3U3FA 1SR2A 3AG3C 4BEJA 4CX9A 3ZVRA 1YA9A 2VB6A 3HNKA 1JRAA 4BJ6A 5B3SC 1LKXA 1Q0KA 3Q6MA 1J8MF 2EPLX 3QW1A 1RKEA 4N4WA 1OQCA 4EHPA 1VYIA 3EG9A 3SXYA 1KU2A 5EHHA 3EJNA 3DAFA 1JPNA 3PHF2 1B68A 4XLNF 1ZZPA 3V7OA 3IPMO 1VYKA 2GWWA 4A2NB 3G4XA 3EFOB 2IXPA 3EGDB 3K1IC 1R4TA 1DOWA 3NMJA 1TWAA 1HE9A 4QI0A 1GGQA 4E0HA 3X2QC 4NY3A 5KYNA 2MYSA 3TOLA 3U8VA 4XPXA 1DOVA 2KGOA 2XSEA 2X0CA 2XLHA 2NSFA 4CSAC 1BBHA 1FMVA 2LSEA 3B29A 3HJCA 1ZW3A 4ANJA 1XWJA 1OCOC 4MTFA 1OR3A 1UG7A 2FFHA 4U5CE 3RQFA 2XS8A 4Q4ZF 3DKAA 3EPVA 3LS1A 2EIKC 3SP1A 2XLWA 3HNJA 1H7IA 2V26A 3CQZA 3TK0A 3S0XA 4DBRA 2HKVA 3C18A 4G78A 2JPUA 2QE9A 2ETSA 3DXJF 3RVYA 4BJ6C 4GQHA 2IBFA 5BQGA 1FFHA 3UNGC 1D0YA 3L1MA 5FCLA 4YWQA 4BJ5C 1QQ3A 5L0GA 2R03A 1O3UA 1QSPA 3AGTA 3C63A 3Q7LA 4NQFA 1PD0A 4WABA 3HNIA 5F5FA 1VLTA 1PD1A 1U6HA 2C04A 2IXMA 3GEIA 3S29A 2CW0F 2HS5A 1MMNA 3S90A 4W8KA 4LLCA 2YLDA 2VCAA 2L6FA 1Z23A 3JT1A 2EPNA 3M1CB 2DYRC 4RD9A 2XM4A 4DOZA 2G3VA 1K05A 3MX3A 1ORSC 1OW6A 1KNYA 3C8GB 3US6A 4AE4A 5DQZA 4U5DE 3VYWA 2NSGA 2R7OA 1NFOA 3FOPA 4LLEA 3WHNA 3QMKA 2ZXPA 1AVOB 3RW0A 4JEAA 2XLMA 3T6GB 3DE9A 4MVSA 3WG7C 1G4WR 2A0BA 3H2VA 1TFKB 2CGEA 2R25A 5E3CA 1O5HA 3FAPB 1MMGA 5JP7A 4JJFA 4A4AA 1YJGA 2J9UA 2XL8A 4ER9A 4XPYA 4MVOA 1QPUA 3U2MA 3W4YA 4IAOA 1BR4A 3HNLA 1J8YF 1A7EA 4WJ0A 1K40A 2PP4A 4Z9JA 1G8XA 2R7RA 3C7JA 1V55C 2Y3DA 3BEHA 3EGXB 2LCHA 5EGYA 1R5ID 4CIHA 1ZYRF 2IYLD 3G4ZA 4N6HA 5DS5A 5KYUB 2PBEA 1RJ9A 2J7PD 1HW1A 2L9JA 4CBEA 1ZHZA 2BC5A 2PFDA 2WVOA 2XS1A 3GWNA 3GM1A 3N2ZB 4MVUA 4PJMA 3SNHA 3FHDA 3DD7A 5A6BA 5JVEA 2BL2A 4Z9IA 2KC3A 2J9BA 1VOMA 2WB7A 2PX0A 4FWVA 3GWLA 4IAQA 5JT4A 1H9TA 4E17A 4AX2A 2MHRA 3B9QA 1NSGB 4CDAA 2QNLA 3T6JA 4F4BA 3LUTB 3B0PA 1CGOA 4IRUA 5L0FA 1YVIA 4YL0A 1N1CA 4YN0B 3AGUA 3DJNB 3ECSA 5T3TA 3RYLA 3HLZA 4CIPA 1LI7A 3IQ5A 3WAQA 4ULWA 3S84A 2HJMA 2CYDA 2R7QA 3JYHA 3NMIA 4G0HA 3GORA 1JAFA 1TKNA 4NTBA 2HMQA 1VTMP 2XL6A 2ICWG 4P9TA 3AJMA 3AG2C 1M57C 2XLOA 3S28A 1D0ZA 1YARO 2DGJA 4GYTA 2QY9A 1A0BA 3C62A 2XRHA 3OWTA 4NC3A 5EK0A 3UMHA 3UMKA 3RQEA 1TFOB 5KYWA 5D92A 4EBBA 1MNDA 5IY5C 1Z3IX 3NRHA 2W4BA 4C3DA 2DB4A 4JE9A 1RXQA 1YZCA 4YL1A 3WODF 2CNWD 1M2VA 1Q0FA 4J7YA 2KSFA 1O87A 3JRTA 1UFBA 2M4EA 3W8IA 4G7HF 3I5QA 4LACB 4XEVA 4DRHB 5KYWB 1EA8A 4IB4A 3K1IA 5DVWA 1YZAA 3E9VA 2VCCA 1WTYA 4KNWA 4OINF 3KYIA 2A1DD 3ATPA 3K6BA 3DAGA 3TJ6A 1H9GA 2I15A 2ZXRA 1NU9C 4PACA 1IW7F 2G62A 2NUPA 3K33A 4CSAA 3EHNA 4PFPA 1E86A 3RFYA 4YT5A 2OG2A 5DLJA 1FTSA 2B0JA 2P61A 3IQCA 3T6BA 1LE4A 3L34A 3X1OA 1JPJA 1YYXA 5F28E 2EINC 1WOLA 3RF3A 5DS4A 4K7BA 4CS8C 3S9OA 2HJ3A 5JS5A 4E7ZA 3TULA 1QKRA 1Y4CA 2EPKX 3F47A 4MTGA 3FOOA 2VH3A 3VAYA 2DYSC 2MWQA 4BJ1A 1WWPA 3ASOC 3QW0A 3JTLO 4OD5A 1ST6A 4BJ5A 3POVA 1VMAA 3RVZA 2KQ9A 1FNTc 3TQOA 1FFTC 2LFFA 2WZLA 3ZTZA 1FAPB 3JZ0A 1QZXA 2A69F 4MVMA 5CIVA 3TJ5A 1RKEB 3I5PA 3ZTMA 4CS9A 3EG9B 1MNEA 5AC5A 4OIPF 2D5RB 4JVSA 3ABLC 3GM3A 2QUPA 4BPMA 4W8PA 3S27A 2EILC 3ZWIA 2HV6A 3RQGA 4BEMJ 5L0IA 2GA0A 1OKKA 1L7CA 1SF8A 4N06A 5BUOA 4JEBA 2VCBA 1SMYF 2EPMX 1ZU5A 1GQAA 1ZHYA 256BA 2ZPAA 4J32B 2WZGA 1S7ZA 3JSEO 2HV7A 3KMIA 3PMRA 2YL1A 4DJ9A 4JTCB 3CZ6A 2IOQA 2F22A 5CI9A 4JCHA 3UGOA 1W2WA 3IEEA 5B1AC 3TOMA 2YKZA 2KW3C 1A41A 4P9FA 2GAQA 5A6KA 3C8GD 4CS9C 3SEOA 1KTMA 3AOUA 3J06A 1T01A 5CI8A 2R7XA 2EIJC 2YQYA 2IM8A 3M79A 2B0HA 4XWJA 3U9JA 1QLEC 2J46A 3NKEA 2OJQA 1MMDA 1OW8A 1YA7O 2QLAA 3K66A 3IHUA 1MQVA 3EZHA 4JW1A 4JTAB 2E87A 4MNDA 5BQIA 1NLXA 2XLDA 4AE4B 2IXOA 3MYIA 4HEAJ 5B1BC 1LI5A 2BE5F 4E18A 3HTKC 4WGZA 3L0IA 3L8JA 1YLMA 2HSQA 2HUJA 4C3EA 5E3AA 1Y6DA 4KC9A 3MYFA 4HFFB 3LESA 1AUEA 3Q7GA 3L8IA 2HZ8A 4PJLA 3M4BA 1YYJA 3DJUB 1Z5ZA 4BJTA 3QVYA 3FDQA 1E85A 1OR2A 1L3PA 3A9CA 3FVYA 3IQ6A 5A69A 3ASNC 4PR9A 2LQGA 3OEOA 4JRZA 1H6GA 3ZC4A 5L0CA 3ABKC 2R7UA 1TQGA 4JJGA 2Y3BA 1T5OA 4MW3A 2YLGA 2DI3A 4JIOA 2A68F 4OIQF 4EBKA 5JRAA 2J0XA 4MTOA 3KL4A 2RSEB 2ZD9A 5COMA 5COFA 2QTVA 4JURI 3ZQYA 1G5ZA 3LNMB 2NUTA 1RJ9B 3EH2A 4ONSA 3NYMA 5A6BD 3FMSA 2AU5A 5FZTA 5T3WA 4AL0A 2L6HA 3EQLF 1D1AA 4C3BA 2KJGA 4JKVA 4O6NA 3M4CA 4XEKA 2YL3A 2XM0A 2IXNA 2YHSA 2OJED 3GODA 3LLKA 4NTFA 3TD7A 4Q5SF 2ZXOA 4B6IA 1BR2A 3O10A 1NG1A 4RBNA 2JX0A 2VASA 2VC9A 4NTAA 4Z9HA 3W2WA 2J8WA 4MVQA 4CS8A 5KYXA 4I3MA 2RD9A 1LS1A 1M56C 1M2OA 1V4AA 4MQ9F 3I4UA 2WVQA 1JR8A 2YWAA 4EBJA 1MMAA 4K0DA 5E2QA 3T9OA 4LDQA 1S05A 2H7VC 4I1MA 3MFNA 4IJJA 1T6UA 5KYXB 1V74B 4EIYA 3AQBA 1TWCA 4AL1A 1C02A 2YL7A 1EKYA 1TWGA 4O6YA 4U5EE 3FAJA 1YAUO 3N0TA 4L6RA 3BRJA 1RKCA 4WGYA 3ZIBA 3NDBB 4BG0A 2Q7RA 5TJ5E 1I5NA 1D1CA 1Z7Qc 1D1BA 1A7VA 1M2VB 2C03A 2YLIA 5JLIA 5KYYA 2V3CC 1M6TA 2YEVA 1HY5A 1C03A 1V54C 1G4US 3AG4C 4E0IA 3U2LA 2XXAA 1YDIA 3SYNA 4YT8A 2J9VA 5JSLA 5COGA 2CNWA 1SZIA 3GEHA 1OXBA 2JD3A 5KYYB 2NUPB 2UUIA 4KBLA 2AP3A 4U5GA 3JCUQ 1RMVA 1XZQA 3V5XA 3H2UA 2FAPB 2LIGA 3T4RA 1T9KA 3QZCA 2KNHA 1A7DA 2R9RB 1PCXA 1CGME 4U9DA 1CGNA 3UR3C 4DVYP 3O55A 1EQ1A 1I4ZA 1OCZC 1LE2A 2WVNA 3QTHA 3R2PA 4K1OA 3NMKA 5L0HA 2J9WA 2Q00A 1ZHWA 4U5FE 1E84A 3O6XA 3SXZA 1T6IA 4OD4A 4HE8D 2G3KA 2YL0A 4YL3A 2KYHA 2AWCA 2AWYA 5AC4A 2XL4A 4LDRA 1Q0DA 1HMOA 3H65A 3SXKA 1K04A 3Q6NA 3G50A 4D4NA 4MS2A 2EIMC 3AQCA 2PNOA 1ZU4A 4CDVA 1NFNA 2XLVA 2GFHA 4G7OF 3IQTA 3EFOA 3EGDA 2UUHA 3N24A 4DBQA 3O39A 4KNVA 3VF0A 2LFDA 2TMVP 2WL8A 1Z63A 2A6HF 2OKUA 3K1HA 3NYLA 4AK9A 1OKKD 4PK4A 4OIRF 1HW2A 3QVZA 4X0RA 3EH1A 4EUKB 1ZHXA 4JCZA 1ZVZA 1Q0GA 2YVKA 3RH3A 2YRFA 4DRJB 4J30B 1JMWA 2L81A 4R32A 1E83A 2D4UA 3ABMC 3SZRA 3VM6A 2J45A 2LD6A 1U0BB 4PJNA 3HKKA 3MLGA 1OCRC 3JRMO 2PX3A 3LLIA 1QVXA 4YK5A 2HFIA 2OQMA 4FAPB 4C7OA 4ZLDA 2P1AA 4IGGA 3M15A 3EHMA 1NU7D 3RIPA 2R7VA 3U5SA 1WGWA 4YT2A 2H7BA 2H8AA 2Y3HA 3B71A 3JYYA 3LS0A 4PFOA 4MVZA 4O6MA 2OCCC 4U5BE 4P6IC 5A6AA 4XLPF 2R05A 4JC7A 1NBBA 4C7OB 1LVKA 3ZG1A 1PV3A 3W8HA 4LERA 1C17M 1ZW2A 2L7AA 2CCYA 3NYJA 3A11A 4H54A 3V5ZA 3R7CA 1TWHA 3MBGA 4IARA 1D0XA 3C8GA 1LM3B 1GM5A 4XTKA 2KK1A 5HSWA 3E70C 2W4MA 1Q0MA 2OOCA 3DM5A 3ZSUA 3KH2A 4DVZA 1RCPA 4NCQA 3LAYA 4U9EA 3UMIA 4D4XA 2P0NA 4OIOF 1VLSA 1Z6AA 2I8BA 3DWWA 2HMZA 3ZDLA 5HV9A 3U3BA 3FXHA 1EI7A 4U5HA 3ZQVA 2X51A 3SXMA 2R02A 4MVRA 2GDCA 2Z15A 1BR1A 4UDVA 4EKWA 1U89A 4DXWA 1WATA 2PF4E 5DS6A 3KYJA 3V5YA 3EGXA 1I4YA 3LEOA 3LJBA 5E33A 1E2XA 1LIHA 4HFKB 3PCVA 1ORYA 1WN0A 1BZ4A 3K7DA 1LPEA 2Y3GA 3CSKA 4YJWA 5KYUA 3RKOF 4CS7A 2R7WA 1WASA 3GM2A 2NUTB 4XEFA 1ORJA 2J7PA 4FX5A 2Q9BA 5L3QA 2FGYA 2YZSA 4DRIB 2Q9CA 4QI2A 3PDMP 4PJJA 3UGPA 2ASRA 1FMWA 3U8PA 2ZXWC 2HSBA 1CPQA 3GANA 4GEHA 3F46A 1VK5A 2OEXA 2OU6A 4I1OB 4QDLA 4MW8A 3U0CA 1JOGA 4CDYA 1CPRA 2R7TA 1IZMA 2OEVA 4O79A 1OXKA 5T1DB 4CJGA 2A0UA 2H7OA 3DE8A 4CJOA 4JZAA 4XPWA 2EPOA 1VB5A 1FR0A 4KI2A 2LK4A 1HE1A 3OA1A 4O7GA 2P6VA 3C8ZA 3VRCA 2J0WA 3CEXA 4N6CA 5DQTA 5A6JA 3KPHA 4ULVA 3EZIA 3B0VC 1OCCC 3GEEA 5L0JA 4H4KC 2LP4A 1BDJB 3LNRA 1F1MA 4FESA 2R7SA 2Q9AA 3LEVA 3ITFA 2XLEA 4I44A 5L0DA 3DI5A 4Q7CA 5BQHA 4YT4A 5F5HA 5K0IA 3JSZA 1TR2A 2O9XA 2W45A 3B0UX 3DMDA 1GS9A 2L6GA 3NKDA 2Q3TA 2XXAB 3W2VA 1HMDA 1APCA 1T6QA 4ZLCA 2Q4FA 1NZEA 2W9YA 2NPUA 3KKBA 3DM9B 1AEPA 1XZPA 2WZFA 5D91A 2CDQA 3NG1A 2Y39A 4JTDB 2M64A 4M63A 2P7VA 4XQ1A 4IWBA 2NG1A 1OW7A 3DZAA
chains in the Genus database with same CATH topology
2A6EF 3AG1C 4EWCA 2Y69C 1ZHTA 5L3VA 4RDAA 4G7ZF 4E7SA 3AG3C 4BEJA 3ZVRA 2VB6A 4BJ6A 5B3SC 1LKXA 3Q6MA 1J8MF 1VYIA 3EG9A 1KU2A 5EHHA 3EJNA 3DAFA 1JPNA 3PHF2 4XLNF 3V7OA 1VYKA 4A2NB 3EFOB 2IXPA 3EGDB 3K1IC 1TWAA 4QI0A 3X2QC 4NY3A 5KYNA 2MYSA 2KGOA 2XSEA 4CSAC 1FMVA 2LSEA 3HJCA 4ANJA 1OCOC 4U5CE 2FFHA 4Q4ZF 3LS1A 3EPVA 3SP1A 2EIKC 2V26A 3CQZA 3S0XA 4DBRA 3DXJF 4BJ6C 1FFHA 3UNGC 1D0YA 5FCLA 4YWQA 4BJ5C 3Q7LA 1PD0A 5F5FA 3S29A 1PD1A 2C04A 2IXMA 2CW0F 1MMNA 4W8KA 4LLCA 1Z23A 3JT1A 3M1CB 4RD9A 2DYRC 4DOZA 2G3VA 3MX3A 4AE4A 5DQZA 4U5DE 3VYWA 2R7OA 4LLEA 3QMKA 2ZXPA 3WG7C 2CGEA 5E3CA 1O5HA 1MMGA 4JJFA 2J9UA 4IAOA 1BR4A 1J8YF 4WJ0A 2PP4A 2R7RA 1G8XA 1V55C 2Y3DA 3EGXB 5EGYA 4CIHA 1ZYRF 2IYLD 5DS5A 5KYUB 1RJ9A 2J7PD 4CBEA 2L9JA 1ZHZA 2PFDA 2WVOA 3N2ZB 4PJMA 3SNHA 3FHDA 3DD7A 1VOMA 2WB7A 2PX0A 4FWVA 4AX2A 3B9QA 3T6JA 4F4BA 3B0PA 4IRUA 1N1CA 4YN0B 3DJNB 3ECSA 5T3TA 3RYLA 3HLZA 4ULWA 3JYHA 2R7QA 4G0HA 1TKNA 3AG2C 1M57C 3S28A 1D0ZA 2DGJA 4GYTA 2QY9A 3UMHA 3UMKA 2XRHA 3OWTA 5KYWA 5D92A 4EBBA 1MNDA 5IY5C 1Z3IX 3NRHA 2W4BA 4C3DA 3WODF 2CNWD 1M2VA 1O87A 3JRTA 2M4EA 3W8IA 4G7HF 3I5QA 4LACB 5KYWB 5DVWA 3E9VA 4KNWA 4OINF 2A1DD 3K6BA 3DAGA 2ZXRA 1NU9C 1IW7F 2G62A 2NUPA 3K33A 4CSAA 3EHNA 4PFPA 3RFYA 4YT5A 2OG2A 5DLJA 1FTSA 2B0JA 3T6BA 3L34A 3X1OA 1JPJA 2EINC 5DS4A 4K7BA 4CS8C 4E7ZA 3F47A 3VAYA 2VH3A 2DYSC 2MWQA 4BJ1A 3ASOC 4OD5A 1ST6A 4BJ5A 3POVA 1VMAA 2KQ9A 1FFTC 2WZLA 1QZXA 2A69F 3I5PA 4CS9A 3EG9B 1MNEA 4OIPF 2D5RB 4JVSA 3ABLC 3S27A 2EILC 2HV6A 1OKKA 4N06A 1SF8A 5BUOA 1SMYF 1ZU5A 1ZHYA 2ZPAA 4J32B 2WZGA 1S7ZA 2HV7A 3KMIA 3PMRA 3CZ6A 2IOQA 5CI9A 4JCHA 3UGOA 1W2WA 3IEEA 5B1AC 2KW3C 4CS9C 3SEOA 5CI8A 2R7XA 2EIJC 4XWJA 1QLEC 2J46A 3NKEA 1MMDA 3K66A 3EZHA 4JW1A 2E87A 4MNDA 4AE4B 2IXOA 4HEAJ 5B1BC 2BE5F 3HTKC 3L0IA 4C3EA 5E3AA 4KC9A 4HFFB 3LESA 3Q7GA 4PJLA 3DJUB 1Z5ZA 4BJTA 3FDQA 3FVYA 3ASNC 2R7UA 3OEOA 3ZC4A 3ABKC 4JJGA 2Y3BA 4OIQF 2A68F 2J0XA 3KL4A 2QTVA 4JURI 2NUTA 1RJ9B 3EH2A 3NYMA 5T3WA 3EQLF 1D1AA 4C3BA 2KJGA 4O6NA 2IXNA 2YHSA 3GODA 3LLKA 3TD7A 4Q5SF 2ZXOA 4B6IA 1BR2A 1NG1A 4RBNA 2VASA 3W2WA 4CS8A 5KYXA 4I3MA 4MQ9F 1LS1A 1M56C 1M2OA 3I4UA 2WVQA 1MMAA 4K0DA 5E2QA 4I1MA 2H7VC 4IJJA 5KYXB 3AQBA 1TWCA 1TWGA 4O6YA 4U5EE 3FAJA 3N0TA 3ZIBA 3NDBB 4BG0A 1D1CA 1D1BA 1M2VB 2C03A 5KYYA 2V3CC 2YEVA 1V54C 3AG4C 2XXAA 4YT8A 3SYNA 2J9VA 2CNWA 1SZIA 2JD3A 5KYYB 2NUPB 4KBLA 4U5GA 3JCUQ 3T4RA 3QZCA 2KNHA 1PCXA 3UR3C 4DVYP 1OCZC 2WVNA 2J9WA 1ZHWA 4U5FE 3O6XA 4OD4A 4HE8D 2G3KA 2XL4A 3H65A 3Q6NA 2EIMC 3AQCA 1ZU4A 4G7OF 2GFHA 3EFOA 3EGDA 3N24A 4DBQA 3O39A 4KNVA 2WL8A 1Z63A 2A6HF 4AK9A 3K1HA 3NYLA 1OKKD 4PK4A 4OIRF 4X0RA 3EH1A 1ZHXA 3RH3A 4J30B 2L81A 3ABMC 3SZRA 2J45A 4PJNA 3MLGA 1OCRC 3LLIA 2PX3A 4C7OA 4ZLDA 3EHMA 1NU7D 3RIPA 2R7VA 1WGWA 4YT2A 2H7BA 2Y3HA 3LS0A 4PFOA 4O6MA 2OCCC 4U5BE 4P6IC 4XLPF 4C7OB 1LVKA 3ZG1A 3W8HA 4LERA 3NYJA 1TWHA 1D0XA 4XTKA 5HSWA 3E70C 2W4MA 3DM5A 3ZSUA 3KH2A 4DVZA 3LAYA 3UMIA 4OIOF 1Z6AA 2I8BA 4U5HA 2X51A 2Z15A 1BR1A 2PF4E 5DS6A 3EGXA 5E33A 3LJBA 4HFKB 3K7DA 2Y3GA 3CSKA 5KYUA 4YJWA 3RKOF 2R7WA 4CS7A 2NUTB 2J7PA 4FX5A 2Q9BA 5L3QA 2FGYA 2YZSA 2Q9CA 4QI2A 4PJJA 3UGPA 1FMWA 2ZXWC 3GANA 4GEHA 3F46A 1VK5A 4I1OB 4QDLA 2R7TA 1IZMA 4O79A 5T1DB 2H7OA 4JZAA 4KI2A 3OA1A 4O7GA 2P6VA 2J0WA 5DQTA 3EZIA 3B0VC 1OCCC 4H4KC 3LNRA 4FESA 2R7SA 2Q9AA 3LEVA 3ITFA 4I44A 4Q7CA 4YT4A 5F5HA 3JSZA 1TR2A 2O9XA 2W45A 3B0UX 3DMDA 3NKDA 2XXAB 2Q3TA 3W2VA 4ZLCA 1NZEA 2W9YA 3KKBA 3DM9B 2WZFA 5D91A 2CDQA 3NG1A 2Y39A 4M63A 2P7VA 4IWBA 2NG1A 3DZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ITF A;  3OEO A;  2Y3B A;  2Y3D A;  3ZG1 A;  3O39 A;  2Y39 A;  2Y3G A;  2Y3H A;  3EPV A;  3LAY A;  3QZC A; 
#chains in the Genus database with same CATH topology
 5B3I A;  2A6E F;  4J7T A;  1SYQ A;  3AG1 C;  4EWC A;  3CAX A;  1LS4 A;  2Y69 C;  3U9M A;  1ZHT A;  5L3V A;  5JUA A;  4LDK A;  4RDA A;  4G7Z F;  5AGF A;  4E7S A;  5GPG B;  2AVK A;  3U3F A;  1SR2 A;  3AG3 C;  4BEJ A;  4CX9 A;  3ZVR A;  1YA9 A;  2VB6 A;  3HNK A;  1JRA A;  4BJ6 A;  5B3S C;  1LKX A;  1Q0K A;  3Q6M A;  1J8M F;  2EPL X;  3QW1 A;  1RKE A;  4N4W A;  1OQC A;  4EHP A;  1VYI A;  3EG9 A;  3SXY A;  1KU2 A;  5EHH A;  3EJN A;  3DAF A;  1JPN A;  3PHF 2;  1B68 A;  4XLN F;  1ZZP A;  3V7O A;  3IPM O;  1VYK A;  2GWW A;  4A2N B;  3G4X A;  3EFO B;  2IXP A;  3EGD B;  3K1I C;  1R4T A;  1DOW A;  3NMJ A;  1TWA A;  1HE9 A;  4QI0 A;  1GGQ A;  4E0H A;  3X2Q C;  4NY3 A;  5KYN A;  2MYS A;  3TOL A;  3U8V A;  4XPX A;  1DOV A;  2KGO A;  2XSE A;  2X0C A;  2XLH A;  2NSF A;  4CSA C;  1BBH A;  1FMV A;  2LSE A;  3B29 A;  3HJC A;  1ZW3 A;  4ANJ A;  1XWJ A;  1OCO C;  4MTF A;  1OR3 A;  1UG7 A;  2FFH A;  4U5C E;  3RQF A;  2XS8 A;  4Q4Z F;  3DKA A;  3EPV A;  3LS1 A;  2EIK C;  3SP1 A;  2XLW A;  3HNJ A;  1H7I A;  2V26 A;  3CQZ A;  3TK0 A;  3S0X A;  4DBR A;  2HKV A;  3C18 A;  4G78 A;  2JPU A;  2QE9 A;  2ETS A;  3DXJ F;  3RVY A;  4BJ6 C;  4GQH A;  2IBF A;  5BQG A;  1FFH A;  3UNG C;  1D0Y A;  3L1M A;  5FCL A;  4YWQ A;  4BJ5 C;  1QQ3 A;  5L0G A;  2R03 A;  1O3U A;  1QSP A;  3AGT A;  3C63 A;  3Q7L A;  4NQF A;  1PD0 A;  4WAB A;  3HNI A;  5F5F A;  1VLT A;  1PD1 A;  1U6H A;  2C04 A;  2IXM A;  3GEI A;  3S29 A;  2CW0 F;  2HS5 A;  1MMN A;  3S90 A;  4W8K A;  4LLC A;  2YLD A;  2VCA A;  2L6F A;  1Z23 A;  3JT1 A;  2EPN A;  3M1C B;  2DYR C;  4RD9 A;  2XM4 A;  4DOZ A;  2G3V A;  1K05 A;  3MX3 A;  1ORS C;  1OW6 A;  1KNY A;  3C8G B;  3US6 A;  4AE4 A;  5DQZ A;  4U5D E;  3VYW A;  2NSG A;  2R7O A;  1NFO A;  3FOP A;  4LLE A;  3WHN A;  3QMK A;  2ZXP A;  1AVO B;  3RW0 A;  4JEA A;  2XLM A;  3T6G B;  3DE9 A;  4MVS A;  3WG7 C;  1G4W R;  2A0B A;  3H2V A;  1TFK B;  2CGE A;  2R25 A;  5E3C A;  1O5H A;  3FAP B;  1MMG A;  5JP7 A;  4JJF A;  4A4A A;  1YJG A;  2J9U A;  2XL8 A;  4ER9 A;  4XPY A;  4MVO A;  1QPU A;  3U2M A;  3W4Y A;  4IAO A;  1BR4 A;  3HNL A;  1J8Y F;  1A7E A;  4WJ0 A;  1K40 A;  2PP4 A;  4Z9J A;  1G8X A;  2R7R A;  3C7J A;  1V55 C;  2Y3D A;  3BEH A;  3EGX B;  2LCH A;  5EGY A;  1R5I D;  4CIH A;  1ZYR F;  2IYL D;  3G4Z A;  4N6H A;  5DS5 A;  5KYU B;  2PBE A;  1RJ9 A;  2J7P D;  1HW1 A;  2L9J A;  4CBE A;  1ZHZ A;  2BC5 A;  2PFD A;  2WVO A;  2XS1 A;  3GWN A;  3GM1 A;  3N2Z B;  4MVU A;  4PJM A;  3SNH A;  3FHD A;  3DD7 A;  5A6B A;  5JVE A;  2BL2 A;  4Z9I A;  2KC3 A;  2J9B A;  1VOM A;  2WB7 A;  2PX0 A;  4FWV A;  3GWL A;  4IAQ A;  5JT4 A;  1H9T A;  4E17 A;  4AX2 A;  2MHR A;  3B9Q A;  1NSG B;  4CDA A;  2QNL A;  3T6J A;  4F4B A;  3LUT B;  3B0P A;  1CGO A;  4IRU A;  5L0F A;  1YVI A;  4YL0 A;  1N1C A;  4YN0 B;  3AGU A;  3DJN B;  3ECS A;  5T3T A;  3RYL A;  3HLZ A;  4CIP A;  1LI7 A;  3IQ5 A;  3WAQ A;  4ULW A;  3S84 A;  2HJM A;  2CYD A;  2R7Q A;  3JYH A;  3NMI A;  4G0H A;  3GOR A;  1JAF A;  1TKN A;  4NTB A;  2HMQ A;  1VTM P;  2XL6 A;  2ICW G;  4P9T A;  3AJM A;  3AG2 C;  1M57 C;  2XLO A;  3S28 A;  1D0Z A;  1YAR O;  2DGJ A;  4GYT A;  2QY9 A;  1A0B A;  3C62 A;  2XRH A;  3OWT A;  4NC3 A;  5EK0 A;  3UMH A;  3UMK A;  3RQE A;  1TFO B;  5KYW A;  5D92 A;  4EBB A;  1MND A;  5IY5 C;  1Z3I X;  3NRH A;  2W4B A;  4C3D A;  2DB4 A;  4JE9 A;  1RXQ A;  1YZC A;  4YL1 A;  3WOD F;  2CNW D;  1M2V A;  1Q0F A;  4J7Y A;  2KSF A;  1O87 A;  3JRT A;  1UFB A;  2M4E A;  3W8I A;  4G7H F;  3I5Q A;  4LAC B;  4XEV A;  4DRH B;  5KYW B;  1EA8 A;  4IB4 A;  3K1I A;  5DVW A;  1YZA A;  3E9V A;  2VCC A;  1WTY A;  4KNW A;  4OIN F;  3KYI A;  2A1D D;  3ATP A;  3K6B A;  3DAG A;  3TJ6 A;  1H9G A;  2I15 A;  2ZXR A;  1NU9 C;  4PAC A;  1IW7 F;  2G62 A;  2NUP A;  3K33 A;  4CSA A;  3EHN A;  4PFP A;  1E86 A;  3RFY A;  4YT5 A;  2OG2 A;  5DLJ A;  1FTS A;  2B0J A;  2P61 A;  3IQC A;  3T6B A;  1LE4 A;  3L34 A;  3X1O A;  1JPJ A;  1YYX A;  5F28 E;  2EIN C;  1WOL A;  3RF3 A;  5DS4 A;  4K7B A;  4CS8 C;  3S9O A;  2HJ3 A;  5JS5 A;  4E7Z A;  3TUL A;  1QKR A;  1Y4C A;  2EPK X;  3F47 A;  4MTG A;  3FOO A;  2VH3 A;  3VAY A;  2DYS C;  2MWQ A;  4BJ1 A;  1WWP A;  3ASO C;  3QW0 A;  3JTL O;  4OD5 A;  1ST6 A;  4BJ5 A;  3POV A;  1VMA A;  3RVZ A;  2KQ9 A;  1FNT c;  3TQO A;  1FFT C;  2LFF A;  2WZL A;  3ZTZ A;  1FAP B;  3JZ0 A;  1QZX A;  2A69 F;  4MVM A;  5CIV A;  3TJ5 A;  1RKE B;  3I5P A;  3ZTM A;  4CS9 A;  3EG9 B;  1MNE A;  5AC5 A;  4OIP F;  2D5R B;  4JVS A;  3ABL C;  3GM3 A;  2QUP A;  4BPM A;  4W8P A;  3S27 A;  2EIL C;  3ZWI A;  2HV6 A;  3RQG A;  4BEM J;  5L0I A;  2GA0 A;  1OKK A;  1L7C A;  1SF8 A;  4N06 A;  5BUO A;  4JEB A;  2VCB A;  1SMY F;  2EPM X;  1ZU5 A;  1GQA A;  1ZHY A;  256B A;  2ZPA A;  4J32 B;  2WZG A;  1S7Z A;  3JSE O;  2HV7 A;  3KMI A;  3PMR A;  2YL1 A;  4DJ9 A;  4JTC B;  3CZ6 A;  2IOQ A;  2F22 A;  5CI9 A;  4JCH A;  3UGO A;  1W2W A;  3IEE A;  5B1A C;  3TOM A;  2YKZ A;  2KW3 C;  1A41 A;  4P9F A;  2GAQ A;  5A6K A;  3C8G D;  4CS9 C;  3SEO A;  1KTM A;  3AOU A;  3J06 A;  1T01 A;  5CI8 A;  2R7X A;  2EIJ C;  2YQY A;  2IM8 A;  3M79 A;  2B0H A;  4XWJ A;  3U9J A;  1QLE C;  2J46 A;  3NKE A;  2OJQ A;  1MMD A;  1OW8 A;  1YA7 O;  2QLA A;  3K66 A;  3IHU A;  1MQV A;  3EZH A;  4JW1 A;  4JTA B;  2E87 A;  4MND A;  5BQI A;  1NLX A;  2XLD A;  4AE4 B;  2IXO A;  3MYI A;  4HEA J;  5B1B C;  1LI5 A;  2BE5 F;  4E18 A;  3HTK C;  4WGZ A;  3L0I A;  3L8J A;  1YLM A;  2HSQ A;  2HUJ A;  4C3E A;  5E3A A;  1Y6D A;  4KC9 A;  3MYF A;  4HFF B;  3LES A;  1AUE A;  3Q7G A;  3L8I A;  2HZ8 A;  4PJL A;  3M4B A;  1YYJ A;  3DJU B;  1Z5Z A;  4BJT A;  3QVY A;  3FDQ A;  1E85 A;  1OR2 A;  1L3P A;  3A9C A;  3FVY A;  3IQ6 A;  5A69 A;  3ASN C;  4PR9 A;  2LQG A;  3OEO A;  4JRZ A;  1H6G A;  3ZC4 A;  5L0C A;  3ABK C;  2R7U A;  1TQG A;  4JJG A;  2Y3B A;  1T5O A;  4MW3 A;  2YLG A;  2DI3 A;  4JIO A;  2A68 F;  4OIQ F;  4EBK A;  5JRA A;  2J0X A;  4MTO A;  3KL4 A;  2RSE B;  2ZD9 A;  5COM A;  5COF A;  2QTV A;  4JUR I;  3ZQY A;  1G5Z A;  3LNM B;  2NUT A;  1RJ9 B;  3EH2 A;  4ONS A;  3NYM A;  5A6B D;  3FMS A;  2AU5 A;  5FZT A;  5T3W A;  4AL0 A;  2L6H A;  3EQL F;  1D1A A;  4C3B A;  2KJG A;  4JKV A;  4O6N A;  3M4C A;  4XEK A;  2YL3 A;  2XM0 A;  2IXN A;  2YHS A;  2OJE D;  3GOD A;  3LLK A;  4NTF A;  3TD7 A;  4Q5S F;  2ZXO A;  4B6I A;  1BR2 A;  3O10 A;  1NG1 A;  4RBN A;  2JX0 A;  2VAS A;  2VC9 A;  4NTA A;  4Z9H A;  3W2W A;  2J8W A;  4MVQ A;  4CS8 A;  5KYX A;  4I3M A;  2RD9 A;  1LS1 A;  1M56 C;  1M2O A;  1V4A A;  4MQ9 F;  3I4U A;  2WVQ A;  1JR8 A;  2YWA A;  4EBJ A;  1MMA A;  4K0D A;  5E2Q A;  3T9O A;  4LDQ A;  1S05 A;  2H7V C;  4I1M A;  3MFN A;  4IJJ A;  1T6U A;  5KYX B;  1V74 B;  4EIY A;  3AQB A;  1TWC A;  4AL1 A;  1C02 A;  2YL7 A;  1EKY A;  1TWG A;  4O6Y A;  4U5E E;  3FAJ A;  1YAU O;  3N0T A;  4L6R A;  3BRJ A;  1RKC A;  4WGY A;  3ZIB A;  3NDB B;  4BG0 A;  2Q7R A;  5TJ5 E;  1I5N A;  1D1C A;  1Z7Q c;  1D1B A;  1A7V A;  1M2V B;  2C03 A;  2YLI A;  5JLI A;  5KYY A;  2V3C C;  1M6T A;  2YEV A;  1HY5 A;  1C03 A;  1V54 C;  1G4U S;  3AG4 C;  4E0I A;  3U2L A;  2XXA A;  1YDI A;  3SYN A;  4YT8 A;  2J9V A;  5JSL A;  5COG A;  2CNW A;  1SZI A;  3GEH A;  1OXB A;  2JD3 A;  5KYY B;  2NUP B;  2UUI A;  4KBL A;  2AP3 A;  4U5G A;  3JCU Q;  1RMV A;  1XZQ A;  3V5X A;  3H2U A;  2FAP B;  2LIG A;  3T4R A;  1T9K A;  3QZC A;  2KNH A;  1A7D A;  2R9R B;  1PCX A;  1CGM E;  4U9D A;  1CGN A;  3UR3 C;  4DVY P;  3O55 A;  1EQ1 A;  1I4Z A;  1OCZ C;  1LE2 A;  2WVN A;  3QTH A;  3R2P A;  4K1O A;  3NMK A;  5L0H A;  2J9W A;  2Q00 A;  1ZHW A;  4U5F E;  1E84 A;  3O6X A;  3SXZ A;  1T6I A;  4OD4 A;  4HE8 D;  2G3K A;  2YL0 A;  4YL3 A;  2KYH A;  2AWC A;  2AWY A;  5AC4 A;  2XL4 A;  4LDR A;  1Q0D A;  1HMO A;  3H65 A;  3SXK A;  1K04 A;  3Q6N A;  3G50 A;  4D4N A;  4MS2 A;  2EIM C;  3AQC A;  2PNO A;  1ZU4 A;  4CDV A;  1NFN A;  2XLV A;  2GFH A;  4G7O F;  3IQT A;  3EFO A;  3EGD A;  2UUH A;  3N24 A;  4DBQ A;  3O39 A;  4KNV A;  3VF0 A;  2LFD A;  2TMV P;  2WL8 A;  1Z63 A;  2A6H F;  2OKU A;  3K1H A;  3NYL A;  4AK9 A;  1OKK D;  4PK4 A;  4OIR F;  1HW2 A;  3QVZ A;  4X0R A;  3EH1 A;  4EUK B;  1ZHX A;  4JCZ A;  1ZVZ A;  1Q0G A;  2YVK A;  3RH3 A;  2YRF A;  4DRJ B;  4J30 B;  1JMW A;  2L81 A;  4R32 A;  1E83 A;  2D4U A;  3ABM C;  3SZR A;  3VM6 A;  2J45 A;  2LD6 A;  1U0B B;  4PJN A;  3HKK A;  3MLG A;  1OCR C;  3JRM O;  2PX3 A;  3LLI A;  1QVX A;  4YK5 A;  2HFI A;  2OQM A;  4FAP B;  4C7O A;  4ZLD A;  2P1A A;  4IGG A;  3M15 A;  3EHM A;  1NU7 D;  3RIP A;  2R7V A;  3U5S A;  1WGW A;  4YT2 A;  2H7B A;  2H8A A;  2Y3H A;  3B71 A;  3JYY A;  3LS0 A;  4PFO A;  4MVZ A;  4O6M A;  2OCC C;  4U5B E;  4P6I C;  5A6A A;  4XLP F;  2R05 A;  4JC7 A;  1NBB A;  4C7O B;  1LVK A;  3ZG1 A;  1PV3 A;  3W8H A;  4LER A;  1C17 M;  1ZW2 A;  2L7A A;  2CCY A;  3NYJ A;  3A11 A;  4H54 A;  3V5Z A;  3R7C A;  1TWH A;  3MBG A;  4IAR A;  1D0X A;  3C8G A;  1LM3 B;  1GM5 A;  4XTK A;  2KK1 A;  5HSW A;  3E70 C;  2W4M A;  1Q0M A;  2OOC A;  3DM5 A;  3ZSU A;  3KH2 A;  4DVZ A;  1RCP A;  4NCQ A;  3LAY A;  4U9E A;  3UMI A;  4D4X A;  2P0N A;  4OIO F;  1VLS A;  1Z6A A;  2I8B A;  3DWW A;  2HMZ A;  3ZDL A;  5HV9 A;  3U3B A;  3FXH A;  1EI7 A;  4U5H A;  3ZQV A;  2X51 A;  3SXM A;  2R02 A;  4MVR A;  2GDC A;  2Z15 A;  1BR1 A;  4UDV A;  4EKW A;  1U89 A;  4DXW A;  1WAT A;  2PF4 E;  5DS6 A;  3KYJ A;  3V5Y A;  3EGX A;  1I4Y A;  3LEO A;  3LJB A;  5E33 A;  1E2X A;  1LIH A;  4HFK B;  3PCV A;  1ORY A;  1WN0 A;  1BZ4 A;  3K7D A;  1LPE A;  2Y3G A;  3CSK A;  4YJW A;  5KYU A;  3RKO F;  4CS7 A;  2R7W A;  1WAS A;  3GM2 A;  2NUT B;  4XEF A;  1ORJ A;  2J7P A;  4FX5 A;  2Q9B A;  5L3Q A;  2FGY A;  2YZS A;  4DRI B;  2Q9C A;  4QI2 A;  3PDM P;  4PJJ A;  3UGP A;  2ASR A;  1FMW A;  3U8P A;  2ZXW C;  2HSB A;  1CPQ A;  3GAN A;  4GEH A;  3F46 A;  1VK5 A;  2OEX A;  2OU6 A;  4I1O B;  4QDL A;  4MW8 A;  3U0C A;  1JOG A;  4CDY A;  1CPR A;  2R7T A;  1IZM A;  2OEV A;  4O79 A;  1OXK A;  5T1D B;  4CJG A;  2A0U A;  2H7O A;  3DE8 A;  4CJO A;  4JZA A;  4XPW A;  2EPO A;  1VB5 A;  1FR0 A;  4KI2 A;  2LK4 A;  1HE1 A;  3OA1 A;  4O7G A;  2P6V A;  3C8Z A;  3VRC A;  2J0W A;  3CEX A;  4N6C A;  5DQT A;  5A6J A;  3KPH A;  4ULV A;  3EZI A;  3B0V C;  1OCC C;  3GEE A;  5L0J A;  4H4K C;  2LP4 A;  1BDJ B;  3LNR A;  1F1M A;  4FES A;  2R7S A;  2Q9A A;  3LEV A;  3ITF A;  2XLE A;  4I44 A;  5L0D A;  3DI5 A;  4Q7C A;  5BQH A;  4YT4 A;  5F5H A;  5K0I A;  3JSZ A;  1TR2 A;  2O9X A;  2W45 A;  3B0U X;  3DMD A;  1GS9 A;  2L6G A;  3NKD A;  2Q3T A;  2XXA B;  3W2V A;  1HMD A;  1APC A;  1T6Q A;  4ZLC A;  2Q4F A;  1NZE A;  2W9Y A;  2NPU A;  3KKB A;  3DM9 B;  1AEP A;  1XZP A;  2WZF A;  5D91 A;  2CDQ A;  3NG1 A;  2Y39 A;  4JTD B;  2M64 A;  4M63 A;  2P7V A;  4XQ1 A;  4IWB A;  2NG1 A;  1OW7 A;  3DZA A; 
#chains in the Genus database with same CATH homology
 2A6E F;  3AG1 C;  4EWC A;  2Y69 C;  1ZHT A;  5L3V A;  4RDA A;  4G7Z F;  4E7S A;  3AG3 C;  4BEJ A;  3ZVR A;  2VB6 A;  4BJ6 A;  5B3S C;  1LKX A;  3Q6M A;  1J8M F;  1VYI A;  3EG9 A;  1KU2 A;  5EHH A;  3EJN A;  3DAF A;  1JPN A;  3PHF 2;  4XLN F;  3V7O A;  1VYK A;  4A2N B;  3EFO B;  2IXP A;  3EGD B;  3K1I C;  1TWA A;  4QI0 A;  3X2Q C;  4NY3 A;  5KYN A;  2MYS A;  2KGO A;  2XSE A;  4CSA C;  1FMV A;  2LSE A;  3HJC A;  4ANJ A;  1OCO C;  4U5C E;  2FFH A;  4Q4Z F;  3LS1 A;  3EPV A;  3SP1 A;  2EIK C;  2V26 A;  3CQZ A;  3S0X A;  4DBR A;  3DXJ F;  4BJ6 C;  1FFH A;  3UNG C;  1D0Y A;  5FCL A;  4YWQ A;  4BJ5 C;  3Q7L A;  1PD0 A;  5F5F A;  3S29 A;  1PD1 A;  2C04 A;  2IXM A;  2CW0 F;  1MMN A;  4W8K A;  4LLC A;  1Z23 A;  3JT1 A;  3M1C B;  4RD9 A;  2DYR C;  4DOZ A;  2G3V A;  3MX3 A;  4AE4 A;  5DQZ A;  4U5D E;  3VYW A;  2R7O A;  4LLE A;  3QMK A;  2ZXP A;  3WG7 C;  2CGE A;  5E3C A;  1O5H A;  1MMG A;  4JJF A;  2J9U A;  4IAO A;  1BR4 A;  1J8Y F;  4WJ0 A;  2PP4 A;  2R7R A;  1G8X A;  1V55 C;  2Y3D A;  3EGX B;  5EGY A;  4CIH A;  1ZYR F;  2IYL D;  5DS5 A;  5KYU B;  1RJ9 A;  2J7P D;  4CBE A;  2L9J A;  1ZHZ A;  2PFD A;  2WVO A;  3N2Z B;  4PJM A;  3SNH A;  3FHD A;  3DD7 A;  1VOM A;  2WB7 A;  2PX0 A;  4FWV A;  4AX2 A;  3B9Q A;  3T6J A;  4F4B A;  3B0P A;  4IRU A;  1N1C A;  4YN0 B;  3DJN B;  3ECS A;  5T3T A;  3RYL A;  3HLZ A;  4ULW A;  3JYH A;  2R7Q A;  4G0H A;  1TKN A;  3AG2 C;  1M57 C;  3S28 A;  1D0Z A;  2DGJ A;  4GYT A;  2QY9 A;  3UMH A;  3UMK A;  2XRH A;  3OWT A;  5KYW A;  5D92 A;  4EBB A;  1MND A;  5IY5 C;  1Z3I X;  3NRH A;  2W4B A;  4C3D A;  3WOD F;  2CNW D;  1M2V A;  1O87 A;  3JRT A;  2M4E A;  3W8I A;  4G7H F;  3I5Q A;  4LAC B;  5KYW B;  5DVW A;  3E9V A;  4KNW A;  4OIN F;  2A1D D;  3K6B A;  3DAG A;  2ZXR A;  1NU9 C;  1IW7 F;  2G62 A;  2NUP A;  3K33 A;  4CSA A;  3EHN A;  4PFP A;  3RFY A;  4YT5 A;  2OG2 A;  5DLJ A;  1FTS A;  2B0J A;  3T6B A;  3L34 A;  3X1O A;  1JPJ A;  2EIN C;  5DS4 A;  4K7B A;  4CS8 C;  4E7Z A;  3F47 A;  3VAY A;  2VH3 A;  2DYS C;  2MWQ A;  4BJ1 A;  3ASO C;  4OD5 A;  1ST6 A;  4BJ5 A;  3POV A;  1VMA A;  2KQ9 A;  1FFT C;  2WZL A;  1QZX A;  2A69 F;  3I5P A;  4CS9 A;  3EG9 B;  1MNE A;  4OIP F;  2D5R B;  4JVS A;  3ABL C;  3S27 A;  2EIL C;  2HV6 A;  1OKK A;  4N06 A;  1SF8 A;  5BUO A;  1SMY F;  1ZU5 A;  1ZHY A;  2ZPA A;  4J32 B;  2WZG A;  1S7Z A;  2HV7 A;  3KMI A;  3PMR A;  3CZ6 A;  2IOQ A;  5CI9 A;  4JCH A;  3UGO A;  1W2W A;  3IEE A;  5B1A C;  2KW3 C;  4CS9 C;  3SEO A;  5CI8 A;  2R7X A;  2EIJ C;  4XWJ A;  1QLE C;  2J46 A;  3NKE A;  1MMD A;  3K66 A;  3EZH A;  4JW1 A;  2E87 A;  4MND A;  4AE4 B;  2IXO A;  4HEA J;  5B1B C;  2BE5 F;  3HTK C;  3L0I A;  4C3E A;  5E3A A;  4KC9 A;  4HFF B;  3LES A;  3Q7G A;  4PJL A;  3DJU B;  1Z5Z A;  4BJT A;  3FDQ A;  3FVY A;  3ASN C;  2R7U A;  3OEO A;  3ZC4 A;  3ABK C;  4JJG A;  2Y3B A;  4OIQ F;  2A68 F;  2J0X A;  3KL4 A;  2QTV A;  4JUR I;  2NUT A;  1RJ9 B;  3EH2 A;  3NYM A;  5T3W A;  3EQL F;  1D1A A;  4C3B A;  2KJG A;  4O6N A;  2IXN A;  2YHS A;  3GOD A;  3LLK A;  3TD7 A;  4Q5S F;  2ZXO A;  4B6I A;  1BR2 A;  1NG1 A;  4RBN A;  2VAS A;  3W2W A;  4CS8 A;  5KYX A;  4I3M A;  4MQ9 F;  1LS1 A;  1M56 C;  1M2O A;  3I4U A;  2WVQ A;  1MMA A;  4K0D A;  5E2Q A;  4I1M A;  2H7V C;  4IJJ A;  5KYX B;  3AQB A;  1TWC A;  1TWG A;  4O6Y A;  4U5E E;  3FAJ A;  3N0T A;  3ZIB A;  3NDB B;  4BG0 A;  1D1C A;  1D1B A;  1M2V B;  2C03 A;  5KYY A;  2V3C C;  2YEV A;  1V54 C;  3AG4 C;  2XXA A;  4YT8 A;  3SYN A;  2J9V A;  2CNW A;  1SZI A;  2JD3 A;  5KYY B;  2NUP B;  4KBL A;  4U5G A;  3JCU Q;  3T4R A;  3QZC A;  2KNH A;  1PCX A;  3UR3 C;  4DVY P;  1OCZ C;  2WVN A;  2J9W A;  1ZHW A;  4U5F E;  3O6X A;  4OD4 A;  4HE8 D;  2G3K A;  2XL4 A;  3H65 A;  3Q6N A;  2EIM C;  3AQC A;  1ZU4 A;  4G7O F;  2GFH A;  3EFO A;  3EGD A;  3N24 A;  4DBQ A;  3O39 A;  4KNV A;  2WL8 A;  1Z63 A;  2A6H F;  4AK9 A;  3K1H A;  3NYL A;  1OKK D;  4PK4 A;  4OIR F;  4X0R A;  3EH1 A;  1ZHX A;  3RH3 A;  4J30 B;  2L81 A;  3ABM C;  3SZR A;  2J45 A;  4PJN A;  3MLG A;  1OCR C;  3LLI A;  2PX3 A;  4C7O A;  4ZLD A;  3EHM A;  1NU7 D;  3RIP A;  2R7V A;  1WGW A;  4YT2 A;  2H7B A;  2Y3H A;  3LS0 A;  4PFO A;  4O6M A;  2OCC C;  4U5B E;  4P6I C;  4XLP F;  4C7O B;  1LVK A;  3ZG1 A;  3W8H A;  4LER A;  3NYJ A;  1TWH A;  1D0X A;  4XTK A;  5HSW A;  3E70 C;  2W4M A;  3DM5 A;  3ZSU A;  3KH2 A;  4DVZ A;  3LAY A;  3UMI A;  4OIO F;  1Z6A A;  2I8B A;  4U5H A;  2X51 A;  2Z15 A;  1BR1 A;  2PF4 E;  5DS6 A;  3EGX A;  5E33 A;  3LJB A;  4HFK B;  3K7D A;  2Y3G A;  3CSK A;  5KYU A;  4YJW A;  3RKO F;  2R7W A;  4CS7 A;  2NUT B;  2J7P A;  4FX5 A;  2Q9B A;  5L3Q A;  2FGY A;  2YZS A;  2Q9C A;  4QI2 A;  4PJJ A;  3UGP A;  1FMW A;  2ZXW C;  3GAN A;  4GEH A;  3F46 A;  1VK5 A;  4I1O B;  4QDL A;  2R7T A;  1IZM A;  4O79 A;  5T1D B;  2H7O A;  4JZA A;  4KI2 A;  3OA1 A;  4O7G A;  2P6V A;  2J0W A;  5DQT A;  3EZI A;  3B0V C;  1OCC C;  4H4K C;  3LNR A;  4FES A;  2R7S A;  2Q9A A;  3LEV A;  3ITF A;  4I44 A;  4Q7C A;  4YT4 A;  5F5H A;  3JSZ A;  1TR2 A;  2O9X A;  2W45 A;  3B0U X;  3DMD A;  3NKD A;  2XXA B;  2Q3T A;  3W2V A;  4ZLC A;  1NZE A;  2W9Y A;  3KKB A;  3DM9 B;  2WZF A;  5D91 A;  2CDQ A;  3NG1 A;  2Y39 A;  4M63 A;  2P7V A;  4IWB A;  2NG1 A;  3DZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...