3OF6D

Human pre-t cell receptor crystal structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
104
structure length
100
Chain Sequence
GTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDSPIWFSAGNGSALDAFTYGPSPATDGTWTNLAHLSLPSEELASWEPLVCHTGPHSRSTQPMHLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T cell receptor beta chain
publication title The structural basis for autonomous dimerization of the pre-T-cell antigen receptor
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 100
sequence length 104
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2010-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3of6D00
1H8OA 5ALCL 1ZK9A 4EIZC 4M1DH 1DQQA 4PYHA 1UCBL 2BDNL 1UB5B 3O45B 3T0VA 4P2QE 1CIDA 3NIDF 4HH8A 3ARTA 4LP5A 5FGCB 3ZKQD 15C8H 1KEMH 1D9KD 4UBDC 1R3JA 2YUZA 3HFMH 2A83B 2R39A 3UROR 1XMWA 5BW7A 4Z8FH 5E2WH 3QEGH 3MPCA 4PLJC 1FYTD 3UTPE 5IF0B 1J1XL 1XR8B 3X11A 1WC7A 4LCUA 2DKMA 1AGBA 1LDPL 4YDVA 4K3HA 3IYLW 1MAKA 2ZUUA 4O58L 4P46C 5DRNB 3BZEB 3QO0B 5HJ3A 5IFJB 4F57L 3IU3A 1HKFA 2DQHH 5FM4A 2DQFB 1HHIA 4I0KA 1BQHG 4PREA 4NN7C 2FDBP 3EYSL 4TPRH 1BBJA 1UB6B 4FQLH 4X4XB 2P42B 4KGLA 4L8BB 1W8OA 5CJQH 1KN4H 4KI5D 2BNRE 5DGRA 5C9KA 4ZXBB 5ITFA 4KKAD 1Q38A 4C58B 2UWEB 4HK0B 3EJYC 1FVCA 1GIGL 3KLHC 3CX5J 5J12C 4Z7WA 1IEAB 4HDIB 4QWWD 4HJJL 4ODSL 1A5FH 4XNMB 5C07E 2X1WL 5L2JA 2NYYD 1TZHB 35C8H 5CSZA 1C5DB 3PP3K 1EHLL 1EX0A 4PRNB 2X4UA 3I6LD 3BKYL 5CCKL 1I3GH 2W0LA 3RWDB 1ACYL 1Q9LA 3GBML 1H15B 5E6IB 1Y0LA 1FNFA 3CSPA 1KJ3H 3CZFA 2CKBB 4HWZB 4N0UE 4CNIB 4HKXA 4LKXB 4HS6A 5IJKA 3VFUB 3WXWL 2RR3A 4PV8B 3GMOA 3TLRA 1N8ZA 1OCWH 2VRAA 5IMLA 2I9TA 3D18B 4BK4A 2EKSA 2H41A 3NPSC 3K80A 3CPLB 5DVKA 2QQKL 4OCLC 4XCEA 4KY1L 2AQ3A 3X13B 3QULA 2XPGA 5FYJL 5F7KC 3GI8H 4WEMB 1PKQE 2Z35A 1BF2A 2VQ1B 4PJ8A 1OHQA 4XCYB 3LKQA 5I1JL 5LGHL 5FA3B 1GZQA 4NQVB 4MMXC 4D0DB 1KNOA 2L7UA 3LKPA 1BFVH 3P4NB 4EVNB 1JZ5A 3EYFA 1VB9A 4P59H 1WV7T 2OK0L 4FHBD 4N90D 1KV3A 2YHGA 4QHUA 4TUKL 2XRAH 4Y4HC 4ISVB 1HKLL 4LAQH 2JELL 1IAIH 1DANT 3LRHA 1XH3A 5GRXG 5FEBA 3BRFA 4AEIH 1RUAL 3W81A 2XTLA 4UNVA 1Q72L 4MA7L 2YPKA 4Z7VB 5H8DA 4U1JA 1N2RB 2J6EH 1OT1A 1MJUH 2VDOL 3TESA 1WBZA 2NW2A 4YFLF 3BT2L 5I8CB 2IPTL 1Q0XL 3SJVD 2VAJA 5EUKA 1R24A 4U6XA 4WI9A 1EHAA 4PYGA 4OZGE 1QFWH 2XFXA 2A6DA 2NY0C 3FB7A 3JV0A 3QNZB 1OGAE 5J6GA 1L9MA 1FL3A 3IDMA 2DM2A 3QIBA 1MFDH 4IJ3B 4KI5C 1NBYA 1UB5A 1IVLA 3O45A 4UNUA 5KANG 1WSST 3T09A 4A6YH 1OAYL 4ZUSB 3QI9D 2R0WH 2WWMC 4RWYH 3WNMA 3LZFH 3R1GH 4Z76B 1MRFL 2A83A 2DD8L 3ZKMC 1F6FB 4I9WD 4QWWC 3B9DA 3CLEH 1MHEB 4JANB 4MJ6B 1F90L 1HH9B 5IF0A 1XR8A 3OSKA 4HQQL 5DRNA 5FCSH 1FYHB 3BZEA 3QO0A 5IFJA 3HR6A 4XI5D 1N5YH 1S78D 4NC1C 4LCWD 2DQFA 1JNLL 2GSIB 4X4XA 1UB6A 4HIJB 1N0XL 3C08L 4ENEC 4L8BA 3FHAA 1P4BL 3ISWA 4LSPL 3QFJE 5I73B 1JPST 1OAZL 3QCTL 3WD5H 1MAML 3W5MA 1Z9OA 5FOBB 4ZXBA 1PBYA 1A3QA 4UU9B 2UWEA 4HK0A 4OGZA 3S3JA 2OP4H 1NBVL 5GS2H 1IEAA 4HDIA 1NMCB 5I9QC 5MEND 4XNMA 5JIKA 3ZYJA 1TZHA 2R2BA 1C5DA 2D7MA 2E9WA 4PRNA 2GTWB 1NCBH 5T3XH 4DGYL 3RWDA 3DX8B 5E6IA 4JFFB 3UJTL 4PJ9C 4HWZA 2CKBA 1FNLA 4YEEA 4WHYH 4CNIA 5KVFH 4LKXA 4HC1L 4YHLH 5GRUH 3SDCD 5I6XC 3VFUA 1FIGH 2GJ6E 2VLJA 4PV8A 1EEUA 1YY9D 2B4CL 1JZ7A 1KXTB 4H8WL 1M05B 5FYLL 5IVXB 3D18A 3FAXA 4XP1L 4NFCA 3CPLA 1VADB 4UUJB 3UAJC 3ARXA 3HZKB 3X13A 2N7BA 5C71A 1GAFH 4LF3B 3DO3A 1PLGL 5DUPH 3C5JB 2VQ1A 4RQQA 3EW3B 4XCYA 5JMOC 3BKJH 5FA3A 4NQVA 4D0DA 1TVHB 1AGDB 3P4NA 4EVNA 1WWWX 5CKGA 3JUZA 1C7TA 4BSVB 4PLNC 2OL3B 1B90A 4ISVA 3GZKA 2BVTA 2O5YL 2QSVA 3QI9C 5JPMB 4GQ9L 3WBDA 1LO3L 5DRXB 1VGKB 4XVUC 1L6XA 3M17B 4Z7VA 4WO4B 5IG7B 1N2RA 2Q8BL 2VN4A 4OTXL 4I8DA 3SKUD 3O6MH 4HV8B 4RGNC 4MHHI 4HWEL 5I8CA 1LE9B 3KYMB 2X70B 2Q7NA 1NCTA 5TFSH 1I1CA 2EE3A 3HI6L 2ORBH 5K59E 3GMPB 3QNZA 5JW4M 1YYML 4WU7B 3O3BB 1YJDH 5DVMA 3SO3C 4HF5L 3L3IB 5TDOB 5IQ7L 1XGYL 1ADQL 5D2LE 3I6LE 2UVEA 3VGGA 4W6WB 4N9OB 1KEGH 1C1EL 5LJYH 3WFDH 4ZUSA 1V3JA 4WW2B 1JF1B 1G7JB 4RMVA 1G7QB 3NACH 1JNNH 3JV5A 4Z76A 2AGJL 5JW4Q 3I85A 3EDKA 2W60B 1YEFH 3H9SB 4LL9A 1OTTC 5ADOH 1MHEA 4JANA 2XOTA 2O5ZL 4MJ6A 1HH9A 3X3GL 1W0YT 2APFA 4XP4L 3PP3H 2KL6A 1JRHI 1HEZB 2GSIA 2V7HB 3ZDZF 4HIJA 1GJIA 1TQCB 4PG9B 3W2DH 2KH2B 4KMQA 5T1DL 4X7FC 3BKCL 3QIUD 5ESAB 4R26L 5FOBA 4P4KB 1BMGA 4UT9L 4IMKC 4RGOL 1A6UL 4YUEL 3VXUD 4HCRH 4OV6F 4UU9A 4MQSB 4S0TD 2HVJB 3BI9X 5C2BH 1P7HL 1KJ2H 1TJGH 1W72H 3MV11 1XIWC 2EDQA 4K9EH 4TRPL 3QO1B 5D7IF 2A77L 4FQJL 2W9EH 1LK3H 3P11L 2GTWA 4U49A 2PTUA 4OB5L 1H8NA 2VYRE 3DX8A 4OCNC 4JFFA 2DWEB 3X12B 5B22A 1T7WA 1HYSC 5BMFH 4LSQL 4YHOL 1RVFH 4XVJL 1M05A 3I3BA 1T2JA 4JB9H 4KJPC 3VD4A 5IVXA 4ODWB 3FQWB 1J8HE 1P9MC 2CUIA 3BO8B 4HD9A 1WK0A 1VADA 4IRJB 3QUYC 4UUJA 3HZKA 4XC3H 2XZCH 1CDBA 1WIPA 1VEMA 4LF3A 1IC1A 4K55A 4YFEA 3C5JA 1FG2B 4I9WE 1F8TH 4XMKH 3HG1B 4RIRB 3GO1L 2H32H 1TVHA 1AGDA 4HBQA 3O4OB 4BSVA 2X89D 2OL3A 3VWJC 4DCQB 2DQJL 2N56A 4UT6L 2X1XR 4LCWE 5JPMA 2UZYB 5DRXA 1L0XA 1VGKA 3BH9B 1OQXA 4K8RH 3VWKB 4KRPD 4JCLA 3M17A 4WO4A 5IG7A 2D7NA 3VXRE 4NWUL 3RQ3A 3UYRL 1A7PH 5HHOE 4HV8A 3PGCB 4N68A 1MIML 5A2FA 1LE9A 4MVBD 3KYMA 1FZJB 4O02H 4LCYB 3GIZL 4N8CH 2X4NB 5HHMB 2IQAB 3SCMB 2NY5H 1BQLL 5EBWB 3GMPA 5HDQH 1NGXB 4WU7A 2D7OA 4DUVA 3CCHB 5MENE 4LSVH 1T89C 3O3BA 5I1GL 3L3IA 5TDOA 1X5AA 4P99A 1OSPL 4XWOC 5GGQL 2ESVD 1TTGA 4IDJL 4WW2A 1JF1A 1G7JA 1G7QA 5JW3L 4YFDB 3CUPB 1I75A 5CAYB 2W60A 3HB3D 4O4YH 3H9SA 1IAIM 1EDQA 4HX1B 4XRCB 3F7VB 4CU8A 3QXDB 5IBTL 4UINL 2WINB 4C4KT 4UV4H 4BKLB 1IMHC 4Q9BA 4MD0B 1HWHB 1SEQH 3VRLF 3BWAB 1A7QH 1J1PL 1AQKH 4L9LB 3V7AE 1HEZA 3TO2B 2V7HA 4DZ8B 3RWJB 2AQ2A 2C4FU 4PG9A 1QFWM 2HT3D 4LSUH 2AEPL 2D4DA 1S8DB 1AY1L 4XP6L 5IROA 2J88H 1NL0L 4QHNB 5JA8B 5ESAA 5SX5H 5KS9B 4P4KA 1FRGH 4KVCL 5D96B 1ZTXH 4Z7WE 4ZG1A 5IVOA 2HVJA 4NFBA 3RVVC 1TZGL 4R4FL 4OGAD 5DJZB 3FO0L 3I2CH 1IRAY 5BO1H 1XF1A 1IC7L 3FB8B 1RZJL 3QO1A 4GUPB 3RY5A 4FQCH 1I9IL 3L3JB 1OARH 5DXWA 2C3XA 3D1MC 4WEBH 3IFPB 2A0LD 4MA1C 2DWEA 2FH6A 3UC0L 4DK3A 1LEIB 1OTUD 3X12A 4M6NL 1UEMA 4PJFF 4UOW1 3VXNB 4NN5C 2L7JA 5I15L 4HIXH 3MODH 1MWAH 5I8OH 4EI5C 1FNSL 2DAVA 3ZT5A 4ZD3L 3FQWA 3BPCB 3QQ4B 1D6VL 5D72H 3BO8A 4JM2D 3SGEI 4OF6A 5J13C 4IRJA 1G1YA 1YMHB 3PL6C 4N8VB 4WHDA 3KS0H 2YS4A 4TTDD 4K2UH 5K9JL 4H20L 1FG2A 1AQDB 2CRMA 2DQEL 3HG1A 4RIRA 3TJHD 2QBWA 5DMGD 4LLVB 3MLVL 1C5CH 2PO6A 4P46B 5HHNB 1QD0A 2J8OA 3P77B 1WAAA 3ULVD 4DCQA 3DYOA 5J3HD 4FQPA 4NN7B 3MA9H 3O41B 4JO1H 3ZE1E 2Q8AL 1AR1C 1BM3H 1S5IL 2HRPL 3BH9A 3VRIB 3SGKA 3THML 2FGWL 3VWKA 3GB7B 4QRRD 4H0HB 1IE5A 4JREC 5FA4B 5L9DH 3LQAC 3MOBL 3PGCA 1ZSDB 3GHBH 2R2HB 4U0RC 1JRHL 1FZJA 4K3JL 4LCYA 4GAYB 4GJTB 3VXUE 2X4NA 2IQAA 5J12B 3SCMA 1RPQA 5EBWA 5HGHB 1GPOL 2FH8A 4OGYL 1EK3A 1NGXA 2P7TB 3HC3H 3CCHA 5EZLB 3HE6A 4M6MH 3ZT7A 5FUCE 1OD9A 1EZVY 3KAAA 4LPTA 1IZJA 2B0SH 4KQ3H 5GRJH 4H0IA 4FQ2L 4NQCD 3RX5A 4F15C 5ALCH 3VDCA 5DJDB 1UCBH 3NCJH 5F7DB 3GNML 2DM4A 3UDWA 1ZMYA 3CUPA 3MV01 4YE4L 5ACMA 4KROC 4MJ4A 3U6RB 3QDJD 3FFCB 4R4BB 4HX1A 5HHXL 5D1ZD 4XRCA 1HH6B 3F7VA 3NPSB 3QXDA 5AYUH 2WINA 5JXAL 3RVTD 4BKLA 4RISL 3ULUD 4ONFL 4MD0A 4WGWB 1ZS8B 2A0LC 2YUWA 1I8KB 1WT5A 1D5BB 3BWAA 4L9LA 4Z5RB 1Z0MA 2R56L 1LDPH 1J5OL 4UTAL 3TO2A 4DZ8A 4MB4A 3ROLB 4O58H 1KACB 1NEZA 4OZHB 3RWJA 1BWWA 2BVYA 3EO0B 3I6GB 5F1OB 2HTLC 4Y4HB 2CKBL 3SGDI 4U6VL 4JFXB 1S8DA 4Q58C 4FQXD 4HAFA 4QHNA 1GCFA 4ONGL 5KS9A 1BEYH 3Q0HA 4V1DB 2UWEE 5E00B 1AE6L 5JUEH 3RA7H 5DJZA 3F7RA 4ELME 4F7CB 1A1MB 5E8PB 3FB8A 5DJCB 4YXHL 4GUPA 2K3TA 1QR4A 3AROA 3L3JA 5F9DC 3RWEB 3L95B 2WSKA 5CD5C 3IFPA 1EHLH 2NY0B 3MC0A 3CVHH 4JKMA 2XACC 3BKYH 3HE7C 3RKDD 5CCKH 1LEIA 4CDHA 2X6MA 4JRYB 1ACYH 2AJUH 2O5XL 3VXNA 5BVPH 1DUZB 1YZZA 4KRNA 7FABL 3H9ZA 3BPCA 1N64L 3QQ4A 2ESVE 3B9VA 1MLBB 1CFNB 5ACZB 1PG7W 1RUKL 4C4KO 1YMHA 4E42B 4N8VA 5J9PB 5DFVD 3BWUC 2QQKH 1AQDA 3A6CL 4KY1H 4JPWH 2QSCH 4LLVA 2AABL 1SYVB 5KJRL 2X10A 4P46A 5HHNA 3P77A 2AKRB 4IRZH 1G9ML 5IEHB 5I1JH 3ALXA 3QRFM 3CLFL 4I0PD 1LILA 1P4LB 3O41A 2CKNA 5SV4A 4Z7VE 3VRIA 2JELH 4F58H 2PXYD 4P9ML 3SDXF 4OCRL 1BWMA 1A4KB 4XCFL 5FA4A 1RUAH 2W0FB 3TH2T 1Q72H 3KPSB 4MA7H 4HWNA 4Y4KC 3QDGB 5JXED 1ZSDA 2R2HA 4GAYA 2FX7L 3TCLB 1FNAA 2HLAB 3CFBB 1KCVL 2WLZA 3RAJL 1HXYB 4PRHB 1Q0XH 5I9QB 5HGHA 4CJ1A 4XHJD 2K9UA 2P7TA 1EVTC 1FNEB 5EZLA 5HYFA 5T1KB 5DT1L 2VH5L 3DUHA 3DYMA 2JIXB 3V7MA 1MOEA 4PJ9B 4KXZH 1F3DJ 1UXSB 2AJSL 5T5FH 5I6XB 5DJDA 1HSBB 5AZEL 1IQDB 1TQBB 1S7SB 5F7DA 4NZUH 3MOAL 5EU7C 1DANU 3U6RA 3IDXL 1LWRA 3L5WB 4JHZA 3FFCA 3F6LA 1CLYL 3OG4B 4R4BA 1HH6A 1KOAA 4NO3B 4OD1H 3L5XL 4D3CH 3JVGC 4IM8A 4NP4H 5DHVB 3QPQD 1T20B 1ZS8A 3MRIB 3S96B 2OX5A 1I8KA 4ZFGH 1D5BA 2BRRH 2E3VA 4Z5RA 2VXQH 3ARBC 4NKIL 3ROLA 5E99L 2OTUB 4NC2B 4OZHA 3EO0A 3I6GA 1FO0B 3DX6B 4Y4HA 4JFXA 1N0XH 3EYOB 1BJ1H 2Z8SA 1JF5A 5ISZD 3PGDB 4LSPH 1AGEB 3FJTA 4D9LL 4V1DA 2B20A 2VERN 5E00A 1MFCL 5DFVC 4U4BA 1MAMH 7CGTA 4I3RL 2LTQC 4HMEA 4F7CA 1A1MA 1GSMA 4RGNB 5E8PA 5DJCA 4LVNC 3RY6C 2ZCHH 3H7BB 3RWEA 3VFWB 3WJLA 3S88L 3L95A 2E27L 5ANMB 4AH2B 4JFFE 3LS5L 4WWID 2NXYB 5EC1B 2OL3L 1DEDA 4NBXB 5CZVL 3SO3B 4JRYA 4LFHD 3UJTH 1NMAH 1DUZA 1TCRB 5C0CB 2UUDK 4XC1L 4B7LA 3NABL 2E7MA 5I1DB 1MLBA 1CFNA 5ACZA 4P5MB 3S36H 4OQTH 1CD0A 4E42A 1X6NA 5J9PA 4XP1H 4Y89A 1RUPL 2B5IC 5F96L 1JPGB 1GHFL 4CU6A 1F6LL 4P9HC 4Y4FC 4XB7A 1PLGH 1SYVA 1OP3K 3ULUE 3UJIL 1KTLB 5LKNA 4TOYL 5IEHA 4ALAL 3ROOB 1MF2L 1PX3A 3MRFB 1P4LA 2D0FA 4U1KB 4GKZB 2R23B 4W68A 2W38A 4RFOL 2C1OB 1MQKL 2W0KA 4NJ9L 4GQ9H 4Y1AD 1LO3H 1IT9H 1A4KA 5M94B 4HMCA 2W0FA 3CFIC 3KPSA 4ODBD 3QDGA 4NOFA 3H3KA 4OTXH 2Q8BH 1J12A 4PJ5B 1LNUB 5C6TL 3MRLB 3RTQB 3TCLA 2HLAA 3CFBA 3WNLA 2DOCA 1HXYA 4PRHA 1L4IA 1XIWB 3HZVB 2F58L 1AC0A 4PJAB 4I18C 4ODHL 4ORZC 1FNEA 1FN4B 4L29B 4UQ3B 1T2QL 1EO5A 2FCBA 3HI6H 5T1KA 4YQXH 4ZTOH 1HI6B 4LQ1A 3VI3E 1YYMH 5H37G 1RK0B 2WBJB 4IRSC 2JIXA 4PJ9A 3O4LB 4NSKB 1UXSA 4HF5H 1XGYH 1HSBA 1ADQH 4S1RL 3V0WL 1KUMA 1IQDA 1S7SA 5FUOL 3H9SE 4HJ0D 2KQMA 4IOSD 3E3QE 4R3SB 2FATL 3FB5B 3L5WA 4PRBB 2VABB 2AGJH 3BPLC 4NO3A 2I26N 1KIUA 2E9IA 3QUYB 5DHVA 1T20A 2V7NB 3MRIA 4P48A 4MS8C 3S96A 2D3VA 4PBVC 3FFDB 5E1AB 2Y7QB 1EEQA 4A2MA 2VR9A 3VFMB 1BAFH 1KCSL 3MGOB 4O5LL 1IAKB 2GJZB 2OTUA 1RZKH 3P9MB 1DSFL 3E2HC 3QG6B 5D2NC 4BH8B 1FO0A 3DX6A 3BUYB 4KZEH 3VWJB 1DBKL 4FQHB 4QGTA 3BYTA 3V8OA 4U3HA 4J3VA 4FZEL 3EYOA 3R8BB 1YYLH 3MUJA 3PGDA 1AGEA 5T1DH 2R1WB 3BKCH 1JJUA 4R6UA 1YEGH 4GKSB 4AL8L 3VFGH 4QTHB 3KYOB 4R26H 5C09B 3KPRB 4RGOH 1VEOA 3H7BA 5I1AB 3WSQH 4APQC 3VFWA 1EJOH 3K74B 3NMEA 5ANMA 4AH2A 1T66C 2NY1D 2ZNWA 1JWUB 3BIBX 4FQJH 5F7EL 4S0SD 5EC1A 4OB5H 1CXFA 1FLRH 3MJ8B 4XBEH 5F7LB 1HOCB 1TCRA 5C0CA 3IU4L 5I1DA 4LSQH 4YHOH 2VAAB 4QO1A 4FN0A 4Y5VC 4P5MA 3TA3B 4XMPL 3ZDXE 3HUJB 1F3RB 4P3DB 3FONB 2ZSVB 4X6CB 1JPGA 4U05A 2ZNXA 4KVNH 3N85H 2V2XB 4UOJA 3RU8L 2VL5B 3QDMD 4OSUL 1KTLA 4FQ1L 1V3MA 2IG2H 4ZUUB 3ROOA 3GO1H 4FXGB 3MRFA 3ZE2F 4U1KA 4GXVH 4GKZA 4YHKL 2R23A 1JWMB 2DQJH 2C1OA 4G3YL 4K3DH 4UT6H 4KTYA 3ARED 4N9GB 4YDIL 2CXGA 4KK8D 1GGYA 3A0OA 2YUVA 1S7WB 2P44B 2EXYC 1MFEL 2DL2A 4IMKA 4NWUH 4OLVL 5ISZE 1NAMB 4LFHG 4PJ5A 1LNUA 3MRLA 3RTQA 1X4ZA 2ICWB 5T1LB 2Q3AA 1CFVL 1XIWA 2GEEA 3HZVA 3VFVA 2G75B 4TSCL 3VD9A 4XTRD 4PJAA 1RUQL 4JO2H 1FN4A 4UQ3A 4L29A 2YD4A 1L7IL 5F1KC 1BQLH 4XH2B 4NNPH 1HI6A 1T1ZB 4GAGL 3KJ6H 1RK0A 2WBJA 4HXBL 3O4LA 1K3ZA 3WFCL 4NSKA 4LIQL 3D3VD 3PQYB 4Z7OE 2AJXL 1OSPH 3CDYA 4MYWB 2P5EB 4IDJH 4NN5B 2D0GA 3SKJL 4EI5B 3TT3L 4R3SA 3FB5A 1MCEA 1C8PA 4Y16C 4PRBA 5JW3H 2VABA 5I1IL 1P9MA 4P2RB 3T65B 4DOHB 4Q2ZB 5J13B 3C6LD 3QUYA 5HI4D 3PL6B 3MUY1 1URLA 2V7NA 3K2MC 4LOUC 3FFDA 5E1AA 2Y7QA 3PNWB 43CAB 3VFMA 3MGOA 1IAKA 2GJZA 3P9MA 4NQDB 4BYHA 4O2EA 4LIQE 3QG6A 1J1PH 1H3PL 1OB1B 4L8DB 4BH8A 2WAHA 3NTCL 4PJEE 4M7JL 3BUYA 4HG4K 2VL4A 3VWJA 4FQHA 2ZPKH 2VZTA 4MAUH 3G04B 5I1KH 5KS9E 4NJAH 1XF2B 1OL0A 5HHVH 1N4XH 1ZWIB 2GITB 2R1WA 2UUDH 4JEGB 1UM4L 4WU5B 2RAMA 3FQTB 4GKSA 4GAJH 3UYPA 4QTHA 3KYOA 3BJLA 5FUZL 1F4YL 4JREB 5C09A 4CUCA 2OM5A 4Y1AE 3RX7A 2R4RL 1VCAA 3KPRA 4PS4H 1DJSA 4N8VG 3CMOL 4NKQB 3HMXA 4R4FH 2HKHL 5I1AA 5BV7C 3TEUA 4JO4L 2EE9A 2YZ1A 5A3ID 3NA9L 4QXWA 4LSDA 1OTSD 1Y6MR 2ICEB 5D71L 4L4VB 4Y88A 3EGSB 1T89A 3PGFH 1G0YR 3MJ8A 1KGCE 3MGTB 3UC0H 3EJZD 2LU7A 4M6NH 1GOFA 1HOCA 4F15B 3C8DA 1K6QL 5FFLA 1PX4A 2EIEA 2ED9A 2NTFB 2XTJD 5JOEA 4WFFD 2VAAA 5KAQG 4ZS6D 1A6TB 5I15H 4GFTB 5L8JB 1QHPA 4KROB 3TA3A 3OB8A 4E41B 3PIQB 5D7JC 1D6VH 1LVEA 3JV4B 3HUJA 3D85D 4JFED 1FVEB 4JZOB 4P3DA 3FONA 5FYKU 4G9FD 2ZSVA 4X6CA 1H3WM 2YPLB 2V2XA 3IETB 5K9JH 2VL5A 3T0XA 1BHGA 4ZUUA 1MJJB 3QUZD 1EO8H 1AJ7L 5C7XH 4FXGA 3MLVH 4CVUA 5F44A 5DLML 3DGGB 2BC4B 1JWMA 3U79A 5C0EB 1FGVL 1N26A 3OMZA 4J23A 4N9GA 5F1IB 2Q8AH 5CP7B 2W0PA 1S5IH 5HGBB 1MELA 4C59B 1KTRL 1S7WA 2NY3C 4OZIF 2FLBT 2FGWH 4ZTPH 2CQVA 4OLUL 1JUFB 4MJIB 2OJZL 4CKVX 3LEVH 1NAMA 3ELAT 1VFAB 1FC2D 1YQVL 2NY6C 3G6JB 2ICES 2ICWA 5T1LA 5C0AB 2C9AA 4K3JH 2G75A 3TT1L 1GC1C 1RIUH 4PRPB 2FO1A 1X5LA 1JZ8A 1MPAL 4OLEA 4XH2A 5AG8A 4OGYH 1T1ZA 4EOWL 4XNXH 3FOMB 4R4ND 5EO0B 1YEJL 5MEOB 4Y19B 4K94H 1YNTB 1YC8A 3HE7B 4L3EB 2MOVA 3PQYA 3RGVC 1ZGLB 4Y2DC 1TJHL 2P5EA 3FFCE 5KVGH 4LDOB 4EI5A 4JQIL 3T3MF 1RIVH 4YE4H 4P2RA 3T65A 5EORL 1A47A 5E8EB 4Q2ZA 1I1YB 3JWDL 4OKVB 3PL6A 4PJXF 1YQ2A 5JXAH 4KTDL 2XN9B 1RY7B 4X9HA 3P0VH 5L7XL 4ONFH 3PNWA 5HPOA 43CAA 3K1DA 2VKXA 4LRNH 4NQDA 2DI8A 1TPXC 4PY7B 1OB1A 4HS3B 4L8DA 4JDTH 1I4FB 2R56H 1UJ3B 3QUXC 3QDME 4PTTB 3UBXB 2DLGA 5F3BB 3G04A 2OS7A 1XF2A 4ZS6C 5J06A 5BRZB 2IPUK 1KG0B 1MHHB 1F2XK 1ZWIA 2CKBH 3D0LB 4U6VH 2GITA 4WU5A 3FQTA 5L88L 2FBOJ 2AP2A 3G5YB 3V9FA 2Q86B 3VMNA 4Q97A 5C0FB 2APVA 1AE6H 4Y4KB 5CJOH 4XWGL 2DQGH 5FAAA 3IFNH 5HVGB 2YRLA 3PXJA 1T2XA 2XKUA 2W9LA 2X9WA 3IAPA 4MXVE 2ICEA 3QUMB 4L4VA 1RHFA 2ZG1A 4JRYE 3EGSA 3MQIA 3MGTA 1W0WB 2F54B 4HK3J 4QCIB 3F7PC 4Y8AA 4X4MA 3V6FB 5ID0B 5BZWB 2NTFA 5ICXB 3H8NA 3D3VE 1A6TA 3GJFK 3SDYL 5EBGA 4E41A 2IADA 4JFYB 3PIQA 1I9JL 3JV4A 3U0WL 3W0WB 5C0DB 4CN1A 1FVEA 4JZOA 3WFEL 1RUKH 3QUKB 5EU6B 2YPLA 3IETA 4NC1E 5DTFB 2VXVH 1MJJA 1MY5A 4NYLB 3ARBB 2AABH 3H9YA 5KJRH 5IGXL 1CIUA 3DGGA 2BC4A 1FNHA 2QEJA 1BREA 2ZCLL 2HKFH 3D25B 3T2QA 5F1IA 5CP7A 1R5VB 1MRDL 5HGBA 4L3AA 4FRWA 3TO4C 3QDGE 2AK1L 4P9MH 3P2TA 1JUFA 4MJIA 4XCFH 1CBVL 4GKNB 1VFAA 5I2IB 4PRHE 4AIOA 1UT9A 3IS0X 5L8LB 1BIHA 2CRYA 2LTQB 5C0AA 4LVNB 4AQOA 1KJMB 5F7NC 3RAJH 4ACPA 4PRPA 1WVZA 4Q9CA 1R3IH 4XT1C 2Q6WB 4IIQB 5F70A 1Q9KB 2GQHA 2A9NH 2EH7L 5EO0A 1T03L 5MEOA 1FO0L 4Y19A 4S1DC 1Y6NR 1YNTA 1NMBH 2I24N 2XQYK 3HE7A 4L3EA 3VXQB 2VH5H 1ZGLA 1HCFX 2E9BA 1S7XB 2AJSH 4PJCF 2ADGB 3MREB 5AZEH 2GK2A 5GIRB 4MQXC 4J3UA 3HMWL 3GEWB 5E8EA 1I1YA 3VXTB 2MTPA 4HFUL 4OKVA 4BZ1L 5KVDH 4YO0B 4GS7C 2XN9A 3DXAA 4F9PC 1N59A 5AWNH 3GJFB 3UTZB 4JFEE 3P9WB 5DA4A 2EXWD 4Y4FB 4G9FE 4PY7A 4HS3A 3L1OL 1I4FA 1WIUA 1UJ3A 2BFVL 2WUBL 5E99H 2X5PA 4PTTA 3UBXA 1I3UA 5F3BA 1EMTL 4M7ZC 3IAQA 5EOQH 1I7ZB 5BRZA 1KG0A 1MHHA 3D0LA 1N6QL 5GHWL 4XMLH 4X4YB 3U30C 5IFAH 3G5YA 5DK0B 4B0MM 3VFOB 3GFUA 1A6WL 2Q86A 3U1SH 3V0AC 2IAND 4N5ED 5C0FA 4Y4KA 3N9GH 1NKOA 4MJ2A 1FAIL 1JPTL 4I3RH 3DJ9A 3O9WD 5E2TL 4MNQB 2N4IA 3FQNB 5EIVA 5B38G 5JQHC 4Q9QH 2J5LC 4JRXB 4I18B 2E27H 5HXMA 3QUMA 5IVZB 4J8RB 4G7YL 3LY6A 1W0WA 2F54A 2BSTB 1F42A 4QCIA 3TN0B 5C0CE 3ULUH 4IRSB 3V6FA 5ID0A 4WI6A 3BH8B 2ENSA 1QKZH 5BZWA 3IFLL 5ICXA 3NFSL 4JY5L 1TVBB 4JFYA 3R4DA 4NKDB 5C0DA 3W0WA 4KK6D 3BPLB 3QUKA 5EU6A 3JVGA 5CJ5A 2D4FA 2D0HA 2MHAB 2HH0L 5DD3L 1BGXL 2AEIT 3Q5OA 5DTFA 2VDPL 1RZFL 4NYLA 1CK0L 3ARBA 5HHPB 4HW6A 2Q7YB 3UJIH 3E2HB 3VFSB 4ALAH 5D2NB 4HPOL 1MF2H 5IFHL 4JKPH 3D25A 2F5AH 5SWQB 3AU1B 5DMKB 2UVFA 5JHLL 1OAKL 1R5VA 1IC5L 4RFOH 1MAJA 1MQKH 4C56D 5AZ2L 4NJ9H 4NRYB 1INDL 4RDQG 2YKLL 1QVOB 4GKNA 5GSVB 5I2IA 4Y5YC 4NNXB 3OKEB 5LWYL 1LO0L 4TTGA 2EXWC 4PJAE 3F8UB 4GBXD 3RUGE 3RY6A 5IR1B 3O6LL 2JLLA 1NCCH 1KJMA 5IB2B 4APQB 2ICCA 4POZD 4RBPH 5EO9B 1GH7A 1AXTH 2Q6WA 3BP6B 4IIQA 1F58L 4ODHH 3CSYB 1Q9KA 5F88B 4R90L 1T2QH 4PGBB 3RVWD 3ARPA 3OBAA 2XZAL 1U2CA 3VXQA 2AXGB 2XZZA 4BZ2H 5H37H 3BGAA 4WVRA 1R6VA 4EJ1C 1P7QD 2NNAB 3ILPB 4N1CA 1S7XA 4L8SC 3DURB 2F8OA 1ZLWK 3TWCL 5IB4B 2ADGA 2A38A 3NVQA 3C60C 3MREA 4KJWC 4J3SA 4ODUB 4S1RH 3OAYK 5GIRA 4KHTL 4NO5B 4Y5VB 2YD9A 3IXAB 2CK2A 3VXTA 2FATH 3DV6B 3O9WC 3CAFA 4YO0A 1YMMB 5HBBA 5A2IH 3HMXL 3GJFA 3G6DH 3UTZA 3QWRA 4Y4FA 1KCRL 3VFNB 1AD0B 2VWEE 4OV5B 1DSFH 4C55A 1KSRA 1YEIL 1I7ZA 3ESUF 1DBKH 2R0KL 3WLBB 4CDGC 1G9NC 1S5HB 2DYPB 4ZAKD 5IBUB 5DWUH 4OBSA 1PKOA 5D8JH 3KPRE 2DQCL 4X4YA 5DK0A 3V95A 3VFOA 1SY6A 4K7PH 4OZ4B 2IBGA 2XZQL 1MI5B 1MJ7L 1ES0B 1EXUB 3T8XB 4L1HA 1AGCB 3LCYA 5DEZA 3BDXA 4KGJA 4YHIB 5E4EC 5CEZD 4MNQA 3FQNA 5E94B 4JRXA 4I18A 2PCPB 1LO4L 4H5SB 5GS1A 5IVZA 4J8RA 2CLZB 2P8MB 1QG3A 1MFBL 3PDDA 4RGMC 5J8OA 2FD6H 3TN0A 2BSTA 4IRSA 4H0GA 4UMGA 3BH8A 5IW6B 4P2OD 4HLZG 5IV2B 3VXPB 3IU4H 1TVBA 4DJMA 1CXHA 4NKDA 1IGFL 3UYOD 3A6BL 5DSCB 4Y16B 4EXKA 1NAML 3H7LA 5IWLC 4JN1L 4L5FH 1JYVA 1S7UB 2MHAA 4YH6A 4BUHA 3RVWC 1J0KA 2XKSA 4LGRB 1YA5A 5A16B 5HHPA 2JK5B 1INEH 4OSUH 2Q7YA 5JZ7C 4FQ1H 3VFSA 3WLWD 3REWB 5D2NA 3MCG1 5KOVC 1IGJB 5D5MF 5D6DA 4LSSL 5SWQA 3SQBA 3AU1A 5DMKA 3GRWA 1SMOA 4PY8I 3MBEB 1HZHL 2Y5EA 3BP4B 1R3HB 4J4PD 3P4LA 4NRYA 3LB6C 4UI2A 3QRGL 3RDTC 1QVOA 4NKMB 5GSVA 4NQSB 3M8OL 1VENA 2QADD 2RGSA 5IB3B 3K3QA 3RP1A 4NNXA 3OKEA 2VDLH 5ITBH 4Y7MA 5IR1A 5IB2A 4XPBL 4APQA 2F19H 5EO9A 5BV7B 3BP6A 4U7SA 1D6EB 5FM5M 1JHLL 3CSYA 5F88A 4M5YH 5GZND 4OFIA 4PGBA 4OLXL 1S7QB 1G84A 4GW4B 4LLDB 2AXGA 4GAGH 2QQQA 4ZAKC 2EDJA 1MCOL 4HXBH 2NNAA 3WFCH 2DBJA 3ILPA 4LIQH 3DURA 3WUWB 1DBJL 4LQFL 4ODUA 5ABDE 4DOHE 4DVRL 2EDKA 1X5XA 4NO5A 1NKRA 5CJXC 4Y5VA 3IXAA 5MI0C 5EFIB 3CVIH 5E95B 1OGTB 3DV6A 3LQAL 1MJ8L 1YMMA 3QHZL 2A1WL 3T3PE 1IM3B 2XNAB 4NQDE 1DE4B 4YFLI 4PIRF 4I3SL 4R2GD 5JPNB 3VFNA 4DUXA 1AD0A 5FCUL 3I50L 2W92A 1UVQB 4YC2C 2H1PH 4OV5A 1JMZA 3FO2B 4XPGL 3NTCH 4M7JH 3WLBA 1E28B 1CXEA 3OJVC 1S5HA 2DYPA 3CH8A 4JO3L 5DO2D 4ZS7L 2NY3B 1UM4H 4OZ4A 1MI5A 4C56E 1ES0A 1OY3B 5B4MD 1F4YH 1CGVA 3UCRA 1UA6L 2NY6B 1NCUA 4OQ1A 3T8XA 1AGCA 3CMOH 4NOBA 1X5ZA 1X7QA 2AJVH 4YHIA 2JJWA 2HKHH 5TE4L 5E94A 1SM3H 3WLWC 5MHSE 2GKIA 2MKLC 4EUPB 2PCPA 5DQ9B 2YA1A 4H5SA 1R0AL 1F4AA 1CLZL 2P8MA 4LPVA 4P23D 5D71H 3ARSA 3T2NL 1MCCA 3MV8B 4ZO7A 4XP5L 1CYGA 1FSKC 3RGVB 2HFGL 1B9ZA 3C9NB 5IW6A 1A7RL 3VJ6B 4Y2DB 1A7OH 3QCVH 3ARGD 2V17H 1LD9B 4D9RE 4RAUB 2CR3A 5IV2A 3VXPA 1KIQB 3CK0L 3LDBC 2CGRH 5DSCA 1DQLL 4Y16A 3IRZA 2YPLE 4TULL 2VOTA 3FO9B 1CGWA 3OKMB 1E4WH 3T04D 5DUBB 4YAQB 1S7UA 3VG9C 4WWKC 4LCCC 5GZNC 4OLWL 1B2WL 2NY7L 1F6AB 4J7RA 5I19L 3EYUL 2P45B 5A16A 2QQLH 1SVCP 2JK5A 3Q6GH 1WFUA 3JBG7 5KSAC 5CJ8A 3REWA 4UT7L 3V6OC 1IGJA 3QUXB 2ZG3A 3BP7B 3TNMB 3MBEA 5E9DD 1PY9A 3BP4A 3GSWB 4MJIE 4QXTB 1R3HA 4DW2L 1AXSB 1I8LC 3G6JE 4NKMA 4NQSA 5D1QD 5IB3A 2NXZD 1GGBL 2SEBB 5HYJD 5AYQA 5C0AE 1U3YA 2FZ3B 2OJZH 4JR9L 2CK0L 1A6PA 3O3EB 1DBBH 1TIUA 1YQVH 3PWPD 4PRPE 3AC0A 1ODAA 4RMQA 4DN3H 5IHBA 4AK1A 2VDNL 4OF5A 3ARDB 2PNDA 3V0VB 3LHPL 1IAMA 5CP3A 3TT1H 1D6EA 4Y19E 5CEZE 2BOBB 1S7QA 1ND0B 3UBXG 5ILTH 4GW4A 4LLDA 3MCKB 3NGBB 5IHUH 3WUWA 3GMLB 1OAUH 1MVFA 1I7TB 1DBML 3PG2A 4MAYC 2GSGB 1TJHH 1CLCA 2CO7B 3UTSD 2G9HB 1KFAL 5D7LB 1U95B 3DVFA 1T21B 5EFIA 1WQVT 3QIWD 1OGTA 4W81A 3MLZH 2M8XA 3BMVA 3JWDH 2XNAA 1G0XA 3SGJA 1DE4A 2JB5L 3MRCB 3ZL4L 25C8H 5JPNA 1CICD 4QRTB 2ZUTA 1JNJA 1QFUL 4LCIL 5L7XH 3RZCC 4OZGF 1UVQA 3QUML 1Z9LA 5LQBH 3FO2A 5BRZE 2IPKA 3MLUL 4NO0D 1E28A 3REVB 2MPAL 3SE3C 3ARGC 2MNUA 3O3UN 2ED8A 1TNMA 1E4JA 4OF3A 5GISL 3TO4B 1R5WB 3SDDD 5FYJU 5L88H 3MRBB 5I0ZA 4OGXH 1QHOA 4YBHA 2HTKC 3AXLB 1I9EA 4MQTB 1JNHB 2RFXB 2NX5B 4XXCC 4L4JA 3ZDYE 5KZCB 3BJ91 4CMMB 2DBLL 3K2UL 1EFXD 4EUPA 5DQ9A 3BDBA 1J11A 4P49A 2F54E 4M6OL 2XXCB 1DDHB 1NDGB 3WN5C 3QPXL 3PWVB 2DMBA 3IT8D 1EA9C 3MV8A 1JP5A 1YECH 3RGVA 3C9NA 4JGMA 3P0YL 4FOMA 4N1HB 5CBEB 3VJ6A 4RA3A 2NXZC 1OLZA 4Y2DA 3ILQD 2HT4D 3UTOA 1LD9A 4UV7H 4RAUA 1KIQA 5FDWB 4PRID 5EU6E 4LAJH 2BVUA 1UGNA 4XNUL 1CFBA 3FO9A 3OKMA 4TNVF 1I9JH 3UXFA 3U0WH 5DUBA 1YEKL 4YAQA 3WFEH 1ZANH 1QBAA 4N0CD 1PFCA 3FQRB 1F6AA 2EYRB 1EAPB 4QNPE 4JKLA 2E7HA 5FB8B 3L3GB 2VLKB 5DEFB 2Z93B 4TSBL 3EOAB 3QUXA 3V5HB 1Y18B 1WZKA 3B2UD 3BP7A 1DP0A 3VH8B 3TNMA 1NC4B 3BISA 2ZCLH 3QQ9C 5GSRB 2EDFA 5FYKL 5SWZD 3GSWA 2N1KA 4QXTA 1AO7B 1AXSA 3U4BH 1KENH 3QIWC 1TJIH 3U30B 2SEBA 3CDGB 2FZ3A 5I66B 1CBVH 3O3EA 5GGTA 1CICC 3IJHB 4U1SB 5T3XD 2R1YB 1A14L 3ARDA 3F7QA 3V0VA 4P9HL 3NCYS 1KTKE 4OZFH 4NPYB 3ZT6A 3ARVA 4PB0H 2J5LB 5C1MB 1SQ2N 1II4E 2BOBA 5BS0B 5ENWB 4JFPB 2ZSWB 5FYKE 1ND0A 3MCKA 1CR9L 1T03H 3RNQB 1NC2B 4EEEA 1FFNB 4E9LA 1WBYB 1WIOA 2GJJA 3SDXB 3K0WA 4HIEB 2XKNB 3GMLA 1I7TA 1MCJA 2GSGA 1IL1B 5KBNC 2G9HA 5IW3A 5D7LA 3VGAC 4AT6B 1SY6L 1U95A 1T21A 4NZRL 1DBAL 4U1NB 1U8NB 3NIFE 3HAEA 2DKSA 4M7LH 3HMWH 1JTTA 1JZ2A 5I74B 4BZ1H 3MRCA 2MCPL 1TVDA 4PG2C 3OF6A 4QRTA 5ELIA 5HDOA 3PP4L 3DRTB 2V5YA 5K59F 3OAUL 3EYQD 4NNYB 3D69B 3L1OH 12E8H 2AI0L 2BFVH 3REVA 3MUHL 1EMTH 3RWGB 2A2QT 5D2LF 5EZOL 2R4SH 1OPGH 3CFJB 5E2VL 4GLRI 3TO4A 1R5WA 5KSUB 5IP4A 3MRBA 2J8UB 2OR9H 3AXLA 3QHFL 4JVUA 4KK5C 4N0CC 1JNHA 2RFXA 2Y36L 5IUSA 1UKSA 2NX5A 5L2KB 1FAIH 1JPTH 4URTB 2YEZB 3GDBA 4CMMA 3O6KH 5CINL 3DMMD 1VERA 1AHWC 4JVWA 2IBZX 3PWPE 2BVOB 5E2TH 1F4WL 4G8GB 1VKXB 4AIXA 1NCWH 2OZ4A 1DDHA 1NDGA 3SE8L 2XG4A 5FGRA 3PWVA 4RAVB 3ZHKA 5EH1A 1HILB 1BJ1J 3TF7C 3GRWL 1KB5B 4LEOA 5CBEA 4D0CB 3AFLA 4YXLL 4PLOB 5IBLD 2CLVB 4YXKL 5FDWA 3C60B 5F8RC 2NY2C 5DJ6B 1U58B 2DLIA 2R29L 4FQIL 2PYED 4JY5H 2OJEB 4GMTL 5ADPL 4R8WL 3FQRA 4FP8L 2EYRA 1NUNB 1AR2A 1EAPA 3J7HA 3RY4A 4PJXE 1JYWA 5D2NE 2X4PB 2HH0H 1BGXH 3JXAA 2IC2A 3QNYB 5FB8A 2VDPH 2VZ1A 3L3GA 2VLKA 5DEFA 2YD6A 2Z93A 1A1NB 1PYWB 2Y07L 3EOAA 3V5HA 3MJGX 1Y18A 5DD1L 3VH8A 2VXTL 2OXGA 1NC4A 2BVEA 4ZPTB 5GSRA 3H3PL 3U2SB 1AO7A 2P47B 1OAKH 1IC5H 5C0RL 4ODXB 2CIKB 2FIRT 5SX4H 4NM8L 3CDGA 4WUUD 3JV6B 4MXQD 5I66A 4HSQA 3DI3B 4MLSA 3QEQD 4NM4H 5J11B 4G6JL 3IJHA 1SEBB 5LWYH 4U1SA 1LO0H 1TETH 2R1YA 2EO9A 5DFTA 2J4WL 5E4EB 3EYQC 4NPYA 3PF2A 5IB5B 3WXVH 2JJSC 1U92B 3LH2H 5IKCB 1F45A 5BS0A 2K7QA 4JFPA 2V5SA 1QYGL 2ZSWA 1F58H 5D7SH 3FB6B 4JHWL 4U2ZA 3BD5A 5HI3C 3RNQA 4UIMB 1NC2A 4RGMB 4ZSOB 1FFNA 1WBYA 3SDXA 4HIEA 2XZAH 1RU9H 5DUMH 2XKNA 1G7MB 5ECJE 5CFHA 5IBUG 3ABZA 1JGLL 4QXUL 1WCBB 1IL1A 1UWXK 1SJHB 3SDAD 4AT6A 2NY4B 2CMRL 1LP9B 4U1NA 3MLRL 1U8NA 3RI5F 3RWIB 1FH5L 2ZKHH 3B8YA 5FV2A 3ARZA 3B9KD 3DIFA 3V2AR 1YJDC 1BD2B 5I16B 2IQ9L 3PWLB 1ACZA 3V4VL 1BPVA 4ZO8A 1L7TL 3HMXH 2YPVL 4FFZH 2BNQD 5GRVL 6FABL 5FGBC 3DRTA 1MCHA 1KCRH 3MRMB 4NNYA 3D69A 3ZMRA 1CQYA 2ZJSL 1BFTA 1LE5B 1MCNA 4K8RD 1RURL 4U1HB 1NGQH 1RMFL 2P8LB 1CF8H 3X17A 3RWGA 1YEIH 3CFJA 5H94B 1MI5E 3EHBD 5JHDB 1BQSA 2VQUA 4X6DB 4L4TD 5KSUA 3L9RB 2PW1B 1TDQA 1Z3GH 2J8UA 3S34L 1XGPB 2DQCH 3MLWH 3RDTB 3U4EB 4LMQE 2YUXA 4J2XA 2BHZA 3OB0K 4Y5YA 4X5XB 4X6BB 5A43C 1B0GB 5L2KA 1I1AD 1XR9B 2EDNA 2YEZA 5CWSB 2BVOA 1DQTA 4G8GA 1VKXA 1HWGB 3ZO0A 2V5RA 5KW9L 4RAVA 1XT5A 1HILA 3MV9D 4MZ2A 1EEZB 3P4OB 1KB5A 4XNYL 4D0CA 1VDGA 2RIKA 4LPWA 2NQCA 4K9EC 4R7DB 3WFHB 2CLVA 3HPJB 3C60A 1OWWA 3AS1A 4OJFL 2NR6C 4XGZB 3OF6D 5CSGA 5DJ6A 1B0WA 4GRMB 1JIBA 1U58A 4JKKA 5MI0B 3RVXC 3TV3H 1R5IB 4CVWA 2OJEA 1IGFH 3E1F1 3A6BH 4Z7WF 5EN2B 3S9DB 3DARA 1DFBH 4PJIB 3IDJB 3O6FC 43C9B 5JTWA 5BV7L 4JPVH 2LVCA 2X4PA 4IS6B 2AJYL 4OF7A 3QNYA 4IHOB 1A1NA 1CQKA 1PYWA 4KKCD 3W5NA 5ERWB 3UTTB 3BQUD 1UKTA 2BP3A 3MCLH 3B5HA 1NSNL 4O51B 1JPSH 4ZPTA 5HI5D 1IFHH 1SJVA 2C4XA 4PR5B 2D31B 4WHCA 5C08B 4LVOC 3U2SA 3WUWG 3FOLB 5JIPA 4HBCH 1HZHH 2VZSA 2PKDA 4ODXA 4XCCL 1IGTB 2CIKA 2MCG1 1BZQK 3JV6A 2WK2A 1Y6KR 3QRGH 2OR8A 3T0ED 2E7CA 2J2ZA 4OCSH 3V4PL 1SEBA 1A22B 1WJ3A 4NFDA 3ARFD 4DEPC 3VDBA 4XPFH 1U8OB 5GS0C 3U9PL 3MXVL 4XPBH 5IB5A 2X4TB 1U92A 3IDGB 5IKCA 4K8RC 4TVPD 5MEQB 1CE1L 3B9AA 2V9TA 1JHLH 3FB6A 2DQDH 2AK4D 4UIMA 4ZSOA 3O8XD 2OTWB 3EHBC 4OLXH 2ZUQC 5FO7B 1C08B 1G6RB 4PJDB 5GJTL 1G7MA 3ZE1F 5ESQB 5EUOB 3OGOE 1FSKB 1WCBA 5B39B 3R8QA 1FQ9C 1SJHA 1A6ZB 4LQFH 1QBLL 2NY5C 3GSXB 4F33B 1E27B 1LP9A 2QKIB 2C3WA 4NCDA 4YK4C 5TF1L 5IMMB 3LDBB 3RWIA 4YX2L 2HT2C 4DVRH 4MA8H 3S8WA 2AEQL 5IWLA 1BD2A 1QA9B 3F7YB 1P6AB 3MLPA 5I16A 1MJ8H 1U3HC 3QHZH 3PWLA 2A1WH 4HMDA 4IMLB 5DJAB 2YC1B 2PYEE 3BAEL 3VG9B 4WWKB 3W39B 4LCCB 4EUPG 1GC1L 5FHBL 2L4OA 3KPLB 3MRMA 5FCUH 1LE5A 5KSAB 2KUTA 4OCYL 4U1HA 4N1EA 4XPGH 2P8LA 2YD8A 3LVEA 3P30L 1YPZB 5H94A 2F5BH 4ELKA 2F8XC 4X6DA 3L9RA 2PW1A 5DYOB 5K9KB 5CLWA 4CU7A 1BP3B 4JO3H 4L8CB 4Q74A 1XGPA 3RDTA 3U4EA 4EDWL 3WMSA 4X5XA 1QFPA 1V7MH 3Q2CA 1BVZA 4HGMA 4X6BA 1BOYA 2AVGA 5J1SC 1B0GA 3T4YB 3DUSB 1UA6H 4YDKL 1XR9A 4P4RB 3GSNH 5CWSA 3QEQE 1CGYA 5C0NC 1IGMH 1PG7H 4EXPX 3FN9A 3D2UD 2CDEB 1R0AH 3ZHDA 1CXIA 2CUMA 2DS4A 4AMKL 4BELD 1EEZA 3P4OA 3T2NH 1H5BC 1ZLSH 1DVFC 4R7DA 4XP5H 3WFHA 3HPJA 4GRLD 1A7RH 4MAYB 2BNRD 2R2CA 4XGZA 3W11D 4GRMA 5CKAA 4S2SB 2UWEF 5CJXA 1R5IA 1ZAGA 2XQBL 2IAMC 3NAAL 4LU5L 5EN2A 1P5VA 5GGTL 4PJIA 3IDJA 4ELMF 3OKNB 3VD5A 43C9A 5GGVH 2BSSB 4OCWL 1NH6A 4QRQB 2ZP0T 4IS6A 3WIFB 5ACLA 4G6FB 4IHOA 4OLWH 5I19H 3WFBL 3O8XC 3RZCB 3BPOC 2DTML 2JCCB 4HZAA 5ERWA 3UTTA 3PDOB 2ATKB 4GMSL 2EDHA 2VXUL 4O51A 3GUTB 4K3EH 4PR5A 4YIQB 2D31A 5C08A 1IARB 3FOLA 2FRGP 5CEZH 1X44A 2FIKB 2XT1B 4K7FB 3T77B 4ERSL 2X1PA 1IGTA 4DW2H 3KWWA 1T04B 2VC2L 3TFKD 4NHUB 4L4TE 1GGBH 1LO2L 5I8KL 4EN3C 1WEJH 4JR9H 2CK0H 4Q6YA 4F2MB 2ZG2A 1U8OA 2X4TA 3IDGA 2VDNH 5F8QC 4NCC1 5MEQA 3QSKB 1NBQA 3LHPH 3TVMD 4QRSB 8CGTA 3EFDL 1UM6H 3DSNA 4WY7L 3WN5B 2OTWA 5FO7A 1UH2A 1C08A 1I8IB 1G6RA 4PJDA 4P2CG 4GW1B 5ESQA 5JW4N 3DNKA 5EUOA 3ZKND 3TBSB 4OZIB 1MHPL 5B39A 4GAFB 4Z7VF 2KQNA 2ERJC 3MV9E 3RVUD 1A6ZA 3BVNB 3DX9B 1QRNB 3FKUS 3GSXA 1DBMH 1C7SA 1E27A 4F33A 2QKIA 1J0IA 5IMMA 2J3SA 4FG6C 3WO4C 4OKDA 4ODVH 4D0BB 1QA9A 3F7YA 5FYJD 4Q0XL 2DQUL 4IMLA 5DJAA 2YC1A 3FZUD 3L6FB 3GMNB 4WWKA 3W39A 4LCCA 3TZVD 3KPLA 2V5TA 3MRKB 1QFUH 4LCIH 1M4KA 5KSAA 2OZ4L 4KAQL 2XI9A 2W07A 1VPOH 3QUMH 4YHZL 4X9FA 5DVNA 5TDNB 3IJYB 1YPZA 3LIZH 3MLUH 4KDVA 4PGDB 2CJUL 2MPAH 5D5ME 2FJFB 5DYOA 2VITB 5K9KA 4H26B 3G6AB 3KPPB 3U7YH 1I8LA 4L8CA 3T1WA 4RAHA 5GISH 1LQSR 1CDGA 2NX5E 1DEEB 3P0GB 1TFHA 3CNKA 5I1LB 4ZNCD 2MQ3A 4AG4L 3BXNB 3T4YA 3DUSA 4X7DC 2DLFL 4P4RA 5DURB 2WIMA 1AD9B 2VUOA 3I6KB 1FBIL 1X3DA 4G5ZH 1NFDB 2DBLH 4BQCA 3JSSA 3K2UH 3WKML 5CIPH 2CDEA 5E2UH 2LAGB 2W9DL 3C5SB 3QJHB 5JIIA 1NAKL 4TVPE 4GXUM 3TH4T 3VH8G 2VDRH 2YRPA 2AK4E 2DQIL 1Q1JL 3JTTB 3QFJD 4QRPA 4UILH 1FV1B 4BSWB 4MAYA 1HINL 3GM0A 2HWZL 4S2SA 3VGAB 4EQ2A 3B2VL 4JCMA 5CZXD 4NGHL 1NBZB 2ED7A 3MBXH 8FABB 3OKNA 1KTDB 2YK1L 4HK3N 2Z31D 2BSSA 4M1CD 3GK8L 2VLKE 4QRQA 3WIFA 4IOIB 4M7KH 3WE6B 3LRSB 4GRWB 5JHDD 3L3DB 3RZCA 4A6YB 5MEPB 2JCCA 4M43H 3ZKNC 32C2B 3RGHA 3PDOA 2ATKA 1AO7E 2X4SA 2P43B 3GUTA 1A3RL 1SMAA 4YIQA 1EPFA 3S4SB 3SE3A 2FIKA 2CH8A 4JG1H 4OFYD 4K7FA 1QSFD 5FYKH 3T77A 3IDMB 3PUCA 1RIHH 1T04A 3WHE0 3WUZA 1NBYB 1YN7B 3KLSA 3EO1B 1CD9B 4NHUA 4M62L 1WZMA 4UAOC 4XBPB 3TZVC 1AKJB 4F2MA 4XXCA 1IQWL 3IAGC 4X7TB 3CFCH 2B8OT 4ZDHB 1A6VH 4Z7UE 5TE7L 3VXMD 1A14H 1AHWB 4LHUB 4P9HH 4QRSA 5FHAH 2CDGB 4LK4A 3ULUF 4F80A 1UWEL 3KPOB 2R9HD 4HAGA 3EDEA 1RZ7H 5D1XC 3WN5A 3WDIA 1I8IA 4GW1A 1CR9H 4HPYL 3TBSA 4OZIA 4WDIB 4WI8A 4X9IA 5FYLD 1GOGA 3TIEB 3DX9A 3BVNA 1QRNA 2FB4H 4X5LA 1IM9D 5EZJB 4NZRH 4D0BA 1DBAH 4WENB 3R0NA 4DQOL 1EGJH 3EO9L 5I1HL 3C5ZC 4X99B 3L6FA 2X40A 2H45A 3GMNA 3JWOC 3M1BB 4Z95H 5CEYB 2DJUA 2MCPH 2VSCA 4P5TC 5CEXB 1RK1A 4LDLB 1V3LA 3MRKA 4HG4J 1IC4L 1CE6B 1Q94B 3OAUH 5TDNA 3VI3F 2R2BB 3IJYA 5FIEA 2E9JA 3V4UH 2AI0H 4PGDA 1KB5L 4WW2F 4OLZL 5IHZB 2EIZB 2FJFA 2J8UE 2PF6A 3WNOA 2A74B 4MWFB 3MV7D 1KPRB 2VITA 3DGCR 4H26A 5EZOH 5SWSB 4G6AC 3G6AA 3KPPA 5K93A 5E2VH 2WNGA 1D5IL 1W8NA 4OIIL 4CAGA 1DEEA 2VLJB 5I1CH 1SYSB 5I1LA 4QRUB 3BXNA 4KUZL 4M1CC 2Y36H 5I71C 1U93B 1AD9A 3JZ7A 3B6SB 2IBZY 3I6KA 1JN6B 1SJEB 4ODTH 3I9GH 2DI9A 1NFDA 5C0BB 1QLRB 1MNUL 1FLTX 2ITDB 2NMSA 4WIQA 2DM3A 3C5SA 3QJHA 2QV2A 4NQED 4XVSL 5IESH 4RQQB 1QSEB 4G9DB 4ZNEA 4M4RA 4Z0BL 4NZTL 1A0QL 2VZVA 3JTTA 1U8QB 4XP9L 3S35X 1G9NL 3GRWH 3QXWA 1FV1A 4BSWA 5GS1C 2B2XL 5IT2H 5E8DH 1NBZA 1D9KC 4S10A 8FABA 4BM7A 4FQIH 1KCUL 1KTDA 4GMTH 1UC6A 3TPUB 4JPIB 5KTEL 1LGVA 2B39A 2VXSL 5ADPH 5FYJE 4PG2A 4WI3A 4IOIA 4R8WH 3WE6A 3LRSA 4YPJA 3L3DA 4A6YA 5MEPA 1E4XI 32C2A 1F4XL 3KXFB 3LAFA 3QA3B 5DVLA 5E03A 3S4SA 3ZYZA 3VGHA 4X7SL 4NHCH 3RJQB 4PGCB 3H3PH 5L0QC 2DICA 4CADB 1CL7H 3LQZB 1UJTA 1V3KA 1YN7A 1J8HD 3EO1A 4XBPA 1J0JA 4S1QL 1F00I 1DTUA 4KKAC 3ZDXF 1AKJA 1DCLA 2OR7A 4X7TA 3EDDA 4ZDHA 2I07B 1AHWA 2QSTA 2J4WH 1WAAF 3I84A 4LHUA 3K8LA 5DJXB 2CDGA 4POUB 2NYYC 3KPOA 2OMBA 1CN4A 2UYLA 2A6KB 5CGYD 1QYGH 2RCSH 4WRLA 1AI1L 4FTVB 4WDIA 3OGCB 3B3IB 1LP9E 3TIEA 1CFQB 3BE1L 1A7NL 3UJJL 3BSZL 1BD2E 3VXRD 4PY8J 4WTZG 2IGFL 5EZJA 5HHOD 3MLRH 4LASH 4LVHC 3PJSB 5IEKB 3TYGH 1GGUA 1ULVA 4X99A 3WNKA 1MCPH 3M1BA 3O6FB 3KG5A 5CEYA 1FIEA 2IQ9H 3WJJC 4QHLB 4DKAA 5CEXA 4M61B 3F5WB 2P48B 3LV3B 1CE6A 1Q94A 2C1PB 1S9XB 5TGBB 4UIKH 3GSVB 4WFGE 5JHDE 1ZXQA 5GZOD 4X6DE 1RURH 3D9AL 2F53B 4OCXL 5F7YC 3O2WL 2GUOB 1M7IB 5IHZA 2EIZA 1RMFH 2A74A 4LVOB 2ARJQ 4MWFA 4Z7OF 1KPRA 5SWSA 1UWGL 5DZNA 2C3VB 1SYSA 1QSFE 1RZKC 4QRUA 2FYYB 3S34H 2A6IB 5SX5K 1NLDH 1U93A 1OOAA 3B6SA 1CXLA 3CH1B 1JN6A 1SJEA 1MRCL 3RWHB 1VFMA 3O0RL 4DEPB 4QGYA 4DN4L 2D9QB 1OAXL 5C0BA 2FEDD 1QLRA 3EOBB 4KPHL 2JJSA 2ITDA 1I3RB 2R8SL 3VXME 4JQXC 1QSEA 4G9DA 4PJEF 1IAII 3D39B 5KVEL 2ZUQB 4M9PA 3DOSA 1U8QA 3QR2A 5KS9F 1G0DA 3VCLB 5FYLE 1FORL 3DHJA 2DQTL 5D70H 4PJIE 4OJFH 4F7PA 1KC5H 4YK4B 2E8YA 4PJ7E 5JO5B 5L8KB 3TPUA 4JPIA 1QFWI 3HNVL 1JGUL 4TUJB 4I2XB 4TNWF 5CGYC 3UTTE 5FGBA 2AJYH 5CP3H 4HHAB 4XI5C 4NO2B 1S78C 5C08E 3AS2A 1CLOL 2ZOKB 5CILL 1TLKA 3KXFA 4UQ2B 3QA3A 5L6YL 1G6RL 1MCIA 2QQNL 4TSAL 5D6CB 1NSNH 4LDEB 4DTGH 4PGCA 3CGTA 5B39G 5J4MA 1YUHB 4G80B 3WS6C 5EWIL 4CADA 1B3JA 3N1PC 3LQZA 1UEYA 4WHTB 1YNLL 5EO1B 1DQML 3MUGB 3MA7B 3MV7E 4UTBL 4YWGL 1KBGL 2NZ9D 4U3CA 1A64A 1CZ8L 4PJ8D 4C54A 3RFZC 3V4PH 3DTXB 3JWNC 2I07A 4M8QB 3FMGH 5DJXA 3U9PH 1G7HB 4XHQA 5AAWA 1CDCA 3GSQB 4PJDE 5C0IB 3WNNA 1DR9A 5F9JB 5FO8B 5EUOE 4X0KB 2A6KA 3VXSB 3ARYA 4G42B 2EH8L 1KELL 4HCRA 4X80L 1XGTB 4FTVA 3AMLA 3OGCA 3B3IA 4NQEE 5GJTH 3QJFB 3SDCC 5KAQF 5GRYA 3VW3H 1CFQA 1H5BB 4WUKL 2BXYA 1DVFB 5ICZB 1YY9C 2EDEA 1I9RH 2DN7A 2OLDA 3OKKB 5TF1H 4AIZB 3LKRB 1CGSH 3PJSA 2IAMB 4QLRA 5IEKA 3HHRB 2AEQH 2DM7A 2FEDC 3RJDA 3O6FA 3IDIB 4HKBB 4QHLA 2C3GA 3BAEH 4M61A 3AUVA 3F5WA 2YN3A 3QXUA 1JZ6A 3LV3A 1GC1H 3QIBD 2C1PA 1U2HA 1YPZE 3BPOB 1S9XA 3GMMB 5TGBA 4P3CL 3GSVA 5T3ZL 5AUMB 4YDJB 2F53A 4MDJB 2GUOA 1M7IA 4LEXL 3DVGB 4KMTH 3P30H 3LD8C 2D7TL 4S1SL 5I18H 1SBBA 2C3VA 1XZ0B 3QH3B 5DR5H 3TM6A 1JYXA 1ZHBB 2FYYA 4K71C 4HS8L 4H88H 4AEHL 4B41A 2A6IA 2H3NB 1BX2B 1IKFL 1KN2H 1PVHA 4EN3B 3WDJA 3CH1A 4OIBA 1BIIB 1HN1A 2KBGA 3RWHA 4YDKH 3EOBA 5T3ZE 4TUOB 2P5WB 5JOPE 1I3RA 3HNSL 4FFVD 3QWOB 5JORB 15C8L 1U6AH 3L7EB 1UYWL 3D39A 2PO6B 4AMKH 5EPMB 4Z8FL 4P2QB 3N1QC 3BN9D 1JTPA 1FC1A 3QEGL 4ZXBD 2ERJB 2J1KA 5EOTB 3VCLA 4S11A 3QAZC 4XCNB 1KT2B 3R0MA 4PGZA 3QYCA 3WO4B 1IEHA 5JO5A 1GGCH 2XQBH 1UXWB 4TPRL 4FQLL 5GGTH 2H26B 4TUJA 4I2XA 2JCCE 4FS0A 1F97A 1TZIB 4OCWH 1QQDB 5HYSB 3LN5B 5CJQL 4HHAA 5E6ID 4G7VH 1KN4L 4NO2A 2NLJB 2ZOKA 2X7LB 4ETYA 4MXVF 5EULV 1GYAA 4UQ2A 4OAWB 2VLJD 1CG9B 4GMSH 5D6CA 2VXUH 3HE6B 1YUHA 4G80A 2VLRB 3CU1A 2PYFB 5E70A 4WHTA 1FDLH 5EO1A 3ALPA 4ERSH 3QIUC 1KPUB 3FRUB 3MUGA 5DC4B 35C8L 3MA7A 2VC2H 4MXWH 2P24B 2GYSA 3MLTB 2XY1A 4RMSA 4RMWA 5I8KH 1LO2H 3DTXA 1I3GL 4ZO6A 1FVDB 2KDGA 3FO1B 5C07B 1B4JH 3GSUB 3QIBC 4M8QA 2VB5A 1HIMH 3JTSB 5C6PB 1G7HA 4AJ0A 3GSQA 4MJ5B 5C0IA 5F9JA 5FO8A 4X0KA 3L5IA 3EFDH 4RNRB 1CDJA 3VXSA 4G42A 4HXAL 1XGTA 4JY4B 1QRNE 4J6RL 3QJFA 3WKNA 1NEZB 1H5BA 1PJ9A 4W4OA 1DVFA 4O2CB 5ICZA 1MHPH 4TQEH 3Q1SL 4AYFA 1ZEAL 4RX4A 3ZE0F 1QBBA 4GG6B 3OKKA 4AIZA 3LKRA 1JV5B 2IAMA 4OM1L 1BFVL 3DROB 2BY1A 4K94C 2DQUH 1O5DT 2XRAL 3IDIA 3M07A 3QZWB 4HKBA 5AEAA 3OL2A 4C57C 1IAIL 1X5IA 1FFQA 2G60H 3AS0A 3EOTH 1FFRA 4M5ZH 4U3XA 1LO5B 4MNGB 3GMMA 2R1XB 4TNVK 2OZ4H 4AEFA 5EA0L 5GGSB 3BN9C 1MJUL 1S7TB 2I60H 4YDJA 5AUMA 4MDJA 2BMKB 3BZDA 3DVGA 4JZJC 3ZHLA 1BFOB 3CXDH 3EZJB 5IJVB 2E7LA 2PR4H 2ARWA 2CJUH 1A4JB 3AY4C 4TVPH 3DUUB 4XPTH 5MERB 4KRPC 1XZ0A 3QH3A 1ZHBA 1QFWL 2ITCB 3KVQA 5BJTB 4MHHG 3H9HB 2H3NA 5FO9B 1BX2A 4UAOB 4EN3A 3LKOB 1P84J 1NFDE 4AG4H 4BSJA 2YA0A 1BIIA 2H2PD 3IGAB 4MVBC 1MFDL 1L0YA 1P4IL 3GI9H 1ZA3B 4TUOA 2P5WA 2LV4A 1WTGT 3VD7A 1OGAB 3K4DA 4A6YL 4KQ4L 4ZNEE 1QSZA 3QWOA 1LMKA 2R0WL 3WKMH 4RWYL 1ONQB 5JORA 3R1GL 3U0TB 3L7EA 5D1XB 2FO4B 3BD3A 1OM3L 2OMNA 1CFSB 1HHKB 5EPMA 3CLEL 4P2QA 4MDIB 2DF3A 1VGEH 3OZ9H 2DQIH 5EOTA 4OLYH 1Q1JH 1DL7H 4NUJB 4XCNA 1KT2A 2HWZH 4JPKH 1N5YL 3HB3C 3LEXB 1UXWA 2FWOB 1JWSB 1CDUA 2F15A 4GRWE 3KPQB 2H26A 2UZXB 2Y5TB 2Y25A 3C5ZB 5JW5B 2FR4A 1TZIA 1QEWB 4LHUG 4MA3B 1X5GA 1QQDA 4P5TB 2H2SD 5HYSA 3LN5A 4JFFD 2WUCH 2NLJA 4KV5E 2X7LA 2OXHA 3C2AL 3MFFB 4OAWA 1CG9A 1JCKA 1M6OB 2APBA 3UPAA 5JA9A 5C0JB 4R97C 1A3RH 1MVUB 4LARH 2X05A 4U7MA 2HT3C 5F9OH 3S98A 2VLRA 2PYFA 4DGVH 3DO7B 3HR5B 5FKPB 4PP1D 1KPUA 3FRUA 4Z78B 5FGCE 4B53A 2BDNH 2P24A 3MLTA 3H2WA 1MCQA 1NCBL 3C8HA 3C87A 4M62H 3RKPA 2VQTA 1FVDA 3FO1A 4OGAC 5C07A 5I71B 3GSUA 5ALBL 5KVFL 2FLRT 3JTSA 3T0BA 1FIGL 4WI2A 1KYOJ 4MJ5A 3F12B 4MCZB 3EUUA 4RNRA 5JDSB 1UWEH 5INCB 1J1XH 3OJMB 2Z8VC 2D03L 4PB9L 4JY4A 2GJ6B 1YC7A 3HA0A 1QSVA 1DN2A 1OTUC 2VZ3A 4M1GL 1G7IB 1U8LB 4WO4D 4F57H 4RMUA 5F6HI 4O2CA 4G8FB 1GAFL 3EYSH 4PGEB 5DUPL 1PW3A 4AZ8A 5GS1B 5CBAB 4J1UB 5E08L 4GG6A 2MQCA 3BKJL 3I75B 1JV5A 3MXWL 5HVHC 3U82B 4JM2C 1D9KB 2DIAA 3DROA 4QT5B 3MRHB 4DQOH 4PJAF 3EO9H 3QZWA 4MD5B 4TTDC 2AQ1A 3RUGF 4PJBB 1FYTB 3MNVB 4U33A 1OW0A 1ROWA 1FGNL 2P49B 3IFOB 3TJHC 5DMGC 2YD3A 1LO5A 1OF2B 4MNGA 2UZIL 5JQ6L 1GIGH 3CDFA 2R1XA 3BIAX 3TIDB 3ULVC 4HJJH 5GGSA 1S7TA 4ODSH 1INQA 5J3HC 5HD8D 4X7EC 2BMKA 3SY0B 4JFQB 1BFOA 3VGDA 5IJVA 4RDQF 1HK6A 2VLJE 3K8MA 2HMID 1NGZB 1WITA 1A4JA 1Q8MA 3DUUA 3H9SD 5L0QB 5MERA 5TFSL 3N06B 4OM0L 3GBMH 1MCSA 4OIAA 2ITCA 5BJTA 2CD0A 2ORBL 3RL2B 3H9HA 5FO9A 1JGVL 3WXWH 3LKOA 3IGAA 1K8DB 5HHQB 1MEXL 1ZA3A 4N8PA 3V52L 2EDDA 4GG8B 5KG9B 1QSEE 1OGAA 3QHTC 2X9YA 1MCWW 4PD4K 1JZ3A 1ONQA 1MNUH 4HIIB 1PQZB 4YZFE 3U0TA 3NACL 1JNNL 5D1XA 2FO4A 5FYJH 4XVSH 1OP5K 1CFSA 1HHKA 5LGHH 1NGWB 4MDIA 5ADOL 3K7UA 4P4KD 4Z0BH 5IK3B 5DEGB 2OK0H 1G9NH 4NUJA 4TUKH 3UTQB 3IDUA 4OFDA 1HKLH 2B2XH 2N7AA 3LEXA 2W65B 2FWOA 1JWSA 3BGFC 5D1ZC 4LVHB 5F7WC 4U1GC 3KPQA 3RVTC 2Y5TA 1KCUH 3C5ZA 3ULUC 5JW5A 4KFZC 4KU1A 1N7ML 2Y6SD 3GBNL 1QEWA 2VDOH 4MA3A 4NN6C 4P5TA 2QHLA 2V5MA 3KXFE 1HQ4B 1JI2A 3BT2H 2IPTH 3RI5K 4CRPA 3MFFA 4F3FB 1DLFL 4HUXB 1L9NA 4WO4C 1M6OA 1L0QA 4YHYC 2X42A 3HZMB 3O2VL 4HCRL 5C0JA 1MVUA 4I5BB 3ZKSD 1KJ2L 4X7SH 3DO7A 4K9EL 3HR5A 3QXAB 4FQXC 5FKPA 4KKLD 4IRJD 4Z78A 1KXQE 4DZBB 2W9EL 1LK3L 4X9GA 4NCC2 2GW5A 1S3KL 3HG1D 1OAYH 1T4KB 2AXJA 3K46A 3P40A 4KDWA 2PO6D 1EO7A 1MRFH 1T7YA 3SJVB 1KPVB 2DD8H 5BQ7B 5BMFL 3F12A 3QBTB 4JGUA 4MCZA 1A7BA 5JDSA 4X98B 1F90H 5INCA 2GJ6A 3QT2A 3RKDC 3VWKD 4HQQH 1G7IA 1U8LA 1PSKL 3OKDB 4MD4B 2XZCL 3E3QC 1JNLH 3LS4L 4G8FA 4KK9D 5I0DA 1T22B 4JHAL 3E8UL 5C0GB 2V6HA 4PGEA 1NANH 3BE1H 5CBAA 4LPXA 1PGRB 3C08H 4J1UA 4HZLB 2Y06L 1A7NH 3QI9B 1WTLA 1P4BH 3I75A 4FNLL 2D9CA 1D9KA 5HHMD 4QT5A 5C3TA 3SCMD 3MRHA 5IVNA 1M1SA 1OAZH 2C3HA 4LSTL 3QCTH 4MD5A 3UPRB 3FT4B 2Z9TA 4PJBA 1FYTA 1I85C 3MNVA 3HE6D 3HNTL 5I75C 5GS0L 3IFOA 1YEHL 4YR6B 3V6BR 1J86A 1OF2A 1PEWA 4FXKB 1NBVH 1EFQA 3TIDA 1G7PB 2YMXL 4LCWB 4G8IB 4I0PC 3T2OA 4P4KC 2YR3A 2WV3A 4OQTA 3SY0A 4JFQA 1K4CA 4QHKJ 4KJYB 4OCXH 3L7FB 4O02L 1NGZA 4DGYH 2PXYC 1JE6A 4MSWB 2NY5L 5IVXE 3RL2A 4HC1H 5HDQL 5JXEC 2Y6SC 4LSVL 2YOCA 3DV4B 1K8DA 1RSFA 2PW2B 3T3PF 2B4CH 5HHQA 5FYLH 4H8WH 2EDOA 4GG8A 5KG9A 1MRCH 4M3JA 5MENB 4DN4H 2APXA 5I76B 4XHJC 2EZ0D 4HIIA 1PQZA 3I3EA 1WCQA 2R8SH 3VGBA 4O4YL 5EIIB 1NGWA 3MROA 1HHJB 5IK3A 4JRWA 3SDCB 1U8HB 5DEGA 5MP6L 4ONHB 1SEQL 3UTQA 2Z91B 2O5YH 1A7QL 1FORH 3MJ9A 2W65A 5LCVL 4G8EB 4I2XE 2DDQL 2EEAA 2OTPA 3QPQC 4RSVA 3WJJA 3HNVH 1JGUH 2C5DC 3OR6B 2IBBA 1HQ4A 2XA3A 5DQDL 2J88L 3L5HA 4HWEH 5C92A 3VWKC 4F3FA 4HUXA 3VFVB 2W59A 4XBGB 3BEWB 4KXZI 1CLOH 3HZMA 1KGCD 3JUYA 4AM0B 5DHYB 5LBSL 5E1HB 5LVEA 4I5BA 2JJTC 3GSOB 5L6YH 3I2CL 5BO1L 4FMKA 5KANI 4MB5A 2QQNH 4LPUA 3QQNA 3LD8B 3QXAA 4X8JB 4NIKB 4KKNA 4FQCL 5EWIH 1OARL 5IQ7H 3NFPB 4DZBA 4WEBL 3O2DA 4K71B 1DQMH 1Z5LB 3C09C 1I8MB 1C1EH 3DRQB 4UTBH 4YWGH 1UM5L 1KBGH 4PJGB 1T4KA 1T6VN 3R06B 1ZT1B 3BIKB 4P46D 4ZOBA 3SJVA 1KPVA 3OR7B 5BQ7A 3VXSE 3WV0A 2GCYB 2YD7A 3MODL 4HIXL 2O5ZH 1U8JB 2YXMA 4X98A 2JJVA 1ED3B 3X3GH 5D72L 3IS1X 3OKOB 4XP4H 2EH8H 1KELH 4O2EB 4HFWB 4X80H 3OKDA 4MD4A 1T22A 5C0GA 4K2UL 3HI5L 4WUKH 5TQ2L 3V6ZB 4HZLA 3QI9A 3G6JF 4P0DA 3QAZB 1AFVL 3EJYD 1U42A 5DGQA 3UZEA 1X4YA 2AEWA 3UPRA 3FT4A 3MA9L 3S35L 2YBRB 4LLQB 2EZ0C 4UT9H 1A21A 1NCDL 1T83C 1A6UH 4YUEH 3SKMB 3AGVA 2ADJB 4YR6A 2OCFD 1EHNA 4FXKA 1M7DB 1G7PA 3LMJL 4LCWA 4G8IA 4TRPH 5L9DL 1OP5H 5T3ZH 2A77H 3D5OF 2ZUYA 3GHBL 4KJYA 3P11H 3L7FA 1P53A 4TVSa 2PUQT 4LEXH 3WS6A 4MSWA 1KIPB 4BJLA 3FFCD 4S1SH 1CI5A 3QIUB 2DJSA 1TNNA 3HC3L 1F5WA 4HS8H 3VXUB 4XVJH 3DV4A 2PW2A 1WZLA 1IKFH 3UZQA 2B0SL 3D87B 5DJ8B 3DYPA 3HG1E 5MENA 2FNBA 5HYSG 5I76A 3NCJL 3AAZA 4Y4HD 5J0BA 1WAAE 4U1IB 3HNSH 1OQOA 5EIIA 4LPYA 1HHJA 1UYWH 4V1DD 5AYUL 5C6WH 3SDCA 1U8HA 3MRPB 2BX5A 4ONHA 4BUGA 4HJ0C 2Z91A 4UZGA 4G8EA 2X41A 2PTVA 2HRLA 1WFOA 4YHNB 4EI6B 4BZYA 3MRRB 3UYRH 3ZDYF 5HHME 2NY0D 3OR6A 3MUZ1 1T6WA 1MIMH 1MCLA 1NJ9B 4U6TA 5KSBB 1WGOA 1BEYL 4JRYD 3GIZH 3CJJA 4XBGA 1UENA 3BEWA 2XWTB 4AM0A 5DHYA 2VLRE 3IJSB 3BRGC 3A67L 3GSOA 4EKXA 5JUEL 3RA7L 3AM8C 2IWGA 1NEZG 4MA1B 1GVIA 2WWMD 3SOBL 4JZJB 4X8JA 1ZLUH 5I1GH 1PDKA 1A6AB 3ZKMD 3NFPA 3G5XB 4KRPB 3VRJB 4ELMB 5FF6B 5B3JE 1Z5LA 5GGQH 1I8MA 4ZOEA 2CUHA 3ARUA 3DRQA 3BGMB 4PJGA 3CVHL 3RRQA 3R06A 1ZT1A 4M93C 3BIKA 3QZWG 4KDTC 1AC6A 2YD2A 2AJUL 3OR7A 1V7NL 4QNPF 5BVPL 2GCYA 3KPTA 2NY1C 5EOCL 4M3KB 1U8JA 4UINH 5IBTH 1ED3A 4ENED 3WYRA 4PJHB 1BOGB 5EZIL 3OKOA 4F37F 3FT3B 3N50A 4HXAH 4HFWA 4AENB 4GG6E 4J6RH 3KPSD 4HJGA 2ESVB 1DUYB 3QDGD 3V6ZA 5GPRA 1F4HA 2VSDA 3ZLQC 4JPWL 2QSCL 3K1KC 3Q1SH 2EECA 4IRZL 2AEPH 1ZEAH 1AY1H 4K7PX 1ZHLB 2CIIB 4PRHD 4XP6H 1NL0H 4OM1H 2XYCA 2YBRA 4LLQA 4KVCH 4MNGE 3ZKXC 1VA9A 2M1KA 1MCRA 2WWKT 3SKMA 5T1KD 2ADJA 1SHMA 5DK2B 1J87A 4F58L 4U0RB 1TZGH 1M7DA 1VSCA 3FO0H 2JIXD 3VD3A 4PJ9D 2CLRB 1VEPA 2HYMA 2EC9T 1IC7H 1YN6B 3IDNB 1RZJH 4YHPB 4CGTA 3NZHL 5HGDB 4OFPA 1I9IH 1N6UA 5EA0H 4BQ9A 5A2KH 3EIFA 4R97B 3JWDC 3AREC 3LKNB 1KIPA 4KK8C 3INUL 2HFFB 4BFEA 3DWTA 3KDMB 3QIUA 3NIGE 2Z8RA 3WJLC 4YLQT 3UAJD 4HT1L 3NIFF 1KB9K 3VXUA 1FNSH 1EEYB 1U9KA 3MLXL 4ZD3H 2IADB 3JWOL 5DJ8A 2VLME 5T5FL 1P4IH 4XTRC 3UEZA 4GRWH 3CX2A 2JF1A 4NZUL 1X6LA 4U1IA 4H20H 4KQ4H 3P9LB 1H3TA 1CXKA 5J1AB 2DQEH 2VKWA 4OD1L 4XVUD 4Z7NE 1J0ZA 1OM3H 3ECBB 4D3CL 1S7VB 3MRPA 2YZ8A 4NP4L 4ZFGL 4KI1A 2BRRL 4RGND 3AB0C 2VXQL 3QDHA 5T5NF 2HRPH 3ALWA 4ZMAT 5HVHB 4JM2B 3THMH 4YHNA 4ZYKB 4EI6A 3C6LC 2EC8A 2G2RB 5HI4C 3QG7L 3MRRA 2LABA 5A40E 4QHMB 2NXYD 1EV2E 2Q3ZA 3MOBH 1NJ9A 1JRHH 5KSBA 1OSZB 3F58L 4WW1B 2XWTA 3CXHK 5BVJB 1QO3B 2X89A 1RJLB 3C2AH 2QTEA 2PETA 3IJSA 5C0CD 2I27N 1GPOH 3VI4E 1QFOA 4XB8A 5F93C 1WFNA 4JZJA 3MJ7B 2ZCHL 3FN0L 4ZPVB 1A6AA 3AY4A 1MCFA 1U0QA 3G5XA 3VRJA 1OTTD 4QRRB 4FQ2H 4ELMA 5FF6A 2V2WB 1H9VA 1YNKL 3BGMA 2Q20A 2MMXA 3GNMH 5J57B 4OUOA 2VNCA 3P73B 3IB4A 1H15A 1NMAL 2Z4QB 4PBWD 1I3VA 3HC0B 2P8PB 5ALBH 5AAMA 5HHXH 4LNVA 5GGUB 5A3IC 1TQBC 3DXAB 2WMPA 1N59B 4RISH 1OTSC 4PJHA 3PHQB 1BOGA 1VFUA 4OZHE 4RBPK 5CHNB 3FT3A 1O7SA 4OQTL 2D03H 1PZ5B 4R0LC 4PB9H 3OKYA 3S36L 1U8IB 1J5OH 3EJZC 4AENA 4UTAH 1OAQL 3KJ4C 5H35B 4NQCB 2ESVA 4M1GH 1DUYA 3MNZB 1IKNC 4PJ5D 2XTJC 4V1DE 4GO6B 3RTQD 1GRWA 5E08H 1VACB 1ZHLA 1QPPA 2CIIA 1XIWD 1BVKB 4PJBE 1FYTE 3QDJB 3MXWH 1XGRB 3BGFB 5D1ZB 4ONGH 4U1GB 3IF1B 2ZUWA 3MOQA 3RIFF 5DK2A 2YSSB 4NN6B 1CGTA 2WBJD 1IT9L 1FGNH 5F71A 1CD1B 3QUZC 2CLRA 3O4LD 2Y23A 4LHJB 1YN6A 3IDNA 5JOFB 1J88A 4YHPA 2LQRA 4YXHH 2UZIH 3NOIA 5HGDA 5JQ6H 4KUCD 3ESVF 4BFIB 4Q7DA 1F02I 2KZ1B 1HYSD 4YHYB 2VDML 3MRDB 4KI5E 4HUNB 4KJPD 3H6JA 3LKNA 4XZUB 2Z8WC 2HFFA 3KDMA 4FQXB 4CVZB 1J8KA 3QUYD 4OM0H 4M48L 1RJYB 3MJ9L 5M95B 2O5XH 5EDXA 4YQXL 4J3OC 4ZTOL 1UACL 2NXYC 1JGVH 2AXFB 1B6DA 7FABH 1EEYA 3FRPA 3CFKB 2ID5A 1N64H 4CMHC 1MEXH 2DMCA 1UZ8B 3V52H 4OFVA 3VWJD 1NLBL 1EERB 3KLAB 2EE2A 3P9LA 3EDFA 1LEGB 3A6CH 4R4NC 3EOYG 5J1AA 1H0DB 2QL1A 4G6KL 3ECBA 4N5UA 1S7VA 1G9MH 1DQJB 2X1OA 3CLFH 5C09D 3NCMA 3KPRD 3Q5YA 4JG0L 4B50A 1BAFL 3KPSE 5E4IA 2BOCB 1RZKL 3MACL 3O2DL 4JM2A 3T08A 4ZYKA 5I17B 4OCRH 2G2RA 2EO1A 5F97E 3ZE0E 1P2CB 2WWKO 4KZEL 2CDFB 5DRWB 4QHMA 1VESA 2HFEB 5HY9B 3MGAA 1N7MH 1YYLL 3GBNH 5I75B 1OSZA 4N90E 3RZWA 1S9YB 2FX7H 4WW1A 3WHE1 1I7RB 2B1AL 1YEGL 4ZUVB 1KCVH 4O2FB 5BVJA 4XWOD 3VFGL 1QO3A 1RJLA 3G9VA 1DLFH 4I0PB 3O2VH 3MJ7A 3RTQC 2MKWA 2VR4A 3LPFA 3TA3D 5DT1H 4ZPVA 3O3AB 3WSQL 3BN3B 1EJOL 2PXYB 2QLVB 1RD6A 4QRRA 2H8PB 1QRKA 2V2WA 2Q76B