3OF6D

Human pre-t cell receptor crystal structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
104
structure length
100
Chain Sequence
GTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDSPIWFSAGNGSALDAFTYGPSPATDGTWTNLAHLSLPSEELASWEPLVCHTGPHSRSTQPMHLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T cell receptor beta chain
publication title The structural basis for autonomous dimerization of the pre-T-cell antigen receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 13
structure length 100
sequence length 104
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2010-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3of6D00
1BZ7B 1QPXA 4WWKC 2CQVA 1OM3H 3BGMA 3VXUD 2ZUVA 3CFJA 2JB6B 3KNBA 3UPAA 3TV3L 2Q8AH 3ULVE 5T1MB 4XCEA 5EO1B 1EO7A 5TH2A 1OW0C 3IJYA 4F9PA 3I6GA 3OAUH 4QKXB 5IKCA 3VWKD 4PJHE 1ERNA 1AO7E 2A0LD 5E9DA 5C70A 5GS1B 1EFQA 3DV6B 4ZUWB 1JPTL 4J3VA 1MHPL 3RY6C 4NQXB 1X6LA 1ND0B 3V95A 2FCBA 1AQDB 2RIKA 3CD4A 5MI0C 1QUNA 2APBA 4JN1H 3RI5K 3B9KB 3DETC 2X4RB 4I2XB 3IDGA 3PJSB 1NDGB 1DQJA 2CMRH 3TVMD 4ZFOA 1YQVH 1XAUA 1N0LA 2IPUG 4YDJA 1W72H 3M17A 4GBXC 2NX5A 2OQJB 3QSKB 3FRPA 3TGXA 2GFBB 3OF6D 1UZ6F 1IM9D 1JHLL 1KYOK 3HZYA 2ADIA 2R4RL 3FQWB 3FO1B 4OLVL 5CUSL 1RJYA 4HWEH 1S9VB 5HI5D 2GJZB 4NPYB 2IPTL 3MUGA 2YD4A 5BXFB 1B90A 3NPZB 3R8QA 3ZKSD 3ZYOA 1CL7L 1CT8B 3BXNB 1A8JH 2DLFH 4Q2ZA 1AP2B 2DOCA 3C6LC 3EOAA 5DLML 4I3SL 5DJ6B 3REVA 2R1WB 3PGFH 3NCEB 5KN5B 1VGKA 1IC5H 1MHHB 1G6RB 2AK4D 3ARFC 4UI2A 5D71H 3PHQA 5DEGB 2MCPH 2VABA 4N0YH 1F3RB 1DDHA 3FQXB 5IGXL 4Y19B 4RFOL 1NCNA 1J10A 1YC7A 3P30H 4PRPA 3SGEI 2PO6A 1WUNT 1BREA 1JGLH 2VQ1B 2SEBB 4EIGB 4JG1H 1N5YH 1A14H 4WHCA 4GKNB 1E6OH 3CFKB 1JYVA 1MIML 1T0MA 3DX7B 4P3WA 3QWRA 2OTWA 3ALWA 5DUPH 3B2UC 4HGMA 1U8IB 2UV3A 1XEDA 4P46C 1I1AC 2CRIA 5CSZB 4Y1AD 2F54D 4JFDA 4PLKC 2VSDA 2B1HL 5KSAB 5CCKL 5IEKA 1QR1B 5KANI 4ZO8A 5J6GB 5GS0L 2BNQE 3GMMA 1CDIA 2R4SH 4NC2B 3MRPB 4O00A 1G7JB 5LWYL 5DRWA 4OLEA 1LHZA 3V6OA 3ZDXF 3DV4B 3WFDL 3V9FA 4NN5C 1XF2B 4PGBB 5I71B 4LU5H 4IRSA 3MV7E 3MV9E 4EI5B 3MSPA 4KZDL 2DKUA 4HQQL 1GHFL 2PTTA 4PJGF 1H9VA 3G6JA 3TNMB 3HAEG 1XZ0A 5AUMB 3HPJB 3OJMB 4EUPA 5FYLD 3OMZA 1XF1A 3RWJA 2W0PA 4UNTA 3UCRA 3RZCC 2FH8A 1KCVL 3PGCB 4QXWA 5K93A 3RU8H 3A0OA 4M93B 2DBJA 2IAMD 4X6DE 1RSFA 2HWZH 1OAYH 1MI5D 2X10A 3VDCA 1F6AB 2H1PH 2R69L 4M6OH 1XCQA 5D93C 4Z9KB 4PJ9B 1HH6B 1MJ8H 4OIBA 1B0GA 5E99L 2OK0H 3QH3B 1MRDL 3QIWB 1IGYA 3KPMA 3UBXG 3MROB 5D7IE 1U95B 2X4TA 2VZ3A 2VXTL 3CC5B 3BYYA 5GGVY 2A1WH 4O5LL 2R0WH 3MLSH 1FNEA 5IVXF 4WU7A 3BRFA 4NNYB 1HEZA 1Z0NA 2DAVA 4KJPC 4ONHB 3IFOA 1XIWD 4FA8A 5DVKA 4LLDA 1DTUA 1N59A 4NZTL 2E8ZA 3C8KA 1S78D 1F02I 2APFA 5EUOF 3X11B 1D5BB 3V5HB 2Q6WB 1TJIH 1EH9A 5JOPE 3HI6L 4Y5VB 2VXSH 4ELKA 1EEYA 1FL5B 3VG9C 1E6JL 1A0QH 4PJFA 1MJUL 4KVCH 4U1IB 1CLZL 4QRRA 2CO7B 4P57B 3STBA 5GZNC 1RK0A 4X6CE 5LXGL 5ESAB 5FM4A 2QSQA 1BD2D 3VWJA 2HT3D 3ARGC 4JHWH 1TLKA 5TDNA 3BRGC 1DP0A 1ED3B 4JJ5A 3BPNC 5FKAB 1IGFL 1KLUB 4G7YL 4TTGA 5LGHL 3PXJA 4UIKL 1WEJL 2DLGA 3NA9L 2YA2A 1R0AH 1GZPA 1K4DA 2F58H 5C6TH 4AJ0A 3U6RA 1XGTA 5F1OB 5FUOL 3O3AB 5CZKA 4Q0XL 3CFDB 2XWTB 1NCUA 3DX9A 2AXHA 4NRZA 3LZFL 4ZXBB 1NGZB 5D8JL 3C5ZB 3TH4T 3RVTC 1T0NA 3G5YA 1YNLH 2UY7A 4TTDC 4ENED 1L9NA 4C57C 3OV6A 3WN5B 5ETUB 1IQWL 2W60A 2HRLA 1HNFA 4MJ4A 4HS8L 5J0BA 4H1LH 2NY0C 1VFOA 3PABB 3HMWL 4NZJA 4JB9H 4LCWE 3SJVB 4KRNA 1CD1B 1Q9LA 5FM5M 4QWWC 1CU4H 2VITA 2P24A 4O2EB 4R96B 1S7UB 4PJ7E 2KZWA 2KL6A 3W11C 4JRYD 4KI5C 4ZOBA 4CGTA 1R3JB 4WUKL 2IG2L 3SO3B 3U82B 4WTZA 4PG9B 1ZT1B 2NY1B 4U6YB 2FGWH 5I76B 2JB5L 1X44A 3L5IA 3CX5J 5ANMB 3GMNB 3EGSB 1IAIL 4PJXE 3BP4B 1LO2H 1OWRM 1JPSL 4ESKA 1U2CA 4OGYL 1KCUL 2OI9C 4NZUH 4L3CA 3F8UB 2BERA 4LKXA 2X05A 4QTHB 1INDL 3HRZB 4ELMF 3KS0J 3L3DB 5AWNL 4WO4C 1FG9C 5EC2B 4LEOA 5LG1A 4Q9CA 1HINH 3RZWA 3O2VL 5CP7A 5KW9L 4JFHE 3NTCL 4GAYA 5BZWA 1YEDB 2J88L 3RKDC 3BWAB 3LH2L 5I1EH 3NFSH 4BM7A 4WI5A 2VAAA 1E4XH 3RJQB 3GSRB 4YHML 5IBTL 1MNUH 4UTBH 3T1FA 3I9GH 2PCPB 1MAMH 4F7PB 5GGRA 4KAQL 4OZGA 1H8OA 3GGWB 5I1GH 1A6UH 2G60H 1TMCB 2QKIB 4Z7QE 2X1QA 3KLAA 4XNUH 3MJ9H 3D39E 4TULH 5FO9B 5HHNB 3O9WD 1SMOA 3RDTC 5BW7C 4P5KB 1A47A 2UWEB 1JF1B 5HPMB 4KHXL 3LN5B 3VE0B 5HHPA 5DMKB 1OAXL 4KTYA 4XC3H 4U1HA 2P8MA 4PJIF 3VXUE 3MLUL 1FPTH 5JMOC 3KPOB 4HXBL 4GKOA 3D85D 1J1OL 5IM7B 1B0WA 1U0QA 5CAYB 3B8SA 4F7MB 1MFCH 2JCCF 4XXCC 3SKNA 4XMPL 1NGYA 2D03H 5D7LA 3FT3A 3P9LA 4O2FA 1Q1JH 4Z7VE 1BFSA 1BBJB 4K8RC 3HE7C 1A1NB 1J1XL 4IMKA 3ZHLA 5ABDE 2R8SL 3O2DL 2R2HB 4PRHD 4HJGB 3T1WA 4MXWL 4J3SA 2AS5M 4WUUA 1MFDL 1KIRA 2HN7B 3GB7A 4PGCA 5DRXA 2Q7NA 1LE5B 4D3CH 2WANA 2Z93A 5IVNA 1MIEL 4XMLH 4G8IB 4F3FB 1IC4H 3OZ9L 3ARFA 1FFNA 1YEJL 3MBEA 2NTFA 1RUKL 3EFDH 3PP3H 4XVJL 4CJ1A 1QR4A 2VL5B 3MLZL 2NCMA 3PV7A 1QA9A 3AB0B 3HUJF 3L3IA 3HG1E 2EE6A 5T5FL 4TUKL 2PYEA 4BJLA 5DJCA 5C0BD 3O3BA 3X12B 2AJUL 3T8XA 4OFYD 5C0AE 3D25A 4H0GA 5CEXA 1FO0B 1LO4H 3EHBD 4J8RA 5CIPA 4Z76A 3H42L 1KJMA 3RRQA 1S8DA 3HI5L 3WBDA 2COQA 2RGSA 1DQLL 4CMHB 5DHVH 3BPLC 1KIQA 3QO0A 1FLRH 5DYOA 2OR7A 3DBXB 4X4XB 3NFPB 3ARTA 4LARH 3U0TA 1ZHLA 2XY1A 1U41A 1U8PB 5EA0L 4HT1L 4LPCA 2WQRA 1QKZH 5FYJD 2VISA 4ODUA 3THML 2YD7A 1WAAE 3TBSA 4M48L 1W0VA 2UZXB 1QFOA 4U6VL 5TQ2H 5C0GA 4XX1G 2YKLH 3UTSB 2J8HA 5CSBA 2VLLB 3CVHL 4PGEB 4HJ0D 4PPTA 3EZ8A 5D2NB 2IANB 4ZTPH 1Q94A 3G08B 4HAGA 1T1WA 1ZLSH 4OB5L 9CGTA 3TO2A 2HJLA 4S10A 4DOHB 1S7XA 4Y5YA 5E5MA 3SCMD 3NIGE 4HKBA 4JFEA 1EJOH 4BUGA 3MLTA 3SKJH 1ZT4A 3MRQA 1LP9A 1JHTA 3FB5B 5F3HB 4EI6A 2WSKA 3DROA 3GRWL 8FABA 3SGJC 4HH8A 1SEQL 5I0DA 1YJDL 3TNNA 3MV8D 4NUJA 2X44D 3S98A 4GAFB 5GS1C 3MRLA 4F2MA 1YPZA 4EDWL 2P5EB 4HW6A 4X4ME 3Q6FB 5F7EH 1A7NH 4N9OB 4UOW0 4OCRL 4XP1L 1H3PH 5D5MB 3UC0L 1EBAA 1MI5E 1KB5A 3B9KC 4M00A 3VW3H 2AXFA 1I3RA 4I77L 1G9NC 5J4MA 3ARGA 3BIAX 1Q0YH 3KPLB 1JTOA 3RL1B 3LSOB 3S96B 1LEIB 1T21A 2QEJA 3SDXA 4Y16A 1DJSA 4LK4A 2HFFB 5EO0A 5JXEA 4XPGH 5E1HB 1HOCA 1CXFA 4WFHD 4HWBL 5ESQA 1IGJA 2ILLA 4UQ3A 2CGRH 4LF3B 2WM0A 4H8WH 2FBJL 2HLAB 3CDFA 4IHOB 1BFTA 4HUXA 1A7RL 2OXHA 1E4KC 4R8WL 3VXMA 1I9RL 4K7FA 4Z0XA 2W9EL 3SDCB 1YEEL 3PHOB 1YZZA 1CGSL 1C16A 2HFGH 5C8JA 4LPXA 2IGFL 1WF5A 5DQJB 4UV4H 3BKJH 3K4DA 5K9JL 2X4NB 5HDQL 3MGOB 1B0RA 2HG5B 1MPAL 3FB8B 1AGEB 4CVXA 3Q1SH 1JE6A 1LK2B 4FQHA 4ETQA 1I9JL 4KZEH 2JK5A 4WNQB 2EDEA 1UFUA 3A67L 4HS6B 4NO0A 5KSAC 4YXLL 3EO9L 1DVFB 5IB4B 4EBQL 2YPVL 1P84J 5D6CB 3JWDL 1ADQH 5DMYA 3OJDA 5IESH 4LRNH 1WQVT 4QXGL 4MLIA 4LNRB 3WFCH 1NMBH 2Q76B 3GMRB 4X7FC 1BM3L 4P0DA 3R8BB 3SE9H 1MCCA 5I71C 4KRLB 4GXVH 2EDBA 4RAUA 4EI5C 2H32A 1SBSH 3S36L 1XF4B 5BO1L 4C56E 5BJTB 4WWKD 4DZ8B 2X70A 3NGBB 2E9JA 5BMFH 4JRYE 2V2TB 3MACH 4L4TD 5EZOH 2A6JA 4AEIH 1TIUA 2FSEB 4M93C 2APTA 4DGVH 3ES6A 1GGIH 5EZLA 5E2UL 1KJVA 5FAAA 4K2UL 3P4LA 5BS0A 4KUZH 4PJ9C 2PXYB 3QIWC 1I3UA 5I1DB 5DFWH 1JZ8A 4X7SH 1HQRB 4AENA 3U7WL 3X3GH 5AG8A 1LQSR 2NY6C 1G7QA 3AAZB 4ZPTA 1OSPH 2YEZA 2EC9T 4PP1C 1I8LC 1D6EA 3DETD 3NIDE 5M95B 3S35X 1NFIA 4IRZH 3KPSD 1MVUB 4X0KB 3U1SL 4RQQB 1CGXA 4GBXD 5DJ0B 4ORGB 1FZMA 4D0BB 1LO5B 1N6QH 3MRIB 5TE7H 4Y5VC 4J3TA 3HKFA 2Q86B 4PRID 4WW2B 5E00A 4XXCA 3TT3L 4ALAL 5JOEA 5FDWB 4JN1L 4I5BA 3SOBL 1NPUA 1SJHA 4HK3J 4KK8C 2XZCH 4P2QD 5E9DE 5GJTL 5EZJA 3DRQA 2BRRL 1NEZB 3VI4E 3MA9L 4IMLB 1ZKAA 4POUB 3G5VA 3MODL 3C6LD 4Q58C 3KWWB 4V2CB 4F57H 3W9EA 1YNKH 2HVJA 3ZYZA 1XT5A 2EKSA 1SQ2N 3HNSH 3QG7L 2AKRA 2Q3AA 3FT4B 3V6ZA 3WNOA 5JA8B 1MCPH 2NW2A 1A9BA 4U49A 2VKWA 2P4AB 4U2ZA 3LKNA 3WJLA 4FQ1L 1TJHH 4ZXBC 1CVRA 1D9KA 43CAB 3O4LB 5KSVB 2X4OA 2RHEA 3QXVA 1M6OA 4P23B 2VIRA 4JVPA 3OKOB 1P1ZB 4NO3B 3WN5C 3B2UD 3WE6A 3MLVL 4HWNA 4P46D 4O9HH 1I1AD 4R26L 5DJYB 5D70H 4QXTA 4AT6B 4XWGH 1M05A 2MCPL 3O6LH 5HYJA 4PLKD 4N0YL 3OJVC 3L3HA 4DN3L 2IQAB 4HIHB 4LIQL 2M2DA 1U91A 4HZLA 1KACB 4Y4FB 1JGLL 3TEUA 3LEYL 3SO3C 3G9VA 1T5WA 2DYPB 1R3LB 3EO0B 5EBLA 4PD4J 3VA2C 2NY1C 5DS8A 5DJAA 3MJ7B 3MRJA 4P2RB 3T08A 2IBBA 2YPLA 2FX8H 3FT2B 1RZKH 2YUZA 3GSOA 5CZXC 3P4NA 2HFEA 1IC1A 4OM0H 3U46B 4U6HB 3B9DA 4FZEH 4ZSOB 2A2QT 4MAYB 4NJAH 3RZCD 2GHWB 4QT5B 2EDLA 4JFQB 4ODTH 3H9SD 3CDCA 3KYMB 2GJ6D 4Q7DA 2IPKB 5BV7H 1DEEB 1Z3GH 5CEYB 1ZA3A 1NANH 3TA3B 3HHRB 2R29L 3DX8A 1AGFB 4BQCA 5CHNB 4ZUUB 5L7XL 3IKCB 2ATKB 3L5WB 4EUPH 4F7CB 4TVPE 4W6XB 4DUVA 4HXAH 1QRND 3V6OE 3K7UA 4DVRH 1AGBB 5LAXA 3AU1B 4KJPD 3RU8L 1BVKB 4K9EL 4GKZA 3I02A 1GXEA 4LSPH 4P5TC 1L0QA 1O7VA 2LVEA 3DTXB 1AC6A 1YY9C 1MJ8L 2H41A 5GS1A 4MAUL 1JMZA 4MSWA 1GC1H 2LQRA 4CN4A 4NM4L 5JIKA 2R0WL 3WS3A 1TPXB 1AQDA 5FM8A 4YDLB 5H35B 1IM9A 3GBLA 4NN6B 1EDQA 1XMWA 5T33H 1JNJA 4O4YH 3LCYA 5GZND 5IBUB 5HY9A 1CE1H 4QXUL 4BH8A 4JAMA 5INCB 5I16B 4OZHF 2VDKH 5DC0A 1JK8B 4HUUA 2H26A 3DURB 4WEUD 2E7HA 1QQDB 5GGTH 4JFZL 4QHUA 2VXSL 2XFXB 3L5JA 3EJZC 4G9DA 4F58L 4KVCL 3G6DH 3FQWA 3FO1A 1QFHA 4HFUH 4U1NB 1UXSB 2DQGH 1UG9A 2BZDA 2D7MA 3BO8B 4FTVB 5LQBH 2ZOLB 4YK4B 1M7IB 3I6KB 4PJFE 1IC7H 4TTDD 1TENA 3QIBA 4Z7WA 5DJXA 2V7NA 1M1SA 4U1JA 5HHOB 1TXKA 4WWID 2YOCA 43C9A 3T65B 5BQ7B 4XWOC 1MHHA 1A1MA 4P5MA 2F54A 5FGBC 1SJVA 2XN9B 3MNWA 4HMEA 3REWB 1CDBA 4FS0A 1J05B 2B39A 4YBQC 2OMBA 3AB0C 3QRGL 1CGUA 1UZ8B 2DQHL 3W11D 3LN4A 5I8CA 4ZFGL 1RHFA 4JG0H 4OAWA 4WFHE 2AV7B 3SE4C 4JKPL 2ZNXA 4XAWH 1KFAL 4J1UB 5ERWA 2P7TA 3WIFA 3S3JA 2JKXA 3UPRA 2W65B 4G43A 1EUTA 5TDOA 4OZIE 1T22A 1KEGH 3F12A 4HBCH 5HYSB 3GSVB 2RAMA 4QNPF 4CMHC 2X4SA 3ZZ1A 1TITA 5L8KB 1FGNH 1TTGA 3ETBF 1EHNA 4JQVC 1U8OB 1V05A 3VXRA 2F9BT 2ZJSH 3L3GB 4ODXA 3IAGC 3IXAA 4LLVB 4WO4D 2FGWL 3CUPA 4PJCB 4GQ9H 5IB5B 7FABL 3CPLB 4GKSA 3ORJA 4HLZG 4E41A 2ZUYA 4IRJC 2WP3T 3RKDD 3KDMA 4NCC1 5K59E 1V7NL 5C0JB 1LILA 3OAZH 4JM2F 4NZUL 1MRCH 5JQ6L 3LKOA 2NQCA 4NJ9H 1ONQB 3FB7B 1WZKA 2A9ML 4KJYA 3QDGD 1U6AL 3IJSA 4G8GD 2H6PA 5IW6B 1D6VH 3BH9A 3WUWB 5HYQA 1HINL 1JNHB 3MRCB 2IADB 1JYWA 4QRQA 5KTEL 1E4WL 3CC5A 4QRUA 2F5BL 4JLRB 5I1EL 3BGFB 5EU4B 1O7SA 3D9AL 5BRZD 4TQEL 6FABL 2QR0A 2F8VA 3FQNA 3NFSL 3FOMB 1BOGA 5E6YA 3RDTD 3QNXA 1U3HA 1I8LA 4QRPB 3VDBA 4OIAA 3JWOH 3KLHC 1J0HA 3VFPA 1U8JB 5ILTL 3I9GL 1QSZA 1PSKH 3WEXB 3QWOB 4MX7B 4L4TE 3EBAA 4X5WB 1IEAA 5MEPB 4XNUL 1Q0XL 1RZJC 4XPFH 2ORBL 1NC4B 3H7BA 3MXVH 4QRSB 4OZFG 1UADC 3ZDZF 3G04A 4XT1C 5EORH 4OF0A 5L6YH 4HV8B 1I3VA 1FGVL 2ITDB 3HE7D 4RCAA 4RWYL 1OLLA 1QRKA 2DLHA 2R23B 1ZGLM 3W82A 3GI8L 4S0TD 4S0SD 1YEGH 2DLTA 4MA3A 3QISA 4G5ZH 1J0KA 1ES0B 4MD4A 3UYPA 3IDMB 3G6AA 4B53A 1KLUA 2MWCA 1F3DH 3HS0B 3W0WD 4K94H 1QO3A 1G7HB 3BIKA 2H2PC 3QP3A 3VGHA 1MFCL 1IGTA 2PF6A 3IJHB 2J7LA 3GMPA 2ZPKL 4F7EB 1O0VA 2XPGB 4ZO6A 5LCVH 1N5AB 4E9LA 1IKFH 5JW4Q 4NCDA 2JIXB 2KZ1B 5IHBA 2EYRA 3MRRA 4Q74A 5E08L 1WBZB 2VLRD 3OPZH 1NGZA 2ARJB 4IOIB 1MRFH 4PRIE 2ADGA 2BNUB 4OUUB 3UTOA 1ITBB 4P2QE 1FZOA 3SDCC 5CKAA 1DQQB 5CD5C 3VGGA 4OJFL 4N0FB 4LSUH 1S7RA 3CFEB 4LLQA 3PABA 4TN9A 4OZGF 4WUUE 3HB3C 3VU2A 1CD1A 1I7ZA 1PKOA 4PLNC 5MEOA 3WSQH 3PQYA 2N1KA 3QDMD 5B39B 5C09B 4U6YA 2FD6H 1OQOA 3O45B 5GGSY 5CIPH 3KPQB 1LO4L 1OTTC 1RU9H 3QJFB 1FRGL 3QZWA 4GQPH 35C8H 3KLDA 4Q9RL 5I1LA 1UT9A 5KSBA 1DVFC 3LQMA 3BP4A 3VD3A 4CDHA 4H5SB 1U42A 1NAKL 5FF6A 1EERB 1BVZA 1QG3A 3ZLQC 3OKNA 4K3HA 3EYOA 5E2TH 3HRZA 4LDLB 1J8HB 3RWHA 2VXUL 5D1QB 1C5BH 1EO8L 3H9ZA 1S9KC 3NFNA 5EC2A 4ZDHB 4UZGA 3AGVA 4TSBH 4W6YB 3CXHJ 1WCQA 2DQFB 5FV1L 3SN6N 4NUGL 3TJHD 1D5XA 1DL7H 4XVTL 1L0YA 1SEBB 5CGYC 2C1PA 4DFIA 3S34H 3QUYD 5E6ZA 4FFYH 4OF6A 3GSRA 1ODAA 3O0RH 4ZG1A 5CGMA 4HMCA 5IHZA 4PJ5A 1PG7W 4P5TA 15C8L 2PXYC 1A6TA 1A7OL 4HG4J 2ED9A 4JY6B 4YHZL 2P8PA 3JTSA 3D85A 4KHTL 1ZLSL 1OTSC 3MO1B 3OHXB 1NSNH 2AV1B 1YYLH 2HFTA 4I0PB 3H9SE 3D1MC 4JPVL 5ADOL 5J11B 2GJ6E 4LQFH 2Z8SA 1PZ5A 2Z8VC 3B9KD 4P5KA 5IFHL 3IB4A 1TZGL 2CJUL 2YZ8A 3BT2H 2EIDA 4V2BA 2QQLH 1QSVA 4AH2A 4OI8A 2DMKA 3EYUH 4PJHF 1BJ1J 1QRNE 3KPOA 1OGTA 2V6HA 1LP9E 1T6VN 4K07A 4OLXH 1GIGH 4HWZA 4WW2C 4L8CA 2BJML 1H3PL 1WSST 4P2OB 1KB5H 4TUJB 3UAJC 4YHIB 3VXSB 3I50L 5IHUH 1A1NA 3U7YH 4CUCA 3S88H 2CDEA 5GRVL 1NMAL 3C60D 4G6AC 2FIKB 1Y0LA 4UILH 2IFGA 2I9LB 5DWUH 1C5DA 4NQSB 1WBXA 1WT5C 5LKNA 3SE8H 4PJBE 4F3FA 1OAKH 3P11H 3T2PA 1IM3A 4Y19D 4YDIL 4NDMA 2HVKA 3U9PL 3UZQA 2IEPA 4QHNB 6CGTA 2XZAL 4U3CA 5FFLA 3VXOB 4P23C 3FO2B 3KYOB 3C87A 5HVFB 2DJUA 5D72H 1MAJA 4X8XA 4IDJH 1NJ9A 1JF5A 2G5RA 5KSAD 4M6AA 5EO9B 3GK8L 4Y2DA 4OCSH 1U92A 4Y4FC 3VXME 3T2NH 2WUCH 4HFWA 3CVIL 1IEHA 2QQKL 2CIKA 2C7UB 2NY3B 2HTKC 4EI5D 5CBAB 3RTQB 2VE6B 3GIZL 4MD0A 5JIHA 1JGVH 1NGPL 1JNLH 3HPLB 3OKKB 1QYGL 4KUCD 2MPAL 2UZYB 1VERA 5DQ9B 4BSVB 4ODWA 4HIXL 4KI5E 4IRJA 4MAYC 4XCFL 5E03A 5GS0C 4LSVL 1B6DA 4HJJH 1ADQL 1OY3B 1BJ8A 3OR7A 1Y6KR 5IESL 3KR3H 4XZUA 3BZDA 5IB1B 4DKDC 4PB9H 1N2RB 5C0FB 1R3IH 1DN0B 1T1ZA 5BVJA 3TA3C 3C5SA 2H32H 5B4MC 4PJ9D 3V5DA 1EZVY 1FYTB 4N0CC 4PR5A 2FX7H 1GAFH 3QIWD 3OKDB 1JN6B 1NCDH 3T2OA 4MD5B 5KS9E 1V3JA 5CEZL 2LU3A 3RWGB 2JJTA 5D7KD 3QQ4A 3WIIH 5E8PA 4PFEA 1FFOB 4OFDA 2AEPH 2XV6B 3IGAA 3N85H 4GOSA 4UT6H 3FN0H 1AHWB 1A7QH 4MCZB 3PDGA 2C4FT 4DW2H 2VDRH 4J23A 5L2KB 1EHLL 1KT2B 5DD0L 4HCRL 4H20H 1EVUA 2GT9B 1E0OB 3DUUB 2AEWA 2X4UB 3DIFB 3RL2B 5F21B 4TPRH 1HHJB 4WJ5A 3GSNL 4N8VB 3O3DB 4ISVA 3X3GL 1OGAD 1TPXC 3RX5A 2BOCB 5EU5B 2Y07H 4YDLC 4NN6C 4PP2B 5JIPA 5D5MA 1RULH 3AS1A 4KK8D 5FV2A 4U6XA 5TFSH 3UTPE 1LD9A 4I48A 3VRIB 4K55A 3QDGE 2HH0H 4G7VL 4JDZB 3HC4L 4OFPA 5KANG 3FO9A 2A74A 4IRZL 2R0LH 4EIZC 3ZKNC 3MZGB 5GISH 2CK2A 3MR9B 3MLPA 5I1HH 1X4YA 2J8UB 4RRPA 3RL1A 5CJ8A 5BRZE 5GJSL 5AG9A 2D31B 1SYVA 4QLRA 3PWJB 1N6QL 1A02N 2E7CA 1CF8H 1UKQA 3CU7A 1FSKB 2XZCL 5HDLA 4HGKC 4U3XA 1RUPH 2XA8L 3MCG1 4H26A 4X6CF 1XR8B 2IPUK 4ZXBD 4YK4C 3C5ZD 1W72B 4FQQA 4NT6B 4S11A 5JHDA 1CFVH 1WFOA 1KXVC 1ZEAH 2ZSWA 1FIEA 2QLVB 5I1KH 1KG0B 2FATH 1JGEA 4PJGB 2JJSA 3SJVD 3CH1B 4FQXB 1NCAL 5DDHB 4EVNB 1EGJL 2LU7A 3VFVA 1LEGB 2WUBL 1A3RL 4MS8C 1HKLH 5T1DH 4A2MA 1TCMA 4NQCA 3ZTJG 4XI5C 3QT2A 1N7ML 5T3XH 1CGWA 5CJQL 4JCMA 1KBGH 1ZANH 3TIDA 1U8QA 3NACH 4LSQH 4OIIH 1J18A 3DVGB 5D70L 1T5XB 4DWHA 2EEDA 3FQTA 3HZMA 1IQDB 2VLRE 1S7SB 2OR9H 3DWTA 3QUKA 5EU6A 5IB4A 5JDJA 3KYKL 1MFBL 1PEZA 2HAZA 3LQAH 4PJDE 2E6PA 5IVXB 2CLVA 2Q76A 4KKCD 1BAFH 1KN4H 3H3PL 4Z7NE 3DXAD 4RFNB 5HYJE 4D0DB 2J1KA 2VKXA 4K3EL 4PGZA 1CXKA 3UJIH 1DUYB 4YR6A 4JO3L 5EUOB 1X5FA 1UVQB 4AEHH 5T3ZH 4MJIA 5GRZA 2K3TA 2WWMC 4X5XA 4F37F 1PKQB 3S35H 5HGBA 3CDGB 3O2WH 4CAGA 1LO0L 3U9UB 4LSSH 2DI9A 4IOFC 5DD3H 3WHXB 1JNNH 1Z3GL 4HUKB 4WCYH 1BQHB 4BZ2L 4XNYH 2LVCA 4X6DB 1YY9D 4J3OC 2ZCHL 1K6QH 3BKCH 1XGQA 5GGVL 3MLWL 1PYWB 5AAWA 1NFKA 1UXWA 3S6CA 3OGCA 1S9XB 3GBNH 2D7QA 3BGFC 2WIIA 3HAEA 3AAZA 4LEXH 2XACC 3LKRA 5ID1B 2BMKA 2R39A 7CGTA 3PWPE 1IEBB 1NC2A 4KDTC 3HC0B 1I8KB 5DSCA 1NANI 4LSPL 4ODSH 2AABL 4NRXA 5C7XH 3HZKA 3D3VA 4RQQA 4ORGA 5I15H 5JPMB 3NBNA 1LO5A 1RIVH 2PYFA 4FXLA 2EYSA 4GRLD 3EJZD 3CNKA 4D0CB 1QLFA 4M61B 4JGMA 4H88H 3UBXA 4O4YL 4KMQA 4RIRB 3LS5L 5FO8B 1A4JA 1R3KA 5F44A 2AK1H 2EECA 1H0DA 3ARDD 4JPIA 3UJJH 2ICWB 4MNQA 4MJ6A 2QQNH 4DVBA 5GGTL 3RWIB 3DGGA 4I2XE 1HN1A 5C07A 1I4FB 4LPYA 3TT1L 2B7DT 4ODBD 3QR2A 4P4KB 4XBGA 3WIHA 1GGBL 2HJKB 4YBQD 1ZLWK 1BZ9A 4POZC 4KGLA 3VXQB 2HT2D 1PD6A 1M7XA 5IQ9B 4LP5A 3O81A 5EULV 5CJOH 4TOYH 2JJUA 1H5BB 4LLYA 3QEQB 2F74B 2LAGB 3SY0B 5JR1L 1S3KL 1U8HA 3VD9A 2I9TA 5EN2B 5EIVA 5HHXL 1ZSDA 1AIFB 1NBZB 4NQEA 2IQAA 1AFVH 4R2GB 5F96L 1A3QA 1WIPA 3KJ6H 3IU4H 1FFRA 4Y5XB 3JVGC 4MB5A 4ZFFA 4XAWL 2ITCA 1MFEH 3MMEB 2V5MA 3VJ6B 5MEQB 3MJ7A 4P2RA 5F1IB 1QPPA 3CU1A 4R4NC 5IVOA 4Y19E 3S4SB 2XTLA 1VFUA 1KEGL 4H1LB 4MQ7B 3RGVA 1VENA 1FN4A 5J6HA 3G9AB 1RURL 3FN3A 3JSSA 2DIJA 3PNWB 2GQHA 1VGEL 3VFTA 5IJVA 1A2YB 3FJTA 3UTSD 4JFQA 3BSZH 3GJFK 5FECA 2B2XH 2PW1B 3KYMA 5DK0B 2NY5H 1DEEA 3V0AC 1HZHL 1FZKA 1T0PB 1Q9OB 5DD6B 5B3JE 5D1QC 4GG6A 4QGYA 2HLFD 1QFPA 3DVNB 4GQ9L 4YHLH 2IAND 4LPWA 1X9QA 1NBVH 3GJFA 3TBWB 3V5KA 4MA8L 4KXZH 1PAMA 3QFJB 1AKJB 5FK9B 4U6TA 3GSUB 3VXRE 5KOVC 3HZVB 4RFEA 4P3DB 1CLOL 3UTZB 3AU1A 2X4QA 1N26A 3ZHDA 1P6AB 3KLHD 2EE9A 3P0YL 2Q1EA 4L8BB 4OV5A 2C26A 5I6XC 3QFDB 5LBSH 1INQB 2FJHA 2Q87A 1RUQH 2P5ED 1K8IA 4M3JA 2B0SH 5CJXC 3K46A 3PL6A 1LO3H 4WHTB 5TE6L 2C3VA 5J11C 1U8MB 4MGXA 2GW5A 4QHMA 3NIGF 1NDMB 5IBLC 2KQMA 3PWUA 3C8HA 2VLKA 2RFXB 4X7EC 1X5HA 5FCUH 4R7NA 2V5RA 1MLCB 1KV3A 2V9QA 3EZJB 3HTLX 4KC3B 2X7LB 5I16A 5DUMH 4ZTOL 1E27A 3V0WH 3QUZB 3CSBA 2DL2A 4RDQF 5D7KE 4AY0A 4E0RA 4WFGD 4EQ2A 1VACB 3N06B 3HUJB 3ARBA 3E3QC 3JUZA 4NO5A 4WI8A 4OCYH 1WBYA 2H2PD 2XWJA 3T3MF 4P2OC 3QHZH 5IROA 2A83A 5EORL 3V52L 4WV1B 5I8KL 3E1F1 1REIA 2J4WH 1AJ7H 2QSCL 3OGOE 5D1ZB 3WFEL 3Q3GB 2R15A 4UAOC 4Z7VB 5T1LA 1YEGL 2ZOLA 1TZHA 3DMMB 4G5ZL 1N6UA 3I6KA 2R1XB 1ZHKB 2VXQH 4K94L 2X1WL 5F1NB 3SDCD 1QLRB 1U58B 3T65A 3HI1A 2HTLC 1G9MH 3U4BH 1VEOA 3VXNB 1ZWIB 2RCSL 1WC7A 5CMAB 5DMGD 3TH2T 2Q7YB 2XICA 3HCVB 2O5XH 1DBBH 4I9WD 1FDLL 1N8ZB 4M6MH 2VMFA 5L0QB 4DKEH 3VXPA 1XGRB 3ZE1F 3LN9A 3TBVA 5M7QA 2VZ1A 1N64H 2VDML 3K8MA 4QY8B 5I8EB 3GKWL 2VZOA 5C0IA 4NHCH 3FAWA 1K4CA 1WITA 3RPKA 1JI2A 4N9GA 2AJXL 1L7IL 2ICCA 3MCLH 1DVFD 5C0AB 4FFZH 4X8JA 3WD5L 1T2XA 1UGNA 3AREB 4G9FB 1C1EH 4ZFZA 1SMAA 1A6ZA 5EBWB 3QUML 2NY3C 3CMGA 1MCKA 5CINH 3RTQC 4UT7H 1NLDL 2AJSL 2WLYA 4ZOEA 3DUSA 1IZJA 5F88B 5I1IH 1NAML 3HMXA 2DB8A 4X7TB 5LGJB 5J3HC 5DHVB 5D7SH 4HDIA 1UYWH 4LPTA 5HHVH 3VRLE 4OFKA 3JWDC 3ULUH 1I75A 4EKXA 1J1PH 4XTRD 1KN2H 4FQIH 4HK0B 1T83C 2WV3A 5E2TL 2BDNH 3FB7A 2ADJB 5ANME 3PV6B 1UEYA 3QYCA 3TJEL 2PXYD 5B8CB 2BSSA 3FAXA 5ICYA 4TSBL 5E8EA 4HF5H 1QFWI 1OTSD 1DBAL 4OD2A 4U7KA 4NHUB 1DL7L 2WW8A 2Y36L 3O3EB 4I18B 2XNAA 2MHAB 1AHWC 2BVEA 4KDTA 4HWUA 1TTFA 2I24N 1EXUA 3L5XL 1IGML 4WI2A 1J5OH 3UTTA 1HQ4B 4EXPX 3QWOA 3RVUD 1YMMA 1JYXA 1AXTH 3DO7B 3JTTB 2R0ZL 3L1OL 1G7IA 1MCSA 5C0DB 4BZ1H 3TESA 1D7FA 1NSNL 1UQSB 3BEWB 3UAJD 2F53D 3LEVL 3S5LA 3QHTC 1F4AA 2ITDA 3SKOB 3JV6A 2FL5A 2QQLL 3RIAK 1A1OA 4GO6B 4B50A 3EYUL 4QGTA 4C83A 5KSBF 4ZUVB 4LSRH 1QEWB 1FC2D 4PLJD 4TNVK 2UWEE 3K8LA 1G84A 3LHPH 4S1QL 3IJHA 4XCCL 1P4IH 3UP1A 3GSXA 3V0VB 1KCRL 1VA9A 4I3GA 1K5NA 1IMHC 5ISZA 3VI3E 5FA4A 3EO1A 5M94B 3TN0D 3GUTB 1HIMH 3D18A 3NMEA 1T7WA 3O2DA 1WBZA 4NM8H 2VR4A 3VI4F 1EFXB 2ARJA 2BSRA 3FFCA 3O4LD 5MP6H 3MXWL 2BNUA 4L4JA 4N5EC 2FIRT 1B4JH 2FB4H 3N1MC 4D8PA 1OAKL 4XPAH 4RA0C 3P11L 3H9HB 1R5WA 1JZ3A 4FQXC 1YEIH 3F7VA 1VFAA 3QEGL 4MJ2A 3OKEA 5ADPH 5A16A 3MREB 4PREB 4G80B 3GIVB 1QNZH 2HKHH 1HH9A 4XMKH 2DYPD 4WI6A 3CX5K 5B39A 2HTKD 5JA9A 5D2LB 3STLA 1IKNA 5FOBB 4LRIC 1I7TB 5DZLA 2DRUA 4QOKD 4N8VG 5CD3A 3RUGA 3KPQA 3PXHA 4LVHB 5E6IB 1D5MB 1F6LL 3I75A 4G3YL 4CDGC 4MAYD 1MQKL 3Q0HA 5SX5K 4H5SA 3EYQD 1R24B 4KTEL 3VFRB 3BP6A 5CILL 3LDBB 4JFOA 4DK3A 1KPUB 3NPSB 4YFLI 5CLTA 2LTQB 3QUYA 1PEWA 1BQUA 4AMKL 4RFNC 4F33A 2ATPA 3B5HA 3TA3D 5B4MD 1EEZB 4MNGA 1NFDF 4N0CD 4WEBH 1SYSA 5FHAH 3GI9L 2BFVH 1S9WB 2XY2A 5DJDB 1SBBA 1JGVL 1UB6B 1WZLA 2A77H 1JNLL 4W4OC 4Z18A 4DKAA 5IT2H 5J9PB 3FL7A 4WVRA 4JFFD 1R5VB 8CGTA 4ZUTB 5I1AA 1GPOH 4KK6D 5K9QI 5I0ZA 1G7PA 1VFBB 2DM4A 2P44B 3CVHA 3MUJA 3QI9A 1MJJA 4V1DA 1NL0H 1I1FA 3P4OB 1J0YA 1GGTA 2AJVH 3T0DA 3HN3A 4TRPH 3H7LA 3PP4H 3GSQB 2VDLL 2UY6A 4JANB 5JPNA 1RZFL 1P4LA 3LS4H 1Z5LA 1DUZB 2GSGB 3MYJA 4CKVX 1NGXA 3MJ8B 3UZVB 2AEPL 5EFIB 2XZZA 4M3KB 3N85L 4UTAH 3GRWA 1CLCA 1ZXQA 2GITB 2VDRL 1U3ZA 3ZKND 5C3TA 4JGUA 2IANE 1X5ZA 2XXMB 3LRSA 3T0EB 5HHMB 5KBNC 1GYAA 3LB6D 4TSCH 3SDYH 3BGMB 3L5HA 3CFJB 1OARH 3KNBB 5ELIA 3JUYA 3L3OA 3PDDA 5FYKH 3NZ8A 3WLWD 2VERN 4YGVA 3MFFA 3GKZA 4XCEB 5TFSL 5TH2B 1KLGB 3IJYB 3I6GB 1WFNA 3KJ4B 3VH8A 5F8QC 2P5EE 2CIIA 1FZJA 3BQUA 5IKCB 1TQCC 2AXGA 3QIUA 4FTVD 3T4YA 5E9DB 2CD0A 1U8NA 1KTLA 4R0LA 4AEFA 5D5ME 2CK0L 5F7DA 5HHOD 1CF8L 2P5WB 4J3XA 4J2XA 3O4OB 1MWAL 4YZFF 4DGYL 4JREB 3RIFK 1FL6A 4P4KC 3IDGB 2DQJH 3NABH 2XN9D 1DQJB 4WFGE 4ZFOB 4RSVA 4YDJB 3GHBH 5IOPB 3M17B 4O02H 2NX5B 5L8LB 1DLHA 1H5BC 2JJVA 5DQDH 1NEUA 3LY6A 2NW3A 2XWBA 3HZYB 2ADIB 1HSAA 5KG9A 1RZGA 4ZQKA 1RJYB 3MRKA 5F7YC 1PBYA 3QUXA 5I18H 4R2GC 4J6RL 3MUGB 1BPVA 5T1DL 4FOMA 4Q2ZB 1BEYH 4WDIA 4Y5XC 2A6KB 2IBZX 1KB9K 3DVIA 1ZANL 3REVB 3WYRA 2C7UA 4X9FA 5MHSD 4GAGH 3RTQA 1VGKB 2VE6A 4BH7A 3T77B 3PHQB 2VABB 1YEHH 3HPLA 2E7BA 1DDHB 4HIJA 1U8KA 4OZIF 2ZSVA 2I07A 4YHOH 3UDWA 2APVA 1BVLA 4PRPB 2WWMD 4L4VA 2MJWA 4S1RL 4XNXL 5H94A 3LQAL 1KELL 2O93L 3W2DH 4IOFD 1BAFL 1KN4L 1T0MB 1OP5K 4FABL 5C0FA 2OTWB 3ZDYF 5HDBE 1CLYH 4CMMA 4B7LA 2DLEA 2AJYL 3DVFA 4HKJA 4EZMA 3CZJA 4IJ3B 4OZHB 3OKDA 4JFDB 5EOCL 1SM3H 4M7JL 4GMTL 4OGXL 4MXVE 4AEHL 5IEKB 1NUNB 1NCTA 4J3UA 2H2SD 3GMMB 1Q9WA 2IFFL 4X80H 5DD5L 5D96B 5K59F 4QRPD 1AHWA 5DRWB 1TCRA 4OKVA 3VMOA 1JPST 1RZ7L 3MBXL 5BV7B 2BSED 4WCYL 4IRSB 2BVOA 3DI2B 3LV3A 2GEEA 4MJIE 2PTTB 3M8OL 3G6JB 1QFUL 2QADC 3AROA 1XZ0B 4EUPB 3RWJB 3GBNL 3TIEB 3TV3H 3HAEH 4ODVL 1WGOA 2HJFB 1NKOA 4PP2A 4PJ8A 3IVKA 4FP8L 3WL9B 1XCQB 4HS3A 3QUZC 3NH7H 1B0GB 1I7UA 5CZVL 1KUMA 4L3EA 5K33A 3KPMB 4JN2A 4OGZA 4RA3A 2X4TB 2D31A 4GRWH 3AMLA 4M5ZL 1OSZA 1C08A 1FNEB 4WU7B 3T0AA 1HEZB 5HYEA 1YNTA 1HHIA 4WV1C 3IFOB 4YFDB 3G5ZA 1OQXA 4LLDB 5BCAA 1N59B 2JIXD 5D1ZC 2AQ3A 3C8KB 2PNDA 4Y7MA 1H3VA 3DMMC 4KRPD 1XGUA 3TZVC 1I7RA 1J88A 5I1CL 2V9RA 4ELKB 1EEYB 3RNQB 1JHLH 2DTML 4JKWA 4PJFB 5DVOA 4UOJA 4QRRB 2G75A 3MOAL 3WO4B 1G7MA 1RK0B 5E4EC 3WIHH 1MCFA 2Z4QA 5TDPA 3VWJB 1PZUB 3WFBL 3U4AA 2IPTH 2IH3A 3LKPA 5DMIL 5TDNB 5JHLL 1CL7H 2DM2A 5L0QC 4DGIL 5C07E 1JWSA 2MSPA 4JM2B 5C09D 1ZLWH 3QNZA 4YHKH 4P49A 4CU6A 3DXAA 1JZ5A 4FQJL 1A6PA 3OX8B 2J5LB 5F72S 1GZPB 1K4DB 2MNUA 5C86A 4F9LC 3U6RB 1XF3A 1XGTB 3R0MA 2PKDA 1WIOA 1JJUA 5IMKA 5IGXH 5DA4A 2Y72A 1AFVL 3DX9B 3AREC 4Y4KA 1J86A 3GNML 3KJ6L 1T0NB 3IU4L 3G5YB 4OT1L 1J8HD 1MIMH 2DDQL 1DQMH 5D1QD 5E2WH 1D5ZA 2W60B 3NN8A 4PRAA 2PUQT 4NQEE 5JW4N 5JW4M 4UU9A 4LCIL 5EUOA 5IB2A 5HJ3A 5FYLL 5CCKH 1Q9LB 1SJEA 2VITB 3WUZA 5T1KA 2D0GA 1JBJA 4NBXB 4FMKA 1YUHA 3DNKA 4XP6L 5KVMC 2ZUSA 4P2RE 1P9MA 4ZPVA 5LWYH 1YY8A 1DR9A 2X89A 2DJ4A 3WFDH 1YEFL 2DQTH 1RFDH 1G7LA 1NCWL 4KZDH 4HQQH 5B8CC 1GHFH 3GJFH 5E1AA 4NGHL 4ZSOE 3DARA 1VCAA 3MNVA 5HHQA 4I0PD 4UB0H 3LQZA 4GRLA 4J4PD 4I18C 4L3CB 3O6KH 4X99A 5IBLD 4LKXB 2BVPA 1CTOA 4HULB 2DS4A 5HD8C 4M8QA 4LGPB 5JQHC 3TPUA 3WNMA 4AG4L 4KDWA 5TJWK 4LEOB 4JHAL 1RUQL 3DX6B 2B0SL 1MRDH 3ARDA 5CP7B 4GAYB 1NGQH 5BZWB 2WP3O 2VXTH 3SDDD 4JKLA 5F9AC 4M61A 4P2OD 1IT9L 2VAAB 1QD0A 2I5YL 3NIFE 4XPTH 3UROR 1CI5A 3VXSD 4RMVA 2ESVB 2OZ4L 1GVIA 4NZTH 3EJJX 5GGRB 2DF3A 4PJAF 4OZGB 5DUML 5IG7A 1AD9A 1HKFA 1EJ6A 2ICWA 3O8XD 3EYSH 3KLAB 3HI6H 3RWIA 1QBML 1E6JH 4LHJB 3X14A 1A4KA 1MJUH 3MRHA 1CLZH 3OB0K 4JFPA 2N7BA 3N0PB 2DQIL 1KYOJ 5HHPB 5LXGH 3MYZA 4OZFA 3BZEA 2YD8A 2OYPA 1AXIB 2P8MB 4U1HB 3MQIA 2DM3A 2YA1A 3VXQA 1IGFH 4N1CA 4G7YH 5H8DA 5LGHH 3SKNB 4UIKH 1ZMYA 3NA9H 1WEJH 1NGYB 1OWWA 3SY0A 5D7LB 4ELMA 3FT3B 4FFVD 2PTVA 2ZP0T 1BOYA 5FUOH 3SDAD 4FTVE 4KI1A 4KJWC 5DGRA 4UINL 2FLBT 2V17L 4H8WC 1B4RA 1TVHA 1C8PA 3VA6A 1S9YA 4YNYA 4PD4K 3CK0H 3RP1A 5D8JH 3RGHA 1MH5A 2L7JA 3BP7A 4M6ML 5HHOE 1KIRB 3QDJB 4PGCB 3GB7B 3HFMH 5CBEA 5MENA 2BCKA 2NY3D 1FORH 5GGUA 3OWEA 2Z93B 4XBEL 1IQWH 4X9IA 3VGEA 4HS8H 1K9TA 4NYLA 4LVHC 5E6IC 3ARFB 3S4SA 4CJ0A 3WJJA 3HMWH 2D0HA 3MBEB 5E8OA 2NTFB 3ABZA 3OKMA 4Y89A 4PJEA 4PTUA 3WXWL 1G1YA 3WXVL 5EG6C 2LE9A 1QA9B 2FECI 5GQBA 3L3IB 3MGAA 5HI3D 3LDBC 2YN3A 2PYEB 3BKYL 3NPSC 4WUKH 2IG2H 5DJCB 2LTQC 2NY7H 3A6BL 2VDQL 3C2AL 3B5GA 2AGJL 3T8XB 4LCUA 1Q9OA 1FYTD 4LSTL 5CEXB 1KIPA 2CDFB 2JB5H 3D25B 3DYOA 5CINL 3VGBA 4J8RB 1K8DA 2Y5TA 3PWVA 5CIPB 4Z76B 3VG0H 5JXAL 1KJMB 4PJIA 3HMXH 1IAIH 1S8DB 1MHEA 1KIQB 3QFJA 3L3JA 1LGVA 1AKJA 3QO0B 1JPSH 2X4PA 3GSUA 1JGDA 5DYOB 4OGYH 2CXGA 1KCUH 2JCCA 5C0CA 3ULVD 3TM6A 3U0TB 1ZHLB 4PJCE 5L2KD 1INDH 3SKMA 2ADFL 4OF5A 2BDNL 4LKCA 2YRLA 3LVEA 4QHLA 3SGKC 4JPKH 2VISB 3O2VH 4ODUB 1H3TA 5KW9H 3TO4B 1OAUL 1ZLUK 2X1XR 3TBSB 5KS9F 1W0VB 3LH2H 1U8MA 3BUYA 1ZT7A 2Y5EA 4KU1A 5HDOA 2R2CA 1D5IL 5SWSB 4HIIA 5IBTH 3SQBA 3T0EC 1L6ZA 1GZQA 1ROWA 1J5OL 4KAQH 4M6NL 3ZT5A 4G6FB 1P4BL 3E6FA 1F90H 3AS3A 1MQ8A 1T1WB 3TO2B 1YQ2A 2HJLB 5C9JA 1S7XB 4LVNB 4Y5YB 4QRPE 5E5MB 1UM4H 3INUH 4HKBB 5FGCE 4JFEB 2E7LC 3IFLL 2A6DA 4ZS7L 5F9DC 3MLTB 1ZT4B 3MRQB 3UTTE 1LP9B 1JHTB 3P77A 4EI6B 3DROB 8FABB 2VLJB 3MOBL 4F9PC 4WV1A 5DEFA 4KHXH 3KJ4C 4AYFA 1BX2A 3TNNB 1OAXH 4FXGA 3RJDA 3MLUH 4EN3B 4F2MB 3MRLB 1YPZB 1LNUA 4Y8AA 4HXBH 4Z7UA 1J1OH 2FHFA 3TZVA 2W0LA 4N5ED 2VZUA 5F1NA 3O4OC 3Q2CA 4XMPH 4JREC 2XQYK 1DSFL 1KB5B 5ECJE 2N56A 3BMWA 3MRDB 3HLAB 4FQXD 2AXFB 1I3RB 1J1XH 5IF0A 2R8SH 1JPFA 3O2DH 4RGMB 4MXWH 1T3FA 1MFDH 3ALXA 1T21B 3SDXB 3GMOA 4Y16B 2VZVA 5ESVA 4NQTA 4JE4B 4RMTA 5EO0B 1TJGH 1FVDA 5ISZE 5C2UB 1HOCB 4NKIL 5ESQB 2EC9U 1B4JL 1IGJB 2FB4L 4RMSA 3AUVA 3OZ9H 1KJ2L 1RUKH 4XVJH 4ZMAT 3FFCE 3MLZH 4JO4L 4YC2B 3M1BA 5ADPL 4KV5F 4TUKH 1BGXL 1HWHB 2FX9L 3FHQA 1HHGB 4HUXB 3VFUA 4K7FB 1TFHA 4Z0XB 2AJUH 4U2YA 4LDEB 3CGTA 1C16B 3EYFB 3H42H 1MCLA 3MV9D 5F88A 5FYJL 3HI5H 1ZGLP 3FB6A 1DQLH 4PRBA 4X7TA 4XB7A 1KTRL 1B0RB 4M62L 1MCNA 3SGDI 2H8PA 1Z9LA 1ZS8A 4CVXB 4G42A 5SX5H 1XR9B 4KGJA 4PJDF 4FQHB 2PW2A 4ETQB 2JK5B 2ADJA 4GW1A 5EA0H 4HT1H 3PV6A 1VFMA 4IJ3C 1RZKC 1T1YA 2E6QA 5H2BA 3THMH 4JFXA 4LPUA 4M48H 3CLFL 2OXGA 4LCCA 1CICD 3UPCA 3OJDB 4KKNA 5D96C 2OI9B 4MNGE 2MHAA 1UJ3A 5K9KB 2D9CA 3LKSA 2F53A 3CVHH 4BKLA 4K23L 5BV7C 3ROOA 3WFHA 4IRSC 4RAUB 2P48B 2WZPD 4Z5RB 2H32B 2VQUA 1M7DA 2AJVL 1DQDL 2E27L 1FBIH 2X70B 1AQKL 2XZQL 3VFSA 3F6LA 4OB5H 2I60L 2A6JB 5JOPD 4NKMA 2OLDA 5A3IC 4V1DE 2XQBH 3GRWH 3ES6B 5EZLB 1CFSA 2JF1A 1KJVB 1SEQH 1WICA 1YJDH 2FJFA 4K7PY 5BS0B 5TF1L 2D3VA 3QEHA 4EDWH 4M5YL 4TSCL 2KDGA 5D1XB 2AQ1A 5C92A 4AENB 1F3DJ 1DFBL 4XP1H 1G7QB 4OCRH 4ZPTB 2XT1B 4G6KL 4XVUC 5FB8A 4Z8FL 3UC0H 4X6EA 5GRVK 1IZKA 1D6EB 4P4KD 1NFIB 2CLRA 1L9MA 4I77H 3ZTNL 3VFWA 3E3QE 4BZYA 3QB7C 5J06A 3P9WB 3TFKC 1FZMB 4EDXA 1BF8A 3QEQD 5E00B 4I5BB 1SJHB 2QTEA 3WO4C 3RX7A 3H9HA 4XAKE 4I3RH 4JEGB 2DQJL 2E7MA 3DRQB 3NABL 4WI9A 1A6AA 4R2GD 3VWJC 3MRFB 3FFDA 5I17A 1OOAA 2FBJH 3B9AA 3GHBL 1UACL 3BUTA 2B1AL 3G5VB 4G80A 5JOFA 4JM2C 4XHJD 4BSWA 1A7RH 4R8WH 1IAMA 1I9RH 1V3LA 3EFFB 3FOLA 2HVJB 2EKSB 1CGSH 3Q6GH 2J5LC 2X9XA 2R0KH 2XA3A 1EMTL 2AKRB 3V6ZB 2V7HA 5K9JH 2NW2B 1A9BB 1NH6A 2OJEA 3BI9X 3LKNB 3QCTL 4UT9L 1MPAH 4JFFA 1D9KB 1FNGA 2EDQA 5C08A 2FEEI 5FCSH 2X4OB 1BEYL 3CFBA 3T3PE 1M6OB 5BVPH 2VIRB 1KGCD 1I9JH 3CXHK 4XNZB 3WE6B 1EEZA 1KOAA 4GAGL 3GJEA 4QXTB 1M05B 1YEHL 3N1PC 5HYJB 3L3HB 1JCKA 3A67H 4JY5L 1R6VA 1UA6L 4YXLH 1KCSL 3EO9H 4P9MH 1JWMA 1U91B 3IU3A 4L8SA 1NBQA 4HZLB 4EBQH 3QA3A 3RA7L 1ADQA 3MUHL 4LLMA 4QXGH 2BP3A 2GY5A 1T5WB 2LFGA 1BM3H 3W2DL 1Z6JT 5EBLB 2FO1A 5DS8B 5DJAB 3MRJB 4MMXC 3SE3C 1QSFA 1CLYL 2YPLB 3NCJL 3O11A 4GUPB 4KQ4L 1TZIA 5BO1H 4KVNL 1CWVA 1WZ1H 1A7PH 3GSOB 1OP5H 2EDTA 1WWWX 3P4NB 1SM3L 2HFEB 2R1YA 3GSWA 4JANA 2ZCKL 3B83A 3BISA 5HGDA 1JRHI 3WV0A 1EK3A 2D4FA 5F9OH 1FYTE 2QHRL 2W0FB 5JW3L 2AI0L 5E2UH 2GITA 1DANT 1ZA3B 4K2UH 4HCRA 4NQDA 3DX8B 3QUZD 4TSAH 3QQNA 4KUCF 5F7WC 2CLZA 2EDOA 4JO2L 3U7WH 3GSNA 1QTYT 4X4ZA 1YMHA 4MWFA 2E7LA 4NCC2 5L2KE 4FZ8H 5LAXB 3U2SA 1J87A 1YYML 1KLGA 5BZDA 3JWOC 4GKZB 3I02B 4LMQE 5D1ZD 3U1SH 2NXZB 4X9HA 4IS6A 4WU5A 3JV4A 4X6BA 3W5MA 1CXIA 3MLXL 3DMMD 3EDJA 3NH7L 4UOW1 4MSWB 1GH7A 3WS3B 3TT3H 4ALAH 2QSVA 2P5WA 1IM9B 3IXTA 4X7DC 4Y4HA 3SOBH 4JVWA 3TYFA 2EEAA 4HKXA 2LABA 4XXDA 4Z0BL 5HY9B 4WTWA 3WDIA 5GJTH 4OBSA 4HPYL 4NN7B 2BRRH 2J8UE 3QPQC 4L3EE 4BH8B 3MA9H 4JAMB 3LKQA 3Q48A 1EHXA 4WTZG 4HUUB 2H26B 3UTQA 5IOPA 1YECL 32C2A 3CSYA 3BKML 3OKLA 3MODH 3ARZA 4D9LL 4QHUB 5F7LB 3HG1D 4K94C 3KXFA 5F9JA 4G9DB 3UBXI 4ONOA 5D7JA 4Y0GA 2G9HA 4XGZA 3WNPA 3QG7H 3UO1L 2EEBA 4FQCL 1S7QA 5DF0A 5C0AD 1CQYA 3WIHL 4A6YH 2WBJD 4IMKC 4MDJA 1EGJA 4GSDL 3ARED 4OQTH 4G9FD 1QFWL 4FQ1H 3MTRA 3H3BC 3QIBB 4Z7WB 2A6KA 5DJXB 2V7NB 4U1JB 3F5WA 2HA1A 4YHKL 3MLVH 4PJGE 2BC4B 43C9B 4R26H 3MLYL 4WIQA 1A1MB 5HGHA 3T77A 4P5MB 3MBEC 1EPFA 2F54B 4LPVA 4DN3H 3QG6B 1QVOA 5AZ2L 4N8CL 3MNWB 1WWBX 4LIQH 1ZHBA 3M07A 1CL7I 3MRMA 3RHWF 1T1XB 3LN4B 3LEYH 5I8CB 4OAWB 1W8NA 5ERWB 1DQML 2P7TB 5E2WL 3WIFB 4DKFH 3UPRB 5EIIB 4G43B 5TDOB 3CCHA 1T22B 3F12B 4LIQE 4OZHA 5CJBA 5TF0A 1KNOA 2X4SB 5SWZA 5IVXE 3RBGA 1A3LL 3H2WA 3VRLF 2Z31C 3DHJA 3VXRB 1JTPA 1GGCL 4ODXB 4XP9L 4G8FA 4MNHA 2R2EA 3IXAB 2DQTL 5EUOE 3T0VA 1RFDL 3CUPB 2R29H 4NWTL 5AYQA 4JFYA 5ALBL 4GKSB 5L7XH 3TO4C 2K7PA 3B4NA 4E41B 1PKQE 4MCYA 1FNSL 3KDMB 3FZUC 3TIEA 4UB0L 2HJFA 2EIZB 4D9QE 4HLZH 1V7MH 3O6KL 3LKOB 4K9EH 5J12B 3WL9A 4LSDA 4KJYB 1EA9C 1MLBB 2DICA 3IJSB 2H6PB 3BH9B 4U33A 5HYQB 3KYNB 4J7RA 1WWCA 4MAUH 1NGQL 4QRQB 4NM4H 1KTDA 4OI7A 3FQUA 4LVNC 4Y5YC 4KPHH 4QRUB 1EHAA 2NY6B 2QR0B 3FQNB 4OF7A 4ZAKA 5C3LD 1BOGB 4PTTA 2YD5A 4XPTL 3QNXB 1U3HB 2BHZA 2NR6C 3VXTA 3VFPB 4QXUH 1ZGLA 4DCQA 4YDVB 5F7NC 4HGWA 3U0PA 4EN3C 1EFXD 2VJXA 4N0UA 3S37L 1KEML 5DZNA 4YGAB 4PV8A 1GCFA 2Y1VA 3EYSL 5EH1A 1IEAB 4JFZH 3FO0H 5GGTA 3RNQA 1Z9SA 3H7BB 3W5NA 4F58H 3VFOB 3IT8D 1IL1A 2A9NH 2UWEF 3G04B 4LOUC 4FXKA 2OTUA 4JZOA 2Z91A 4KJWD 1P7KA 2MOVA 5DURB 4OZFH 4K3DL 2YD3A 2CRMA 1RK1A 3KPPA 4RGMC 3ZE0E 5GRXG 1H15A 2BXYA 3OB0H 4MA3B 3W9DA 5IJKA 4MD4B 5FO7B 5ENWB 3G6AB 4Y16C 4JM2A 1QO3B 3BIKB 4PGDB 3UZEA 2DMBA 4GG8A 2WMPA 5IMLA 4LHUA 5JXEC 1IGTB 3GMPB 5E6ID 3OX8A 5F97E 3B43A 1W0WA 4YO0A 2P43B 3AY4A 3N1QC 4EQ3A 5B38G 2AW2A 4YC2C 2EYRB 3MRRB 4X9GA 5L2JA 3QRGH 1K3ZA 4M1GL 2DQHH 3VRJA 3CK0L 3QEQE 1N6VA 4MLSA 4X5LA 1FL3A 4C55A 3HFML 3MCKA 4U0RC 4ZFGH 4LASL 2ADGB 2EH7H 4HH9A 4JKPH 2OCFD 1KFAH 1FORL 1GGYA 4EEEA 1DLFL 1FZOB 3QPXH 4I1NB 1S5IH 1S7RB 2XYCA 4LLQB 3IDJA 4C56D 2W91A 1I7ZB 4OFIA 2P45B 5DT1H 5MEOB 2OL3L 1AC0A 2ENSA 4MB4A 3DLQR 3PQYB 2NY7L 1VADB 5TE4H 4M9PA 4EOWL 3FRUA 2KBGA 3SE3A 7FABH 1AY1L 2A6IA 3NZHH 3QZWB 1J11A 3VG0L 3HMXL 3OAZK 5I1LB 4N5UA 5KSBB 4XBPA 3V8CA 4DN4H 4CW1A 1V7NH 5FF6B 5KZCD 1KGCE 3OQ3B 3OKNB 5JQ6H 3EYOB 2C3XA 2BNRA 1QSEA 3RWHB 5HPOA 3T0ED 2A9MH 1U6AH 3WNNA 3BOVA 3NFNB 3QFJE 3UMTA 4OCXL 1IAII 4JPKL 2AERT 3DX6A 1CDJA 4JZNA 2JCCE 1E4WH 4DUXA 2UZIH 1D5XB 4RMWA 2F5BH 3D9AH 4TQEH 6FABH 2C1PB 2EC8A 1ZLUH 2ZOKA 4R90H 2ESVA 1ORQA 3IDXL 5IHZB 4PJ5B 5ILTH 1F45A 4P5TB 1FV1A 5E9DD 3TF7C 1MCWW 1A6TB 3HC3L 1F90L 4PJEF 2EYTB 1RJLA 3QO1A 1F4WL 5D1XC 5B3NA 3VGFA 2DBLL 2P8PB 3JTSB 3D85B 1Q0XH 2ORBH 1UM4L 3INUL 1WVZA 4O2CA 1B9ZA 1PZ5B 1IAKA 4HK3N 2CRZA 1FGVH 1YN6A 3NCBB 3KPRA 4RWYH 2P1YA 1N4XL 3SDAA 4D2NA 1FCCA 3HUJE 4R3SA 2O61A 3GI8H 2VN4A 4AH2B 4Z77A 5IWLC 4QEGA 3ULSA 5K9QG 5FUCC 1OGTB 2NX5D 4WRLA 5JDSA 4MXQC 5DJ2A 1RD6A 4HWZB 2D4DA 4L8CB 3VCLA 1KJ3L 1ZAGA 2C4FU 2ZPKH 1NFDB 3FTGB 3QHFL 5F89B 2VYRE 3QCVL 4NKDA 2CDEB 5E08H 1A6WH 4LP4A 4NQVA 1P5UA 1Y0LB 4IEFB 2X42A 3QDJA 5B21A 5I74B 2DQEL 1C5DB 4PY8I 1WBXB 3BP5A 1TJGL 3VDAA 4W4NA 4OJFH 1OP9A 1IM3B 1TETL 4ZS6D 4DJMA 4AIZB 4APQA 4XH2A 2E9WA 4NDMB 3H9YA 1F4YL 4PRPD 2HVKB 4DQOL 2PO6D 1Z2KA 3WJLC 3BN9C 2AJZA 2HMIC 1QBLL 1EEQA 3P0GB 3GM0A 1D9KC 4YE4L 2G2RA 5FHBH 4L9LA 1CDHA 3CLEL 3QWRD 1C7TA 3QUMA 3VD7A 3LIZL 4XNZC 5SX4H 3WKML 3ILQC 1X5JA 3BPCB 2CDFA 4YXHL 5HBBA 4JFDD 3ZE2F 1FRGH 1NJ9B 5F7FA 2ERJB 1NAMA 4I8DA 4G9FE 4Q9RH 4PJHA 1AO7A 4U1LA 4Y2DB 5IEHA 4TVPD 3RWDA 1NAKH 1U92B 4Z7UF 4CU7A 3PE9A 3SEPA 3LQAC 4KY1L 4HFWB 2Z31A 2VC2L 2CIKB 5DRZB 3LRGA 4RZCB 3DGCR 2VXUH 1PJ9A 4IRSD 3V7AE 1EO8H 3JV0A 4H0IA 3EJYC 1UH4A 2EDFA 4MD0B 5HDBF 2CKNA 4PG2A 1XCTA 3O6FA 3TO4A 4ODWB 4NUGH 4IRJB 4MXVF 5A3ID 2XTJB 4XVTH 3K80A 3OR7B 4XZUB 3TH3T 5I9QB 5SWSA 4NC1C 1FP5A 1T1ZB 2VUOA 5JW5A 5BVJB 3C5SB 3V5DB 15C8H 2D7TL 5MERA 3MV8B 1A7OH 4PR5B 2A0LC 1FBIL 5TQ0L 4YHZH 4YPGB 4KHTH 3QQ4B 4QHKI 2GTWA 1PLGL 5E8PB 4XVUD 4RX4A 4JPVH 5ADOH 2DQUL 2QBWA 3K3QA 5JORA 3G5XA 3IGAB 2Y06H 2XQBL 5IFHH 2VLJA 1TZGH 2Z9TA 2CJUH 2NXZC 3DSFL 1P7QA 3TVMC 5EOQL 4KK5D 2YZ1A 2NPLX 4EN3A 4W81A 3TFKD 2YBRA 4WJ5B 3K2UL 4ISVB 4X98A 2D7PA 5DTFB 2BJMH 3F62A 4QRRD 4U6XB 2MFNA 1LD9B 4I48B 3D2UA 2YXMA 1G6RL 5I19L 1LDPL 5I66A 3FO9B 3MRDA 2A74B 2IC2A 3HLAA 3I50H 5TGBA 5JW4R 4NN7C 3VWJD 1WFTA 1IE5A 2ZUTA 5HI5C 3MPCA 3V4VL 3NCFB 5ICXA 1NMAH 4WI4A 3OR6A 4YHYB 5DHYA 4FQLH 1SYVB 3O3UN 4WW2F 5F6IB 4GW5A 2BNQA 2YN5A 1LK3L 3BDYH 2ZWLT 3H0TA 4BFIA 4NOBA 4XRCA 4P59L 3UXFA 1UKTA 1EEUA 4I3RL 4YDIH 3MV7A 1X5IA 4H26B 2YS4A 3U9PH 2YRZA 4QCIB 5F93C 2XZAH 4FQQB 2C4XA 5JHDB 3O41A 3QIBC 5ALCL 1HHGA 5DZOA 5DVMA 4YQXL 2ZSWB 5E2VH 4ONGL 3DHMA 3WKNA 1FG2A 3Q6GL 3EYFA 2R0KL 4KMTL 5EBMA 3KHOA 1JGEB 5SWQA 1T2JA 3VFVB 1LEKA 3GK8H 4NQCB 5D2LE 2FGZA 3CVIH 2MKWA 4G8EA 2QQKH 2CUIA 1JFQH 1XR9A 5BVPL 3TIDB 3ZTJH 1U8QB 1JVKA 3GIZH 3ARRA 1BFVL 4BA8A 1NGPH 3RPIA 1ZVYA 3FQTB 1QYGH 3HZMB 2MPAH 4U1KA 4XNQA 4HIXH 4P9ML 3QUKB 4OD1L 4XCFH 5EU6B 4LSVH 1NCCL 4KKLD 1WCBA 4TNWF 2CLVB 2Z0BA 1FFQA 5K9KA 2NY5C 4K71B 1UM6H 4Z5RA 4R4FL 1PG7X 2P46B 1U8LB 4YR6B 3GMLA 1WZ1L 1A7PL 4X6CA 5CEZH 5EPMA 4MJIB 4YWGL 2F5AL 4X5XB 4RMRA 2W59A 2P49B 4KTDL 5HGBB 1ZLVK 2F8XC 2BVQA 2FWOA 5CKGA 5F9OL 5J12C 1EHLH 5DD0H 4HCRH 3KPSB 4ZYKA 1XGQB 4OKDA 3AMKA 4TSAL 2CUHA 3HNTL 5D1XA 3NAAL 1UXWB 3OGCB 3GSNH 2HKFL 2WIIB 3HAEB 3LKRB 4ODHL 4FZ8L 4NQDE 4JR9L 1U3HC 2BMKB 3IDIA 3T0EE 1NC2B 4G7VH 5EC1A 1UWEL 3HC4H 2VQTA 5HHME 1T04A 3QXDA 5DSCB 3QRFM 4C59B 1HDMA 4NRXB 4LMQI 3HZKB 3D3VB 1DE4A 2HT3C 5F71A 5JO5A 5IWLA 3VMNA 2ZUQB 3A6CL 3ZKMC 4LCWA 5GJSH 4GRWB 2PYFB 4OTXL 2EYSB 1CBVL 1QLFB 5D7LD 1MWAA 3UBXB 4RAHA 4LBEA 2O5ZL 4F37K 4U05A 1GJIA 1AXSA 2XA8H 1A4JB 1R3KB 4U1MB 3DJ9A 3MOQA 3MRFA 1H0DB 4JPIB 1MHCA 4WUUD 3RVVC 5IMMA 2P5WE 3MLRL 4MNQB 4MJ6B 3QULB 4DVBB 2JELH 1NBYA 1V3MA 1T7XA 3DGGB 3KPTA 3EFFA 4G6ML 5C07B 4MA7L 5GS3A 4QF1A 5BOPA 3H3KA 4HLJA 1T89C 3ARFD 3RY4A 1G9MC 2VR5A 1EAJA 3MBED 3L7FA 2R2BA 3NCMA 2OJZL 2VTFA 4XBGB 5ACMA 1NCAH 4ZO7A 4A6YL 2P47B 1EGJH 3HE6A 2WUBH 1A3RH 2NX5E 5ACZA 4BYHA 1BZ9B 4OQTL 3QXUA 1N7MH 2EE3A 2PYED 3PWNA 4OD3H 5CJQH 5GSVB 4E42A 1WV7T 4LLYB 5DI8B 5EZIL 4OLZL 4R4BB 4ORZC 1U8HB 5FYKU 2I9TB 2C9AA 4R97B 4XC1H 1CFQA 1ZSDB 2OP4L 1C5CL 4NQEB 5ICZB 3KYKH 1MFBH 3C5JA 4JDVA 1BIIA 1NLBL 4NFBA 4JRXA 3D39A 3N1FC 4ZFFB 2BY3A 3H3PH 2ITCB 1T2QL 5KVDL 4K3EH 2FR4A 4DKFL 2DQCL 2X1OA 4GUPA 4JJHA 4JO3H 4PJAB 4PRPE 5C9KA 5E4IA 3S9DB 3OXRA 3RGVB 1FN4B 1F4XL 5J6HB 3BPOB 3DECA 3VXUA 4YBHA 3FZUD 5F3BA 1JYNA 3IKKA 3Q5OA 4L5FL 3VFTB 3ULUC 2C3HA 5IJVB 3AS0A 5D6DA 1LO0H 2FJGA 5FECB 2W0FA 1MUJA 5DK2A 4EXKA 4OZHE 1FZKB 4JFDE 2UVFA 4PJCF 4BZ2H 4GG6B 3BYTA 4K3GA 2ZUXA 2ZCHH 3W39A 5SWZE 3C9NA 3VWKA 3GJFB 3RWFA 5GGVH 3KAAA 2ZUWA 3MLWH 3V5KB 2ENYA 2X5PA 1E4JA 2FYYA 4X4YA 4JFED 4RFEB 4CVZB 1XGPA 3S7GA 2X4QB 3O9WC 4F80A 1V7ML 3FMGL 2NR6D 1HYRC 1AD0A 1X5XA 3G6JE 3U0WL 4OV5B 4Z95H 4MJ5A 2AABH 1CIUA 1A9EA 2FJHB 3TVMA 1K8IB 3PL6B 4P4RA 3LMJL 4FG6C 4KPHL 2C3VB 4NFDA 3OF6A 4QHMB 3CSPA 1BQLL 4LOUD 2LV4A 2IALA 3PWUB 1OT1A 3LS5H 2VLKB 4R7NB 1ACZA 1Q9KA 4LAQL 3ARGD 4U1SA 1P2CA 1E27B 4E0RB 3IS1X 3ARBB 4NO5B 4Y16D 3AFLA 1WBYB 1ETZA 3FO0L 5JXED 2XWJB 2A9NL 3TT1H 2A83B 1FO0L 4JPWL 4UDUB 4QNPE 5JLZA 4MDIA 3MX0A 2EKJA 2AK4A 3K2MC 1GGBH 3IETA 1RIHL 4P2CG 2ICWI 5T1LB 1TZHB 3RVTD 4RISL 1WAAA 1MCBA 5I74C 2IJ0C 4M8VA 3ARQA 5GIRB 3VXMD 4QRRE 4LLWA 2VR9A 3F65A 3MGTA 3EW3B 5JR1H 2BC4A 2B4CH 1RZ8A 1S3KH 3HI1B 3P4MA 2NY0D 2VWEC 1ORSB 4Y1AA 5F8RC 5HHXH 3IFPA 3QG6A 3DI3B 4YHNA 4QWWD 5F96H 1WC7B 3STZA 1T1XA 4KI5D 3VXPB 1T03L 2YSSB 1LE9B 3LPWA 3KLSA 3TBVB 4Z7OF 2DWDA 2OM5A 3K1DA 3RNKA 2EH7L 12E8L 2ARWA 2KUTA 3F58L 1INEH 5C0IB 2ZG2A 1AGDA 1K4CB 1RUAH 3QPXL 5EIIA 3OG6B 1S5IL 2ERJC 4N9GB 1CG9B 4NO0D 1EAPA 3B8YA 1RURH 4Y2DC 4X8JB 5DT1L 1VGEH 1GL4B 4ZFZB 4U0QB 1A6ZB 2BHYA 2IAMA 2DIBA 3QQ9C 5E8NA 1HZHH 5TE4L 1XH3A 1MI5A 2DMCA 3C08L 4G8GB 4HJ0C 3SHSA 3DUSB 1ZHNA 4KQ3L 4ETYA 3NZHL 5KJRL 3QJHA 4MA8H 4YUEL 2YPKA 1CDGA 4AM0A 1JHKH 4HDIB 2YK1H 1RZJL 2XTJC 4HD9A 3T0XA 4DN4L 25C8H 2EIZA 1CLOH 3CAFA 4NSKB 5I9QC 3P0YH 3U7AA 3BJ91 1XIWA 4M7KL 3UTPD 1QLEH 5JIIA 1MLBA 2BSSB 3L7EA 3KYNA 5ICYB 3HRPA 4U3HA 5E8EB 2JJTC 4HC1L 3EOYG 2UZIL 4OD2B 5TE6H 1CE6A 2W9DL 3HNVL 2XNAB 1NUDA 2H45A 4I4WA 4R90L 5FGCB 1NGWA 4PYHA 1JPGA 1EXUB 2OZ4A 2HRPL 2D7NA 3UTTB 4YDVA 3L6FA 4ZTOH 1BD2A 1S7VA 1IGIL 3GM8A 3MRGB 4X6FA 1YMMB 4MXQD 4ZUSB 5GRJL 5T5NG 1G7IB 2FEEL 4LVOB 1C12A 2ESVE 1T6WA 3VFOA 1E4XI 4C4KT 3EOBB 3OTTA 2QJDA 4ERSH 3V52H 5J1TC 1KTKE 5E70A 3I3DA 5I8KH 4OZGE 1W8OA 3S5LB 2OTPA 4K8RD 5L88L 1CGYA 2QSCH 4UQ2A 2GI7A 3WFEH 3K8KA 3JV6B 2FL5B 3O6MH 1A1OB 2AP2A 1I85C 3U79A 3BZFA 2HT4C 5H37H 4C83B 4YHYC 4HZAA 5FO7A 5ENWA 3ZL4L 5C71A 1BBDL 1P5VA 5F6IC 4M4PA 4HHAA 4JCLA 4PGDA 1MEXL 5CWSA 2VN7A 3GSXB 1T89A 1K5NB 1OAZL 5ISZB 3L3KA 4BK4A 4L29A 4HX1A 3GMQA 2RCSH 3EO1B 4N0RA 5FA4B 1H3UA 3D18B 5E7BA 2FLRT 3BN9D 4C56A 3V8OA 3QCUH 1A6WL 3CMOL 1UENA 1D9KD 1FDLH 2J2ZA 5T3XD 2BSRB 1UB5A 3FFCB 5DUBA 5D7LE 3TWCH 4JRYA 2VDMH 1HILA 2KKQA 1V5JA 5GGSA 3GKWH 3ILQD 1I3GL 2NZ9C 3U48A 4D8PB 5HYJD 2AJXH 4NNPL 1A6VL 5J57B 1R5WB 1L7IH 1NUFA 2JJSC 4W70A 3T0WA 3F7VB 1VFAB 3QDJE 4R6UA 1PX4A 3OKEB 5F9WC 3WD5H 5A16B 1Q72L 2O5YL 3MA7A 5FHBL 1HH9B 3VFGL 3QUMH 2I25N 1DBML 5CP3A 1VADA 3STLB 3EJYD 3BHBA 3FONA 3KPNA 1NLDH 5CD3B 4QYOA 2AJSH 3RUGB 3RWEA 3TYGL 4XPBL 5JUEL 1NAMH 2VH5L 2V5TA 3I75B 3T2QA 4PUBL 5T3ZD 3EOTH 1N0XL 2PYEE 2UUDK 3IDYB 1WIUA 1LDSA 3RWCA 3BP6B 4JFOB 1CZ8H 3QUYB 2DD8L 5SX4I 4K71C 1MF2L 4KRMB 4RRPG 2ATPB 4F33B 3GHEL 5IV2A 1BP3B 3PWPD 4MNGB 3TJEH 4CBPA 1SYSB 2CKBH 4JQXA 1F97A 4TUOA 5A1AA 2IQ9L 1DBAH 4Q9BA 2EH8H 5FM5O 1BZQK 2Y36H 5DRNA 5HYIA 4XNMA 5I1AB 3O9WA 5IB3A 5J8OA 1G7PB 4K7PL 2B20A 3L5XH 3OXSA 1IGMH 3CVHB 2NXZD 4IIQA 3QI9B 1MJJB 4V1DB 5GRUL 2VDOL 3SBWA 1EZVX 5I6XB 3ZKXB 1I1FB 4H25A 5EIQA 3ZKQD 2EYTA 5JPNB 1P4LB 4Z6AT 2R0ZH 5L9DL 1Z5LB 3EIFA 3L1OH 1KENH 3MYJB 5SWSE 1NGXB 2RBLA 4MZ2A 3ULVF 1MCJA 2Y06L 1AI1L 4KWUA 2YC1B 3LEVH 1BHGA 2KPNA 3B6SA 3LRSB 1H3WM 2WAHA 3EDKA 5IR1A 4RGOH 2ZUQC 4DEPB 3C60B 4JFEE 4PRHA 3BEVA 5DGQA 1ACYH 3ESVF 3L3OB 3NZ8B 2FHBA 4YGVB 2VLJE 1Q8MA 1BWMA 3C2SA 1RQ5A 2NNAA 4S1QH 4XCCH 3C09B 3MFFB 1KCRH 1MCOL 4K3JL 4WI3A 1NFDA 3FTGA 3VH8B 1YPZE 5F89A 2CIIB 1FZJB 3BQUB 2AXGB 1RMFL 3QIUB 3T4YB 4ZNEA 5AAMA 2J8UF 4UAOB 1U8NB 4GRMA 1KTLB 3OB8A 3QIBD 4R0LB 3F7YA 1HHHA 4FQLL 4NC0B 3MXWH 5F7DB 5C0BA 3N1GC 3R06A 3BDYL 1L0XA 5JZ7C 5FOJA 4OFYA 1KJ2A 1FL6B 3RAJL 2NXYB 4AIZA 4UNVA 3LEXB 2BSTB 3GBML 3QEGH 3SDXE 5KVGH 5I75B 5F1KC 3P73B 1DLHB 5CS7A 2NW3B 2XWBB 4WHYH 5E2VL 1HSAB 5KG9B 1RZGB 3BPCA 4ZQKB 3TC9A 3MRKB 4R97C 4OF8A 3D6GA 4LLUA 4G3YH 3QUXB 1MQKH 4OLUL 5FUZH 1T20A 3WS6A 4LGSB 2BVYA 1ZVSA 2DWEA 4B7IA 4KTEH 2K9UA 1NQBA 1SY6L 3ALPA 5K9OA 1KC5H 5CILH 4JDTL 3VXRD 2ICEA 4WDIB 1UWGH 4NKQB 3EYVA 1JFQL 5DRZA 4AMKH 5F70A 4RZCA 3R1GL 4ZD3L 2DLIA 1UCBL 2OSLA 4Q6IA 2GK0B 4NP4L 5A2LH 3GI9H 4BH7B 2GSIA 4JM4L 3RGVC 4E41D 2W38A 2AVGA 1U8KB 3BPOC 4HIJB 1PQZA 2ZSVB 1CFNA 3BVNB 3VD5A 2I07B 1PY9A 1BVLB 3IF1B 4L4VB 4NRYA 4HKZA 3SCMA 5H94B 3T0BA 1NEZG 2VLME 2P8LA 3P40A 4WTXA 5DD1L 2ZCLL 3QQ3A 5GHWL 2JLLA 2W1NA 4OQ1A 4MA1B 4UUJB 3JBG7 4MMZC 4CMMB 5GS2H 3DRTA 1UM6L 4HKJB 5EOTA 3MV8A 5ITBH 4HAFA 2VDLH 4YPGA 1RZFH 1F00I 2NY6D 3BH8A 2B8OT 1Q9WB 1OGAB 3FQRA 1EO5A 2WWKT 1U3HD 4PP1D 5E94A 4GMSL 4KDVA 1TCRB 4OKVB 4X6DF 4YXKH 5J89A 2BVOB 3LV3B 1FNHA 1Y6NR 1ZLVH 1DN2A 3ZKMD 1NUGA 3PL6C 2A73A 4CNIA 5CJ5A 1CD9B 5D7IF 5DTFA 4PY8J 4PJ8B 3IVKB 5D9SA 5BS0E 2CSPA 3B9EA 3P9MA 5I30L 5DURD 3BMVA 2H9GA 4E5XA 4HS3B 2DI7A 4OZIA 1I7UB 3RVVD 1I85A 2PETA 2AJ3A 4L3EB 4QO1A 3ARBC 4JN2B 1FH5L 2CK0H 3PWLA 4XVSL 1OSZB 3MRBA 3L9RB 1MWAH 1C08B 1RIUL 5DVLA 1JUFA 4DGYH 3V6FA 2DM7A 4NKOB 5IROC 1F2XK 4HUWA 1YNTB 1HHIB 3X17A 3G5ZB 3L95A 1IAOA 5FUCE 2VDNL 3AM8A 4UIMB 2ZUUA 4QCIA 1XGUB 3ZE0F 1I7RB 2D0FA 2JELL 1N3NA 4XPHL 1FE8L 1J12A 4O58H 2B5IB 1WFUA 2G75B 2H3NA 1TTUA 1G7MB 2Y4SA 5IK3A 3UJTH 2Z4QB 5TDPB 4A6YB 1HSBA 4J6RH 2J6EL 2IH3B 2F8OA 3LKPB 3ZT6A 2E8YA 3R0NA 5INDA 4URTB 3OBAA 3PQYD 5KVFH 4LFHG 3C6SA 4OD3L 1JWSB 4GXUN 3ROLA 3X3FL 5DK3A 4JZJA 4GXUM 3QNZB 1PG7H 2NY1D 3MJ6A 1S7WA 3DXAB 1JZ7A 1RJZA 1XF5A 3D0VB 1XF3B 4XC1L 1RY7B 4WWKA 5CZXD 5DA0B 5DJZA 4AL8L 5IMKB 3U4EA 2D7OA 5T3XE 5IBUG 1MREL 1ULVA 4QHKJ 1FAIL 3ULUD 4Y4KB 4S1RH 4L4TA 4XNXH 1MAKA 4GW4A 1KELH 5AD0A 4PJ7F 1HCFX 1DQTA 4YIQA 1I9IL 1OW0A 1Y18A 4FABH 1D5ZB 3NN8B 4PRAB 1NCBL 3MUY1 2AJYH 3PIQA 5I1JL 1CXHA 3CFCL 1U8LA 5EOCH 4UU9B 2WNGA 2XOTA 4M7JH 4GMTH 5IB2B 4OGXH 5HJ3B 4P3CL 1AGCB 4JRXE 3WHE0 1SJEB 5ID0A 3RY6A 5T1KB 4PJXF 1YUHB 2IFFH 3KYAA 5DD5H 1HI6A 3IS0X 4ZPVB 3D0LB 1UM5L 1YY8B 2YPLE 3CZFA 4NNXA 4U31A 1RZ7H 3MBXH 4PJ5D 4P5TD 3KPSA 1G7LB 5B22A 3SKUD 2OR8A 2EE2A 2G5BA 3M8OH 5T3ZE 1QFUH 5E1AB 3ARSA 4A2LA 4IDLA 5C1MB 5GGQL 4GBXA 5GGRY 5E8DH 3MNVB 5FEBA 4FG6D 3IFNL 3ZT7A 4XP5L 5HHQB 4ODVH 3LQZB 4M7LL 4GRLB 4NC1E 4PRIA 3UEZA 1P7HL 4X99B 5IFAL 4FP8H 4OCMC 2BVPB 4P2QA 1YDPA 4U4BA 4M8QB 4Z95L 1HXMA 3JXAA 3TPUB 5CZVH 2EIBA 3ARDB 1I1YA 1EBPA 1B6UA 1OPGL 4YAQA 3C6LA 4LVOC 4M5ZH 5HYSG 4Z7QF 3CXDL 1OAQL 4HUVA 3BJLA 4NZDA 4PGJA 4OM1L 4LNVA 3ILPA 1DBJL 2CR3A 5HGAB 4U1MA 4YEEA 1TQCB 4F8QA 1G0YR 3QAZB 5IG7B 3AS2A 1AD9B 1KPVA 2RR3A 3VFMA 3QULA 5I1CH 3N9GL 2DQDL 5IW1A 1RZIB 2F19L 4MQTB 2DTMH 3PGDA 3X14B 1A4KB 5IFJA 4XWOD 3MRHB 2ZG1A 3BE1H 4P46A 3CDYA 1I1AA 3WLBA 4JFPB 3MOAH 5KAQG 5EUKA 4OZFB 4Y88A 3IRPX 3WFBH 3BZEB 4Z7VF 5DMIH 4S2SA 5JHLH 5AYUL 4DGIH 4NO2A 1EVTC 3S37X 5GSVA 3WUWG 5C0EA 5DI8A 2AK4E