3OF6D

Human pre-t cell receptor crystal structure
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
104
structure length
100
Chain Sequence
b'GTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDSPIWFSAGNGSALDAFTYGPSPATDGTWTNLAHLSLPSEELASWEPLVCHTGPHSRSTQPMHLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T cell receptor beta chain
molecule tags Immune system
source organism Homo sapiens
publication title The structural basis for autonomous dimerization of the pre-T-cell antigen receptor
pubmed doi rcsb
total genus 13
structure length 100
sequence length 104
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2010-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3of6D00
4NNPL 2JB5L 2R2HB 1IARB 3HG1B 3B9AA 5DLML 3S4SA 3LPWA 2QEJA 1JPSH 5GRXG 2E6PA 3HZVB 4DKFL 3DX9B 1KPVB 3HE7B 3TO4D 3MRPA 3SQOL 3SGJC 3GMMA 3DBXB 3IFOA 3V6OA 4X4ZA 3RVTD 1OARL 1NGQH 5EU6A 2EXYD 3K4AA 1AO7E 1NBQA 3T65A 5HVFB 1FL3A 4ZUWA 2FATL 2AXGA 3ARGA 1EJOH 1FG9C 2BOCA 4I0KA 5DT1H 1OSPL 3BDYH 3MLUL 4P48A 2FZ3B 2EKSA 4XCFH 2VDOH 3FB5B 4R8WH 1FNEB 3RA7L 5DMGC 2VDML 4P46D 5GS0L 5FYKH 1KNOA 4O4YH 4ZSOB 4J4PA 4YGAB 3T8XB 2GQHA 3RVWC 1FC1A 5ENWB 4X0KA 3NCFB 4HUUB 2DMCA 1YEIL 1H8SA 4CN4A 1C5CH 2D3VA 1C08A 4XB7A 4P3WA 3MLVH 4OZHF 2X4RA 3SDAC 1A14H 4HUUA 2NY2B 2VLKD 5ILTH 5GJSH 4TRPH 1SJEB 1XT5A 1AO7B 4CVUA 3ROOA 1AKJB 5B38A 4X6CA 5DZNA 3MV8B 4JPKH 3SCMC 4MJ6B 3EYFB 5IB5A 4YFLF 1UADC 1FC2D 5EPMB 1U6AH 3QIBD 3UROR 2IQAB 4JZJB 4ZO6A 2KZ1B 2ADJA 5C0EA 3O6KH 2NTFB 4HXBL 3VRJB 3CU1A 4XP4H 2BVQA 1MFNA 2PCPB 1YY9C 4PBXA 1SVZA 1AHWB 4UAOC 5D1ZB 5SWQB 5HVHC 4IOIA 3FO1A 3E3QE 3GEWB 3O9WB 4ODUA 2FH8A 3PF2A 1FVEA 2AI0L 2DQDL 5C0CD 4FTVE 4HKXA 5EG6C 3NGBB 4RGOH 4ONGL 3SKNA 3DIFA 1N4XL 3GJEB 5DYOA 4NQCB 3S34H 1HKLL 3F7PC 4HAFA 1MCJA 4CMMA 5JO5A 3S5LA 5ICYB 3PP4H 2MMXA 3KXFA 3QPQC 4LLMB 2FEDC 4HHAB 5EN2B 2IAMC 5D5ME 4OZ4A 4V1DE 5I19L 2VDQL 3EOTL 2Z31D 3HNTL 3NGBC 1G7IA 5EA0H 3VFVA 2BY0A 3B9KA 3OXRB 1RU9H 3V0AC 3AMLA 5EO0B 3B8SA 3MRFA 4ZQKA 2P46B 2D9QB 3QUYD 3RIAF 4NKOB 3AY4C 3VXMA 3BPOB 3ULVD 4XPBH 4NC1C 4OJFH 4Q9BA 4GG6B 3L5IA 5FGBC 4ZQKB 5KW9L 1AY1H 3B9KD 1H3XA 5FECA 4J1UA 8CGTA 3BN9C 4DZBB 1NLDH 3FQRA 4LU5L 1FYTA 4FXKB 3TV3L 4TUKL 5GGTA 1JFQH 5C09E 2FBJL 3MJ9L 3EJZC 4NT6B 4XCYA 3T0EE 3TJHC 3SBWA 3X12A 2ZPKH 3LEXA 5FB8B 4WI8A 4C4KO 2FL5B 5E5RB 1JIBA 3TA3A 1A7NL 4I4WB 3RHWK 2IPTL 4K23H 4OCSL 3MNWA 1DTUA 2CSPA 3QDGD 4PUBL 1NUGA 1INEL 3IB4A 2Q20A 2QQQA 3JV6A 5HHPB 1PKQA 2GAZA 1BEYL 3IDNB 4LLVB 3AMKA 1OB1A 3UP1A 1YJDC 2DJUA 5HHOE 2ZCHL 3V7MA 4WI4A 4XVUC 3RVUC 2PO6B 3IFPA 1I9IL 2BSSA 3CJJA 1OW0A 4JB9L 4E41E 4U1MB 1EGJH 2X42A 3ARWA 4WFFE 3CCHB 3S37L 2K7PA 2Q8BH 2NX5E 3KPQA 4Y5VC 1OCWH 4WV1A 3A67L 5IOPA 3D69A 1F02I 3DV4A 2IBZX 5F88B 5IG7B 3HR6A 5FHBH 4LVEA 1IGCH 1RZFH 4NKIH 4RMUA 1IQWH 3JTSB 4QLRA 3VFPA 5ICZB 1PZUB 1PLGL 3L5WA 4BQ9A 1U3JA 2VDLL 3SBWC 3S8WA 3RAJL 3GM0A 2X9XA 1RZIB 3BZFA 3L7FB 5E2WH 2HRLA 3V7AG 3FHAA 5IEKB 1U42A 1JV5B 3MXVL 4WWKB 5DD6B 1V5JA 3O8XA 4LHQB 3RNQB 5KVFL 3IS1X 4IJ3B 2BK8A 1CLOH 2FX8L 1XH3A 4DN3H 4HF5H 4NN5B 2CDFB 5DD6A 3LZFH 3CLFH 3QT2A 5DUML 2GFBB 1PAMA 1INDL 1A5FL 1ACYL 3FB8A 1KN4L 4D94A 1RUAL 2B4CH 4G8FA 3QDJD 3EJYC 1IEAA 4GJTB 5E6IC 1I3RB 4XMKL 3VGEA 1Z9SA 2HJKA 5HYSG 2VZTA 2W0KA 3VXRE 4X0KB 2R2CA 2DL2A 3QULA 4YXHL 4HWNA 5CD5D 2MCPH 1FG2B 1K5NA 2XTJE 4ISVA 2MTPA 1F42A 1QBBA 5BZWA 4MJIA 2BRRH 2YS4A 1JZ2A 1PVHA 1KN2H 2BMKA 3VG9C 1O7VA 3DXAE 4E5XB 4U3HA 1JPST 1WVZA 1CS6A 5JW4M 4ZS6D 5IM7B 1I3GH 2ZUXA 5DEGB 5FXCH 4IRSB 2A9MH 1HHJB 5HYSA 1T0NA 2Z91A 5GSRA 3LAFA 2FDBP 1Q38A 5JPMA 4E5XA 4EJ1C 2B5IB 5DFTA 4I9WD 1AIFB 3OJDB 4U1GC 1EFXA 4ORZC 2FX7L 1L9NA 5HHMB 5C07D 3CVHA 4CL7A 3IJHB 1Y6NR 3CFDB 5BZDA 3VWJB 4AEHH 4NZRH 4X6CE 1KTDA 5D7JA 1MAMH 4HH8A 3VXPA 4S1RH 3K46A 5JR1H 4H5SB 4NJ9L 3CFDA 4O51B 4OAWB 4PJ7F 3SO3C 1A6PA 3GSQB 4HCRL 2DBLH 5TGBB 4PRNA 2FECL 5GHWL 3QIBC 5ITFA 4XRCB 4OGXH 5HHXH 5FYJL 1S7QB 1U8LB 5DYOB 5MENE 2J88L 4TVPD 2XTJB 4KQ3L 1RJZB 1DUZA 2GSIB 4JO1H 5E8DH 2VWEC 1F4YH 4ZDHA 5AD0A 5HYJE 2J8UB 3P2TA 1OW0C 4UOW1 2DYPB 2WIIB 5GQBA 2PTTB 5D2NC 2PYEA 5CJXA 3QG6B 4X5XB 3WO4B 1RMFL 4KKAD 4JQXC 3H3BC 1ZE3C 3A6BL 1JCKA 5FDYA 4P2RA 4BSVB 3C8DA 4CVWA 1B0RA 5FV1L 3UTPE 3HAEA 1S9WA 3QDGE 4YIQB 4MLSA 1UJ3B 1CYGA 2XN9B 3TN0A 3KLAA 4JKKA 1P7KB 1QFHA 1FAKT 3OGOE 1MCPL 2NXYC 5BS0E 5T3ZH 3W11C 3GHEH 1EUTA 3VA2C 4RA0C 5EULV 5FYLD 4YIQA 3DO7A 4U6YA 3HLAA 2QHLA 3IVKB 5CD3A 4ODHH 4C56E 2XN9A 1JPFB 3EJZD 4WW1A 4XCYB 1H3GA 1DZBA 2PXYB 1D9KB 1EEYB 3D1MC 3P40A 1MY7A 2EE3A 2AJZB 3QIBA 3UTPD 5GGTL 5DA0B 5J3HC 4CVZB 2EDWA 3MNWB 2H9GA 2VSCA 5K33A 1MHHA 2R2BA 2Q6WA 3U4BH 4GRLB 4PJBE 3WFCL 4PRID 4ZFFB 5KSVB 3EYUL 3GI8L 2OYPA 2D0FA 2H2SC 5DR5H 3VE0B 5KVDH 1R3JA 3MNZB 1KCLA 2PUQT 1MJUH 1IZKA 5AAWA 5CEZE 1IGYB 3TFKC 3N0PB 1F90H 2IG2L 4TOYL 2NW3A 1P2CA 1IQWL 3TFKD 2NLJA 4G8IB 1JGLH 3LDBC 3O6FA 3EJJX 2XFXA 1XF5A 2JCCB 5D1QA 4P3CH 3K74B 2DMBA 1N64H 3CSGA 1MCDA 2AQ3A 1PGRB 2AGJL 4L4VD 2R4SH 1F00I 3QISA 4JDVB 2N56A 3L5WB 3FZUC 5C0CB 1EA9C 3MRIB 2IADB 1H8OA 4KK5C 4ZODA 5GISL 2YKLL 1NBZA 1BLNA 2C26A 3VI3F 4DVBB 1J0HA 2X10A 3OXSB 2VR4A 2MJWA 1AQKH 5DVLA 1XCTB 5C0ND 3C5JB 3BO8B 2HKFL 4ETQA 5KS9F 1IGJB 4LNRB 2P47B 4HCRH 4PJIE 1XGPB 3TYGL 1UG9A 5JPNA 4KROB 4JRYB 5SWSB 5MEQB 1J87A 3JWOC 4LU5H 5B3NA 3I02A 2ATPB 4LLUB 4X6FA 3V6ZB 1LWRA 5I0ZA 5D7KD 3SDAD 2YPVL 4XNMB 5JW4R 1FL5A 4JN1L 4WI5A 4AM0A 4PJEB 3RKDC 2BRQA 1B0GB 1HZHL 1FG2A 2WBWB 5GRVK 1YPZA 3SDXF 4X80L 4ZG1A 2JTDA 3KYNB 1MIMH 2ICCA 3LN4A 5DDHA 5C0AA 4ZXBD 1R5WA 2I5YL 3MUGB 5KN5A 1R24A 3AXLB 1L6ZA 1I3GL 4PRIB 2D31A 5I19H 1L7TL 4M02A 1S9YA 5B22A 5BRZD 1R3IL 1KOAA 4GBXA 3JWDH 5J89A 3MUGA 3OKLB 4K2UH 3EO0B 1K85A 4M61B 3VFWB 5C8JB 1U58A 1TETL 2C9AA 3QH3A 1HK6A 3BT2H 5DUBA 3QUZA 4NQEA 4HK3N 3RX7A 1N5YH 4MD5B 4KY1H 4M1DH 5I6XC 2DF3A 3ZKND 4Z7UE 4N9GA 2HT2C 1QUNA 1UCBL 5KVGL 5CIPH 5K9KB 1T22A 2EDLA 3VWKD 2UZIL 4LCCC 5CKGA 1Q0XH 1S7XB 1OTSC 1RVFL 5J6HA 1GAFH 1FO0H 2IPUG 2JJTC 5FOJA 4IRJD 3UBXI 1I3VA 1YN6A 3TN0D 1RZJC 2K1MA 3LQMA 4FN0A 4J3WA 4YDJB 5F8QC 1OAXH 3MSPA 4LVOB 3MXVH 4NO2B 4PJIF 3TVMD 4Z0BH 3NFSH 5SWZE 3OF6A 4XBPA 3QNXA 5IF0B 2XTLA 1J8HA 3U36B 3EJYD 1LP9E 2NY2C 1UWGH 3ARTA 3TJEL 4HAGA 1OTTD 1EZVY 1R3LA 1BMGA 4WU5A 5D96B 4TNWF 5HHNA 3ARRA 4LSQH 4Y1AA 2DQUH 4FFWC 3CDYA 1HHGA 2Q8BL 2GSGB 5E08L 2P8MA 1B3JA 2X1OA 1KTLB 1GXEA 1AR2A 4D0CA 1A7OL 4OGYL 4Y4FB 1OSPH 2MQ3A 4BQ6A 3TWCL 4YK4B 4U2YA 3SE3A 4CU7A 3AVEA 3VXRA 3OHXB 4M8QA 4GRLA 3EYOB 1NCDL 3BHBA 4NDMA 4MZ2A 1FZJA 4M48L 4DAGH 4F15C 3CSBA 3Q3GB 4HS6B 2EE6A 3BGAA 5TJWK 1UA6L 4UT6L 4CUCA 1RIUH 5KTEH 1NGQL 2NY3B 43C9A 1Q9LB 2Z0BA 3C8KA 4OCNC 1TZHB 1G7PA 5FKAA 1IAKA 1GIGL 4LHUD 3V4VL 2SEBB 1MCLA 1OF2B 3D3VB 4OCXL 5DD1H 1WZKA 5JXEC 1H0DA 4Y5YA 3QIUD 4QT5A 1HEZB 4YHYC 1MFDL 3OKYA 1SBSL 3PHOA 4OLZH 3QEQE 3FZUD 1X5LA 3CXHJ 5HD8D 4PJ7E 3LRSB 5C08B 3G5XB 1NANH 3Q48A 3TBYA 1F6AA 3PIQA 2ZSVA 5D7IE 4K71B 2C3VA 3G6JE 4NWUL 4PGBA 1RQ5A 2F74A 3C6LB 3PHOB 4DGIH 1AGCA 2E8YA 4TQEL 2X41A 4OZFB 3BW9A 4JFQA 2IAMA 1DEEA 3OXSA 3BJ91 4GMSL 4X6DA 2DQHH 1P7QD 5CBAA 4RFEB 4M1CC 4C83B 3NIFF 3B9KC 1INQA 1CFTA 3TF7C 1XF2A 3ELAT 2N4IA 3BH8A 4KHTH 3DSFH 7FABH 1BZ9A 1PKOA 2UY7A 5ACMA 4M8VA 5CLTA 2OR8A 1DQML 3HPLA 2XTJC 4L5FL 1BGXL 4OLYH 2R9HD 3AS1A 3MRNA 1KCUH 3LIZH 1ZXQA 3W5MA 4HJ0D 3G6AA 4L4VB 4HXBH 3ARQA 3ZT5A 4BFIB 1RULH 4KY1L 1ZEAH 3ARDD 5C0AE 1SJVA 4RAVA 4DCQA 3IDMB 3DUHA 2XT1B 3PDGA 1H3WM 4D2NA 1AFVH 1DBKL 3SDAB 1PZ5B 2WBJB 4GSDL 1T83C 1QR4A 3PUCA 3PP3H 1I8IB 2F53B 1NMAH 1C5BH 5SWSD 4W4OA 5DZOA 5FGBA 1E4WH 4X4MA 3S96B 3VDBA 3GMNA 2BDNL 1IGTB 3E8UL 1FLRL 5ACZA 2CO6B 4QEGA 3RDTA 1IKFH 4L3EB 1EO8L 4FHBD 5B39B 1G1YA 1CGYA 1OTUC 3QUXC 4NZDA 4JO2L 3RWJB 4HC1H 1S7TA 1T1XA 4GLRI 2VDMH 4BJLA 1A1MB 3A6CL 3MLSH 2DD8H 1MOEA 4R8WL 2E9WA 4PJDE 3P73A 2Z8WC 1NMBL 2H1PL 4OF6A 3MLUH 3OGCB 2DQFB 4WI9A 4OD1L 4M7LH 2NY5L 2VLJD 1CICA 1NSNH 2FATH 4PG9A 2BNQB 3D18B 5EFIA 2C1PA 1P53A 4U6VH 3WDIA 5JW4N 2AJSH 4MA3B 4LPUA 1DANU 4M1CD 4M7JH 3CUPA 1URLA 3PQYB 1JPTH 4QTIH 4HLZG 3LSOB 4HXAL 1QLEL 1DE4B 4EOWL 5C0BA 4JM2A 4F3FA 1UC6A 3ARGD 5ESQA 4JM4L 4PD4K 2IALB 3RFZC 3O3BA 5IT2L 4KVCH 4CADA 3NBNA 5T1LD 3X11A 4DJMA 3GMRA 3QDJA 4OZIB 4GKZB 1KLFA 3TJHD 3MYJA 3F8UB 5F1IA 2JB5H 3QWRD 3T77A 2F54B 3LKRB 1HHGB 1EIBA 2A6DA 5L0QC 5IVZA 2IBGA 1BBDL 1FCGA 4PTTB 1FHGA 5CILL 1CICD 1SY6L 4MDJB 3HE6A 2CJUL 1DBAH 3KPPA 1Q9KA 4UB0L 1KCSH 1X7QB 1R5VA 3WIFA 3F5WB 4MJ5A 3WHXA 4LSSH 3W82A 3KXFE 2I60H 2NZIA 4KI5C 1GZQA 3OKNA 1CBVL 1VHPA 1X7QA 4XVTL 4JG0H 3TNNB 5CIPA 1WWAX 3W9DB 2G60H 1U3HC 2Q7YB 3MA9H 4DW2H 4H8WL 1FBIL 4Z95L 4BH8B 1ED3B 5A2JH 4FQ1L 2Y6SC 4Y1AD 5I74C 1BX2B 3GSNB 1ZGLB 4U1KA 4YHPB 2BSTB 4BH8A 4P23D 1SEBA 2DQIL 3ORJA 4EUPH 3P30H 1OAUL 2GT9B 3BZEB 1N6UA 5IHLB 1I85A 5DRXB 3VXUE 1N6QH 3K4DA 2G60L 1NCWH 3BXNA 1BJ1H 4DKEL 3NTCH 1YMMB 3IXAA 4ZUTB 1HXYA 2A9NL 2VNCA 4HIIB 1KFAL 3SDXE 3DROB 1IC5H 5HHMD 1SY6H 1XR8A 3HCVA 4KQ4H 2DM3A 3QDHA 3K7UA 3RVUD 5BCAA 4XBEL 2DI8A 5F89A 3EFFA 3U46A 4JO1L 1J05B 4ZFOL 2Y72A 2J6EA 4JRXD 4KQ3H 4HJJL 4MJ4A 3LKSA 4N5UA 4RA3A 3MV7E 5TFSL 1HQRA 2VR5A 5TQ0L 4P3DB 1A6WH 1T4KB 3MRNB 2FO1A 1B6DA 3U46B 5LGJA 4MDIA 1SEQL 5IV2B 3CZFB 4RNRB 1NCBL 1R3KB 4NJ9H 5BMFL 4FG6D 1I1FA 4PGEB 5DS8A 4GAGH 4JY5H 4NKMB 5T1MB 2R1YA 4JFHD 3VFSA 4J3XA 1CTOA 5LWYH 5EU5B 2JJSC 3PGFH 3DX6A 2JIXB 2VZOA 3QG7L 3F58H 1A7PL 4K8RL 4U6VL 2YD7A 3OZ9L 1MCQA 3LKNB 4JY4B 1EV2E 4KKNA 4I13B 4HQQL 3FQNA 5JZ7C 2Y06H 4NZUH 4ZXBA 1ES0B 1C12B 4EQ2A 3SEPA 5EBMB 2EYTA 2K3TA 3SCMD 4Q9RL 4P5KB 3H3KA 1WIPA 2DLFH 5IVNA 1FQ9C 5H94B 4LRIC 5I1CL 5F7KC 4R90L 2FEDD 2DD8L 2OTPA 4KMLB 5MEPA 2MCPL 3BEVB 4WWKD 5HHOB 1Q1JL 2YD8A 2VAAB 3WFEH 4WO4A 1ROWA 2QLVB 3SO3B 4XMLH 3TVMB 2YC1B 2MPAL 3O3UN 4PJXF 4LKXA 4WW2F 1YN7B 4ZFOB 5FDWB 4O2CB 5HYQB 4PJHA 1CDBA 1LK2B 2J1KA 5C0IA 3BYTA 3P0YH 4QNPE 3GSOA 4GS7C 1A7QL 3GUTA 2DTSA 1AHWA 1OTTC 1REIA 1TQBC 1CLOL 1AFVL 1DBKH 3TBTA 1LDSA 1F58L 1A7RL 1VDGA 1W0VB 2PO6D 2GJZB 4KKBC 2ADGA 4FQQB 3FB7A 4N0FA 4DK6A 4TTDC 3ILQC 3TBTB 1G7LB 2FEEL 1FPTL 1TVDA 1G6RH 3DX9A 2PF6A 4MJ2A 3PWNB 5LCVH 5HGAB 4GW4B 5CCKL 5DRNA 2AEIT 3R06B 4FQHA 2ERJC 4R4BB 4LPWA 2VDPL 4DKDC 3O3EB 1EEUA 1NCAL 4J6RL 3QEHA 1YQ2A 2HRPL 1KF9B 2HFGH 3IDYB 2XZCL 4M00A 5I1IH 1GC1C 3A67H 2ERJB 1OCWL 3MRRB 1Q9KB 1LP9B 4FNLL 4XZUA 3H42H 3I50H 4JE4B 4X4XB 2Z4QA 4XNYH 2J8HA 4IRJB 4PJ8C 3FT4A 1T03L 3KAAA 1PY4A 4FQ2H 1OAKL 1D6VH 4KI5F 2FGWH 3EYSH 5JZ7D 4OKVA 5DZLA 2FZ3A 1HKFA 3QUYB 3FB5A 1PW3A 3TZVA 1BD2D 3RTQC 5C2BH 5DRWB 1QRNE 1HXMA 1QLFB 4WWKC 5HYFA 1FFPB 3MLWH 2CUIA 1LO5B 5LG1A 1HHHA 4YHKL 1J1PH 5I15H 4XAKE 2OJEA 1G7JA 3G5ZA 3T4YB 4HD9A 3P4LA 1AD9B 1J1PL 4LEXH 1QO3A 1CDCA 5C0AD 1N59B 3BIKA 2P5EB 5D96C 1LVEA 3UJTH 1EDQA 4HG4J 4H0IA 5E1AA 3SKMA 1GZPA 2CUHA 3G5ZB 4M48H 1AKJA 3K3QA 3OAZK 2JJUA 1S7SA 1TMCB 4C57C 1A7BA 3BP5B 2Q1EA 5TE4H 4I3GA 4PRIE 3U4EB 2KQMA 5F96H 3O3AA 5MHSE 2D9CA 4FP8H 4ZTPL 4P4KD 4RQQB 1MELA 5CJ8A 5TF1L 4FG6C 3IU3A 3DARA 2YZ8A 3DUUB 4BFEA 2XQBH 1L7IH 3ZT6A 2AJUL 5JDSB 5D7IB 4YE4L 3T2QA 1G9NC 2R0ZH 1QFPA 3OX8B 1HH6A 4WUUB 4MSWA 4KU1A 4PJ9C 1HDMB 2JE8A 3IXTA 2W9EH 1AD0B 3WBDA 3IDIA 2B4CC 1NCAH 4PJ5E 1QSEA 4FABL 1BVKA 3BUYA 3GBNH 4MWFB 4G8GE 4QF1A 5FV2A 4Z7OE 2V17H 2R0WL 3DNKA 3CDFA 4U7MA 1OPGH 3S5LB 5ICYA 2ZUSA 1CXLA 5C07A 5LCVL 2B1AL 1GGCH 4RGMB 3NAAH 5ECJE 4N0RA 4NHUA 1U0QA 4HZAA 3UXFA 4EIZC 1NPUA 3BQUD 3QIWD 4OKDA 4Z0BL 5BQ7B 1PJ9A 2HVJA 1D5MB 4ELKB 4P46B 5D9SA 3CK0H 4QGTA 1I7TB 5EO0A 1HSAA 1X5KA 1PKQE 3LH2L 4NHUB 3PNWA 3I84A 5FO7A 1FO0L 5BVPL 4HZLB 4R7NA 2HVJB 2FYYB 2BVPB 1MH5B 2O26U 3Q6FA 3X13A 2EH7H 2YRZA 5HDBF 3E2HC 5BZWB 4OZIE 3NAAL 4MQSB 4OT1H 4HKZA 1I8LC 1N5YL 1V05A 1VACA 5T3XH 1RJCA 1IQDA 3UAJD 5C0RH 3MA7A 1S9VA 3SJVD 4NC1E 2DLIA 4O4YL 3QDGB 4PP2A 1ZS8A 1KELH 1XMWA 3LN9A 4O2FB 2X1WL 1ZHNB 4EZMA 1JGUH 3GIVA 4PJHB 4PJ7A 4JPIB 4JR9L 1I1AC 3FTGB 3G9AB 2X4SB 3ULVF 2I25N 2XWTA 3ARGC 3IFNL 2QSVA 4KGJA 2OZ4H 2PO6A 3IFPB 3QA3B 3JV0A 4CU8A 1FH5H 1ZHNA 5J1TC 1DLHA 4H5SA 4LSPH 2PYEE 4ENED 3SCMB 1G0DA 4P9HH 1M71A 1U8HA 1T3FA 4GQ9L 4WENB 5DJAA 2R15A 1A64A 1VKXA 1S7QA 4GW5B 1PKQB 4FFVC 2BNUA 2FJGB 1M71B 1U8HB 1UH2A 1DUZB 1BD2B 3PWNA 4FZEL 5C70A 1AE6H 3CFIC 4NHCL 1MWAA 5DGQA 1EAPB 2AJ3A 1MCWW 3R06A 4FQHB 4R7DA 1XCQA 2QQKH 4JM2D 5IW1A 4LCYA 3WUWB 2FB4L 1RJYA 3GMQB 1ZWIA 1AO7D 4HWEH 5EOQH 2RFXA 4N8CH 1FFRA 2P8PB 2A6KA 5L6YL 4LCWA 4NNPH 3MRRA 1ZLUH 4G6KL 1KYOK 3BMWA 1XCQB 5F44A 1ZLWK 3KLAB 3L3OB 1I1AB 5D7LB 3VRLF 4X5WB 1EEQA 5JQ6H 3H8NA 4KQ4L 1TCRB 1G6RB 1E27A 1GGIH 5ICZA 1YECL 5DC9B 1P1ZB 1FFNA 1X5GA 4HPOH 4HWZB 4XNYL 1VFBA 3DHMA 2IBBA 5D8JH 3CVHL 5HGDB 2A77L 4JFDB 3NTCL 2VQ1A 5FM5O 4PGDB 5EU7E 1N8ZB 4R2GC 2HFGL 1IC7H 4MAYB 5CJOL 4OLUH 1NCWL 1S9KC 3H7LA 3TCXA 3IKCB 1MFCH 1OAZL 3M1BA 3IJSB 5IWLA 3MFFA 2CDFA 1MFEL 3OG6B 4ESKA 2F8XC 5DJ2B 1JGVL 1A6VH 1A3LH 2HMIC 4G9FD 2H32A 1WEJH 4JFOA 3QIUC 3FB8B 1CL7L 3W39B 3MR9A 5DMIL 2AAVA 3DMMA 3FFCB 4BELD 5INDA 2EICA 5E6ID 2CRMA 3B83A 3GMOB 2QADC 2BY3A 2EDDA 1N3NB 4JFOB 3WFDL 2NY6C 4TNVK 3ZKMC 2LE9A 2EC9U 4J8RB 1BF2A 3BP7A 2VDRL 5HTSA 1LD9B 4NO0B 2IWGA 2N7BA 2Q7NA 4JQVA 2IFFL 1NGXB 3EYFA 3O4LD 15C8H 2Z93B 2X05A 3L5XH 4PRBA 1JUFA 1KPUB 4ODHL 5EUKA 2ZUTA 4EDXA 4P57A 2JK5B 2G5BA 2ORBL 3T0WA 1Q9WA 5CZXD 3IXTB 3WJLC 1RJLA 5H2BA 2AP2A 3QFJE 5DK3A 5ID1A 1EHLL 5IWLC 1R0AL 1VGKA 3QEQD 4J7RA 1MAKA 1MVFA 1R5IB 3EO1A 1T83A 4E9LA 1FRGL 3KNBA 2UYLA 1NLBL 4H88L 4R90H 2YA0A 4ETQB 1M7IB 1EHNA 3G08A 4YBQD 2DQEL 1KB5H 4OTXH 1FE8H 1IGIH 2KUTA 3P9MB 2VXQH 2D7PA 3KYMB 4CMMB 1KENL 2A6JA 3INUH 1WCQA 3GSNH 3I02B 1NCNA 3WV0A 2NY3D 3K1DA 2YSSB 12E8H 4HXAH 2YK1H 4HZLA 4G42A 4KVNH 1FL5B 1R3HB 1HILB 3LY6A 2PR4H 5JORB 5AD0B 3FN0L 4XC1L 1FO0A 1ZT1B 2VIRB 1H5BA 5EBGA 2WUCL 1NSNL 2IANE 2PTTA 2ITDB 2LVCA 3OPZL 1MAML 5KN5B 1NFIB 4WFED 5C09A 5AYQA 4M7LL 4UT7L 4NCC2 4XAKD 2H1PH 5I66B 4N0UB 1QRKA 1U8KA 2EO1A 3V6FB 2AABH 3QUYC 2VZ1A 4NBXB 4U1SA 5TQ0H 1EO5A 1EEZB 3FRUA 1E28A 1ZA6B 3QQ3A 5LGHH 4OZFH 3BPCA 3LEXB 4JDZB 4UDTB 3HR5B 4WJ5B 5IB1B 4TUOB 3SDXA 4FQIL 4XCNA 4Z7UF 2XQYG 4U1SB 1QSED 2XWTB 1IKFL 1IC5L 4WTZA 3GDBA 4JO4L 2VLJE 1FLRH 5DD3L 4U1NA 2FLBT 2V5SA 4KDWA 2X5PA 4MD5A 4YPGB 1S7RB 2OQJA 2NY0D 2X1PA 4N9GB 1MLCA 1JWSA 3ZL4L 3MRLA 4HBQA 4CVZA 1R6VA 3MJGX 1W2KT 3EAKA 3B4NA 4YXHH 3ARXA 3WS3B 2NX5B 2QSCH 3OR6B 4DGYL 3A0OA 1IC1A 1GC1H 1CQKA 2O5XH 4RBPH 1Z3GH 4IOFD 4LK4A 1ZHBB 5DRZB 2X4PB 3UTSD 4NO2A 3MNZA 2KQNA 4I8DA 5FA4B 1RZGA 1JK8A 2AJXH 4ZPVA 5DD5L 4OLVH 3CLFL 4OCRH 3P9LB 1BGXH 4QHLB 5DUMH 3R8QA 4DN3L 4Z95H 3JVGC 4NQXA 5FA4A 1C16B 4A2LA 4IS6B 4XX1E 2WBJC 4FQXB 1JV5A 3JBG7 1F3JB 3GBML 1G6RA 5JLZB 3AS2A 3OKMB 5GIRA 4UTAH 1U8PB 1FGVH 2I9LA 1T89C 4LSSL 4NQCE 4OF0A 2HT2D 5JIIA 1F3JA 1KJVB 3RY5A 4LSTH 2KPNA 5AUMB 3ZHKA 3QO0A 4L8SB 4UMGA 2B1HH 1EPFA 3C5JA 1N0XL 2DM2A 3MO1A 5CZKA 1ADQL 3T4AB 1UXWB 4WFGE 1G7HB 4QXUH 5I9QB 4RAUB 1I3RA 2W0LA 1CXHA 5DDHB 4F9PA 4QRPD 3RY6A 4XHJC 3RVWD 1PQZA 3DV6B 1IM3A 4RFNB 1E6OH 4D0BB 2BY1A 2Q86B 5A43C 2UWEF 5GGQL 3BI9X 4ODSH 5DHYB 3ZKQD 4N9OB 2RHEA 5IGXL 1I1RA 3GMLA 2D7QA 1U8OB 3D2UD 4GXUN 4QTIL 3OKLA 4LASH 3PGCA 3MJ8A 4MB4A 4Y4HD 3UMTA 3C5ZC 4M61A 4JHAL 4RMVA 3RZCB 2N1KA 2DTML 4OFDA 5DUPL 32C2B 1AIFA 3OJDA 4XWOC 3VXSD 4AMKH 4S1QH 1YEGL 5DK0A 3TV3H 3C6LA 3DO3A 3PGCB 3R1GL 1QSFD 4EDXB 4OD1H 3O81A 2NY4C 5EU3B 3VMNA 5H2BB 3FN3A 4L3CB 1T22B 3X3FL 1XZ0A 3RQ3A 3F7RA 3UTTE 1JN6B 3RVTC 4GRWB 1A22B 2R8SH 4NNXA 4W4NA 1RIVH 3EHBC 3G04B 5JQHC 2HH0H 1XIWB 4HWBH 5A16A 5D2LF 2VLJB 4RGNE 2J12B 1CXIA 4L1DA 1MCFA 3L9RA 1OLLA 1OP9A 1SM3L 1UWGL 1MRFL 5SWZA 5T5NF 3ALXA 3V79C 3NCJL 1T21B 2Y5TB 1C5BL 4ZSOE 1V7MH 4YNYA 2IBZY 1AC6A 4BFIA 3NFNA 4OCYH 3IYLW 1ZT4B 4GUPA 1NUNB 3QSKB 3BP6A 2FCBA 4FTVD 4QRRB 2CKBH 4MMZC 1FP5A 1CU4H 2VZVA 3FOMB 7CGTA 5I75C 1ZT4A 4KK6C 5C09B 4LSDA 3S88L 5DVMA 4K55A 1NC4B 3EOBA 5MI0B 4JEGB 5KS9E 4H25A 2D7MA 4LCIL 2XZQH 3ZSTA 1I7UB 4XPTH 3U9PL 1V3LA 1TDQA 2WP3T 4KJQD 2PXYA 5T3XE 3EOBB 1TETH 4TUOA 4NDMB 4F7EB 5SX5H 3QEUA 5T33H 5J9PA 5E95B 4TRPL 5BV7B 4ONHB 3V5KA 4ACPA 2YRLA 2BFVH 4AG4L 4NRZA 5I76A 3WKMH 2FL5A 1QFWM 2YPLA 1JHTA 1KC5L 1F45A 4AZ8A 5KSVA 2IH3A 4ZYKA 1AGBA 1C5CL 4UI2A 4HEME 4C56B 1BJ8A 4NWUH 5GRYA 1QSFB 5E6IB 4KI5E 4LLVA 1YEDA 3D39A 1S8DA 3SO5A 4MD0B 3CDCA 2JCCE 3K1KC 4TVPE 5F6IB 4Z0XB 2IH1B 5I1EH 3PWJA 2EC9T 4HMDA 2C3VB 5JXEA 1AQDA 1CQYA 1ZSDA 1YEDB 1X4XA 2BSRB 5DD1L 4XPAH 3Q1SL 1FNSL 1T04A 2MHAA 3ALPA 1G9NH 1AGFA 3LKOB 1BQHA 1RZ7L 3CFCH 3O3BB 3QDJB 1CDYA 1K4DA 3H9HA 5E03A 1QFUH 1B2WH 3MRQA 5FUOL 3OKMA 1JI1A 5F1OB 4G9FA 2DQTH 5J0BA 1WIUA 2FR4A 5IGXH 3RVXD 4YBQC 5AYUL 2ZCLL 4UQ2A 3V95A 4RMRA 3PXHA 1JTOA 3QRGL 4RX4A 1RZ7H 4LSUH 4LPCA 1WZMA 3L3JB 5CINL 1NDMB 1FNSH 1N7MH 2C4FT 4DKFH 3L1OH 3AC0A 1F6LL 4MVBD 4NFBA 3DXAD 3HUJF 4Z77B 2NR6C 1ZA3B 4D9QE 4E42B 2AGJH 4K94H 1AGEB 5TDOA 2P42B 3GKZA 2ICWA 5JOPE 1A1NB 4JKMA 2P45B 3SDAA 3MUHL 3RPIA 3NN8B 1PZ5A 5I71C 3BKYL 4Z76A 3DV6A 4RRPG 3ULUE 1NGZB 1BP3B 5BVJA 4PREA 5LBSL 1KLUA 2J7LA 5E0QA 4Y5VB 2IG2H 4TOYH 4LPYA 3WKML 1QYGL 1YMMD 1R24B 3KPRA 2VZ3A 1D5IH 2IGFH 1BX2A 1JWMB 1IGFL 3H9SE 4ZS6C 2ZUQB 2R56H 4JFYB 4HJ0C 3VXRD 5IBUB 4CW1B 3HMXH 4MNQE 5JW4Q 1CGUA 3CVIH 4WCYL 3BZEA 1P69B 3UPAA 4XBGA 5IHBA 4GMTL 4Y19B 4OZGB 3RIFK 5FGRA 1I8IA 4W4OC 5LAXA 1DP0A 3R0NA 4J3UA 3U0PB 3ILPB 4LIQE 5KVMC 4BUHA 3OB0H 2V7NA 4ZUTA 3JSSA 3RP1A 1NAKL 1X5FA 1L4IA 3MV7D 1YEHH 5FUCC 1K8DB 1MCOH 3LKPA 4MD4A 1OT1A 2PTUA 3RPKA 2CGRL 3LB6C 2R23A 2LQRA 5ISZA 3O2DH 4UUJA 2RCSH 1A1MA 5LQBL 2RIKA 1CICC 2CDEA 3RGVA 1J05A 2VDKH 2PW1A 2VDNL 3DX7B 4M7KH 1GVIA 4YHNB 1FORH 5C0BB 2YEZB 4RCAA 1MI5E 1QTYT 2AXFB 4E41D 3MRHB 4YGVA 2G75B 3QNYA 4DEPB 1CICB 4U49A 5GGRY 1ADQA 3WUZA 5I1KH 5FM4A 4OSUH 4M43H 1FJ1B 1CLZH 3RDTD 5C0DB 5F1IB 2H26A 4KROD 4HH9A 3UTOA 2A73B 5F9DC 1FL6A 1R3LB 4K3EL 2DB8A 3PE9A 1UB5B 4FXGB 5GHWH 3O2VL 4L3ED 3DRTA 5D5MF 1FDLH 1VENA 1WWWX 4EI6A 1FFQA 1X5IA 4PLKC 5ID0B 3C09C 3QIWB 2B0SL 3KPPB 3C60A 4WEBL 2VLLB 1TVBA 3OPZH 3ABZA 5EOCH 5A3IC 2W38A 1NEZB 4XPFH 4UNVA 4K3HA 3MYJB 1DVFB 5IW3A 2IFGA 4XC1H 3QIWA 2YD2A 2X4TB 3VXNA 2AV1B 2F54A 2HFFB 5CBEA 1XGQA 1TVBB 5IVXF 3BE1H 3ISWA 3TO2A 3W9DA 1UXSB 1L6XA 1BFVL 3KPNA 3MLRL 5KG9A 3QIBB 4ELMA 1KBGH 2W91A 4ZS7L 2OMNA 4L4TE 4X6BA 3QUXD 3L3HA 1DQLL 5DJCB 1IGIL 4MGXA 4NFCA 5L2KE 1S7VA 1Q9LA 3ME0A 4PB0L 5KJRL 5E6IA 2YMXL 1BQSA 4F7MA 3SDDA 3HC0B 3C5SB 2GKIA 1I7ZB 5DJZA 3TNNA 4JQXA 3QQ4A 3V5HA 2QQLL 5HPMA 5ESAA 3GJFH 5GRWA 3V0WL 4ZNEE 1JNLH 3F7YB 3MCLL 3SDDB 4OFIA 4UIMA 5EH1A 3DYMA 1T04B 3L3DB 1RUAH 2B4CL 5TE6L 4F9LA 5T5FL 3O8XC 2DL9A 1YNTB 1XAUA 1MJUL 4KTDH 3OAUH 4YHPA 3VFOA 3ROLA 1INDH 4L8BB 1A9BB 4Z7WA 1WUNT 1PEWA 3HI1A 3M8OL 5E6ZA 2FX8H 3QPQD 2YXFA 1MLBB 3REVB 4AEFA 2GIYA 2R1WB 1A6AB 3B9DA 4P4KC 5DK2A 2NQCA 1BZ7A 1RUMH 1MREL 3QB7C 5I6XB 4G6MH 1KEML 4OCWL 3RWEA 1M6OB 3ARPA 3FQWB 3DBXA 4K7PL 4MA8L 5DMIH 5HSFA 2AQ2A 2VDLH 1BD2E 2D0HA 3K2MC 4JFDD 4JN2A 4PYHA 3O41B 2V9QA 2XG4A 4JFPB 5TE6H 1F4AA 5TDOB 1EVTC 1UVQA 3T65B 4DVRH 3G5VB 1K8IB 3S9DB 4MA7L 1WTGT 3VRLE 1JF5A 3TZVB 5J13C 2MFNA 2R1XA 2BOCB 3E3QC 4NPYA 3I6KA 1H15A 1OP3H 3LS4L 4LDEB 4JQIL 5IHUH 4JB9H 1LE9B 4HPOL 1S7WA 4PTUB 5IBTH 4JFXA 1Y18A 1YY9D 1FNEA 4Y16C 5JW3L 4PJ9D 2LFGA 1DBML 3EBAA 5F8RC 1H15B 4M5YH 1KULA 4HKBA 4FQIH 5H94A 4LMQI 3G6JA 4GLRH 5E8DL 1LO2H 5FA3B 4YX2L 1OSZA 4N8VA 1IKNA 2J88H 4Y4HA 4Y5XA 1AI1H 2IPTH 4K23L 4OCSH 1HINH 3SN6N 3JXAA 4H26A 2VWEE 4JFEA 3HS0A 4BH7B 3T09A 1GZPB 1S5IL 1BVZA 5AZEL 3W2DH 4H1LG 2ZPKL 3CXDL 2LABA 4UT7H 4PJDB 3OL2A 2NZ9D 3GSXB 4XPFL 3HAEH 3U4EA 2LVEA 3I2CH 3O3AB 1CZ8H 8FABA 3T0EC 1W0WA 5KANI 4LSVL 3V5DB 2FJFA 2EDNA 5BO1L 4K3EH 4LCCA 4NOBA 4YHML 3DX7A 1FIGH 2VAAA 4JKWA 1I75A 2YK1L 4JCLA 2VC2L 1Q9OA 3MBED 3M07A 2NW2A 4LSPL 1U9KA 1A47A 2V2XA 4Z5RB 9CGTA 3CUPB 1JF6A 3S6CA 1P9MC 1KJ3H 4HMEA 3GBLA 3P11L 4PJHE 3DTXB 3GSOB 4WRLA 1ZLSH 3BKMH 1NC2B 2I27N 4Z5RA 3NA9L 4HH9B 4RAHA 2KH2B 3S34L 4NM8L 4J3TA 1SMAA 3DLQR 1LE5B 5IF0A 4D8PA 4O2EA 1NUDA 1X3DA 4IRSD 3W9EB 5LQBH 5E9DA 5HDQH 4NO5A 3B43A 1W0VA 4CKVX 5T3ZD 4YO0A 5I1AA 3OQ3B 1YEEL 3VG0L 3RZCD 4O2EB 3CFKA 2Z4QB 2FSEB 1CT8B 3QO1A 1ACYH 4O58L 2EECA 4KKBD 4IMLB 4HF5L 1FL3B 1U6AL 2FHFA 5KSBE 3P77B 3FMGH 5KVFH 3AROA 2HT4C 2P5WD 4R0LB 1T6VN 3GSVA 4P9HC 4YDIH 4OM1H 4P2QD 2UUDK 4HK0B 4MNGA 1AKJD 5DURB 3MACH 1S7UA 4JRXE 5DURD 2IANB 1JNHA 3DRQA 3LQAH 3FTGA 4I18B 5E5MA 3PV6A 1MFEH 2AK4A 4TTGA 3GSNA 1A6UL 4KKAC 3C8KB 1JHLH 3NABH 3VXTB 5GS0H 4F58L 4G7VL 1A3RL 2NY1C 4YE4H 3UJIL 4S0TD 4FQJH 5I16B 1YYML 1XGRA 2Y6SD 2NYYC 4GS7B 3NFPA 2ICES 3LRHA 4GBXC 1J1OH 5EUOA 2MKLC 4FP8L 1HXYB 3TBYB 4RGNC 1U3HD 2P44B 3AFLA 1F8TH 5F88A 1UFUA 3B3IB 2W9DH 5F7HA 4V2BA 5F7FA 3KPRE 3U83A 4G6KH 4HGMA 2DQTL 3SGKA 1IAII 3BKCH 1A4KB 2UVFA 2YUWA 1QFUL 4JHBA 4CMHB 3MLPA 3V2AR 3DVFA 2R2HA 2CMRH 1FZOB 5JW5A 2HTLD 1QP1A 3O4OB 5SWQA 3AAZB 3SJVA 3RKPA 5DQDL 5TE7H 2XPGA 4OB5L 1A0QL 4ODUB 2P43B 4I18C 3QUMB 1V7NH 3QUKB 4QKXB 1HQ4B 2A1WH 3GM8A 5JW5B 5C2UB 1GGBL 3GGWB 5A3ID 4OI9A 3KHOA 2OR9L 3QNZB 4NFDA 1ZKAA 5BW7A 1J9CT 4K8RC 2X4NA 3FB6B 1HSAB 3IDIB 5HVWA 5TF0A 5EWIL 1OGTA 4LIQL 4O5LH 1XGUA 1KGCD 3VDAA 1F4XH 1G1CA 1UWXK 4EN3D 5ABDE 1OAKH 2WQ8A 1J1OL 4JLRB 3RU8L 1D9KC 1P7HL 2Y25A 4GOSA 5D1ZD 4NKOA 4HKZB 1OP5H 3TA3D 3VXQA 1OSZB 4N8VB 1HKLH 4FNLH 2XZAH 2YD4A 4ZFGL 4ISVB 3NCMA 3R8BB 1BWWA 3VXUD 3LKQA 3S96A 3SKOB 3ARSA 2BMKB 3RI5K 3RRQA 5E94A 4Z78A 4P4RB 4PJDF 1MH5A 3Q6FB 3X13B 3ARDB 1FVCA 3T1WA 3BPLB 2W65B 1UWEH 5EORL 1FPTH 1C1EH 1NGYA 2VQUA 1BIIA 1J0JA 3O6KL 4FQLL 4XNUH 1TXKA 1I9JL 3SCMA 4GG6E 5EZIH 5B38B 4HK3J 3LH2H 3SDCD 4JPVL 3ULSA 5H35A 2FLRT 4XPGH 1ZHKA 1K3IA 5J1SC 2QKIB 1CIUA 5DQ9A 2EXWD 4KRNA 5F6HI 4JPIA 4CNIB 3JV5A 3CCHA 2XTJD 5ELIA 1NC2A 2OMBA 1GGTA 1SHMA 4KKLC 4R7DB 1U8LA 5KSAB 4D8PB 2QR0B 1RHFA 4JDTH 4LPTA 3GMQA 4LLQB 2ESVE 2VLKB 1NBYB 2EIZB 4OLEA 3JTSA 3NZ8A 2WIIA 2CLVB 3MV8D 1DVFC 4MJID 3DGCR 3BZFB 1B6UA 4F8TA 4P2RB 1BD2A 4XCFL 5D7LA 2D4FA 1DQQA 5GRVL 1Z5LA 1T1ZB 5HI5D 4PGCB 4JAMB 2CXKA 1LEKA 1KIQB 3RWCA 3GSRB 1Z9MA 3MRCB 4XXDB 3RUGF 3R1GH 3D85A 1Z9OA 3VFVB 5IW6A 2CIIB 1QRNB 1VFBB 2QTEA 3PWUA 4NZUL 5HYJA 5DUPH 3KPSD 4K8RD 5IQ7H 1MFBH 2VQ1B 1P4LB 1MY5A 3MMEA 5D1XD 5BO1H 4ZUUB 3BPLC 4LSVH 1QKZL 2WV3A 2HG5A 3FQXA 4JDZA 4UDTA 5E99H 1WV7T 2IANA 4JGUA 4G7YH 4PGJA 4J1UB 4ZD3L 3SQOH 1P4LA 1WITA 3B6SB 1U95B 5F6HJ 3WFBL 3FO9A 1LEIB 5KSUA 3C60C 3TA3C 5DLMH 4UIKL 4F80A 1CDIA 3NCCB 1WICA 4I4WA 4IMKA 3CLEL 3F65A 2IAMD 3KPTA 5JA9A 4MAYA 43CAB 3ULVE 3DUSA 3F12B 1N0XH 1XGRB 3VGAC 1RK0A 5DEGA 1J10A 2VXSH 2QSQA 4G80A 1D6VL 2AERT 4S2SB 3TBWA 2FWOA 5E56A 3GI9H 4N5ED 3O6FB 1A4JB 3JVGA 3HE7D 2VLRB 4LMQE 3UBXA 5D7LD 1BQUA 1I1AD 3BXNB 2MOVA 3H42L 2YR3A 3EYVB 4EI5A 1RURH 3EZJB 2G5BB 3K80A 3GBMH 5ALBL 3MRDB 1RJLB 3SDDC 3SKUD 4MA7H 2VUOA 1OM3H 4YXKL 4JM2C 2IQAA 4L3AA 5IMOA 2Q8AH 4TYUA 3QUKA 4LHUG 4QRPE 2NR6D 4S1SL 5I18L 1RJZA 1BQLH 2GSIA 3GIZH 1KCVL 3NZHL 3D0VB 3FO0L 1HHKA 4HKXB 4JO3H 2F19L 1FV1A 2ED9A 2F5BL 4XP6H 3JUZA 1OGTB 4G42B 1C7SA 2BCKA 4XGZA 2QSCL 3UPCA 3RY6C 4HV8B 3BX7C 2JJSA 4XP1L 3IDGA 4Z7VB 5CKAA 2Q76A 3EHBD 3Q0HA 4LOUD 5E5UB 5HHVH 3WNKA 1MI5A 2Q3AA 2YD5A 4HIHB 4PJXB 4HUKB 1G7IB 5FUZH 1CGXA 1VEMA 3TN0B 1ONQB 4BM7A 3VD4A 1ACZA 3QQ9C 3KPMA 5LKNA 5DJDA 3PABA 4N0UA 1IVLA 3BVNA 5CAYB 3SOBH 3IDJB 4OQTH 1F5WA 3MUZ1 5ADPL 3CDGA 1R5WB 3ARBC 4GKSB 2EDHA 3VG9B 4BSWB 2P4AB 1IC4L 3MXWL 3ULUF 1J8HD 5KAQF 5H8DA 4PS4L 3ZE2E 3MJ6A 1H5BC 1UZ6F 3D2UA 1QSZA 3MJ8B 1PG7L 3UC0H 4JFZL 1FZMB 5KJRH 2AEWA 3RZCA 4F37F 1XGYL 1UM5H 3WCYA 1GH7A 1NDGB 2DLTA 3GIVB 5HHOA 1IL1B 4IBLT 3MV7B 2L0DA 3TA3B 4BQBA 4YEEA 1A8JH 2OM5A 1FZMA 1OD9A 2H2PD 4YHOL 3RX8A 1QLEH 4PP1D 2ZP0T 5IEHB 1A7PH 1WWCA 2EZ0D 2DDQL 2PR4L 5F7WC 3NPSB 5CP7B 3OAYK 4M7JL 2AVGA 1LK2A 1J0KA 5LWYL 1IAIL 3LEYL 4YHOH 3EW3B 1RUPL 5CEYA 3MUJA 3TH3T 3GUTB 4POYA 5K9KA 5D7JB 1M7DB 1KCRH 2XZZA 5F6IC 3WL9B 2B0SH 3X3GL 5B3JF 4QTHB 1KIPA 5GRUH 4Z7UA 1FAIH 4DKAA 5I8OL 5C0NC 3TIEB 3VU2A 5ADOL 4JDVA 2CXGA 3MLSL 4DWHA 5GGVY 4P5TC 3NCYP 1CFQB 4HLZH 4KHXL 4JO2H 4QHUA 2AS5M 4G8GD 5IKCB 1ZK9A 1BFOB 2P8PA 5I9QC 3RWCB 2Z31B 4Y88A 5MI0C 2ZOLA 3TIDA 5D7SH 3V7AE 1XCTA 3HUJB 2YPLD 1YNLH 1MJ7H 3ULVH 1ZLVH 1FORL 5IK3B 4YJZL 2BNRE 1GSMA 3UO1H 3UPRA 2VDNH 1NANI 4AL8H 1RFDL 1WBZB 1EXUA 2DLEA 5H37H 1A1OA 4PJEF 3MNVB 5GPRA 3FAWA 2YWZA 2CGRH 1MHPL 4WHYG 4KMTL 4NYLB 5CD3B 2I9LB 3KJ4B 1QVOB 3MGTB 1LEIA 4S1SH 3IKCA 4LP5A 5I18H 1YQVL 2CR3A 4NRZB 1WF5A 4M9PA 1BFSA 5IR1B 5ITBH 5DC0A 3VW3L 2FX9L 1H3PH 4UV7H 5DSCA 5CSBA 5EUOE 3ULUH 4H8WH 5BS0A 3QXDA 2BJML 2H2PC 5C0BD 4OUOA 4CBPA 3EO9L 4NQSA 3TO4A 4ZAKA 2HKHL 5FGCB 1JZ8A 2DQGH 5INDB 4PGZA 5TQ2L 3UYPA 3VXSE 3D39B 4YC2B 4WI3A 1D5XB 4TULL 4GXVH 2NY7H 3QFDB 4MCZB 1J0YA 4LHUB 2CK0L 1QZ1A 2EE2A 3RTQB 3E2HB 1LO0H 2CRZA 4FFZH 2VLRA 2CDGB 2OTUA 5CUSL 3T2OA 3VGAB 1JMZA 2X4OB 4KUZL 4U33A 3W11D 5LBSH 3QIUB 1DBAL 1RZJH 1UKQA 3QH3B 1T1YB 1KJ2A 2W59A 4NP4L 5IB3A 3G5XA 1YDPB 2XKNA 5EC1B 4LIQH 2EZ0C 4O5LL 3UZQA 2GTWB 1N5AB 1Q9WB 3P0VH 3B2VH 1MCEA 5I17A 1SBSH 2HT3D 1DEEB 1DFBH 1GOFA 1LO3L 3SDYL 4PRHB 4NKDA 2ZOKA 4EXKA 1DQDH 1V3MA 1V7NL 4KVCL 1F11A 4O51A 3S36X 1NFDA 1HYSD 1GIGH 4AIZA 4X98A 4DVBA 4G7YL 3FQUA 1WISA 4MNGE 1PG7X 4EOWH 4PJEE 3TO4C 3BSZH 1Z6JT 2R0KH 4PRHA 4YQXL 2BCKB 4XGZB 1JPTL 3HNVH 3HC3L 3KYMA 1UEYA 5ICXA 5J4MA 4LNRA 1B4JL 5CEZL 2AJSL 3DIFB 4QOKD 5EO1B 5GZNC 3JUYA 4P9HL 3QUZC 5BQ7A 3IGAB 3QG6A 4X5XA 4UDUA 4O02L 2WWMC 4WU7A 1I7TA 1PX3A 4LQFH 4NRYA 4W81A 3O0RH 3QXVA 3M45A 5C9JB 2VIRA 4OQ1A 1ZT7A 3BVNB 3MCKA 4H25B 4PR5B 5ESVA 3TYFA 3OJVC 5D6DA 4KROC 1W0YT 1I7UA 1UQSA 2AJVL 4KZDL 4PRPD 4H8WC 3WNMA 4HS8L 4QRRA 2VUYA 2FIKB 5I2IA 2BHZA 4BZ2L 2EYSA 4BSJA 2NXYD 3KPLA 3MJ7A 3OTTA 3E8UH 5C6PB 5I1JL 5EUOF 3CMOL 4P2RE 3HPJA 1HCFX 3H6JA 4Y8DC 3TPKA 4GBXB 1T89A 2X70A 3D9AH 4J12A 2OSLB 4C55A 4PPTA 5FCSH 43C9B 3KPLB 3AM8C 1IFHH 3VGDA 4QWWC 4UNUA 1F4HA 1JZ4A 1MJ8L 3I9GH 5J3HD 1T0MB 1MNUH 3QUZB 3W0WD 1KGCE 4D3CL 3N1MC 4WY7L 1JHTB 3FCTB 4P2OC 3N85H 2NCMA 4PJ8B 5L2JA 3L7EA 4NRXB 1ZHBA 2XWJB 4K7FB 3ZTNH 4JJ5B 2EC8A 2G75A 2ADFL 5D1QB 4U7SA 4G43B 1YEEH 2VISA 1JL8A 3DECA 4PJ8A 5C86A 1HI6B 4YHIB 3BYYA 4MD0A 2X4UA 4IIQB 4G9FB 4OFYD 1QBMH 1A6TB 2ZG1A 4BKLA 3BEWB 3V4PL 3BKML 4P2YA 3STZB 1NBZB 3MODH 1CD1A 4I5BA 2Y5EA 2XXCB 4R4NC 1L7TH 2DLGA 1SM3H 2QQNL 3K4ZA 5JMRA 1U8PA 2ARJQ 4CJ0A 3V6BR 3BISA 3GMMB 4QOKE 1A02N 4L4VA 3D3VD 2BVOA 3QCVL 1LNUA 4LLDB 4N8VG 1U8JB 1YPZE 2EDEA 5HPOA 3MO1B 1DSFL 1CE1L 3GRWH 5I30H 4X6FB 3V6ZA 4C56D 2GJ6A 4CMHC 5I15L 3OB0K 3WLWC 3RY4A 2YUVA 1B0GA 3W2DL 5M94B 3ZYOA 4PLJC 2R4RL 3ARED 2WZPD 2BSED 2ZUYA 3DMMC 4LAJH 2NNAB 4LRNH 2HKFH 2GJ6B 3JV4B 4P9ML 1NCDH 4PJCA 1ND0B 3QULB 5JOFA 1XR9A 1YY8B 4QXTB 3VXUB 1BOYA 2AKRA 1MHCA 3DMMB 4PRIA 4ODSL 4KRPD 4L9LA 4ODVL 5F7DB 4GG8A 4GW1A 4BUGA 5I71B 4L9DA 1JZ7A 2BHYA 3BGFC 2E7MA 5FYLH 1NH6A 5GRJH 4D9QD 3SE4C 5AAMA 4U6XB 3U30C 5CD5C 1UM4H 1MWAL 1FYHB 3OG4B 3VFOB 4G6FB 4P2OD 2DWDA 3VFWA 5C8JA 4UV4L 5C0JB 5D7LE 1TVHA 2HRPH 5ISZE 3ZE1E 3ZDZE 5DJ8B 1D9KD 1UCTA 6FABH 3BN9D 3ILPA 1PSKL 4YHNA 4XNQA 1OAYH 4LSTL 1PYWA 4I2XA 5FHAL 1FVDA 1IGML 5BZDB 3KLHC 3BW9B 4Q74A 4L4VE 4AEEA 3QIWC 1G6RL 4ZFZB 5ID1B 3DJ9A 1F97A 4ONFH 5IB4B 4UTAL 3MACL 3LKPB 5K9OA 1VCAA 1R5IA 3EO1B 3H9ZA 4K7PH 4MA8H 3AREA 3WDHA 3MOQA 3QHZL 4OFPA 5HGBB 3T2NL 1DE4A 1KT2A 1YNKL 2Y5TA 3BAEH 3IU4H 3FMGL 3HZMB 4IOIB 1OL0A 3IGAA 4IIQC 5ISZD 4PJBA 3PHQA 1GAFL 3DGGA 5CSZA 2YPKB 3AREB 3D6GA 4NN7C 3VA6A 3FONB 2DKSA 3IDUA 3U48A 1WAAE 2UZIH 3GJFA 4OCRL 5HI3C 2AJXL 1MRCH 1NMCC 3MRKA 1DQJB 3OKDA 1U41A 4PR5A 3BDBA 3C60B 4NQCA 4JFFA 3DGGB 4M1DL 1UQSB 3JWOL 4WU5B 5E8OA 4D9RE 1GC1L 1UJ3C 2O5XL 3MROB 5J7CC 2LU7A 4XMLL 4ERSL 1JNLL 1Q1JH 3WFEL 4AQ1B 3ESVF 3IFLH 3WDJA 1C12A 5DC4B 1P84J 3CH1A 2FJHA 1QQDA 3HLAB 4OCLC 5GSVB 1MPAH 5GGVL 5I74B 2I24N 1IGTA 3GNMH 3O45A 1FNHA 4JO4H 1KUMA 5DD3H 5FO8B 3ZYZA 3QQ3B 5I76B 4HBCL 3WKNA 1QQDB 4WJ5A 5FYKD 4JGJA 1NFDF 2O61A 3FQRB 2ADIA 1H3VA 1W0WB 3C5SA 3UTQA 3TO2B 4LKCA 4LLWA 3CAFA 4RWYL 5EC2B 5L9DH 1G7PB 4ELMB 3W81A 2ADIB 1CGSH 4FQXC 1LMKA 3DVNA 3ARBA 3L7EB 4NRXA 2YXMA 4PLNC 4JY5L 4XVJH 4S1RL 2NTSP 5IMKA 3RJQB 4KJQC 1YNTA 2MNUA 2GAZB 4MYWB 5GGRA 5KVEH 3TYGH 1X6NA 1OWRM 2XICA 4J23A 5TPWH 1I7ZA 5DJZB 4CU6A 5T5NG 4ZFFA 3QJFA 3IDXL 2G9HB 1RAMA 4HJJH 1RZKH 3VJ6B 4LFHD 4QHLA 1P7QB 1OGAA 4X9FA 4MHHG 2IALA 4QY8B 5F3HA 2VYRE 2HTKD 1BREA 4X9BA 3GNML 1K3ZA 2OJZH 4Y4FD 5MP6L 3FOLB 4XCCH 2A9NH 4Z7WB 3BQUC 4JQIH 3L3JA 3S98A 4JM2F 4OBSA 1MCIA 4Z7NE 5H37G 3T0VA 4HGKC 4XZUB 4F7TA 1JZ5A 4G6JH 4IRJC 4U3XA 2EDBA 4IRJA 1BBJA 3VGHA 4PGEA 4R2GB 4KK6D 4U1LA 3RNQA 3JWOH 4F7TB 5JPNB 2DKMA 4K3JL 1DJSA 3RZCC 5JA8B 2CKBA 4MNGB 2VXVL 3OWEA 2IFFH 2R0LL 3LS5L 5D1QC 5DR5L 5KVDL 35C8H 1XF4A 4MNQB 4CN1A 2GFBA 5EU6D 1KG0A 1KEMH 25C8L 4OCWH 1TQCC 4U1IB 1U3HA 4LARL 4JQVC 5D70H 3U4BL 3H9SB 3TBSA 1T0PB 2P5WA 1RUKH 3CVIL 2PXYD 5DFVD 1NJ9A 2OS7A 3QEQB 3M8OH 4ZSOA 1X5AA 3GMNB 4MXWH 5HI4D 1I1YB 4TSCH 5MEOA 4JREC 4ONFL 1FSKB 5I8EA 4KTDL 5EO9A 5D1ZC 1N59A 3BIKB 4KGLA 1SMOA 1A6VL 1C08B 4A2MA 3UJJH 4WNQA 3NFPB 1NJ9B 5DMGD 5GXBB 2DWDB 5I1GL 8FABB 1IGCL 3MCLH 3Q5OA 4ZUVA 5IJKC 3U1SH 3BP5A 5CJOH 3HHRB 5E9DD 2RAMA 4X6DE 4O2CA 5HYQA 2A0LC 2DKUA 4UV4H 4HUXB 4I2XB 4GAYB 1PYWB 4P2QA 4XCEB 2JELL 4PBVC 1EFXB 1J7VR 2DYPD 1F13A 4ZFZA 5FCUL 2AXHA 4XXCC 1I4FB 2VJXA 4NUGH 3ARFA 4RGNB 1RZKC 5IB2B 1TTGA 1CGTA 2C1OA 1CR9H 3TZVD 4PG9B 5EFIB 4Z8FL 2EDTA 1Q0YL 4XCEA 4QRTA 2OK0H 3QRGH 3ARFC 4LCCB 3OKOA 4WUUD 1LE5A 5DHVB 1QNZL 2BC4B 3VCLA 3TESA 1HIML 3IDXH 5IROA 1A7NH 5EOQL 3G5YB 3UTSE 5DMKA 5C0FA 1T21A 4X9GA 2H26B 5E70A 2KKQA 2ITCB 5HGHA 2FBJH 4JFFB 4RSVA 3THMH 4Z7QF 4GRWH 4G5ZL 4KK5D 4PY7B 4XVJL 2Z8VC 3QO1B 1U8IA 4X6EB 1CGSL 3PDOA 2VE6B 1Y0LB 4TTDD 4Q9QL 2Y07H 5L9DL 3O2VH 3QUML 5I1EL 4XPBL 5EU5A 2OCFD 4OUUB 5F93C 5C71A 2UV3A 4PY7A 3A6CH 4FXLA 1EHAA 3N06B 3QQNA 3MRGB 4TVSa 5HHNB 5GSVA 2ESVB 5F9JA 4HFUH 1IKNC 2GSGA 5L2KB 4PV8A 2P8MB 3QDMD 3O45B 5FO8A 1T7YA 5DWUH 1J5OH 4MJ5B 1FNGA 1JNJA 4I2XE 3IFNH 1X44A 3ULUC 2LTQC 3MREB 2BDNH 1P4BH 4ODTH 4TNVF 3MA7B 3E1F1 1QLFA 2BRRL 3MFGB 1JGUL 3RGHA 4PV8B 3PV6B 1ZS8B 3O11B 4YZFE 3HMWH 5CEXB 4P4KB 5T33L 1TTUA 3BH9B 4GXUM 1JGDA 2AI0H 4MZ3A 4FTVA 3ZT7A 4PJ5B 1MHHB 2ADFH 3LPFA 4NZTL 1YEHL 5BOZG 1RULL 3RIAK 2Z9TA 4X7CC 4MXVF 1ZVSA 1KJ2L 4OZHB 1TNMA 3VFTB 2EDOA 1ZANH 2C3HA 3MV8E 1P9MA 5BV7H 4KI5D 1CU4L 5DEFA 4D3CH 2J5LB 2LU3A 4YFLI 3ROLB 3BAEL 3DSFL 7FABL 3O2WL 4KDTC 3HI1B 2YN3A 2J6EH 2EIZA 3EGSB 3GK8H 3PIQB 1F6AB 1J88A 4QY8A 3DV4B 5F3HB 3AM8A 2JCCA 1E4JA 3DVIA 5CWSA 1VPOH 1BZ7B 3WEXA 2YD6A 4F7CA 3DROA 1RJYB 4P0DA 3P4OA 4WUUA 4WUKH 3RWEB 1Z5LB 1LEKB 1HDMA 1T1ZA 1TJIH 1PSKH 1U93A 3D87B 3GBNL 4PB9H 3O3EA 4P49A 1UGNA 4HFUL 2Y36H 3NH7H 3C2SA 3HA0A 5F3BB 2DI9A 4PJAB 3LHPH 3RA7H 4KUCF 5K9JL 1AGDA 1IRAY 1G9MH 3CSYB 2CKBB 4UINH 1YUHB 3BIAX 2JF1A 1I9IH 1TJHH 5TF1H 1XF4B 3UEZA 3ZKXC 5L2KD 2F9BT 5EIIA 3ZDZF 2X9YA 3O3DB 3THML 5FF6A 5DF0A 2NY4B 3BPOC 4YDVA 3LVEA 3C5ZA 5CEZD 5EB9A 1B4JH 3RL2B 5FYKU 2GCYA 3HC3H 1EFXD 4UILH 4WI6A 3HRZB 4WW2B 3BSZL 1DBBL 4L4TD 3C5ZB 4H26B 2CRIA 3FRPA 4QRQB 3TWCH 3BPNB 2W65A 3Q1SH 5FKPB 5KW9H 1Y6MR 2FWOB 4NUGL 5FCUH 4Y19A 2DQJH 3MBEA 2NPLX 1UM6L 4L3EA 3P0VL 4V1DA 1LD9A 4NO0A 4JKPL 4QXUL 4K3DH 3PWVB 1JWUB 4GRMB 5T1DL 2V5RA 2ZNXA 3QA3A 3U1SL 3VH8G 3PL6C 4NQVA 5E7FA 5F7EL 5HHOD 3WNPA 3VRIA 3HNTH 4QHNA 5EA0L 3OKEA 2BNRD 5EZLB 3K8LA 3IU3B 1DUYA 4CDGC 1T03H 4UUJB 3KLSA 1LO0L 1WC7B 3PP4L 1T20B 1T66D 2GK0B 4LHJB 2NY7L 3PJSB 1WSST 2BC4A 1N4XH 3EZ8A 4QRSB 2NTFA 1OAXL 4MQXC 3RGVD 3O2WH 2DQDH 3MRBB 4HX1B 2VXTL 3G08B 2WQRA 5CS7A 5ETUB 1QG3A 2VDPH 3QJHB 5TH2A 4LCYB 4XH2B 4CN6A 4L8SC 4NBZB 4YDJA 5KVGH 4Z7VA 1WBXB 2CKNA 3MRCA 4R97C 3RWGA 2OI9C 3B9VA 1D5MA 4ELKA 2AW2A 1J18A 1CT8A 4KMTH 3MRMA 2CKBL 1MQ8A 3SE3C 3F6IA 4JPKL 5JNYB 3KWWA 5ANME 5IVZB 5EU6B 3M17A 4MNQD 1OQXA 1MHEB 1UACH 2EEDA 4JFDA 2A2QT 5D1XB 2X4TA 1R3IH 3VXNB 3ZYJA 4XCCL 3IVKA 1P4BL 4ODTL 4WDIB 3M17B 3WIFB 4Q0XH 2CIIA 1YEIH 5CEXA 5C0CE 2AK4E 2MPAH 3SGEI 5I1LA 3FFCD 3K0WA 1IAOB 3AS3A 2RB8A 1IEHA 1MIML 2HP4A 1U3ZA 5JHDD 5TDNB 4B0MM 2YA1A 3QDGA 5DJCA 4LCWE 3RWFB 2BERA 2CLRA 4B41A 3IETA 4EI5D 2XN9E 3W39A 2R2BB 5I1LB 4K71C 4NO3B 3EYOA 5SV4A 2XOTA 5F9WB 2MWCA 4P2CG 3WHE1 5EOCJ 1PY9A 5ENWA 5KSUB 4K7PX 1KCRL 1R3JB 4S1QL 3L3GA 3NPSC 4RX4D 3KDMA 1EHXA 3BP7B 2Z8RA 4L29B 1IAIH 3T08A 3B2UC 3GKWL 4XI5C 1OP5K 3S3SA 4QT5B 4KVNL 4LCWD 5J06A 3HNVL 4NN5C 1K2DA 2R0KL 1BAFH 12E8L 1SJEA 5INCA 3EOAB 1BM3H 1T1WA 3S35L 2HLFD 5GGQH 3HKFA 1KENH 2C3WA 4QRRD 3WFHB 1CR9L 1A4JA 4AY0A 5DJYA 1QBLL 4L8DA 2X2YA 4M9OA 4U1JA 4JFZH 4RWHA 4YWGH 1AGCB 4NBYB 1PFCA 2VKWA 1CFSB 3KNBB 5E8NB 3RWHB 3RTQD 4PJAA 5CJXC 5D2NA 4YDKH 2GI7A 3MOAH 3ULVC 2QADD 2QV2A 1MCRA 5D1ZA 4Q2ZA 4U1JB 3HZVA 4JN2B 3BGFB 5HYJD 3P9MA 4XMPL 2OL3B 1QHPA 5F7YC 1WFOA 1T4KA 1KJVA 1RZJL 4M62H 1CE6A 1KFAH 3F7VA 1MFAH 3QO0B 4JZOA 5IV2A 1FFNB 4V1DD 5E2VH 1PDKA 5IFJB 1AJ7L 1U92A 1WZ1L 3WJJA 4TSCL 5KSAC 4PJAE 3MPCA 1WGOA 4PRHD 4XP1H 2A74A 1G7HA 3EYUH 3S97C 4U0QB 3WN5A 5CMAA 4XP6L 3EO9H 1WZLA 4MXVE 5IFJA 5KOVC 3B9KB 2BJMH 4PJEA 3VFMA 4XVSH 3QWOB 3QPXH 4XP9L 4F2MB 5GGTH 3OJMB 5DHYA 5DO2D 2R0LH 3CC5A 5DVOA 5F1NA 1ES0A 1LK3H 1LILA 1ZGLM 2HJFA 3QFJD 3QZWB 3CFEA 2EDJA 1Z3GL 1J8KA 3MA9L 4DW2L 3SDCA 3FT2A 3NACH 5GS1C 1GYAA 4J4PD 4LLAA 1MCPH 4IRZH 2F53E 2BNQD 3O6FC 4XVTH 3X12B 4AYFA 1RFDH 5DA4A 2Z91B 5GSRB 3NOIA 4W70A 2A77H 3MZTA 3ZL4H 1BJ1J 2QADB 1H3TA 3I3BA 1NGXA 4K7PY 4NNYB 1MJ7L 2B2XH 5FM5M 5D2LE 5FYLL 2APBA 1WT5A 4EUPA 1YECH 3DXAB 4NQDA 1NFDB 5JQ6L 3BQUB 1KIPB 4K07A 2EXYC 1F4YL 2V2XB 4PV9B 5BJTB 1RZKL 4JY6A 4ENEC 1VA9A 3TCLB 4P46C 2EXWC 2UYLB 4N8CL 3RWDA 4AJ0A 4N1CA 4PV9A 2P5WE 4EUPG 5KVEL 3PQYA 1HYRC 4FOMA 3LSOA 5L8JB 4UDUB 1Z9LA 5JR1L 1CLCA 2YZ1A 4NO5B 4PRAB 4Z7UB 2WUCH 4KTEL 4QRPB 1JRHL 5C07E 1KXQE 3TH2T 4M3KB 3L3IB 4QCIA 2YWYA 3BKJH 1CGWA 4BK5A 1B0RB 4Z7VE 5D1QD 4HHAA 2CO7B 2GY7B 3E6FB 4IMLA 5I8CA 2E3VA 3GSNL 3QI9B 1OP3K 4LPVA 3N1PC 3OXRA 4HWZA 4PJGE 1UM5L 3MRFB 3FQXB 3MJ7B 1NMBH 2DMKA 4WIQA 2DOCA 1PG7H 3V4UL 1MIEH 3QAZC 4WUUE 5GS3A 1NLBH 4H88H 2H2SD 2D7TH 3ARGB 2Y1VA 4IOSD 3GSWA 4O9HL 1KB9K 2IC2A 2I9TB 1PQZB 1EHLH 5FIEA 4WHDA 5L88H 2GTZA 2Q86A 5CIPB 2EKSB 2E6JA 4G8EA 4N0CC 4JFEE 4MXQC 2Q6WB 4YXLL 1QA9A 3WE6A 4Y16B 4W68A 2EIBA 1IAKB 5FKAB 3LQAC 4FRWA 4L8CA 5HY9A 1ZV5A 5SWSE 1P6AB 2L4OA 32C2A 4NQSB 3TO4B 1K2DB 4W6XB 4X8XA 2BSTA 3UBXB 4G43A 4DFHA 5E1AB 3SKMB 1HHJA 3IU4L 2X4QB 5EDXA 2JJTA 2NLJB 1ZEAL 1IFHL 5DRZA 1BQLL 3GIZL 1ZTXH 1G9EA 4QOKA 4OCMC 2X9WA 1CXKA 3RTQA 5E2WL 1C1EL 1W72A 4WTZG 1FNLA 4JFED 3KPQB 1PLGH 4KZEH 3CMOH 1JGVH 4QGYA 1CFBA 4I5BB 5IB5B 3DUUA 1IM9B 2UWEE 4Z9KB 2ZCKL 3VXPB 4FABH 1N2RA 3FT3B 4IS6A 1A2YB 2GTWA 4PJ9A 4Y2OA 1NBVH 5SWZB 5I8KL 4F33B 5DXWA 1F3DH 2AJVH 3RNKA 3DVGB 1RHHA 4QYOB 3BUYB 4GMSH 4JHWL 2XQBL 1S3KH 2OP4L 4QF1B 2F8OA 5CHNB 1TLKA 1MQKH 5I0DA 4GUPB 2YBRB 4TQEH 4W6YB 1EZVX 1F4XL 1RZ8A 2VXSL 4YPJA 1BEYH 1R3KA 2W0FA 4LNVA 2HJLB 3RVVC 4JRYA 5MEQA 1IT9H 4HLJA 4PRPB 4B50A 1OLZA 1FO0B 1ZT1A 2DJ4A 4LRNL 4P9MH 4RAUA 1A9EA 4UIKH 2R4RH 4X83A 3AU1B 4GKSA 5I75B 2W9LA 3AY4A 4WU7B 3PQYE 1GGYA 2HJFB 2C4FU 4IDJL 4TUKH 2VZSA 4MMXC 1NLDL 1D6EA 4NHCH 3KYNA 4OI7A 3GRWL 3HPJB 4NQTA 1BFTA 5TE7L 4PRDA 4CVXA 3V6FA 1DLFL 5ESVB 3TYFB 1AY1L 3AU1A 1YEKH 3RUGA 1LO3H 2BX5A 3GMLB 3MLWL 1FGNL 1ZA6A 1QSVA 1UA6H 2CLZA 4MXQD 3B2VL 5HHQA 1NL0H 2V7HB 1IL1A 5GJTL 4HPYH 3FKUS 3ZDYE 4JG1H 4XI5D 5IP4A 4WFFD 2QJDA 4PP2B 1SJHA 3RUGB 4NNYA 1S7TB 2HWZL 4MS8C 3ZO0A 3LN5B 2E7LC 4WWID 2OTWA 4CRPA 2X44D 1QSFA 1T0NB 4FQ2L 1A7OH 1FIEA 1KB5B 4MAYD 4FFZL 1XIWC 5CUSH 5L2JB 3MODL 2HAZA 4K7FA 3VH8A 1S3KL 2OP4H 2WWKO 3U0TA 1DANT 5HBBA 4JY6B 4GRLC 2DQUL 2V9RA 1QLRB 4KJPD 1GOHA 2PW2A 4TN9A 5F7UA 1WIOA 1XIWA 2VH5H 2C1PB 4RGOL 3NABL 4WGWB 1CDJA 4G8IA 4J6RH 4JFHE 3BPNC 2A83B 1AGFB 3U0TB 3Q6GH 2DWEA 1H3PL 2YPKA 3C9NB 2PW2B 4UV7L 5CCKH 4UQ3B 2VABA 4MLIA 4PRAA 1XF1A 1U8QB 2AJ3B 2C4XA 3N85L 4N0FB 1TPXC 4HUVB 1G9MC 4U1HB 4KTYA 2JKXA 4UQ3A 5BVPH 3ZSSA 5HGAA 5IK3A 2A6KB 3RX5A 4L4JA 3I9GL 3VFPB 1FZKA 3CD4A 3MV9B 3N9GH 5C08D 4S11A 3FQTA 2A6DB 3L7FA 1A1OB 5IJVA 1QRNA 5DD0H 4WWKA 3HFML 3IT8D 2CD0A 4I48A 2C7UA 3RBSA 2ZUWA 1UWEL 2UWEB 5EORH 5AUMA 1LP9A 1YNLL 4GQPH 3QEGH 1OPGL 4Y2DA 4FFVD 2V17L 2AQ1A 2WUBL 1KTLA 1QFWL 3T3PE 4ODXA 1KIRA 1YJDH 3C08L 4R9HA 4U6YB 5HDQL 5KG9B 2W9EL 5FUCE 4HS8H 4K2UL 2Z35B 5DSCB 1B9ZA 4Y5VA 4YHZH 2R0ZL 3O4LA 4PJCB 3L3HB 4E41A 5AEAA 4NUJB 1ND0A 3HI5L 4K3GA 5I1CH 5DRWA 1IEAB 1MEXL 5FGSA 5DJ2A 2UZXB 3VFNB 4H1LH 1KCKA 4HT1L 3O0RL 4R3SB 1KJ3L 3LQZA 3K8MA 2YOCA 5FYJD 3QFDA 4MCZA 4C56A 5F96L 4P59L 5IMKB 4A6YB 3SY0A 4U6XA 2X4OA 5GGRB 2NY6D 2VL5A 3UAJC 3VFNA 4JFFD 2SEBA 3PGDB 3UTTA 2Q3ZA 4R4FL 1FIGL 1FFOA 3D3VA 4X7TA 1WQVT 4FZ8H 3MC0A 4Y5YB 2IH1A 5EZOH 1UZ6E 3TBVA 2Y4SA 4XNQB 4APQD 1N5AA 5JOEA 4X7TB 3VXSB 5D93C 1A0QH 5IVXA 1IILE 3LKOA 4H20H 4QHKI 4U1GB 1JZ3A 3PXJA 3WFZA 4P5MB 5BXFA 3IJHA 2ZOKB 2GYSA 3HCVB 2V2TB 2YEZA 1CD8A 1HINL 5A16B 5TFSH 1KTDB 2BVEA 3C09B 5IVOA 4YGVB 5C0CA 4YX2H 3BP4A 3PHQB 1DN2A 1MRDH 3WS6C 5JMOC 1D5ZA 4UBDD 3CIQA 4NP4H 5D5MA 1CD9B 4BFBD 4P3DA 4XX1G 5T3ZE 5LGJB 3FO1B 4YBLB 1MCNA 2R4SL 4OLWL 5D5MB 3I50L 1J8HB 1WFTA 2CIKA 2R1XB 4DQOL 1A3RH 1KG0B 1J0IA 1JYVA 1A1NA 5I8KH 4QRUA 3W0WA 2N7AA 5CSZB 3MLZH 1NEZA 3DX6B 2O5ZH 4OZIF 3ES6B 1EFQA 3KS0H 4D0DB 4J2XA 3P4NA 3CH1B 1MAJA 4HS3A 4PJGA 3ULUL 1KCVH 3NZHH 2DQIH 2FX9H 1UJ3A 4PRDB 4CVXB 2WAHA 4MB5A 1UKTA 4PJIA 2APXA 5HVHB 4Y5XB 2Q8AL 1CK0L 2IPKA 1KJMA 1ZTXL 4YDIL 4U2ZA 1MREH 2NYYD 3SHSA 4XVSL 1F58H 4YR6B 4XBGB 1EX0A 3HZKA 3U2SA 2FD6L 3BPCB 3BEVA 5D7IF 1EEYA 3U0PA 3MV7A 3LMJH 4HFWA 4XNXL 2I60L 4Q6IB 2V7NB 3GI9L 4JVUA 4YFEA 3BJLA 3ARFB 1S7RA 4UB0H 5FDWA 3RI5F 3P73B 4UOJA 4ZTOL 2NY2D 4JPWH 4ZOAA 5L88L 3REWA 4F7PA 1BBDH 4WFHD 4LKCB 5ERWB 5KZCD 1M7DA 4L3EE 4APQA 1JBJA 2QHRL 3HRPA 3RGVB 4O9HH 4NO0D 4XT1C 3CLEH 1OB1B 5CZVH 4WHYH 1MF2L 1ZLSL 3QCTH 4Z7WE 2EYRB 2XWBB 3BZ4A 3KYOA 4GW5A 5EBLA 4ZPTA 3BUTA 4PJ8D 4PGBB 1IE5A 3U82B 4NCDA 5DK2B 1G7LA 4LVHC 5IFHL 5AZ2H 1QOKA 5E9DB 2WM0A 4WV1B 4PYGA 2XWBA 3BZ4B 3D69B 3KYOB 2H45A 4K8RH 1OTUD 4XC3L 3NCYS 1T2QL 3WHE0 5CBAB 3WUWA 1VEPA 1Z0MA 4HGWB 4OZIA 2VERN 2IPUK 2DIJA 5IQ7L 2X6MA 3MRPB 3EIFA 5B39G 1LDPL 5E8EB 4U4BA 4RIRB 5EOCL 4AEIL 2VTFA 3BO8A 4I0PC 1SEQH 4HDIA 5AZEH 4Y2DD 5D7JC 5J8OA 1S5IH 3WXWH 2HFFA 3ZZ1A 2E6QA 5BRZE 5CZVL 2VMFA 2Y7QB 3AREC 3H9SA 4NN7B 5SWSA 4OD2A 1XH3B 4M6NH 3PL6D 2ENYA 4P4KA 1IBGH 3T4AA 1BHGA 4OQTL 4MA1C 5BS0D 4OSUL 2ZSWA 3ZHDA 5BS0B 2WBJA 2AK4B 2E5EA 4J3OC 4QXTA 3ZLQC 1S7VB 1JWMA 5IHUL 1S9XA 1Z2KA 4QXGH 1ZVSB 3HS0B 4BH7A 2HJKB 4HS6A 1D5XA 4I1NB 1W8OA 3LRGA 3Q3GA 5IROC 2H32B 5JUEH 4GAJH 2VOTA 1PBYA 4YDLC 4JCMA 3TP4A 3TM6A 3W0WE 1ZGLA 1WBYB 2RCSL 3VFRA 1JMXA 5LAXB 3O2DL 2F5BH 3O6ML 5B39A 1UT9A 5JIHA 1SEBB 3EYQD 2AK1L 5IBUG 3F6LA 3QDMA 3VDCA 1OAUH 4U6HB 4WTWA 4ZXBC 3RWIB 1I1YA 1MCOL 4IHOA 3EGSA 5I8EB 5BOPA 1NAML 2YA2A 4HMCA 5DJ8A 1A5FH 4Q9CA 2VR9A 4NN6B 2JIXD 3ZKSD 4OZFG 3RWIA 3OGCA 2WSKA 4G6ML 4MX7B 2W92A 4IHOB 4MJ6A 1FZOA 1EJ6A 3QPXL 4JHZA 5IB4A 3CVHB 3MLZL 1BVLB 5DHVA 2OBGA 3O9WD 3VWJC 2P5EE 5HXMA 5HGBA 1BOGA 1H9VA 1WCBB 3FQUB 1IGFH 2AXFA 1B90A 4RFEA 5F21B 1YMME 1WCBA 1SQ2N 2CJUH 3PDOB 3VGFA 4XRCA 5EIIB 3QP3A 3ARBD 2P1YA 1TNNA 4WHTB 2A73A 3GJEA 5EWIH 3V0WH 3GMRB 5HDBE 1XGUB 1UKSA 1QD0A 2QQLH 2Z92B 1P5VA 1ZAGA 3DRTB 4N0CD 5DMKB 1BF8A 3V8OA 2J8UA 5HVGB 4PJFF 2DYPA 4R26L 2ITCA 4X6DF 4OD3H 4WW2A 3FHQA 5HYEA 2YD3A 4H20L 2HTKC 2GHWB 3EYQC 3KJ6L 4OBRA 5CSGA 3DYPA 2LTQB 1KIUA 3WIIH 5I2IB 5CBEB 1BM3L 5FYJE 3V0VA 1VERA 4I0PB 4PUBH 1EMTH 2EYTB 3BE1L 4FZ8L 5GZOD 3DO7B 4ORGA 4DAGL 4LF3B 5C6TH 3BKCL 1NQBA 1JGDB 5DJ0A 1MFBL 2GW5A 5J9PB 4RDQF 1X5XA 3U7WH 3T0AA 1CL7I 1F8TL 5DHVH 1JFQL 2ARJB 3Q5YA 3ZE2F 4AH2B 4NQVB 4ORGB 4WEBH 4FS0A 3L6FB 1FZJB 2DN7A 3ZE0F 2D7NA 4ALAH 4QNPF 1E0OB 1NCTA 4LAQL 5E8PA 1YYMH 4FQJL 4AT6A 3SGEH 2B39A 2DQFA 1YZZA 2IMNA 1OGAE 4JDTL 4PJCF 5ETUA 4AT6B 3ZDXE 5EBLB 2GEEA 4NQDE 3B2UD 1TJIL 5HHME 1P2CB 4YHIA 4I3SL 4UU9B 4YK4C 5D2LA 3GFUA 4Y4FC 1UACL 3EDKA 4DZ8B 1MLBA 3NZ8B 3REVA 2CLVA 3AAZA 3SJVB 1HNFA 3KPOA 5E00A 3HI6L 3N9GL 1XR8B 4XWOD 2BNQE 3C60D 1M6OA 3CPLB 3I6GB 4PJFE 1T5WA 1DDHB 1Q0XL 4X99B 2ED7A 1KXVC 2IADA 4FQLH 3SGKC 1INQB 1BBJB 3BWUC 2X09A 1KPVA 3HE7A 1XF2B 1JYXA 2YPLE 1QBAA 1CFVH 5CJQH 5DI8B 4MDIB 2BP3A 4R96A 4ZUUA 4E42A 1IGJA 2PKDA 5B8CC 2FO4A 1T2JA 4OCYL 2YHGA 3D3VE 3BWAA 1AXTL 2JIXA 3TT3H 1QYGH 3PL6B 3EKCA 4G8FB 1NMCB 3LKNA 4JY4A 1YMHA 1JNHB 3DRQB 3P11H 1ZLWH 3S5LG 2GUOA 1MVUB 3EDJA 5TDPB 1ULVA 5E6YA 2P7TB 4ZO9A 1ZLUK 3WS6A 5EU7C 4PFEA 4GG8B 4GW1B 2HN7B 4KFZC 1EBPA 4JKPH 2X89A 1MCSA 4YHMH 2VITB 3HRZA 4ZUVB 1NL0L 4OGAC 3AXLA 5JHDE 1MFDH 2DQJL 4Y16D 4X7EC 2Y07L 1B88A 4E0RB 1GGBH 3L1OL 4QRQA 3MLYH 3WXVL 3I2CL 4G5ZH 2YC1A 3WMSA 2FJFB 3D25B 2ZCLH 3MBEB 1DBBH 3B3IA 1YN7A 3MCG1 2DTMH 1JGEB 1JPGA 4QRSA 4WV1C 4RQQA 5C6TL 1YMMA 3IXAB 3MV8A 4L3CA 1AI1L 1AR1D 5JHDA 3PWPD 3ZKXB 2A6IA 3UX9B 1IT9L 3KPSB 3EDEA 4I0CC 5JDSA 4QHNB 2PYFB 2XPGB 2Z8SA 3MTRA 1G9NL 4DFIA 1DBMH 5KBNC 4Z8FH 1KT2B 1HHKB 3NCBB 2YKLH 2QSTA 2ADGB 4FQQA 2XRAL 4WHTA 3KHQA 4BK4A 3L9RB 1G9ML 4R26H 3UDWA 1ZHLB 1A21A 3FFDB 5E08H 1GGUA 3QAZB