3OFFA

Structured domain of drosophila melanogaster boca p65 2 2 crystal form
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
MKKGRTLMTFVSVTGNPTREESDTITKLWQTSLWNNHIQAERYMVDDNRAIFLFKDGTQAWDAKDFLIEQERCKGVTIENKEYPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Characterization of the Boca/Mesd Maturation Factors for LDL-Receptor-Type beta-Propeller Domains
rcsb
source organism Drosophila melanogaster
molecule tags Chaperone
molecule keywords LDLR chaperone boca
total genus 25
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2010-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3offA00
1YBAA 3IBWA 3O1LA 3AB4B 3DC2A 3IXQA 3ENWA 3NRBA 2FGCA 2RQMA 2QMWA 3P96A 3UW1A 1RWUA 2JOQA 2MDAA 3AB2B 2H9ZA 5JJBA 2QSWA 1O8BA 1SC6A 1UJ6A 5T41A 5IT4A 2ZHOA 2PC6A 2CDQA 2LQJA 3MTJA 3LUYA 2J0XA 3ENQA 3DHWC 2QMXA 3S1TA 3OFHA 2PA3A 3OFGA 2RE1A 4GMKA 2F8MA 2I9SA 3OFEA 1KS2A 3HHEA 3KWMA 3DHXA 5IS2A 2RQKA 2P9GA 3OBIA 4X84A 1M0SA 3TUIC 3AAWB 3W7BA 4IO1A 3OFFA 2QRRA 2DT9A 4GO7X 4M8LA 3L7OA 1LK7A 4PWUA 3DDNA 1LK5A 2JHEA 3TUZC 3K5PA 1YGYA 5FIIA 1PSDA 3U7JA 2KO1A 1ZPVA 3LOUA 3CEDA 4GO5X 3N0VA 3TUJC 2J0WA 2DTJA 2P9EA 5IT0A 4LUBA 1UJ4A 2LVWA 1LKZA 1UJ5A 2NYIA 1Y7PA 3MWBA 1XTZA 2F1FA 3ENVA 4NMLA 1U8SA 2P9CA 3MAHA
chains in the Genus database with same CATH superfamily
1AZSB 4I2PB 1FFWB 2LQBA 1LOUA 1I51B 3KFWX 4ZP6A 3SCLE 2QX0A 3DXBA 4NI2B 5EN1A 5H1SV 1X9MA 3J7AN 4PXCA 3C15A 5KT6A 2C3UA 2BDPA 4LBPA 4RO0A 1X4BA 4XK8C 2G4BA 2W9BB 4NE9C 5IV3A 2VFRA 1VFJA 4DBQA 5KFDA 3CWJA 2MKYA 2XMAA 3QZ8A 1N56A 4B08A 2FGCA 3CDEA 4Q8FA 3KLIA 4Q0BB 3FDSA 3FRYA 3QAUA 4HT5A 4DUYJ 4F4KA 3HVRA 3TQ1A 3TWZA 4UY8T 3GE9A 3CD6S 1Q79A 4RW4A 4IH6A 5C24A 4K50A 2XMUA 4QIEA 3BGFA 5GAGU 1UCNA 1DTQB 2QSWA 4P52A 3AOCA 1TKXB 3DLEA 4OX6A 5IZHA 1TKTB 3QAEA 4CO5A 3KLFA 3TVKA 4NEZA 1TVRA 2YWWA 2M7SA 4AL5A 3DMJB 2P2CB 3NCQA 5IT4A 2L9WA 4RW9B 1S9GB 5EWGA 3AOAA 2ZZNA 3V81B 1D3WA 2RS8A 3GJSB 3NS5A 1T9VA 2GVZA 2W01A 3EMTA 3WC0A 4A46A 3ENAA 2CQIA 4RW7A 2OEJA 2MQNA 2GIFA 1NPRA 1S6QB 1W25A 1FRJA 3DFEA 4ID5A 5FD1A 4F0HA 2BR0A 3CMQA 1U2FA 4HDHA 3W2WB 3W66A 2NQPA 4OHYA 1EKRA 5HVGA 3HXMA 1R8AA 1SQEA 4ID8A 3BQ1A 4ZHRA 3PXGa 3PYGA 4RKUC 2KT3A 4ES3A 4JI5J 2AYEA 2BYCA 3AQPA 4J37A 4A8SA 4C7QA 4B3TF 2JVOA 5B0GA 2V2ZA 3F56A 4HI2A 1DTQA 2HIQA 1R89A 3C8YA 2BE2A 1YJWS 4LF8F 1YTYA 3GCWP 5HMZA 8RUCA 2XHWA 4GMKA 1RTHA 3W5XA 3FZBA 3SIPB 5F3ZA 3H2VE 3FC9A 3NAHA 3GTYX 4FXWA 3V81A 1IKXB 1RT3A 1VBKA 2CPEA 4OYPA 4A4JA 4NLPA 1YJ7A 2B4PA 5ETLA 4OI2A 2V4RA 3MEGB 2Z2LA 4NLTA 1RB0A 1ACMB 4USVA 1OQ6A 1P8GA 2RUSA 2HHPA 4PZVA 1GXLA 4AQYF 1YJTA 3OFFA 3FRZA 1JWWA 5K14A 2CZVC 3QJLA 4ZP8A 3R5BA 3TZXA 4USIA 5IC4B 3ZZTA 2W9CB 4BC7A 4DL7A 2ZH2A 4J5OA 3CJ5A 3DDNA 4EFAC 2QL5B 1PKUA 1UWAA 4M5DA 1TP7A 3MGJA 3M8RA 3HD2A 3TVYA 4DV7J 2HHTA 2VASA 4JP8A 2E9TA 2YKAA 3CC4S 2XYGB 3K89A 3ZZOA 1Q86T 1K1SA 5FIIA 2ZZMA 2V2QA 3MUMP 3TJAA 1PGZA 2XQCA 1NEEA 3K5OA 1TL1B 3WQPA 4DPXA 1JB0C 3TOQA 2OIHA 4K2XA 2QYGA 5KFIA 4ECWA 1JIHA 4OX8A 1HQEB 3CEDA 1AA1B 1GMWA 1U45A 1N33J 3PTWA 3ETMA 4YB1P 3B4MA 2CZ4A 2XMTA 5T7LB 2FLLA 2Y8YA 4USJC 3FMBA 2HBQB 2I0XA 2AV5A 3QGGA 2W7OA 1FT8A 3H90A 3N01A 2QSFA 4U7CA 3A3OB 1U2CA 4LBHA 3RG6A 1S0NA 3ADAC 3M6VA 1HNIB 2DNMA 2IRXA 3BB5A 3EZUA 1RWMB 2DGOA 3ET6B 4P72A 4USWA 1CS4B 3Q89A 3MUTP 1NK8A 4KHPF 1X8DA 2C3MA 4NMLA 3VZHA 4YFUA 1QLNA 1RT7A 2Y9HA 2HLTA 1YLXA 3T19A 1TKDA 2XNQA 3KK2B 1DRZA 2XS5A 3NMAA 4WF9Q 4LF9F 4FVCA 2XY7A 3HSJA 3HHLD 4DN9A 4Y3CA 2LXIA 3IG1B 1WHVA 3O1LA 3ZTOA 2XSFA 1Q7YT 1HR0J 3M8SA 2FIUA 5KT5A 3GB0A 2GIRA 3NNHA 1T11A 2ASYA 4K4XA 2LMIA 2XG8A 3LGMA 2HLUA 4A8KA 3MM8B 4O3SA 3I0RB 1N32F 2CQBA 4ZVTB 1KN6A 9ATCB 1R7IA 2VBXA 2OPSB 2WSFC 5KFKA 1ZTWA 3TJ9A 1QSLA 1RHMB 2WONB 2DH9A 2JH3A 2OP5A 2N3LA 5DDOC 1R31A 3VAJA 4OYIA 2KFZA 2FYXA 1KHVA 5CYMA 1RAHB 5D6GA 3CJ0A 3GFYA 2A18A 3VVTA 5M2UA 1IJEB 1RAAB 4PYDA 5KFWA 4MIWA 3C16B 3UD4P 1URNA 4RNOA 1YZ6A 1MN9A 2V8HA 2BUNA 1I1GA 3D0GE 4ZCMA 2CPYA 3VR1A 1F6TA 4QWCA 1V3SA 3BDEA 5GAHU 1HNZF 5D8HB 4I7FB 1NKEA 2CPIA 4CLWA 2YQ3A 3J7A1 5IFMA 2M9KA 4M5GA 1UZHA 2GMJA 3I87A 3T1YJ 2FJAB 3D66A 3OL9A 5L1KA 3S1TA 3H25A 1R8CA 5DRKA 4ANEA 4MYUA 3UVJA 2CNNB 2KL8A 4J9KA 2YNFA 4X2BA 5CABA 2X51A 4I6AA 1X4EA 4NLYA 3G9CA 2W2MP 3V6DA 3KLEA 4M95A 5E2QA 1G2EA 4ECRA 1LFWA 1B7YB 2OMOA 3HHDA 4KTQA 3BO4A 2EK1A 2HBYB 2OHDA 4C8MA 4X4VA 3Q24A 5ETOA 3SBMA 3Q8PB 4PXBA 1B99A 4JUZA 4BC9A 1SC1B 3KWMA 3GP9A 5C2CA 2MYFA 1TVRB 2LDYA 2RQKA 4MK9A 5CZXA 2YQ0A 3ETOA 3Q22A 3UDCA 4F4XA 2AD9A 3O44A 4MK7A 1YJNS 1U6ZA 1S79A 3ITHA 2QLXA 5J2PB 4DR4J 4B9NA 2DT9A 3BS9A 3OUYA 2PD1A 1UA0A 3F44A 4RUAA 4LRAA 2H54B 3SQOP 3CUNA 3JS9A 4PCQA 5DGAA 4PAAA 4H4KC 3SSQA 2G0CA 3DOLB 4I2QA 2Q6BA 4K8RA 1Q5YA 3O8WA 3UO0A 4X62J 1BQNA 2YWEA 3N4WA 5EGYA 2IC3B 5AJ3F 4PYAA 3FCWA 4CP5A 3MDFA 1DURA 1FFGB 3VQSA 3Q8QB 4DV2F 5L9XA 4ED2A 5CA5A 2HMIA 2AEMA 5KFYA 3C15B 1LV5A 1A7GE 3DRSB 5EX3A 4O4GB 2QZ8A 1RYSA 2A6OA 3CCLS 1F9HA 1NSKL 4USKA 2DVIA 1RI7A 3V4IA 4O0NA 3A1YG 1JLFB 1QUPA 2FDNA 4U95A 3V6HA 4DL4A 2GAHC 2M70A 2F9DA 4UUXA 3KMSA 1FRKA 1NPPA 1CG2A 3OJUA 3R1LA 1HMVB 2NYHA 2KFNA 2B4OA 2P8IA 1MWQA 2AX0A 1YG0A 2W4DA 3M8ZA 4B3TJ 2W2QP 4ATNA 3POTA 3EGNA 3F41A 1B0PA 3NG8A 2UUCJ 1S7HA 2Y1LB 2OGUA 2DNYA 1RWPB 5KG6A 3TZWA 1V5IB 4C3LA 1DBDA 2QGFB 2B9EA 4Z7CA 1R0AA 2V8GA 1RCOB 1OWXA 2XZTB 2JFDA 3MAHA 3QT7A 3RRHA 1OY8A 2KT2A 2RU9A 3J7YI 3CCJS 5F8MA 3CCQS 5J2QB 2MGZB 4DPTA 1FE0A 8ATCB 3FEXB 1F2GA 1Z1ZA 5LL6d 5B0CA 2YVSA 4QR2A 3H20A 4DF4A 4OJGA 2ABYA 2V6AA 1NDCA 1FERA 4Z2XA 2R7SA 2VBWA 2CQ3A 4HHHA 3H0PA 4PWDB 4LF2A 2O5DA 1RWXB 3KG0A 2AQ4A 2EW9A 2AYGA 3KDOA 2B9YA 3NGTA 3UDLA 3VV2B 1VRUB 4EGLA 5KFQA 1AUDA 4HHUA 4WE1A 5A8RA 1SKRA 2GA7A 2M8DB 2PDAA 1XIQA 3D1OA 4R8UA 2WCXA 4EK2A 3J81j 1AT1B 5F8JA 1F5CA 2F40A 4ZPTR 5LXYA 1A6LA 4HL9A 1DHMA 1MN7A 3IN5A 1FJGF 1FE4A 4O4RA 5BR8F 1IKYB 3HSGA 4ES1A 3ONQA 1C2PA 2E7VA 2QMUB 2MGZA 2DHGA 1NZAA 4ZPWR 2ZH3A 1R43A 4L3NA 4DR6F 1VRQC 3T41A 2YNGA 4OZLA 4DJBA 2CQ2A 2P6TA 1RT7B 1TK0A 1WC3A 3NEKA 3MHYA 1IVZA 2RKIA 3Q83A 4QIVA 1RE1B 2KXHA 1QM9A 2ZEJA 4GKKJ 2HQGA 2GQQA 1REVA 4AXJA 1OQ3A 1WOOA 2DHSA 2QLJB 4WBFA 5DGBA 3MURP 2ZH7A 3HJVA 1GX6A 4MMOA 3KOAA 5DQGA 1U24A 4U6PA 1GNKA 3TX8A 1F1BB 2VUGA 2UXCF 1CJKA 2VH7A 4GKKF 4RPFA 3MTKA 3NGRA 2HHHJ 2WONA 2EKNA 3IBCB 4EBEA 4JBCA 3EVMA 3GSDA 4ZN1A 2HZAA 1DJ0A 1MMNA 1T3OA 3IWLA 1D09B 3S6EA 4DV3F 2GAGC 2V9KA 5GMKa 4DR1F 3OTDA 1B64A 1EP4B 2A0FB 3PYDA 3US5A 3QRRA 2LP4A 3HD1A 3KG1A 5KFJA 3M2RA 2C1EB 1O51A 4C8OA 2KM8C 1WC1A 3GFHA 2B56A 4YP3A 3EXCX 3T5HA 2VG5B 2HHXA 1VQSA 2W25A 2LCWA 2WVFA 2UUTA 1F3FA 1WHYA 3JTNA 4WFAQ 4DFPA 4DHVA 4LF4F 4WZMA 2B7CB 3P5BP 1B70B 1RAOA 1LEOA 4F0MA 2JX2A 5IV4A 7FD1A 3MUVP 1DZ5A 4B3SJ 2AIRB 5IQ6A 1KLNA 3I32A 3DLLQ 3G8SA 2J6SA 3GFZA 4FZVA 1MNEA 2DRDA 3N28A 1FVQA 4K59A 4ED4A 1M90T 1J5EJ 3PV8A 3A8KA 4ZP7A 4N41A 1R27B 2R4FA 4HT7A 1P6TA 2QLFB 1FDNA 2CPJA 2BKPA 1ZZFA 3FJ2A 2VJUA 3CVKA 1QSYA 5GAEI 1AZSA 1GMUA 4I2PA 4RBUA 4DL2A 5KFOA 4NA2A 1NJYA 1KVJA 1KFDA 1M5SA 3PJ9A 4WP3A 1IWAA 4F50A 3QIPA 2B5JB 2LQ9A 2OSRA 4YDDB 1LW2B 3M05A 1S49A 3OXGA 2GCFA 1U49A 3R5CA 1XMOJ 1N52B 4DEZA 1UJ5A 4ZKAA 2X7IA 2ZWOA 2DCLA 5KG2A 5DQIA 3ISZA 1U8WA 1RHUB 2B7BB 3PW5A 3I82A 4C9DA 4A8QA 4UQTA 4FYYB 3S8SA 4YB5A 3UN5A 2N4CA 1U8SA 2MQ8A 3QT5A 4IQXA 3HSZA 3MCNA 2ZVSA 3MPVA 3KHLA 3VAHA 1DQAA 3D9BA 1U0HA 3B54A 1WD6A 2IJRA 4USUA 4N7TA 4UT4A 2MB0B 1HQUB 4B17A 4ZIVA 2C3OA 3OSNA 3RB6A 4DSIA 4JI1J 4NXNJ 1V6HA 1FJEB 2E5JA 4DU7A 3AOBA 5AE2A 3W1YC 5KFFA 1IJFB 5ETTA 4OI0A 1RHJB 4O4GA 2CPFA 3NBPA 3A3PB 3CJ3A 4LFBF 1A0OB 2LEAA 4IRCA 4B02A 3CULA 3TI0A 3QJPA 2XMMA 1S1WB 4YB7A 4WFXA 4XO0A 4IR9A 2YH1A 2IJFA 3FVYA 2D1CA 2ROGA 2CQ0A 2R7RA 4M5JA 1H73A 3NGSA 4KSEB 4UTGA 2W8LA 1Y00A 2OFHX 1S1UB 2PE8A 1IKWA 1FTCA 4PG7A 4B9VA 2G2OA 2P5VA 2HVDA 2JFKA 2RUGA 4KAIA 4Y65A 4CH7A 4F3MA 5F9LA 3RZAA 3MR6A 3WIVA 2F4VJ 3QQCD 1S6PB 1VBYA 3LGHA 1R0AB 2AYMA 1UPPA 1NSQA 5CYMB 1IBMJ 1HBUA 4C8NA 2AEFA 1WKJA 3CCVS 4RW7B 2G9OA 1D8YA 4LIWA 3M9OB 2RVJA 2WBMA 2V67A 3ZNUA 4RW4B 2DGQA 3K17A 2IVMA 2IYGA 3DRRA 2AYBA 4FF2A 5L1LA 2QMXA 5H9FJ 5HROB 3VGUA 2FHMA 5FLXU 1S1XA 2FC9A 2WVCA 4K4UA 1TKTA 1S6UA 3CE8A 2B6AB 4KHMA 3KLFB 1S72S 4HKQA 1TL5A 4IH5A 3C19A 2RE1A 3LPYA 2K3IA 3IS9A 4B9MA 4NCBA 3DLGB 2W9CA 2JRSA 3G2XA 1JXEA 1MU2A 2HWHA 4OX9J 3I0SB 1FDAA 4IFVB 3KJFB 3SSRA 2BE7D 1S0MA 1B0VA 1PG5B 4AUKA 3K0JA 3MPWA 2VDIA 5AE1A 4DQSA 3NY0A 4IYQA 2OD4A 1FRXA 1S4FA 1N5VA 5HJYA 4NLVA 4IG3A 3ZZPA 2M2BA 1B4SA 5F8LA 4B3MJ 2BE2B 2D3O1 4BLGA 3VAIA 4NXMJ 4F67A 3KUEA 4D3HA 3LALA 2LXUA 1W26A 3H5YA 4DS5A 1KC8T 5FDLA 1N8RT 2H3EB 2KI2A 1KLMB 1LK5A 2RF2A 3MAAA 1NXIA 3NGUA 2JHEA 4I68A 4OZ0A 4P2FA 5D4LA 2C22A 5GVQA 4ZK7M 2R3VA 1PBAA 2B4UA 4QU7A 4AFFA 1UAWA 2PSZA 1R0CB 2CG4A 3MEDA 2NPIA 3RBXA 2PO4A 5BYRA 4N5SA 3AD9C 4I1TA 1TAQA 2UUWA 2GGPB 2YQ1A 5A2QY 4DV3J 1KNZA 4KKOB 5D0GA 1RZMA 1XWLA 2BJEA 2Z2ZA 3W9HA 2OPQA 5GMEA 3CT9A 3OTBA 3C6TB 4GO5X 2AWZA 3BGUA 3PYEA 4QPTA 3TUJC 3ULHA 2CQCA 1HI0P 2NS1B 3G82B 1S9GA 2DTJA 2C2RA 2POKA 2J9CA 2F8EX 2MQMA 4CT8A 3FGVA 2KH9A 4PXDA 1SBRA 4QWAA 1E6VB 2GNKA 2DITA 3CIMA 4LIRA 2FLPA 3KNAA 1S6QA 1VIXA 2BRLA 2ZOMA 5E3CA 3WX4A 4B3SF 3FBEA 4B9UA 1OYEA 4QZVB 1FDBA 1YDLA 1E6YA 2CIMA 1EETA 1CJKB 1HARA 1NO8A 2VG6B 3CDBA 2KYZA 3IGVA 4I6YA 4OI3A 4OHZA 3EXYA 1MWZA 2R8IA 5B0DA 3LTOA 3QZ7A 4MFBB 1H2UX 4B3RF 5E3RA 2WAQD 3C6TA 1RJJA 4NX9A 3HP6A 1YRTA 2X1GA 3NKYA 2OELA 5C7PA 4EMDA 1RT5B 4JI7F 4PUOB 4JI2F 2UXBJ 2OEKA 3ET6A 2ZE2B 3DLJA 3H8YA 4I7FA 2Q66A 4K0KJ 1LWFB 4C8YA 2ZFHA 2ATLA 2H48B 1CBKA 1EHWA 1YVFA 2MDAA 2H5EA 1NHVA 2CVEA 4QR0A 4LF9J 1FJ7A 2O3DA 4N47A 4CLKA 1SUQA 4TU9A 4AQYJ 2VU5A 1ZS6A 1NMEB 4JV1A 3JAMY 3IG1A 1ZPWX 3VHQA 2OTJS 3CDUA 2RDDA 4ILRA 1SC6A 1LWEA 4OX7A 4WTYA 4ZVFA 1SL2A 1UJ6A 3NCPA 4XAKA 2HVIA 3IM8A 1C1CA 4QW9A 2LQJA 4LQ9A 4C2MA 2E66A 3MPDA 4GRSA 3I5AA 4AT1B 4YHHF 4YOEA 3CJRA 5K5MA 5D15A 1RHKB 1WACA 5LXRA 2OJ3A 1CVJA 3ENQA 4Y2IA 1F0XA 5J2NA 5G0RB 4HR2A 4NZ6A 2FY1A 5HO4A 2RJZA 3FFIB 2GMLA 4FYWB 4HHJA 5ETSA 5HQLA 3MMCB 1S57A 1JNRB 4GVBA 2IYIA 1TK5A 4IDKA 3UVJB 5BYSA 1EX8A 1RU1A 3Q86A 5J2PA 1JLAA 2DXEA 4ETZA 4P10A 4KFBA 4TYAA 3OXFA 2DGSA 1UEKA 1GMVA 2GQCA 1TL7A 2GVDB 2B0GA 4JV5F 4A8MP 2OMLA 3CF5Q 3OFEA 4DDFA 4URQU 3HVTA 1JJ4A 5H9EK 1ZZNA 1Q81T 1VIOA 4QIWD 2PEBA 3CXCR 1L3VA 1VQLS 4L3KA 3CJKA 4TQRA 5CQGA 1ZETA 3ISND 2RRNA 3DU5A 1WEXA 1PJ6A 3I55S 3I5BA 2MZQA 5CCLA 2OPRB 3HZGA 2HEKA 1RGVA 1S5ZA 3UR3C 2ALYB 5IT9Y 5HSPA 1ZAWA 3OVAA 5HQMA 4GO7X 1SKSA 4F3OA 2CRLA 4WXOA 2VF3A 1C0UB 2ACMA 5KFNA 1DTTB 4CZCA 3LP1A 3PW2A 1T9TA 3M2RB 3E2EA 1RK8A 1WHXA 1Y9OA 4C4WA 1RYRA 2J76E 1BQNB 1WKKA 1LW0B 4OYXA 2F63A 2HFOA 2GJ2A 2MLZA 3FNNA 1VYAA 5HP1B 3G86A 4DUZF 3EGZA 3PIOQ 3BKFA 4ZVRB 3BREA 4A47A 2HMIB 2HK2A 1KDNA 3MD3A 1S6PA 3DLGA 1UETA 1QSSA 3P8BB 5GADU 2DXDA 1FJGJ 5LT5A 3Q8RB 1S12A 3E01A 3IR5B 1Q7LB 1M5HA 4RLEA 3QFWA 3U1NA 5A6PA 2XGQA 4W92B 1XNRJ 2V2KA 1YZ7A 4FBUA 3HLUA 2NXCA 2N7CA 5HROA 4OYAA 1YRUA 1TV6B 2EFOA 2CJKA 1DLOA 2MEWA 3T9ZA 3HMJG 2H1YA 4YB6A 1SQFA 5LMUF 5L8RC 4DR3F 5E33A 5EWEA 1IBKJ 1FKAF 1GAOA 1LW0A 4C3KA 3T1YF 3C2PA 2RH3A 4KJIA 5THWA 4N77A 4WIQA 5CH7B 4XPCA 3GFXA 1WTBA 2YKNB 3MCMA 1SIZA 3VZIA 5HMWA 3V4IB 2KJVA 3W8GA 4BBYA 1VHFA 2YNFB 2Y3YA 4DLGA 1XERA 3ISNC 5GMDA 4K5RA 3MR3A 2R9LA 3G87A 3A3NB 3N9UC 1XBWA 2V8VA 4HTIA 3U27A 3TR5A 2YWGA 3DM2A 2CQGA 4KB7A 2ZH9A 2VDHA 4ICLA 1H38A 3ENWA 3AD7C 3LGNA 2BABA 4LBIA 4TVAB 3SCJE 4ZCIA 5T14A 2AJQA 1TTHB 3UD5A 3M1VB 3P96A 4J9OA 2XB2D 4NYOA 1DLOB 2PMZD 1WOPA 3KJQB 3LWLA 2I38A 2UUBJ 3KLGA 1JLQA 1UW9A 2IM0A 2BJ3A 2IRUA 3IGNA 3OQ2A 3W3SA 3OXLA 4HLBA 5CYQB 2CFXA 4USTA 1KONA 2PMWA 2DNRA 2VKZG 3RRKA 5E41A 1XK8A 3DOKA 5KG5A 1ROFA 3KDNA 4TY9A 5C25B 2DNLA 2E5LF 2R8KA 1RACB 3ICLA 3LO3A 1CQMA 2AZ1A 1Q95G 2GGPA 1QD1A 4O44B 3UCZP 3PDNA 4X62F 1S10A 1CJVB 4KGKA 4U8YA 3BEGB 1FFSB 1TUWA 3BGOP 4N8OA 3KJVB 2RKIB 3L7UA 4ELUA 4DPWA 3IMQJ 1BGXT 1TUGB 1SKUB 3KNGA 3N6LA 2ZUGA 4FPRA 2ZZTA 4HTJA 1HPZB 3LWMA 2YX7A 4NLOA 1T05A 1Q82T 4LF5F 2VPYB 1HBOB 2M8HA 3PO4A 3QFHA 2AU0A 1TMJA 3I4HX 1VRTB 1RAIB 1T95A 4Y34A 1HWKA 4LRDA 4LFCJ 1NZ8A 1FXDA 3SFGA 2ZJPQ 1ICEB 2QLBB 2HQDA 1ZAXA 3PZPA 3Q8UA 3NWRA 1S1XB 1J5OA 2FZKB 2EG1A 3M2UA 5L1IA 2YKQA 2V63A 2D74B 2J9DA 2HAIA 1LWCB 3TEHB 4OFZA 1KS2A 1K1QA 1T8EA 2OUGA 5CD4H 2ZH8A 2DO4A 1U09A 2HGNA 2WSEC 3TA2A 3RB0A 1EARA 4NWBA 4ZPCA 4BWMA 3K59A 2GJFA 2X1AA 2DNQA 2V2VA 5CHCB 3SEOA 3IWXA 1SB6A 2XS2A 1OPZA 4Q45A 3JB9k 1AW0A 2G0JA 2JC0A 4ZVQB 4OV1A 3U1LA 3D68A 2HS0A 5LJ5Y 1IR1A 1IQTA 4FDFA 4IG3B 4PWUA 2VHGA 2YWHA 1T03B 4TQSA 2IM1A 4ED6A 2E5HA 3HSDA 2M4MA 1V3ZA 1FKPA 3MZIA 1AXQA 2KT5A 3MOZA 3WIUA 4CIOA 3G6VA 4RU2A 1SXLA 2LEPA 2UXDJ 1XNRF 5DG7A 1MROB 1TK8A 2OSQA 2EWHA 2HS3A 1X4HA 2DNHA 5ETNA 2LQ8A 4YY3F 1U1KA 3BF4A 3QBCA 1SH0A 5HJXA 3MM8A 3R1HA 2YKPA 1U26A 2DR7A 2M88A 1NBEB 2YKOA 3I4PA 3M9MB 4LF7F 2JDJA 3GJRB 2YKMA 2XEXA 2YNGB 1RISA 1FD2A 5K20B 1ZA2B 3MXHP 2K8GA 2BXJA 4DV4J 4OI6A 3MFIA 1FD8A 2IJNA 3QGHA 2GV1A 1APSA 3MWBA 4X65J 3G82A 1GXTA 4TNOA 3GV5B 4JI6F 1VK3A 4DZDA 2XY5A 1U1NA 2OH2A 2DCUB 4C11A 4KY3A 3HPOA 4GC7A 4QWBA 3IBWA 5ITHA 1MMDA 5KFVA 4WFYA 1ZTTA 3ZTSA 4IG0B 1JLCB 2MPUA 4P2SA 2DRAA 3ZNJ1 1OMSA 4KGVB 2KRBA 3MM6B 3PJXA 2CJQA 1VQ4S 3FUYA 1Q8LA 2X3GA 1C1BA 4AL7A 1H7XA 3GCXP 1VQ6S 2J0SD 3FBCA 2ZOFA 3NRBA 1VQNS 1RAGB 2FTRA 1NHKL 3BN4A 4GVBB 3CC2S 2QMWA 4WXWA 4H54A 1IKVB 4MJKA 1K44A 2MMYA 1FEHA 3BYPA 4FVMA 2DNZA 2O66A 4TU7A 3FSIA 2HZCA 4IUFA 4LRFA 4Z7YA 5H9FK 4HH0A 4TKTA 3DOMA 4OYMA 4C0HA 3MOJB 3HKZD 2MJNA 4LF8J 2H9ZA 3W65A 2C28A 3AH6A 3JYTA 4RJVA 5B08A 5LSOA 1S1UA 4HI1A 3GSIA 2FHOB 3L7PA 2RHSB 1SH2A 3CD5A 1HWUA 4IG0A 4DUZJ 3QRQA 3AFGA 2MZTA 5KFAA 3D3BJ 4ED1A 1HNWJ 4ILMA 1DARA 2BM1A 1EB0A 3H42A 1CC8A 5D3GA 4LF7J 2CPHA 4KGMA 4DFJA 2MKSA 4KBIA 5ETVA 4ZJQA 2AX1A 4LRBA 3KYLA 5HBMB 2ZM6F 1SPBP 2RNEA 1TKZB 3HF5A 2ALZA 2CPXA 4FYXB 1X4DA 3C3LA 1U4BA 4DR7J 1PILA 1HBNA 3A12A 4XDDA 1KR4A 3GILA 1BLUA 4E0DA 1RDRA 2IC3A 3NLCA 4FXDA 1KP6A 3D28A 3OFGA 3ZFVA 1UVNA 2U2FA 1HLWA 3RR8A 3BKUA 2EVZA 1FXLA 4H4MA 4C48A 5I3UB 4P73A 3W5ZA 4V19X 3GU0A 3HI9A 3M2VA 5FDLB 2ZOGA 2GX8A 1NRKA 3Q2SC 3BSAA 4NCGA 4UOFA 4L6V3 1P9QC 3FSXA 2E1CA 3MF5A 3M8YA 4HH1A 4NLSA 4IH7A 2RHQB 4ID5B 2KVQE 1HMVA 2E44A 4B9SA 2P9GA 3PEJA 4LJMA 2KKHA 2KG1A 1KRPA 1FA0A 3QLHA 4LF6J 3BN7A 1FEEA 2R2SA 3JQMA 4O44A 1QTMA 1RT6A 2W24A 3D7SB 2BW2A 3GPAA 2MXYA 2LECA 2DEIA 3G4SS 5LSRA 2A3JA 4KC5A 3EDRB 1RHRB 1HBOA 2DY9A 3HKWA 5CYQA 3OTOF 1Z2ZA 5L1JA 3E3XA 3FCHA 1VRTA 1VS3A 3L09A 1ELOA 1UFLA 3J80U 1WC4A 1RXOB 4NCGB 3H5SA 1IKXA 2VA2A 3SYZA 1XMQJ 3K8WA 2IBOA 1JLGA 2HNYA 5HQ8A 2KN4A 3QWPA 2MKKA 1FWPA 5HAOA 2ZD1B 2EPIA 4EUVA 3OLBA 1W2BR 2DK2A 1VC0A 2DKOB 4J91A 2IMWP 2COLA 2MSTA 4ED5A 2E7XA 5HI7A 2CNKB 4KH1B 4O3NA 4URSA 3KXDA 3JSMA 3VAFA 2HVHA 3NAIA 1IN0A 3MR2A 4FNHA 4RW6B 1P1TA 4DR4F 3OR2A 2FGOA 3HVAA 3CCMS 4CI0B 4HYKA 1OIAA 3PACA 1SJRA 3KHGA 3CC7S 4LFAF 1HNWF 2N82B 4OI4A 2HVEA 1M5PC 3GONA 1KQFB 1ZH5A 3NMRA 1I5OB 3MEGA 1URRA 5KFTA 1FDDA 4ANCA 4ZCKA 4O0IA 2MSSA 3MR7A 1RABB 2FZGB 4ED0A 3I31A 2B6AA 5CYJA 2DY1A 2B4VA 5LSLA 1KVKA 3TZZA 4JI8J 3HM9A 2N4DA 2XS7A 1XR7A 1UMJA 2RT3A 3FMWA 3MI7X 3S01A 4E2FB 1MROA 1U1LA 2YKNA 1YBTA 1HPZA 3B82A 3DC2A 4OYBA 2KRRA 4PXEA 3OL6A 1T3NA 4IO9Q 3D54A 4NZ7A 2OI2A 2CNOB 2EC2A 2ZDPA 2RQMA 5KFZA 3EZOA 1X5SA 1FRMA 4KGXB 2XLJA 5KFEA 3OL8A 1VC5A 2Z0GA 1QAIA 2NZ4A 4OJ3A 1T9UA 3AB2B 1RKIA 3V6JA 4YEAA 2FHKA 2HFNA 1YKWA 2EBEA 1OY6A 1FK9B 3HHNB 2LDIA 3AODA 4DV6F 4IOCQ 2GHVC 4J90A 1FRLA 3DGVA 3HK2A 1DAXA 2ZC4A 2W4CA 1KQKA 4C11B 3H5UA 3O5TB 4KV8A 4K4ZA 2V8DA 5CAAA 4ZLLA 3RBEA 1H6KX 2EBGA 3GG1A 4WTOB 4Q8EA 5SZTA 3I0RA 4ZDNA 1Q8IA 3UE2A 1BY9A 2MQPA 2HSEB 3NOGA 2MZ1A 3IBFB 5JUMA 2VD3A 4J9MA 5AE3A 1OSCA 3R5DA 2HNDA 6FDRA 1PC4A 3M8QA 4LR9A 4TYBA 2WB1D 2HQFA 2PA3A 2F7VA 3OD2A 4HEA9 1X4CA 2ROPA 5D4NA 3LPEA 1WTFA 2H5JB 5K8OA 1YIJS 1JLAB 2DR8A 1T05B 2FVCA 3AJ2A 1IM4A 1VISA 3H4DA 1NH7A 3UQSA 3UNGC 4DLEA 2BVZA 1OO0B 1ZA1B 3H98A 3BBCA 4FKYA 1N5YB 2IM2A 1VK8A 2DHAA 1YQHA 2APOA 2GW8A 2MZRA 2ZITA 1X0PA 3R5AA 1IR2A 2XMJA 1AB8A 5I4MA 2HRUA 2J7WA 4ZPVR 5J2NB 3IWNC 1SJQA 1EETB 4ITSA 3EJMA 5LMUJ 5I3PA 1NKBA 1YHQS 1J5OB 2EG2A 2YNIB 1JLBB 1I94F 2MLYA 2R7VA 5G4DA 1VGYA 3N79A 3IRXA 5KT3A 2ASLA 3D2WA 4NRTA 1N6QB 1RTDA 4M8LA 4PEOA 3RB3A 1FCAA 1IR0A 4KO0B 3U02A 3SV4A 3QPIA 1YJUA 4RUCA 2UUBF 1UVKA 6FD1A 3TARA 2F3JA 2NSBA 3TW0A 5F9NA 4B3OA 4PQUB 1N36J 3MD1A 3QMQA 3SCKE 4PKDB 1U25A 2UUAF 4LR7A 3R7BB 3L95X 3PM9A 4MK8A 4Y2KA 2RQCA 1BQMA 3MM6A 4PQAA 2CADA 3CJ4A 3DI6B 4LFCF 3NBPB 2MY8A 1LXNA 1WSVA 3ZTPA 4WYLA 5DJBA 1QDUB 3WBZA 4DX6A 1X9SA 2K06A 1BHNA 3QWUA 4RBTA 2A2DA 4KGZB 3SDEB 3Q2TC 1KWMA 2RB7A 1WG5A 3VWSA 3MEEB 4O3QA 5LM7E 2DYAA 3N5FA 1SCJB 1N6QA 1RTDB 4X64J 2KXFA 2FJBB 4K4SA 2V5HG 2D9OA 1HL6A 3DLKB 4IQMA 1HNZJ 3BGRB 2GFFA 1TV6A 1XNQF 1W2IA 3M4XA 3B6BA 2GMHA 3W9JA 5HP1A 1NSPA 3M1VA 1JMTA 1ZOTA 3AXKA 3TEGA 4C0BA 3D3CJ 3UI3A 3TZYA 1YK9A 3BQ2A 4LF4J 2Z8QA 3TUZC 2H65B 3D4JA 3T1AA 2YWKA 4F4AA 4YQWA 3RBDA 2R8JA 1O0PA 1QAXA 3FQKA 3HT3A 3VALA 4DQRA 2E1PA 1K8AT 5C5JA 3OUYB 2AKWB 3T9NA 5KG0A 1Q4RA 1AUSL 1XN9A 2VL1A 1HD0A 3W2WA 5C24B 3D5MA 3PHTA 3H40A 2A6MA 4LF6F 1L3KA 4I2QB 3KHHA 2R2TA 2DHHA 3J80Y 4C8LA 4DSJA 2AGOA 1CJVA 1MG7A 2D3UA 2V69A 3DU6A 3H2LA 4JI5F 3UW1A 4WZQA 5D0EA 4JI3F 5GAHI 4ER8A 2RD5C 5KFHA 4CLPA 3W61A 2DPIA 2OO4A 1N5QA 2W9BA 1R8HA 4PWDA 4KPCA 3R7NB 2WOMA 1NK5A 4USMA 1RTHB 3Q8SB 3BR9A 2ZNZA 2HHHF 1BWEA 5DETA 2VQEJ 4G1QB 2U1AA 4U96A 2F8HA 1N0UA 5HMYA 1WC5A 2BKNA 2GO9A 4CYUB 1XMQF 2EC0A 3CGIA 2LFVA 4IRKA 3CJ8A 3UNYA 1JQGA 1OJ4A 3GIKA 2ADCA 4ZVUB 2B43A 4ZHRB 4JV5J 2VOPA 2NUHA 3ILIA 4OZ2A 3SXLA 3CSKA 3BPSP 2ZBCA 1R6VA 4OMFG 2BACA 4P7TA 2VJVA 1V3RA 1VQOS 4C3MA 4PPDA 4R0JA 2ROEA 4R8UB 4DR6J 3WHIA 4RUBA 1QTNB 5IWAF 4RW6A 2DPJA 3FBFA 3R6GB 4M5LA 4G1IA 3TX0A 5KFXA 4F0KA 1NKCA 1HWLA 1XQIA 5C25A 3NOCA 2UVWA 1HIYA 3M7VA 1TL3B 4CT9A 3S7RA 4DV7F 2IBKA 1R8BA 2VPXB 4KKOA 4DI6A 4NLRA 4AYBD 5LMNJ 1PAEX 5DO2A 3KJVA 5DM7Q 2FJWA 4B3RJ 1XEZA 1FKOB 1RWKB 5M2PA 4KR0B 4ETXA 4RW9A 3ZZZA 2HURA 1VQKS 3HHLB 4DR5F 1OS5A 4K5SA 2DRBA 1RQ0A 1YJVA 1FX4A 2FLOA 1OPIA 3A4TA 3OBIA 4X84A 1ZYQA 2MTLA 3DN9A 3TUIC 1TMMA 3Q8YA 4CLLA 5E7OB 4DCOB 2UP1A 4TLRA 3PX0A 3EX7B 3OR2B 3Q0AA 2YNHB 3BR8A 1RTJB 2DO0A 2XCAA 3LP0A 2AGPA 3L7OA 2YKMB 1T02A 1V9OA 1TL4A 3BBFA 4LF1A 4LSLB 4WFBQ 2MY7A 2EI5A 2WTFA 5I42A 3TAMB 3DCAA 5KTQA 1NUEA 2NXEA 1BC6A 2VB6A 3K5PA 1FKOA 2BBEA 4H4OB 1RAJA 2PA8D 3JQJA 4FXVA 1VQYA 1SL1A 2ZBQA 4PG8A 2XM3A 4NLDA 1GXUA 2VQFJ 3EGWB 2Q43A 2KDOA 3GR1A 3GG0A 3GYGA 2DH7A 4MKVA 4NEYA 2XMVA 1B3TA 1Q8KA 2VPWB 1P9YA 2ZNYA 2GHWA 2VC1A 1I3OB 3GIRA 3IFEA 3NS7B 4G1PA 2BKOA 1CJTB 2M52A 3QGPA 5LJ3Y 1CS4A 2VKRA 2V94A 3GIIA 3BJYA 3QIDA 4ZJOA 2MJUA 1H3DA 7AT1B 2BJDA 4F4YA 5AXNA 4DV2J 3KMQA 1NHUA 4B3MF 4K4VA 1P1LA 1Q0NA 2IPOB 4HACB 2BA9A 1F9EB 2Q6CA 3CDAA 2YNIA 2ZBRA 1S7IA 3MM9A 3SMZA 4CO1A 5EWFA 1HBMA 1RHQB 1S1TB 4DV5F 1U47A 4F4WA 4JV2A 3DYAB 3LP2A 2AJ4A 4DV0F 5D77A 4QR1A 2BQ3A 4DUTA 1WI6A 2CUYA 3CTRA 1UFWA 4CLSA 4YR0A 4EYIB 2LYVA 1VQ5S 2J7UA 2QL7B 3DXSX 4D3GA 2XLIA 4IFYB 3PW7A 3DRPA 3W2VA 1Y5NB 5DDQC 4U7UD 5DG8A 1ITPA 3KUGA 5EHHA 3RGIA 2LKZA 3FEYB 4X65F 3MPUB 3EWGA 4P75A 5D4PA 4C8ZA 1UL3A 2HBZB 1IQZA 4KQZA 1MMLA 1RBOB 1JKHB 1U0SA 5AXMA 3SQGA 2D3OR 4F2RA 1HI8A 2HNDB 1CJUA 3MMAB 5A0YB 3DKDA 1L3SA 2WBRA 2YX4A 1IKVA 4GKJJ 1X4GA 2GS8A 5A8WA 2R7XA 2HWTA 4PRFA 5HBMA 3AD8C 3C16A 4H4KA 4QWEA 3D6MB 1NNDA 3LQVA 2BQRA 3M6WA 4OL8A 2VFTA 2ZWPA 5E3QA 4LFAJ 5JJBA 4UZBA 4R0EA 2VZ9A 1S0OA 2G13A 1TKXA 4MIBA 1R6YA 3DDKA 4WKRA 2G2YA 4F8RA 4LVOP 3CJKB 2KJWA 2BEFA 4NRUA 4ZN3A 2XC9A 1RLDA 3QIPB 2W7AA 1KBRA 4TY8B 1IM6A 5JVHQ 2ERRA 4V19J 3D6FB 3ZXWA 5IM0A 2BRKA 3H2UB 3LUYA 5K8MA 2JJ4D 3DLHA 1HYSA 5HK4A 3GR0A 4ZVOB 1GT8A 1R8PA 3P3DA 3VTIA 2D41A 1NJWA 2JVRA 1U6BA 1VC6A 1FX2A 1HD1A 1U1OA 4OLOA 2CPZA 2NCKL 2XMKA 3ZZUA 1IBKF 1VDHA 3G6YA 1HA1A 4CLYA 3L9ZA 1UVMA 2HW3A 1F5BA 1U0HB 3FSYA 2RRBA 4Y28C 5ETQA 2FJXA 3G6ES 1VQ8S 4Q2LA 3P6YC 2MLXA 3B8HA 3J7ZT 3ILLA 3AJ1A 2HGLA 2VODA 3SV3A 2NLWA 1BQMB 4MKBA 1VJQA 1U48A 1NK0A 1JXLA 1H72C 1SJ1A 2K7KA 3OW2R 4KPYA 4Y6IA 2XI3A 4O23A 2L9NA 1WELA 1RT3B 2XO6A 3MR5A 1PJ5A 2JLGA 1TKZA 2CVIA 3CCRS 2FVQA 2KU7A 1NDLA 4CYUA 3NL0A 2B51A 3MEEA 5B09A 4DV6J 3RRGA 4QOTA 1N0VC 1HNVA 3W62A 4DU8A 2D7SA 1JLCA 1R3NA 1WJ9A 5L39A 3JTOA 2M5YA 1CC7A 1WG1A 4OHWA 1ZM4A 2OKQA 2NSCA 3TA0A 4ECQA 5DQHA 2MZJA 4K4WA 2HHSA 2QTWA 1BE4A 3T3FA 1UFKA 3ZTRA 1MU2B 2EFNA 3UFCX 2G1HA 3KKFA 1EJ7L 4UOGA 3IP0A 4DR7F 2E5GA 4NLGA 1D9DA 4DR5J 5K8PA 3PX4A 4CO3A 2QV6A 1HHTP 4DXLA 3GIMA 1X4FA 3ILJA 3MCSA 3QNWB 4ECVA 4ED3A 4OYOA 3OTOJ 2ZUAA 3JXOA 1NDKA 2R7TA 2YH0A 5I3QA 5DG9A 4K4TA 3HO1A 1GEHA 2QFIA 3CJSA 3H5XA 2V9WA 2VOOA 3K7RA 3UWTA 3DRSA 5L38A 2MHNA 4LUBA 1N34J 3BDPA 2E7WA 3HULA 1IBMF 3W5YA 4ZLJA 2WW4A 3MCOA 2SXLA 1Y5LB 2CA9A 3DRYA 3THPA 5BR8J 2QYCA 4W90B 1KTVA 4OJHA 4EO6A 3PVXA 2F9JA 2M0GB 1XR6A 2C2KB 1YBAA 4JI0F 3KLVA 3R8YA 2HHUA 1FHTA 4ECXA 2E9ZA 4DL6A 2PEHA 5B0AA 4QQBA 1FK9A 3JSMB 4FF4A 4C97A 2W9AA 2GJIA 2AJ1A 1RADB 1M5VC 2LA6A 4J9LA 1OY9A 2WVBA 4LFBJ 3TA1A 1L5UA 1RLCL 4XTTA 1EKSA 1PBUA 4V1Ak 2Y0BB 1XR5A 3PRBA 1BD6A 4MTPA 4QIFA 4ALZA 2WHOA 2R2RA 2OPSA 2DIVA 1YJRA 2DJWA 5D0HA 3KG4A 4CQ1A 2WVEA 4PG5A 4NYZA 3UR0A 4QWDA 3DOLA 1SQGA 3K57A 4DR2J 1RT6B 3RU0A 2UUCF 3CD7A 5LMNF 3TP2A 2OD6A 4DFKA 1IKWB 4JI7J 4C98A 1QY7A 1UWBA 5DDPC 3RAXA 1RKJA 5ADZA 4A8OA 4FF1A 2FUG9 1HW9A 4DR1J 3G6XA 4B9TA 2B3TB 4MYTA 1RA7A 2YPZA 1QAJA 4EEYA 3MTJA 1IKYA 1KOHA 1M1GA 2ZVIA 1F5AA 4DR2F 2Q3PA 3MMJA 4RBVA 1G6BA 4S0MA 1VQPS 4RZRA 1NLKL 1ZM9A 4ZVEA 4NZ0A 2ZH4A 1CLFA 1VQ9S 2EFPA 2HWIA 1HFEL 1SC3B 3DHWC 3VGSA 3TAPA 1G4CA 1YSJA 2X3DA 4NCAA 1LW2A 1D9AA 1WC0A 5B0FA 4NLQA 1RT4B 5IC6B 4YHHJ 2IVYA 1JKHA 1RAEB 2CZ9A 2E1RA 3SQGB 4WKYA 2C3PA 2VICA 4MKYA 3M30B 4X4SA 4M5IA 1AROP 2IDLA 1OYDA 4IOBA 1REVB 5A76A 1EIYB 1SV5B 2Z30B 3HZEA 4MT1A 3FEZA 4JI3J 3BPDA 4O3RA 3M32A 3ILOA 3LANA 2NUUG 3JQKA 2UXBF 1F2HA 4N56A 3A8JA 3HVWA 3PW0A 1Y5IB 3MECB 2UVUA 2MKJA 3GWCA 1NJZA 4LMZA 2C2DA 2UUAJ 1M1KT 2R7WA 2HK3A 2XYPB 4PPZA 4QYRA 3RBZA 3OHBA 4Z37A 2BJ7A 3LW5C 1Z2LA 2QRRA 5CZVA 1N34F 1FRHA 2ZJQQ 4WP9A 1T0TV 5T7LA 2KHCA 1LWEB 1S1WA 4CLFA 4CO4A 3KK1A 4ED7A 3OJSA 2K7JA 1FTRA 2XZDB 5D0RA 4EBCA 1F9FA 1U1MA 4CWBA 5HVFA 1X7VA 3I96A 1Y0HA 2DNNA 2J7KA 5CXTA 1JK9B 4NA3A 4RNHA 2Y1JA 1UVJA 2KTQA 2BQUA 1HQUA 2EEYA 5G0RA 5KG3A 3OLAA 4X4UA 1X5OA 4A8XA 3D1QA 3HX9A 2IVFB 3EPGA 3D0HE 1U6FA 3IRXB 3TAMA 1QJHA 1RCXB 4U9RA 2Z57B 2V4QA 4CCHA 1JLFA 3AY0A 3R5JB 5HL7Q 1KTQA 2RIJA 3UCGA 4F2SA 2E29A 2ZM6J 4KO0A 2CAJA 2J0WA 5J1NA 3RW6A 2FVRA 1TAUA 3R6LB 2C2EA 4DQPA 5KFUA 2QA2A 1GMWD 2V4JB 1S9FA 2PFDA 3D6TB 1FWLA 1X9WA 4R25A 3OL7A 2VFUA 4DQQA 4F02A 2FB0A 4DPYA 2HFSA 2B5JA 4ZOSA 1UPMB 2F1FA 3PX6A 2ZC3A 1K9MT 3D67A 1QVFR 4HACA 3TNVA 2H51B 4TY8A 1T94A 1XMBA 1UEVA 2I8EA 2O67A 1PO6A 1N5TA 1JXVA 2DH8A 4AL6A 2AHOB 2G1DA 4LVNP 4C8KA 4WK3A 5KOWA 1CULB 2E1MC 4DOZA 4DZ6A 4YY3J 3E01B 1D0EA 4DQIA 4UY85 3FZ2A 1TR0A 2DIUA 2JC1A 3T5LA 3MM7A 3OTCA 2FLNA 3NS6A 1L3UA 1EZZB 1XNQJ 4YS2A 4JYAJ 3DRPB 4TLQA 1BMQB 1BWVA 4M5KA 3B4DA 1NSAA 1H74A 2NREA 2CJBA 1RBAA 1M5KC 4JI4J 3M9NB 2JOQA 4QYZJ 1DY3A 2JSXA 3LA0A 6AT1B 1TELA 3UPFA 5HLFB 3M2VB 2CQDA 3BV8A 3MM5A 1ZAVA 1AFJA 3PG9A 4ZCLA 4OX9F 3V4MA 1HBUB 5HVHA 3IAS9 1RTZA 1O8BA 2Z2YB 4ENOA 1H0HB 3V6DB 1GX5A 3BKTA 4YMEA 2JLFA 2XMWA 2GQ2A 2YXLA 1FI4A 4RL1A 4MH8A 3BYRA 3EDQB 5CD4A 2A2CA 5KFGA 2ZHOA 3M8PB 5JXSA 3J81Y 5H9EJ 1N33F 3LF0A 4RNNA 3D1HA 1X0FA 1KD1T 2ZH6A 3W9IA 4FS2A 2RS2A 1VLYA 3GIJA 4KIAA 3PIPQ 1RT1B 2J0XA 4DG1B 4U67Q 5GAGI 3BBBA 4DV1J 3IS9B 5J1EB 4WFNQ 1PC5A 1FO1A 4OYWA 5ETPA 1C0TB 1IBCB 4X4NA 5DLGA 3AA9A 3K58A 1H98A 1WSRA 1HNXJ 1G1XA 1P27B 2UV8A 3C66A 3I0SA 4C0OC 1FXRA 2OAUA 3N6MA 4G1QA 4UZCA 1KLMA 2RF2B 3IC1A 3MAAB 3QGIA 3SDEA 2OEMA 4WWSA 3D0IE 5HMXA 1RA6A 2MQQA 4WFZA 2LLZA 2FHJA 4XPEA 2DD8S 2YWFA 4IRDA 1Q5VA 4PABA 2XGPA 2R8HA 1FWKA 3TRGA 3PCOB 4DMZA 4MFBA 1IWGA 3POTB 4UW2A 4ZP9A 5AT1B 4I64A 4DL3A 1V5VA 2NR0A 2P6SA 5IQQA 2HQIA 4KE5A 2DNPA 1U7LA 2PGCA 3JSRA 3CMAS 1RT1A 4DG1A 2WVDA 3AT1B 2Y0SD 4K7QA 5F3TA 3SCIE 4Q2MA 1SJ3P 4JYAF 1RTIB 3CB4A 1S0VA 2DBBA 4HDGA 4E98A 4X66J 3MAQA 2IFXA 1RU2A 2F65A 2QO3A 5D4OA 3TAQA 4L74A 5EX0A 4NXNF 4ES2A 2YNHA 3B78A 2ADBA 5F8GA 1PJ7A 2ACYA 4EYHB 2XY6A 3QSIA 3OSPA 3N5BA 4RWXA 5SUHA 2AZ3A 4AD6A 1LWXA 3E8OA 5KFLA 1E6YB 1RWOB 1S1VB 2A10A 2VG6A 5C42B 3KK3A 4J9PA 1LNQA 1YBUA 4FF3A 3X3UA 3RAQA 2AP6A 1UW4A 3M6UA 3LAKA 3J7Z5 4EZ6A 4NA1A 4W98A 3M30A 3W63A 4PG4A 2B9XA 2XSJB 4ZVHA 4IFVA 4FP9A 4R5PA 1K73T 1CQNA 4NL5A 2RDJA 1HR0F 4I56A 1HHSA 4ZS6A 3R27A 4FYDA 2AF6A 2E9RX 1VCTA 2BE9B 4OZNA 3TVZA 5KFPA 4N76A 3LOUA 1RWVB 4M63A 3I6PA 3LAMA 5MAOA 4UOHA 2K2PA 3LP0B 3W2VB 1RT2B 3HFVA 2FJDB 3AQOA 2I5JA 3BH6B 4UF4A 4QPXA 2UXCJ 1IXKA 2P9EA 1GH8A 2W1BA 3J81U 1UJ4A 4KHRA 3AJDA 3THVA 1N48A 1B7FA 1HKAA 2YPYA 3MM9B 4JV0A 2NYIA 5K9FA 3UN2A 3VAMA 2OPPB 2AT1B 1XTZA 3NCRA 4ZPAA 1SV5A 1DQ8A 1FVSA 4K4YA 1FRIA 3K2YA 4LREA 2HFZA 4BWJA 2CXEA 1CJTA 1S4EA 4FBTA 3R5GA 2HGMA 3AB4B 2J5AA 2MQLA 2ILYA 4ECSA 3CMES 2HG4A 2N3OA 2PIIA 1GTHA 3OV7A 2BX6A 3AHPA 4DX8H 2ASJA 3ELHA 4DFMA 4CH0S 2HRYA 4E8UA 4QIGA 3TQEA 4X4OA 3K5NA 4A8WA 4ZLNA 1T03A 2DGWA 3G8QA 4EI2A 2DNOA 5C2GA 4QU6A 1KQSR 3E51A 3QO9A 4ECYA 2CG8A 1WEZA 2HKEA 1Q53A 1UVLA 4EZ9A 2BANA 2HYIB 3SI8A 5BXIA 2QT7A 3EYZA 1HI1A 1S76D 5B7WA 4ZIWA 4M94A 1BQXA 4RW8A 2HHQA 2RU3A 4URGA 1RTJA 2VBZA 2W2PP 3L4BC 3CO0P 5U47A 2XZWA 3QJJA 5T41A 3R2DJ 2DGUA 1HHQA 4AXIA 2VFSA 4LRCA 2JEJA 3PKMA 5F8IA 1JLBA 2RAQA 3OPKA 4G6VB 4GC6A 4IOAQ 3KJNB 2W4PA 2OPQB 1NH8A 5J2MA 2LXFA 1WC6A 2K1RA 3PNIA 4OJ1A 5AXKA 2W7PA 2UXDF 2BOAA 3R3TA 1LQ9A 1JLEB 1WWHA 4L75A 3T6BA 5FJ4A 4KFBB 3QO9B 4Y2AA 4JI6J 1C0UA 1DTTA 2FJEB 1YJ9S 1TFYA 2F5GA 2JWNA 3VAKA 3CO9A 3FCVA 1G3OA 4NI2A 2VQFF 2F4FA 2FD2A 1SC4B 3DGPB 2VC0A 2FY8A 4RW8B 4Q7AA 4RX6A 2XHCA 4M1KA 2KM8B 4FS1A 2KB2A 4NLUA 1S9EA 4ED8A 4FKXA 4YDXA 1SUQB 2BJ1A 1NK7A 2AJ2A 3MMCA 2FPHX 1KOOA 1RT4A 3EICA 4OI1A 4NXMF 1HYSB 2DR5A 2Z2MA 3CCZA 3HCXA 4JB8B 2QIFA 4BCAA 1HBMB 1S1TA 4RU9A 3T1HJ 4L72B 1SKWA 1QE1B 1X5PA 1WNEA 2PFFB 1C1CB 2GC8A 3RR7A 2HBRB 3HHLC 2ZBPA 3SFUA 1NB7A 3O2IA 1M0SA 1TU0B 4ICLB 1N54B 5DLFA 2DGXA 5B0BA 1T9YA 4MKAA 2V4JA 5FLXY 1JJHA 1NDPA 4G65A 4LSNA 2QN6B 3EPIA 3QT8A 5KOXA 2VV5A 1DFDA 1JLQB 3IO1A 1TZ0A 2V68A 3M8WA 4MAKA 3WX8A 5JMNA 4QW8A 2KFYA 1YWXA 3GV7B 5K8NA 4OIXA 1MLAA 3CCUS 2H5IB 2I1RA 5KT2A 2QE5A 2BV3A 2ZKUA 4ZLPA 3OR1A 5DM6Q 3P49B 2IHR1 5F41A 4C6AA 2DGVA 1PIEA 4P7VA 4ZVSB 2KXNB 3BH7B 3WDOA 3LP1B 1Y3JA 4TN2A 4DV1F 3VQTA 4PWWA 4I67A 3U7JA 3AXMA 2KO1A 2CQ4A 1ZPVA 3MM7B 4NLWA 1F60B 1F3VA 1G7CB 1U2RA 2BW7A 2CQHA 3K5LA 3VAGA 2IRYA 3BGLA 3FQLA 2ZBIA 4ILLA 2F4VF 3BQ0A 2UVVA 5A6WA 4LSZB 4OHVA 1C0TA 3NP5A 1SVDA 2C2ZB 3QATA 4P9SA 1S59A 4Q5VA 1W7WA 5HLFA 4ELTA 1LKZA 1N88A 1E6VA 4KH0B 2IMOA 2ZKTA 5DZ7A 1A9NB 4OZ1A 1WOSA 2IA0A 5E3AA 4ECTA 4Q0BA 3OR1B 3D6HB 3EM1A 3DOKB 1TFWA 2GVDA 1UP1A 4FN5A 1TL7B 3CIZA 4DWIA 4A8YA 1YRXA 5KG4A 3DM2B 1FF2A 4ZA1A 3M8PA 2AMCB 5C42A 3RTVA 1Y11A 1UEUA 4YR3A 3NGKA 2R7OA 4Y2CA 5DDRC 2QA1A 4DUYF 2NXNA 1VLOA 2BM0A 2XWYA 2E5LJ 1PCAA 4O3OA 1KSPA 2Q1LA 8AT1B 5J1EA 1IBLJ 2OPRA 3IXQA 1RTIA 5LOQA 4X4PA 4CTAA 3FK4A 5A8KB 2R8GA 4DCPB 1HNXF 3FKBA 2B8PA 4WP8A 4J9UE 2ZE2A 2CQ1A 5KFRA 4F7VA 4DX7A 2XO7A 3J7YU 4CLTA 4CNZA 2YY3A 2BJ9A 4G3IA 3KHRA 4CO0A 1WHWA 3KK3B 1WF2A 2NXJA 1UKUA 1HW8A 1X4AA 2J9EA 3R9LA 4RNFA 1AFIA 2RQ4A 3DLEB 4WK1A 1K0TA 2XI2A 1HQEA 2DB1A 3JTPA 2WZ1A 1C4CA 3IR7B 3EUNA 4P6QA 4F3QA 1XC9A 3ZZYA 2KZZA 4OQJA 1BXNA 4W4MA 2WK4A 4DSEA 1D1UA 2B8QA 4R5PB 2IAJB 3HT0A 3KLHB 2DNKA 1U1RA 4DN0A 1PYTA 2QEXS 2UVRA 2EFGA 3KLIB 3GV8B 1FNXH 2VFVA 3PO5A 4KHPJ 1IUJA 3IM9A 3IAM9 2IM3A 5A8KA 2ZJRQ 1NK9A 4RUHA 2RMLA 2A1BA 1MWYA 2FZCB 3W8PA 3PYFA 4RNMA 4LSLA 1SJ4P 2KG0A 2AGQA 4QYZK 3V5RA 2CYYA 2DHXA 4JOUA 2ZHBA 4M5NA 3M2UB 2YBVA 3OFHA 4PR6A 4F26A 4Q44A 3P4UB 1NU4A 3G8TA 1Y3KA 5BYQA 4DF8A 1ZBTA 4U8VA 5EUHA 3GQCA 3K8VA 3JAMU 3H7HB 3CJ2A 4U7UK 3GZ7A 2DGTA 2F8MA 3MMBB 4F25A 3KK1B 3PW4A 3A8IA 2XSJA 4RWWA 2GVZB 3QSYB 1TUVA 5M2RA 1S97A 2V0NA 3HHKA 4KV8B 4DSFA 1N32J 2CWKA 3HVTB 5F8HA 2EFVA 2ATCB 2J9DE 2C2NA 1M5OC 3LH2S 3DDIA 4NYPA 5HANA 1MSWD 4ZVGA 1RWWB 3I56S 2L41A 2CQPA 2MZSA 1GQEA 4KYZA 1HWIA 3W7BA 2DR9A 1LWCA 2YTCA 2QA4S 1NJIT 2V34A 2ASDA 1LFPA 4LF5J 4Q43A 2V8PA 2CKWA 2JEGA 2LEBA 2E5IA 2L08A 1EQ0A 4XDCA 3OT9A 2D69A 3OTEA 3CPWR 2FQQB 4DSKA 1VMBA 3MECA 3NNCA 2AW0A 1BUXA 5EDWA 1J2VA 1M1HA 1ULRA 1QUVA 1VR6A 1GK8A 2XCPA 4DV0J 3DGPA 1KKHA 2LA4A 1B0TA 4NPOA 2UV8G 4P2MA 3U1MA 4OLPA 3TJ8A 1N4LA 1VQ7S 3HFKA 3KUHA 3IRWP 5K14B 1Q16B 5KFBA 1FNOA 3KK2A 4X4RA 3WZ0A 1UWBB 1UZDA 4WCEQ 3BO2A 3QT6A 5IT9U 4MIAA 5KT7A 4GKJF 3NXZA 1EP4A 1WI8A 5IT0A 1K0VA 3RAMA 1WORA 3VGVA 2LVWA 2E1AA 2HQCA 4J9NA 2HS4A 1LWFA 1Z4UA 5KAKA 1XMOF 4CLZA 1N5YA 5CCMA 1VI7A 4CM2A 1ZM3A 4K2JA 2J8AA 2I5JB 2EKYA 1Q8BA 5GAEU 2Y8WA 3T6JA 3PR5B 1S9EB 3GJQB 3PY8A 1C1BB 2RSQA 4P2XA 2MQOA 4F36A 2KZMA 1WF0A 1RAFB 1Q78A 1U02A 2CWXA 3MM5B 2ZH1A 3CDWA 3EVWA 2QC3A 3T5JA 1J27A 2JNJA 3ITHB 3Q8VA 3OHAA 1NB2A 4OZ5A 1NCLA 1YX2A 1T9WA 3PRVA 4KT0C 1JLEA 2DR6A 2QFJA 3VCDA 2AJ0A 5JVGQ 2JEFA 2VQEF 2O1PA 1N5SA 3MFHA 4P71A 1VBZA 1HBNB 2FC8A 4EBDA 4JI0J 1RWUA 3JSBA 2CPDA 3TANA 4QCLA 4J9SA 3GJTB 1KHWA 1CSJA 2H4WB 2XWXA 4USHA 5HATA 3DMJA 4ECUA 2HHVA 3HJFA 2R42A 1GTEA 3ZZRA 2QA4G 2L3MA 1Q1KA 3PHEA 5E5NA 1CULA 2H4YB 4ZPBA 4OHXA 4RR5A 2VG7A 4GVLA 5IWAJ 1VBXA 2DEJA 4KRWA 3DOMB 3UN3A 4CM0A 1QVGR 2PI4A 1T7PA 2ZD1A 3CCSS 1HNVB 4BHQA 2JEIA 3SSSA 5HN0A 3BM7A 3JYTB 4CLUA 2HPUA 4HVZA 3TUPA 4Y2MA 3OVBA 4EWTA 4ELVA 4IKAA 1ZM2A 2HQ3A 2L9DA 4OV6A 2Q79A 2WSCC 2GIQA 3UD3P 5BJRA 3UCUP 4FPIA 2IA6A 1WG4A 4WU3A 4ECZA 5A2QU 1HQ2A 2IY5B 3PEHA 5MLCV 2EK6A 2L48A 2M3DA 2N7YA 3DRXA 2ZDOA 3QYYA 4YN3B 1AYEA 4CTAB 1FNMA 4DPOA 4ZITA 5J2QA 1SH3A 2GO8A 1KFSA 2WB4A 4JI4F 2EFQA 5D78A 2YX1A 1QAYA 1T9XA 2VONA 5KG1A 3V6KA 3VGTA 1H2VZ 4J7CA 4OZ3A 1S1VA 2V50A 5F0WA 2AJFE 5L9NA 2IIHA 1RSCA 5DZ6A 3RJMB 4EO8A 3BSOA 3W64A 1R0BG 3ZZ0A 3DLBA 4ZVPB 2OTLS 3HHEA 5A8RB 2D9PA 3DHXA 4ZJLA 1H7WA 2NPFA 3NWGA 4YR2A 1UA1A 5IS2A 3PR4A 4K0KF 1NAQA 4ZPDA 2BJ8A 2GZOA 3M6XA 1CPZA 4JI2J 2HZVA 1OSDA 4NASA 3BSCA 3AAWB 3UDVA 3C14B 2IDEA 3KLHA 3BSNA 1YI2S 4F04B 1N36F 4TU8A 4I6WA 3Q23A 2MKHA 5ETMA 3CCES 2XLKA 2Y1IA 1NJXA 1RT2A 4QBUA 1TL3A 1LK7A 4BDPA 1I6JA 2ZH5A 3SZ2A 3WC2A 3JSYA 2XYHB 4WU2A 4X66F 1FKPB 1JNZB 2OFGX 2HNZA 5E0OA 2AEJA 3EE3A 3V2UC 1S99A 5KG7A 5B0EA 4ZMMA 3KLGB 1CEZA 4EU0A 1FJCA 4YUDA 4X64F 3A8EA 4O3PA 1YGYA 4CDIA 3EZ5A 3QRPA 4UUWA 2IAJA 5ETRA 3MMBA 1WKLA 3P5TL 2Z4PA 2B9WA 3P45B 1X60A 3ZTQA 2XNRA 1EAYC 3RB4A 2UU9J 3O3LA 4N8NA 2J6UA 3RW7A 4ANDA 1PYOB 2UZAA 5L46A 2LU2A 3IA0A 2MKCA 5KFMA 3OVSA 9RUBA 4Y00A 3K5MA 2KYXA 3TYTA 3BGRA 2VPZB 1UTAA 3I5CA 2FVPA 4B9LA 2DXFA 2PN6A 2R7QA 3EVOA 2K3KA 1KQGB 3PFEA 1VRUA 1Y7PA 3PRDA 2HVZA 3R97A 5I42B 4DV4F 2OPPA 2HNZB 2QLWA 5E3PA 1KEKA 3HFZB 4J9QA 3HHLA 4IR1A 4H4MB 4CNYA 5KFSA 2HIYA 3GYXB 1WDTA 5I3UA 2X1BA 3W60A 4J9RA 1PYSB 3F0NA 3PKYA 2RDIA 1KVIA 4UQGA 2ZHAA 4FNIA 2MKIA 2CNLB 1JLGB 2HNYB 4M5MA 4QJVA 4UOCA 4DX5A 1SIWB 3CJQA 7FDRA 2RRAA 3MEDB 2J0QD 1SI9A 1U1PA 1VJWA 4CRJA 4DPUA 1D8ZA 5AJ3J 4Y0FA 5F8NA 2CJAA 1H2TZ 3M8QB 4WE1B 1X5TA 1SL0A 1O6XA 1RUSA 1XJWB 2FJVA 2O01C 4H4OA 2RILA 2I6WA 2CJYB 2HHWA 3MEKA 5J1PA 3M32B 3L3CA 3RYLA 2FVSA 4FYVB 4M5DB 4P74A 4I4BA 4M5HA 4DR3J 1JJ2R 3TO8A 1HNIA 3KTQA 4WYWA 2DNGA 2VIHA 2JLEA 4IFYA 2PT0A 3CNQP 2LU1A 3GMGA 5ETKA 4DL0C 4XIUA 2I2YA 2PC6A 2CDQA 2CJXB 1DQ9A 2C3YA 2G2ZA 3GYNA 2NXUA 2X1FA 1RP5A 4L76A 2EXUA 4OZJA 5KFCA 4NLXA 1WF1A 5J2MB 1PAUB 3HDSA 3C6UA 5IOLA 3R7SB 3CD0A 4F4ZA 2BANB 4WPAA 2C2MB 3VF0B 5A8WB 4I0WA 3THTA 1O5JA 3NGDA 2J6TA 4J9VA 1I94J 2FHJD 1RT5A 1WEYA 4PUOA 3VVUA 1IBLF 1MW7A 1VOMA 2G0IA 2Y1RI 1L3TA 5DS7A 3NNAA 1S48A 2HFVA 4A48A 3C46A 2XULA 4ERDA 4I69A 1C4AA 1TQLA 1X31C 2MHEA 2JL9A 1TL1A 4L73A 3UDEA 4X4QA 3T5KA 5F0UA 2ILZA 2I9SA 2OLWA 2UU9F 1D9FA 4A8FA 1REGX 2C42A 4WIIA 2D3ZA 1RWNB 5IM0B 1WDDA 1EQMA 2CJ9A 1CJUB 3MMAA 5A0YA 2PI5A 1QE1A 1U1QA 4DCJB 4PG6A 3I9V9 2R2UA 1S77D 3C6UB 2QJ3A 2VG7B 3PFOA 2LQ5A 3CCWA 1JX4A 3A13A 1K47A 2HRTA 2Z58B 3QLHB 4JI8F 3R2CJ 3CJTA 1NPKA 3O6QA 4IO1A 2BMBA 3BO3A 3T1HF 3H4BA 4JI1F 1WUUA 4X4TA 3RUBL 5IXUA 2W2NP 3CCTA 1GFWB 2QL9B 2VBYA 3FFIA 3AA8A 3BZQA 2WOMB 3G96A 2HAFA 2DISA 2XBPA 2WW8A 1NK6A 4TXSA 4IDKB 1VHIA 2C2OB 2PMHA 3GLJA 3KLEB 4LQ3A 2Z56B 4LR8A 3PJWA 3ZC4A 1UVIA 1RBLA 2W8KA 2VA3A 1HWJA 3DRRB 2BOPA 1PSDA 4BS2A 2NZCA 3CW2C 3MPYA 3ZO7A 2KHDA 3FBBA 3X1LB 4CO2A 4B3OB 2VG5A 1VQMS 4PQUA 4LSNB 2JZ5A 3N0VA 2XTJP 1YITS 1NK4A 2BZ2A 5RUBA 5KT4A 2J8SA 3DI6A 4DS4A 1SJFA 1Y10A 1NM2A 1Y4ZB 3H59A 1J5EF 3EGVA 4DV5J 5D3GB 2R7UA 2QG9B 2CDRB 5AXLA 4OYZA 4NMXA 3C14A 3F73A 3IR6B 2K1RB 4NOHA 2W2OP 3N6NA 2HFUA 1LXJA 2WRMA 3DYAA 3LP2B 1JJCB 4LT6A 4CH1A 4WJBA 4DSLA 5GADI 3ENVA 2GHPA 4DL5A 2KVIA 1FESA 3G71S 3I9ZA 1S6OA 3DLKA 4AE5A 2P9CA 3DNCA
chains in the Genus database with same CATH topology
4I2PB 2LQBA 1LOUA 3KFWX 4ZP6A 3SCLE 3DXBA 5EN1A 5H1SV 1X9MA 4PXCA 5KT6A 2C3UA 2BDPA 1X4BA 4XK8C 2G4BA 2W9BB 2VFRA 1VFJA 4DBQA 5KFDA 3CWJA 3QZ8A 1N56A 4B08A 2FGCA 3CDEA 4Q8FA 3KLIA 4Q0BB 3FDSA 3FRYA 3QAUA 4HT5A 4F4KA 3HVRA 3TQ1A 4UY8T 3GE9A 3CD6S 1Q79A 4RW4A 4IH6A 5C24A 4K50A 2XMUA 4QIEA 3BGFA 5GAGU 1DTQB 2QSWA 1TKXB 3DLEA 4OX6A 5IZHA 1TKTB 3QAEA 4CO5A 3KLFA 3TVKA 1TVRA 2M7SA 4AL5A 3DMJB 5IT4A 3NCQA 5EWGA 2L9WA 4RW9B 1S9GB 2ZZNA 3V81B 1D3WA 2RS8A 3WC0A 3NS5A 4A46A 2UP1A 4RW7A 2CQIA 5FD1A 2MQNA 1W25A 1S6QB 3DFEA 1FRJA 4ID5A 2BR0A 1U2FA 4HDHA 3W2WB 2NQPA 4OHYA 3BQ1A 3HXMA 1R8AA 1SQEA 4ID8A 4ZHRA 3PXGa 4RKUC 2KT3A 4ES3A 2AYEA 2BYCA 3AQPA 4J37A 4A8SA 4C7QA 4B3TF 2JVOA 5B0GA 3F56A 4HI2A 1DTQA 2HIQA 1R89A 3C8YA 2BE2A 1YJWS 4LF8F 1YTYA 5HMZA 4GMKA 1RTHA 5F3ZA 3FZBA 3H2VE 3NAHA 4FXWA 3V81A 1IKXB 1RT3A 2CPEA 4A4JA 4NLPA 2B4PA 4OI2A 2V4RA 3MEGB 2Z2LA 4NLTA 1OQ6A 1P8GA 2HHPA 1GXLA 4AQYF 1YJTA 3OFFA 3FRZA 1JWWA 5K14A 2CZVC 4ZP8A 3R5BA 4USIA 3ZZTA 2W9CB 4BC7A 4DL7A 2ZH2A 4J5OA 3CJ5A 3DDNA 4EFAC 4M5DA 1TP7A 3MGJA 3M8RA 3TVYA 2HHTA 2VASA 2E9TA 2YKAA 3CC4S 1Q86T 3ZZOA 1K1SA 5FIIA 2ZZMA 3MUMP 1PGZA 1NEEA 3K5OA 1TL1B 2OIHA 1JB0C 3TOQA 4K2XA 4ECWA 5KFIA 1JIHA 4OX8A 1HQEB 3CEDA 1U45A 4YB1P 3B4MA 2CZ4A 2XMTA 5T7LB 2FLLA 4USJC 3FMBA 2I0XA 2W7OA 2AV5A 3QGGA 1FT8A 3N01A 2QSFA 4U7CA 1S0NA 3M6VA 1HNIB 2DNMA 2IRXA 3BB5A 3EZUA 2DGOA 4EBCA 3MUTP 1NK8A 1X8DA 2C3MA 4NMLA 3VZHA 4YFUA 1QLNA 1RT7A 2HLTA 3T19A 1TKDA 2XNQA 3KK2B 1DRZA 2XS5A 3NMAA 4WF9Q 4LF9F 4FVCA 2XY7A 3HHLD 4DN9A 4Y3CA 2LXIA 3IG1B 1WHVA 3O1LA 1Q7YT 2XSFA 2JEIA 3M8SA 2FIUA 5KT5A 3GB0A 2GIRA 3NNHA 2ASYA 4K4XA 2LMIA 2XG8A 3LGMA 2HLUA 4A8KA 3MM8B 4O3SA 3I0RB 1N32F 2CQBA 1KN6A 1R7IA 2VBXA 2OPSB 2WSFC 5KFKA 1ZTWA 1QSLA 2WONB 2DH9A 2JH3A 2OP5A 2N3LA 5DDOC 1R31A 3VAJA 2KFZA 1KHVA 5CYMA 5D6GA 3CJ0A 3GFYA 2A18A 5M2UA 1IJEB 5KFWA 4MIWA 3UD4P 1URNA 4RNOA 4ZCMA 2V8HA 2BUNA 1I1GA 3D0GE 2CPYA 3VR1A 5D8HB 4QWCA 1V3SA 3BDEA 5GAHU 1HNZF 4I7FB 1NKEA 2CPIA 2YQ3A 3J7A1 5IFMA 2M9KA 2GMJA 3I87A 2FJAB 3OL9A 3S1TA 3H25A 1R8CA 5DRKA 4MYUA 4J9KA 2YNFA 4X2BA 2X51A 4I6AA 1X4EA 4NLYA 3G9CA 3V6DA 3KLEA 4M95A 5E2QA 1G2EA 4ECRA 1LFWA 2OMOA 3HHDA 4KTQA 3BO4A 2EK1A 4C8MA 4X4VA 3Q24A 3Q8PB 4PXBA 4JUZA 4BC9A 3KWMA 2MYFA 1TVRB 2LDYA 2RQKA 4MK9A 5CZXA 3ETOA 3Q22A 3UDCA 4F4XA 2AD9A 3O44A 4MK7A 1U6ZA 1S79A 3ITHA 2QLXA 5J2PB 4B9NA 2DT9A 3BS9A 3OUYA 2PD1A 1UA0A 3F44A 4RUAA 3CUNA 4PCQA 5DGAA 3SSQA 4H4KC 2G0CA 3DOLB 4I2QA 2Q6BA 3O8WA 1BQNA 2YWEA 3N4WA 5EGYA 2IC3B 5AJ3F 3Q8QB 3MDFA 1DURA 3VQSA 4DV2F 5L9XA 4ED2A 5CA5A 2HMIA 5KFYA 1LV5A 1A7GE 3DRSB 5EX3A 4O4GB 2QZ8A 1RYSA 3CCLS 2DVIA 1RI7A 3V4IA 3A1YG 1JLFB 1QUPA 2FDNA 3V6HA 4DL4A 2M70A 2F9DA 4UUXA 3KMSA 1FRKA 3OJUA 1CG2A 3R1LA 1HMVB 2KFNA 2B4OA 2AX0A 1YG0A 2W4DA 4ATNA 3POTA 3EGNA 3F41A 1B0PA 3NG8A 1S7HA 2DNYA 5KG6A 4C3LA 1DBDA 1R0AA 2V8GA 3RRHA 1OWXA 3MAHA 2JFDA 2UVUA 2PI5A 2XS7A 2KT2A 2RU9A 3J7YI 3CCJS 3CCQS 5F8MA 5J2QB 2MGZB 1FE0A 3FEXB 1F2GA 1Z1ZA 5LL6d 5B0CA 2YVSA 4QR2A 3H20A 4DF4A 4OJGA 2ABYA 2R7SA 2R7TA 1FERA 4Z2XA 2VBWA 2CQ3A 4PWDB 2O5DA 3KG0A 2AQ4A 2EW9A 2AYGA 2B9YA 4EGLA 3UDLA 5KFQA 1VRUB 1AUDA 4WE1A 5A8RA 1SKRA 2GA7A 2M8DB 2PDAA 3D1OA 4R8UA 2E9RX 2WCXA 5F8JA 1F5CA 2F40A 4ZPTR 5LXYA 1A6LA 4HL9A 1DHMA 3IN5A 1FJGF 1FE4A 4O4RA 5BR8F 1IKYB 4ES1A 3ONQA 1C2PA 2MGZA 2DHGA 1NZAA 4ZPWR 2ZH3A 1R43A 4L3NA 4DR6F 2YNGA 4OZLA 4DJBA 2CQ2A 2P6TA 1RT7B 1TK0A 3MHYA 2RKIA 4QIVA 2KXHA 1QM9A 2GQQA 1REVA 4AXJA 1OQ3A 2DHSA 5DGBA 3MURP 2ZH7A 1GX6A 4MMOA 3KOAA 5DQGA 1U24A 4U6PA 1GNKA 3TX8A 2VUGA 2UXCF 2VH7A 4GKKF 3MTKA 2WONA 4EBEA 4JBCA 3GSDA 1DJ0A 1MMNA 1T3OA 3IWLA 3S6EA 4DV3F 2V9KA 5GMKa 4DR1F 3OTDA 1B64A 1EP4B 3US5A 5KFJA 3KG1A 3M2RA 1O51A 4C8OA 2KM8C 4YP3A 3GFHA 2B56A 3T5HA 3EXCX 2VG5B 2HHXA 1VQSA 2W25A 2LCWA 4DFPA 2UUTA 3JTNA 1WHYA 4WFAQ 1FNXH 4LF4F 4DHVA 4WZMA 2B7CB 1DZ5A 2JX2A 7FD1A 3MUVP 1KLNA 5IQ6A 3DLLQ 3I32A 3G8SA 2J6SA 3GFZA 4FZVA 1MNEA 3N28A 1FVQA 4K59A 1M90T 3PV8A 4ZP7A 4N41A 1R27B 2R4FA 4HT7A 1P6TA 1FDNA 2CPJA 1QSYA 1ZZFA 3FJ2A 3CVKA 5GAEI 4I2PA 4RBUA 4DL2A 5KFOA 4NA2A 1NJYA 1KVJA 1KFDA 1M5SA 4F50A 3QIPA 2B5JB 2LQ9A 2OSRA 4YDDB 1LW2B 3M05A 1S49A 3OXGA 2GCFA 1U49A 3R5CA 1N52B 4DEZA 1UJ5A 4ZKAA 2DCLA 5KG2A 5DQIA 3ISZA 3PW5A 2B7BB 3I82A 4C9DA 4A8QA 4UQTA 3S8SA 4YB5A 4IQXA 2N4CA 1U8SA 3MPVA 3KHLA 2ZVSA 3VAHA 1DQAA 1WD6A 2MB0B 1HQUB 4B17A 3OSNA 2C3OA 3RB6A 4DSIA 1V6HA 1FJEB 2E5JA 5AE2A 5KFFA 1IJFB 4OI0A 4O4GA 2CPFA 3NBPA 3CJ3A 4LFBF 2LEAA 4IRCA 4B02A 3CULA 3TI0A 3QJPA 2XMMA 1S1WB 4YB7A 4WFXA 4XO0A 4IR9A 2YH1A 2IJFA 3FVYA 2D1CA 2ROGA 2CQ0A 2R7RA 4KSEB 2W8LA 1Y00A 2OFHX 1S1UB 2PE8A 1IKWA 1FTCA 4PG7A 4B9VA 2P5VA 4KAIA 2JFKA 4Y65A 2RUGA 4CH7A 4F3MA 5F9LA 3MR6A 3RZAA 1VBYA 1S6PB 1R0AB 2AYMA 5CYMB 1HBUA 4C8NA 3CCVS 4RW7B 2G9OA 1D8YA 4LIWA 3M9OB 2RVJA 2WBMA 4RW4B 2DGQA 2AYBA 2IVMA 2IYGA 3DRRA 4FF2A 5L1LA 2QMXA 5H9FJ 5HROB 2FHMA 1S1XA 2FC9A 4K4UA 3CE8A 1TKTA 1S6UA 2B6AB 4KHMA 3KLFB 1S72S 4HKQA 1TL5A 4IH5A 2RE1A 3LPYA 2K3IA 3IS9A 4B9MA 4NCBA 3DLGB 2W9CA 2JRSA 1JXEA 1MU2A 2HWHA 3I0SB 1FDAA 4IFVB 3SSRA 1S0MA 1B0VA 4AUKA 3K0JA 3MPWA 5AE1A 4DQSA 4IYQA 2OD4A 1FRXA 1S4FA 1N5VA 4NLVA 4IG3A 3ZZPA 2M2BA 5F8LA 2BE2B 3VAIA 4F67A 4D3HA 3LALA 2LXUA 3H5YA 4DS5A 1KC8T 5FDLA 1N8RT 5GAHI 2KI2A 1KLMB 1LK5A 2RF2A 4I68A 4OZ0A 5KFNA 2JHEA 4K4WA 5D4LA 2C22A 5GVQA 4ZK7M 2B4UA 4QU7A 4AFFA 1UAWA 2PSZA 2CG4A 3MEDA 2NPIA 4N5SA 2PO4A 5BYRA 4I1TA 1TAQA 2UUWA 2GGPB 5A2QY 1KNZA 4KKOB 1XWLA 2BJEA 2OPQA 3CT9A 3OTBA 3C6TB 4GO5X 2AWZA 3BGUA 4QPTA 3ULHA 3TUJC 2CQCA 1HI0P 2NS1B 2C2RA 1S9GA 2DTJA 2POKA 2J9CA 2F8EX 2MQMA 4CT8A 3FGVA 2KH9A 4PXDA 1SBRA 4QWAA 1E6VB 2GNKA 2DITA 3CIMA 4LIRA 2FLPA 3KNAA 1S6QA 1VIXA 2BRLA 2ZOMA 5E3CA 3WX4A 4B3SF 4B9UA 4QZVB 1FDBA 2VG6B 1E6YA 2CIMA 1EETA 1HARA 1NO8A 3CDBA 3IGVA 2KYZA 4I6YA 4OI3A 4OHZA 2R8IA 3EXYA 1MWZA 5B0DA 3QZ7A 4MFBB 1H2UX 4B3RF 5E3RA 2WAQD 3C6TA 1RJJA 4NX9A 3HP6A 1YRTA 2X1GA 3NKYA 1RT5B 4JI7F 4PUOB 4JI2F 2ZE2B 3DLJA 3H8YA 4I7FA 2Q66A 1LWFB 4C8YA 2ZFHA 2MDAA 1YVFA 2H5EA 1NHVA 2CVEA 4QR0A 1FJ7A 2O3DA 4N47A 4TU9A 1SUQA 4JV1A 3JAMY 3IG1A 1ZPWX 2OTJS 3CDUA 4ILRA 4OX7A 1SC6A 1LWEA 4ZVFA 4WTYA 1SL2A 1UJ6A 3NCPA 4XAKA 2HVIA 1C1CA 4QW9A 2LQJA 4LQ9A 4C2MA 2E66A 4YHHF 3I5AA 5K5MA 1WACA 5LXRA 2OJ3A 1CVJA 3ENQA 4Y2IA 1F0XA 5J2NA 5G0RB 4NZ6A 2FY1A 5HO4A 2RJZA 3FFIB 2GMLA 4HHJA 3MMCB 1JNRB 2IYIA 1TK5A 4IDKA 5BYSA 5J2PA 1JLAA 4ETZA 4TYAA 4KFBA 3OXFA 2DGSA 2GQCA 2B0GA 4JV5F 4A8MP 2OMLA 3CF5Q 3OFEA 4DDFA 4URQU 3HVTA 1JJ4A 1ZZNA 1Q81T 1VIOA 4QIWD 3CXCR 1L3VA 1VQLS 3CJKA 4TQRA 5CQGA 1ZETA 3ISND 2RRNA 3DU5A 1WEXA 3I55S 3I5BA 2MZQA 5CCLA 2OPRB 3HZGA 1RGVA 3UR3C 5IT9Y 1ZAWA 3OVAA 4GO7X 1SKSA 4F3OA 2CRLA 4WXOA 1C0UB 3PW2A 1DTTB 4CZCA 3LP1A 3E2EA 3M2RB 1RK8A 1WHXA 1Y9OA 4C4WA 1RYRA 2J76E 1BQNB 1LW0B 2HFOA 2GJ2A 3FNNA 5HP1B 2HW3A 3G86A 4DUZF 3EGZA 3PIOQ 2HMIB 3BREA 4A47A 3MD3A 1S6PA 3DLGA 1UETA 1QSSA 5GADU 5LT5A 3Q8RB 3E01A 3IR5B 1Q7LB 1M5HA 4RLEA 3U1NA 2XGQA 5A6PA 4W92B 2V2KA 4FBUA 3HLUA 2N7CA 5HROA 1YRUA 1TV6B 2EFOA 2CJKA 1DLOA 3HMJG 3T9ZA 4YB6A 5LMUF 5L8RC 4DR3F 5E33A 5EWEA 1FKAF 4KJIA 1GAOA 1LW0A 4C3KA 3T1YF 3C2PA 2RH3A 5THWA 4N77A 5CH7B 4XPCA 1WTBA 3GFXA 2YKNB 3VZIA 1SIZA 3V4IB 5HMWA 2KJVA 4BBYA 1VHFA 2YNFB 4DLGA 1XERA 3ISNC 3MR3A 4K5RA 2R9LA 3N9UC 1XBWA 2V8VA 4HTIA 3U27A 3TR5A 2YWGA 3DM2A 2CQGA 4KB7A 2ZH9A 1H38A 4ICLA 3ENWA 3LGNA 2BABA 3SCJE 4ZCIA 5T14A 2AJQA 3M1VB 3P96A 4J9OA 2XB2D 4NYOA 1DLOB 2PMZD 3LWLA 2I38A 3KLGA 1JLQA 2IM0A 2IRUA 3IGNA 3OQ2A 3W3SA 3OXLA 4HLBA 5CYQB 2CFXA 1KONA 2DNRA 2VKZG 3RRKA 5E41A 1XK8A 3DOKA 5KG5A 1ROFA 4TY9A 5C25B 2DNLA 2E5LF 2R8KA 3ICLA 3LO3A 1CQMA 2GGPA 4O44B 3UCZP 3PDNA 4X62F 1S10A 4KGKA 3KJVB 3BEGB 4ELUA 4N8OA 2RKIB 4FPRA 1BGXT 3KNGA 3N6LA 3LWMA 2ZUGA 4HTJA 1HPZB 2YX7A 4NLOA 1T05A 1Q82T 4LF5F 2VPYB 1HBOB 2M8HA 3PO4A 2AU0A 3I4HX 1VRTB 1T95A 4Y34A 1HWKA 1FXDA 3SFGA 2ZJPQ 1ZAXA 3PZPA 1S1XB 1J5OA 2EG1A 3M2UA 5L1IA 2YKQA 2D74B 2J9DA 2HAIA 1LWCB 1T8EA 4OFZA 1KS2A 1K1QA 5CD4H 2ZH8A 2DO4A 1U09A 2HGNA 2WSEC 3TA2A 3RB0A 4NWBA 4ZPCA 4BWMA 3K59A 2X1AA 2DNQA 5CHCB 3SEOA 2XS2A 3IWXA 1SB6A 1OPZA 4Q45A 3JB9k 1AW0A 2JC0A 4OV1A 3U1LA 5LJ5Y 2HS0A 1IQTA 4IG3B 4PWUA 2YWHA 1T03B 4TQSA 2IM1A 4ED6A 2E5HA 2M4MA 1V3ZA