3OFFA

Structured domain of drosophila melanogaster boca p65 2 2 crystal form
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
MKKGRTLMTFVSVTGNPTREESDTITKLWQTSLWNNHIQAERYMVDDNRAIFLFKDGTQAWDAKDFLIEQERCKGVTIENKEYPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LDLR chaperone boca
publication title Structural Characterization of the Boca/Mesd Maturation Factors for LDL-Receptor-Type beta-Propeller Domains
rcsb
source organism Drosophila melanogaster
molecule tags Chaperone
total genus 25
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2010-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3offA00
3OFHA 2QRRA 2H9ZA 3U7JA 3ENVA 3N0VA 1UJ6A 1LKZA 2CDQA 2P9GA 1KS2A 3AAWB 5T41A 2RQMA 2QMWA 3AB4B 2PA3A 1LK5A 2MDAA 3O1LA 2RQKA 3DDNA 2JHEA 1YGYA 3IXQA 3L7OA 3OFEA 3S1TA 4LUBA 1ZPVA 1M0SA 2J0WA 3MWBA 1UJ5A 4GO7X 3MAHA 1Y7PA 1UJ4A 3CEDA 4M8LA 1RWUA 5IS2A 3W7BA 2JOQA 3P96A 3OBIA 1YBAA 3AB2B 4IO1A 3MTJA 3UW1A 2DT9A 3ENWA 5IT0A 4PWUA 4GO5X 3DC2A 1SC6A 2ZHOA 2KO1A 3TUJC 1LK7A 4NMLA 2LVWA 1U8SA 2J0XA 3HHEA 3OFGA 2NYIA 5IT4A 3TUIC 3DHWC 5FIIA 2I9SA 2P9CA 3KWMA 3OFFA 2LQJA 2DTJA 3NRBA 5JJBA 2PC6A 3LUYA 4GMKA 2P9EA 1XTZA 1PSDA 3K5PA 2F8MA 2RE1A 2QMXA 2F1FA 3IBWA 2QSWA 3TUZC 1O8BA 3DHXA 2FGCA 4X84A 3ENQA 3LOUA
chains in the Genus database with same CATH superfamily
2RILA 3ZZZA 1S9GA 4ZHRB 4DR1F 3DM2B 2HVIA 2BJ3A 1HFEL 3I96A 2AYEA 4K0KJ 1PC5A 1T94A 2YWHA 3LP2B 4CI0B 2VQEJ 2VIHA 1IKWA 2E9TA 1O0PA 3UPFA 2KDOA 2NSCA 2ZH3A 1KOOA 2ZHAA 4OYAA 2BVZA 4HI1A 3Q8QB 3G6VA 5IT0A 1U1RA 2HHPA 2DR8A 2D9OA 4C3LA 4H4OB 4C0BA 3DGPB 1I3OB 2YNIB 4OIXA 4OYXA 4DR7F 1R27B 1FWKA 4FYWB 1T03A 3DFEA 1TKDA 4O23A 2XQCA 2IYIA 5LMUF 4NMXA 4J9SA 3J81Y 5HROB 2MZSA 1WSRA 1S49A 1Y4ZB 2BJ7A 3SFGA 4LREA 2B8QA 1OJ4A 3I9ZA 4NLVA 3MPUB 3CDUA 5HVHA 4WFAQ 5F3ZA 3DNCA 5A0YA 1YGYA 2E44A 1RT2B 4HACA 4CQ1A 3CJ3A 3TAPA 3KK3A 1WWHA 2Y1RI 3MWBA 1KQKA 5D4OA 2BMBA 2ZE2A 2XHWA 4OYWA 1Y5IB 3CCES 3PKYA 4E98A 3H7HB 3G82B 2J0QD 4W98A 3C3LA 2VPYB 3MR2A 1KLMA 1SL1A 4ER8A 2O66A 1QM9A 3HHLB 5A8WA 1SUQA 4O4GB 3KLEB 2PMHA 4DLEA 3BB5A 4QW8A 4PKDB 4DPWA 3KK1B 2HAFA 2HRUA 1IBCB 2R2SA 2LQJA 3HHLD 3KLHB 2ZOMA 1WG1A 3U1MA 1F5BA 2OKQA 5AJ3F 2EVZA 4B9NA 1B64A 2DXEA 5KG3A 1VQKS 4HYKA 2K1RA 3QRPA 3IM9A 3IRXB 4V19X 3MM5B 3D6FB 2G13A 3VQSA 4OHVA 1ZZNA 2BABA 1FX4A 2DHHA 5D3GA 3HHDA 1TKTA 3OL6A 1S6UA 1RACB 3I87A 3J7A1 3CO9A 1YBUA 3QFWA 4FF1A 2EK6A 4K2JA 2PD1A 3LPYA 1UJ4A 4KIAA 4LFBF 1Q5VA 5HJYA 2OH2A 1IQZA 3NP5A 4TLQA 5FLXY 4N5SA 1SC6A 3ETOA 3CMES 4JV2A 4TU9A 3UN5A 1URNA 4LR8A 3N6LA 4FS1A 4Y28C 1HBOA 2P6SA 1F9HA 2J9DE 2P9EA 4DU7A 4OI1A 3P5TL 3CIZA 1WF0A 3RBZA 4WU3A 4F0KA 2QA1A 3UR0A 2PSZA 3MCNA 2V4QA 4PWDB 4YFUA 3NY0A 1T11A 5F9LA 2KN4A 2YNGA 4ECVA 1FE0A 2CRLA 2VASA 3V4IA 1LV5A 1FRKA 4DJBA 3PRDA 2NR0A 2H65B 1RHRB 1HD0A 1NSQA 3ETMA 2UV8A 1LXJA 2V0NA 4XPCA 2VFSA 4F3QA 1NSKL 4ED3A 1YJ7A 2LA4A 2QEXS 2FIUA 5GMEA 8RUCA 1QAYA 3KLGA 1YLXA 2Q79A 3WBZA 3TA0A 3FZBA 2FVQA 3M2RA 1QTMA 1PYTA 1UKUA 3M2VA 4YB1P 2UUAF 5K8MA 2VPZB 3RB3A 2HBYB 1VQLS 3M2UB 3LGNA 4QPXA 4ZVQB 2XMAA 1FK9B 5CYMA 3FQKA 3QATA 2J6UA 4RUBA 2R2UA 2Q3PA 5KFMA 1N54B 3PJXA 1HR0J 4QIFA 3PYEA 4UQGA 4PXDA 4IRKA 2Y0SD 1AT1B 4DV5F 3TEHB 2HIYA 4JI7F 4N8OA 1SPBP 3D1QA 3C15B 1JLQA 3RG6A 3J81j 3MR3A 3MM8B 1XMOJ 2JL9A 1H38A 4QWBA 3VVTA 2UV8G 2DHAA 1UZDA 4BWMA 3PIOQ 3AT1B 3PYDA 3FDSA 5KG4A 3RRHA 3ZZOA 2MKIA 4QJVA 1EZZB 4IH5A 1WELA 3L7OA 6FD1A 1GEHA 2RDJA 3BSNA 2YKNB 1U0HB 1VRUA 1NK5A 4DX8H 4AD6A 4X4NA 3I4PA 1AFIA 3CEDA 1OWXA 3HZGA 2VICA 2CIMA 3M32A 1FD8A 1V5VA 4TU8A 3NNCA 1SV5B 1X7VA 4DFMA 2HS0A 3W2WB 1MWYA 4NMLA 2DEJA 5THWA 4ED7A 1KR4A 3TJ8A 1S1UA 2JFKA 1U6ZA 3I0SA 3R6GB 1S0NA 3D0GE 3I5CA 2CZ9A 1UW4A 1S1TB 5C25B 1WI8A 5AE1A 2OD6A 3R7NB 4ZCLA 2DGQA 2E7WA 2EG2A 1ROFA 2QLFB 2QLXA 5T14A 1HWUA 3ILOA 2DGTA 3LWLA 2NYHA 2XYPB 4MJKA 3TZXA 3MD3A 4C8OA 2MJNA 4H54A 5CD4H 4DV0F 3H5YA 4Q0BA 3MEEA 4P2FA 4J5OA 4R0JA 4I6YA 1FJEB 1OPIA 4I1TA 2HWTA 1IKXB 2H5JB 2ZVSA 4F4WA 4MK8A 3G86A 4NZ0A 4X64J 2WHOA 1RWUA 3TNVA 1RAFB 1TUVA 3X1LB 3HT3A 1CJVB 4DL6A 3ISND 1RBLA 3TX8A 1S6QA 4PCQA 4ZP8A 1T9VA 1RBAA 2LDIA 2OAUA 4I64A 3GYGA 2W4DA 2NUUG 5CQGA 3D67A 1NB2A 4X65F 4C11B 5B0CA 2HWIA 1ITPA 2KTQA 1OQ3A 2B8PA 2Z0GA 2N7YA 2BQ3A 1WC1A 1X5SA 3AXMA 1SKUB 1NJYA 4I6WA 4KT0C 1CJUB 2AEFA 4GKJF 3GE9A 1FO1A 3MM7A 3I0RB 3M6XA 3ZNJ1 2OO4A 3ENQA 4IOCQ 3H2UB 2C3YA 1BQNB 1BY9A 1RWKB 2QRRA 2VHGA 2EC0A 3GB0A 1BWEA 1EQMA 1QE1B 1U4BA 2O3DA 5J2PB 3NL0A 2YPYA 4L76A 2ZKUA 5KFWA 3PO4A 2YKMB 4F02A 2B3TB 3PJ9A 3ZTRA 3BBFA 4Y2MA 2MZJA 1EETA 3B78A 2AGPA 5IZHA 1TMMA 1VC5A 2HG4A 4Y2CA 4MKYA 1FNXH 1YRTA 4H4MA 1WG4A 3G8QA 3T6JA 4WYWA 2U1AA 2ASDA 5E5NA 2HPUA 3N01A 1YBAA 4Y65A 4KGMA 2DB1A 1VQ8S 4H4KA 3UI3A 3TUJC 4MYUA 4ICLB 3O8WA 1NEEA 4MIBA 1OYDA 3IFEA 4WZQA 3G6YA 3EMTA 1B99A 5HBMB 3NGRA 1V3ZA 3OJSA 1IXKA 1T3OA 5GAGU 2ZH2A 1ZAXA 5L46A 5KAKA 2AMCB 2DH8A 4QIWD 3KLIB 4JI8F 2LQ9A 3ELHA 1GX6A 4PABA 3FQLA 2YY3A 1HI1A 2JLEA 5L9NA 4DSLA 2HHXA 8AT1B 1VC6A 3CDBA 4ZCKA 1U24A 3DLGB 3OTOJ 3M1VA 1KONA 3DCAA 4J9NA 4B3SF 4DV2F 2VPWB 4WU2A 1Q86T 2CPZA 4BS2A 2U2FA 1IUJA 1WJ9A 2M2BA 3NNHA 3W61A 1WEZA 3TOQA 4C8ZA 1S57A 1IR0A 1XMBA 2GHPA 2NYIA 3VGUA 4OZ0A 3BGRB 3F41A 3M4XA 4F2RA 4LF4J 1OSDA 2YWKA 1UVKA 2F4FA 2WOMA 4J9VA 3V6DB 1VQSA 5C42B 4EMDA 2B0GA 5LMNF 4ANEA 3UCZP 2V8DA 2CQ3A 4KHMA 3PVXA 3U7JA 4MKVA 3KUEA 4V1Ak 4LBIA 2MQOA 4HH0A 1EP4A 4DV3F 4ZMMA 3DDNA 1BQMA 1WHWA 4ED1A 4CTAB 3FMBA 2AD9A 2MSSA 3R2DJ 1RDRA 1KP6A 1NJWA 1SL0A 1NK6A 4FYXB 4CZCA 3EGNA 2VDHA 4MKBA 1FKOA 1UJ5A 1Y7PA 2AHOB 2IAJB 2CPIA 3JSRA 2MQNA 4DF4A 1SB6A 2IDLA 2AYMA 2XMUA 4KY3A 3DGVA 2CWKA 3KDOA 2HHTA 4IQMA 5LMUJ 3IMQJ 1SBRA 2M5YA 1S7HA 3I82A 3M8QA 1R0BG 1VI7A 4PG5A 1XIQA 2VKRA 2QGFB 2HW3A 2BM0A 2GFFA 3IBWA 4LSNA 3US5A 1N36F 2VQFF 5DM6Q 3QWPA 4X4VA 1KNZA 1ZM4A 3C8YA 2R7VA 3SDEB 4WK1A 3HJFA 2XMWA 2BE2B 1KOHA 3RB6A 3AH6A 3G8SA 3ZZTA 4IRDA 2B9EA 1NDLA 1S10A 2FVCA 1Y3KA 3D3BJ 5IV4A 4LBPA 3DOKA 4JV1A 2IA0A 2OMLA 4RNHA 3S1TA 3OXFA 1CJTA 4B3MF 4J9QA 4M5KA 2KZMA 3LP1B 1JLEA 3PYFA 4K4YA 4HH1A 4DQQA 2BRLA 5EWFA 1EKRA 5EWEA 5I4MA 3RBDA 4ID5B 5DGAA 2KHCA 2B5JB 1FRMA 4K4VA 2YVSA 5DDRC 1RT4A 3LWMA 2V63A 2UU9F 4NLQA 2RDIA 3CJ4A 2IM2A 7AT1B 5JUMA 2AJFE 1RTIA 1HPZB 4ED8A 2OP5A 4IG3B 1JLBA 1IR2A 1X4HA 4Y00A 5F8GA 2FC9A 2HQ3A 1EB0A 4UY85 2GV1A 1PIEA 2B4OA 1E6YA 1CJKA 5F8IA 4GVLA 3OFHA 4O44B 2QE5A 3N0VA 4P7TA 1S1WB 4C3MA 3M6UA 1FRHA 1W7WA 2ZOFA 4QZVB 4F36A 4W90B 2KZZA 1WC4A 3HJVA 2ZBIA 1HMVB 2KYXA 1O6XA 3EVWA 2FLOA 4I69A 3KFWX 3GFZA 4LFBJ 2RDDA 3K17A 1KHWA 2EFGA 1AFJA 2IDEA 4X4PA 4J9LA 2LYVA 5MAOA 2GVZB 1UEUA 4WP3A 5DM7Q 3SQGA 1DLOA 2J8AA 2VL1A 2QL7B 3CB4A 1I1GA 3MCMA 2CVIA 4KKOA 1T9YA 1TKXA 2B7CB 3ULHA 5KG6A 1HD1A 3UD3P 4MTPA 1WOOA 2BKOA 3OL9A 9ATCB 2CKWA 2L3MA 1RA6A 1RK8A 2K06A 1WSVA 4OX6A 3RAXA 3W5YA 3BGUA 4TLRA 1VQPS 2CAJA 2V34A 4F3MA 3MUMP 2Q6BA 2BUNA 4NRUA 2G9OA 1FEHA 2CQHA 3A3OB 4KGZB 2YKAA 3IGNA 4DDFA 4EYIB 1UL3A 2CNNB 2RKIA 2Z2YB 2WB4A 3RUBL 3WZ0A 1J27A 1Q95G 2HMIB 3K59A 1K1SA 5M2RA 2HZVA 2BZ2A 3R5BA 4WJBA 2CQIA 4ZVFA 2MKJA 1T9UA 5J2MB 3L3CA 3IBFB 2FHJA 4RNOA 1KTQA 4M95A 4LJMA 1S1XA 1TL4A 3H25A 4UOGA 3JTOA 1B70B 4OZ3A 4PPZA 2GQ2A 2KRBA 4I68A 3N5FA 3TEGA 1WNEA 2UUCF 3AD7C 2IRYA 4ZP7A 2E7VA 2DXFA 3HKZD 2C3UA 4FF3A 1NPPA 2ZUAA 2KB2A 4KH0B 1RWWB 2FJXA 3R9LA 1BE4A 2ZH7A 2G1DA 1ICEB 2RU9A 3G87A 4KV8A 3K57A 2DR7A 4P6QA 1TUGB 4Y2KA 5KFLA 3PDNA 1N34F 5LSOA 4XO0A 3CCTA 3GJQB 1HWKA 2YKPA 3DRPB 3Q2SC 4YB7A 1S9GB 3H5SA 4OYBA 1H3DA 4DMZA 3DLEB 2QLJB 4ES1A 1WKLA 4KH1B 4NCGA 4GKKF 3B82A 4XDDA 3ZO7A 4URSA 1FXLA 1YVFA 5HMWA 7FDRA 5K5MA 2R7WA 2M9KA 3PXGa 4YQWA 2W9BA 1ZTWA 5A2QY 1XNRJ 3MAQA 3BR9A 2BKPA 5J2QB 3PACA 2I0XA 4M63A 1AYEA 4DCJB 3DLKB 1YJTA 4CLLA 2BRKA 1YX2A 2CQ4A 4I2PB 4DV1J 2HZAA 4RW9B 1TAUA 4LR9A 4DFPA 3OUYA 2ZDPA 1FKAF 4DV7F 1C1BA 4DV0J 4I2QB 1X60A 4ECSA 3AJ1A 3QT7A 4KO0A 1QSYA 3FEZA 2WTFA 1ZA1B 2XYHB 2BA9A 4FYYB 2ADBA 1C0TA 3CJSA 4LIRA 3VQTA 3W9IA 4QPTA 3AQPA 4ZKAA 3E01B 3ET6B 3U02A 1N5SA 2ZKTA 5A0YB 1UP1A 5HQMA 3QGGA 4C9DA 3FBCA 2ZBCA 2Y9HA 2QYCA 4F04B 4DFKA 4U7UD 3C6TB 3TR5A 5EUHA 1F9FA 4JI3F 5F8MA 3IR5B 2GHWA 3KTQA 1QVGR 4X65J 3HHEA 3AJDA 5DETA 1CULA 2VV5A 1SUQB 2BW7A 1WC0A 4UY8T 1FNOA 1OMSA 1F9EB 1U09A 2DGXA 3AD8C 2F1FA 3Q8PB 4YP3A 4LF2A 1RU2A 1Q81T 1U48A 1Q82T 1NHVA 1CBKA 4Z2XA 3Q0AA 1FKPA 5T7LB 4TU7A 3GR0A 4DR4F 5KT3A 2XY6A 3BKTA 4NEZA 3Q8UA 3QGHA 3POTA 4ECZA 3HZEA 2W7OA 3O2IA 1VMBA 2K7JA 4QYRA 2P5VA 5HMZA 5ETRA 1Q53A 2Q43A 1U1LA 3HSGA 1VR6A 5D3GB 1HQUB 4NI2A 1VIXA 3OR2A 3U1NA 1IJFB 2VONA 4NLDA 4C3KA 2ALZA 1NKBA 3CWJA 4U8VA 2XGPA 4K2XA 1ZM2A 1DQ9A 3DM2A 3T41A 1HNXF 3BS9A 2SXLA 1RWNB 2E1MC 3CCQS 1BGXT 1NZ8A 3LP2A 3GWCA 1FEEA 3MM6A 1QVFR 2DNQA 4ZCIA 4NYZA 3MMBB 5IT9Y 4MIAA 3KHHA 2C3MA 4MMOA 3HXMA 3UN2A 2QX0A 2MZRA 2RQ4A 4PAAA 3H4DA 4WYLA 2ZH9A 4NLSA 1N5QA 2DH7A 2R2TA 1FRXA 2WSFC 2IYGA 4H4OA 5L1KA 5D77A 4DUZF 2AT1B 4CDIA 1JXVA 1S9EB 3DGPA 1NHKL 2YNIA 3Q24A 3OVAA 4HT5A 2MZQA 4BDPA 1U26A 3OXGA 5H9FJ 1W26A 3M30B 1H2UX 3QZ8A 4Q43A 3M8ZA 3HVTB 2M3DA 3WIVA 3F0NA 1HWJA 3GZ7A 3H5UA 5HP1B 1UEKA 2D1CA 1Q0NA 3V6JA 2WSEC 1ZYQA 4K7QA 3OHAA 3OBIA 4JI6J 2HWHA 4FXWA 1I5OB 3ENWA 3UD5A 2AIRB 2GX8A 3U27A 4OYPA 2BJDA 3O3LA 2JVOA 4A8KA 1UA0A 2BE9B 4KBIA 5DLFA 4PQUB 1NMEB 3Q83A 1PYSB 1YK9A 4FKXA 2YQ0A 4J9MA 2IC3B 2EK1A 4DSIA 4FP9A 2CYYA 1D9AA 3C46A 4CO4A 1IBLJ 3EGZA 2XZTB 1PGZA 4FPRA 3BYRA 1GMWA 2GIQA 1O8BA 1SH3A 1TL1B 1FX2A 3G82A 2V50A 1GXLA 2KM8C 1UJ6A 1BUXA 1S4FA 2QO3A 2VH7A 4FN5A 2E1PA 4O4GA 3KLEA 2W7AA 1BXNA 1RT7B 3K8WA 2RQCA 2C3OA 4LMZA 1VQ4S 1AB8A 3KK1A 3MDFA 3TVKA 3BYPA 3Q8SB 3K2YA 1M0SA 2BXJA 1XR7A 3KLHA 4DSEA 1VBXA 8ATCB 3RYLA 3PR5B 5KFAA 2JLFA 3ZTQA 3TARA 2CFXA 4ETXA 3QAUA 4M5NA 2WAQD 3IRXA 2OIHA 3CF5Q 3MM5A 3GTYX 3FCWA 2XO7A 4DR5J 2HGNA 3GCWP 3CXCR 3FVYA 1O51A 1TK0A 2HHVA 2F8HA 2JVRA 1N36J 2VQFJ 2WRMA 2IY5B 1RHKB 2BKNA 3MPYA 2C2MB 4WIQA 4JOUA 4UUWA 3J7YU 2BACA 1IBKF 5SUHA 4YUDA 2AX1A 5ETNA 2G1HA 2GAGC 2B9WA 1L3UA 4HHHA 2VBYA 2Q1LA 1RWVB 3GIJA 5IV3A 2GMJA 4B3MJ 3FFIB 4LQ9A 4EI2A 2K8GA 1T95A 1TR0A 4O3QA 3KHGA 1E6VB 1JJ2R 4I0WA 3MEEB 2HHWA 4J9PA 4DR3F 1QDUB 2GNKA 2FQQB 1S97A 1F3FA 4DL5A 4PWDA 2B43A 3VGSA 2IPOB 2MKCA 2L9NA 2FGOA 2UP1A 2W9CA 4DN9A 5JVGQ 1HL6A 3L09A 1FCAA 2YWEA 4ITSA 2RAQA 5BR8J 3A12A 5HQLA 3HF5A 2ZZNA 3SQOP 5I3PA 3N5BA 4K8RA 3NGTA 1RBOB 2ZD1B 1GH8A 3ZZYA 3BGLA 3MM7B 2ZWPA 2RVJA 3R1LA 1JK9B 2E5IA 1FK9A 3VHQA 4DQSA 5M2UA 4DBQA 4N8NA 2BJ9A 4DR6J 1JX4A 2HBQB 3BBCA 3CD6S 4J9UE 1NRKA 3CD5A 1Z2LA 2APOA 4JI0J 3IAM9 1QJHA 4WBFA 4OJGA 1VRTB 2MSTA 1KFSA 5D6GA 3C15A 1MMDA 3MM8A 3KJQB 1ZAVA 1UEVA 2MXYA 1W2BR 4OI6A 2F9JA 3RU0A 1U25A 1HW9A 3QQCD 2J5AA 5KFIA 3SCLE 2PIIA 2YKNA 5LJ5Y 1V3RA 1U0HA 4IH6A 2A2DA 2XWYA 2P2CB 1JIHA 2J76E 4F4XA 2YWFA 2OPPB 2UUWA 4PXCA 2V2KA 2VQEF 2QLBB 1SV5A 3H2LA 2G2OA 3W2WA 1MWQA 5B0DA 4ZVSB 4AQYF 3GCXP 2XMVA 1S6OA 4NXMJ 1CC7A 3VZIA 2KHDA 1R31A 3QO9B 3TAMB 1AXQA 2EXUA 3HMJG 2R8JA 1S1TA 5C25A 2NQPA 2XMMA 3W9JA 4DSJA 4OYMA 3BQ2A 2QT7A 2DT9A 1XJWB 4PWUA 2HGMA 1B4SA 2V2ZA 1T9TA 2UUCJ 4USKA 2K2PA 1SVDA 1DTQA 5FIIA 1RAAB 4RUHA 4P2XA 4F7VA 5EGYA 2DNHA 2OSRA 3KNGA 2R7QA 1LEOA 2OTLS 1FDBA 1S12A 3CDEA 3HSJA 1IKXA 3OR1B 1EARA 4ZPBA 4U96A 1N34J 2WBMA 2M4MA 2DH9A 2NPFA 1CJVA 2I6WA 4ED0A 1FF2A 1SJQA 3IP0A 2QMWA 4CLKA 3FK4A 4J9RA 4LF6J 2E29A 2JWNA 1KSPA 1NPRA 5AT1B 3AXKA 4C11A 2KT3A 1NXIA 2DGOA 5KFOA 1IR1A 4GKKJ 2CPXA 3J81U 3QYYA 1CJUA 4B3TJ 4FVMA 4DZDA 3I0RA 2I5JB 2NS1B 5IXUA 4YEAA 4K50A 3TQ1A 1BQNA 5H9FK 4OFZA 3UFCX 2DHGA 1QE1A 1QAXA 5J2PA 1J5OB 2HURA 1WHVA 2E5HA 2YKMA 3CW2C 3MR5A 5E3AA 2DR6A 2RE1A 4F2SA 5F8JA 2F63A 1J2VA 3CMAS 1TFWA 4DV7J 1X5PA 2FJBB 4OX9F 1VCTA 1Q7LB 3AODA 1Y0HA 4ICLA 5G0RB 2BV3A 1TK5A 4WXWA 5GAGI 5ETVA 3QZ7A 3KK2B 2RUGA 1ZPVA 1UETA 2ZM6J 2BW2A 3MXHP 2QG9B 1RLDA 5HBMA 4B9LA 4BC7A 2JC1A 3W5ZA 2J7KA 1VIOA 1P6TA 1M5KC 3BSOA 5HAOA 3SFUA 4RJVA 4G3IA 3JTPA 4ZJLA 3H42A 2QN6B 3P49B 2RRBA 3A8KA 4OL8A 3KLIA 4ZLNA 2EPIA 4OHXA 3NEKA 1O5JA 3MM9B 2L08A 3KOAA 1R0AB 1MNEA 3WHIA 2MKHA 1KD1T 4TNOA 1FRIA 2OPQB 3DLGA 4P9SA 1FJGJ 1JXLA 2YBVA 4C98A 3G4SS 3DHXA 4X84A 1OY8A 1FE4A 3EZ5A 5FLXU 3C19A 3HFVA 2HNZB 3Q8YA 2M8DB 3BGRA 2ACMA 4BLGA 1VOMA 2W4PA 2MQPA 3TZZA 2Z2LA 2DJWA 1M5HA 2VDIA 3V6DA 5C42A 3V2UC 1Q4RA 5DS7A 2W7PA 2HIQA 5B09A 2AYGA 2Y3YA 2ZHOA 2K3IA 3ZZ0A 1PO6A 4ED5A 3EM1A 3W62A 2BOPA 2J6TA 2RB7A 1PCAA 4LSLB 4LFAJ 3KJFB 3W5XA 1X0FA 1TKXB 2F8MA 1XMOF 3D9BA 1XK8A 4U95A 1WC5A 1K44A 4ES3A 1Y9OA 1HNWJ 2PI5A 1WDDA 4DUTA 1S1VB 4C7QA 4UW2A 3B4MA 3CMQA 4I4BA 1DHMA 2ZEJA 1HBUB 2M52A 1FRJA 2X1AA 2IAJA 4OJ1A 2GJIA 4RNFA 4PUOB 3E2EA 3CCSS 4CIOA 5L1JA 2QFIA 3LP0B 5E2QA 3PFEA 3EDRB 2KRRA 3W64A 2DISA 2DRAA 4NLGA 2D3UA 2I8EA 5IFMA 1S59A 3I56S 2DR9A 5SZTA 3BGFA 5E3QA 1AZSB 2W8LA 4DV6J 4M8LA 2R7UA 3IBCB 3W7BA 2FJWA 1BD6A 2DPJA 2DEIA 3IO1A 3EDQB 2PGCA 2BE2A 1A6LA 4OZJA 4O4RA 3D1OA 3SCKE 2FJDB 4XDCA 1S1XB 2QFJA 1JMTA 2OD4A 4ZN3A 1IKYB 1YI2S 1PAEX 4CO5A 4RW4B 2QMXA 4HLBA 1XMQJ 3M9NB 4NA1A 2CG4A 3LP1A 1Z2ZA 4LR7A 3RAMA 1N56A 4LFCJ 1TP7A 2FJAB 2VA2A 4G1IA 4QR0A 3CSKA 4USIA 3QFHA 4PQAA 4WP9A 4NA2A 4ID5A 5EX0A 4YN3B 2P9GA 3U1LA 2CQGA 4C48A 1OO0B 2C2ZB 2B5JA 4ELVA 4IH7A 2CPDA 5B0GA 3BSCA 5LJ3Y 2R9LA 3A8IA 1LWEA 3NGKA 2XLIA 4ES2A 4X64F 4R25A 1RT6B 2HFVA 1SJ3P 1FTCA 3CPWR 1IKVB 1HPZA 4IG3A 4OZLA 5K8NA 3HCXA 2W01A 2MQQA 4U67Q 3SYZA 2A10A 2VG5B 2L48A 3GLJA 4OQJA 3OTCA 1Y00A 3F73A 1B7YB 2E5JA 5J1PA 4P2SA 3BO4A 5AE3A 4O44A 3GV5B 3A1YG 4OYOA 1UW9A 1S1WA 5ETTA 3I55S 5KFNA 1FDNA 2XBPA 4ZPAA 3HVAA 2VB6A 3CC2S 3BEGB 3I4HX 3W8GA 2X3GA 5HSPA 1HMVA 1PJ5A 4I6AA 2MYFA 2OEKA 1YJ9S 2GVZA 3Q2TC 4C8YA 3B8HA 5HJXA 1KN6A 1KS2A 2BOAA 3FEXB 5CCMA 3SZ2A 4KRWA 1H0HB 4QBUA 2PEBA 2DGVA 1S0OA 1TL5A 4DR3J 1RADB 2ZH5A 2YNHA 4QYZJ 1MN7A 5KT2A 3G2XA 2DRDA 3SMZA 4M94A 4WE1B 1NU4A 2H5EA 4KGVB 1UA1A 3OLBA 4G65A 1RI7A 1S7IA 3TI0A 4XK8C 1KVIA 1L3VA 3D54A 2NSBA 5GMKa 2G0JA 2JSXA 4KAIA 4NYPA 1N48A 5ETOA 1N4LA 1JNRB 1DJ0A 2XO6A 2HMIA 3QWUA 3TJAA 3D0IE 1U2CA 1HIYA 3RW7A 4QWEA 4NZ7A 3O6QA 1RSCA 2Z2ZA 1PJ7A 4N56A 1RT1B 3DYAB 5J2MA 1RT3B 3MI7X 1I94J 3CC4S 3K5OA 5K8OA 5KG0A 3OTOF 2XCPA 2OHDA 3MFIA 1RABB 4IOBA 2E1AA 3RJMB 2RHQB 4O3SA 3R8YA 4Z37A 5HLFB 2A1BA 5KFHA 1U6BA 3JQMA 3CCJS 3POTB 2QSFA 2V9KA 4IFVA 4B17A 4KR0B 4HTJA 4NL5A 5DDOC 1U7LA 4RNNA 1YHQS 3EXCX 3DLBA 2KI2A 4YDXA 4JI1J 1SIZA 2RJZA 3G8TA 3AOAA 3ZTOA 4LF4F 3N4WA 3D1HA 3PZPA 2NCKL 3PW2A 1WUUA 4O3NA 2FHMA 2AF6A 3OR2B 2QIFA 4UZCA 2PDAA 3DRPA 2V9WA 1RA7A 3LF0A 1ZH5A 3D3CJ 3TANA 4L73A 2YNFB 2PMZD 1ZOTA 2CQ1A 3FSYA 3RRGA 3DLEA 4K4TA 4DPOA 2G0IA 1NPKA 1CQNA 1H2VZ 3MM6B 2EBEA 4N76A 2NUHA 5EDWA 4AQYJ 3MHYA 1APSA 1X4CA 2CNOB 4M5HA 1SKRA 5DRKA 4KFBB 1Q79A 3M8RA 3KHLA 5FD1A 4B9VA 3T1HJ 4L3KA 5KFCA 1LOUA 5J2QA 3DLKA 2KFNA 4USHA 1UAWA 4CCHA 3MTJA 2AJ0A 2QYGA 5E3PA 5BYRA 4I2PA 3R7BB 4RW9A 3T9ZA 3T19A 1Q7YT 1CSJA 2XMTA 5KFZA 2UXCJ 1GMUA 5LOQA 4AL6A 3M8PB 4UT4A 3LPEA 4AL5A 1K0TA 4I2QA 4ZOSA 3HX9A 4WP8A 3UWTA 4LF9F 3FZ2A 2I38A 3JB9k 2VG7B 1Y3JA 4HEA9 4PR6A 3H5XA 1P1LA 2B9XA 2EFOA 3E01A 3ET6A 3NKYA 1CS4B 1IWAA 1KC8T 4U9RA 3C6TA 2FLNA 1PYOB 1UCNA 4DR2J 2J8SA 2DRBA 3A3NB 1NSPA 2F8EX 4ZJOA 2C28A 3O1LA 1WC3A 4O3RA 1MWZA 1RTZA 1GMWD 2V5HG 3CNQP 4N77A 4EO6A 4UF4A 2GVDB 5LXRA 1HWIA 1YWXA 5IC6B 4F26A 2XY5A 2C2DA 2HS4A 1HHQA 2V2QA 1WEYA 4D3GA 2NREA 4DL2A 3M8WA 5M2PA 7FD1A 3B6BA 3ENAA 2LA6A 2Z2MA 1V5IB 3OTEA 5T7LA 1SQFA 2H54B 2Y8WA 3CJKB 3MFHA 4CO3A 2E9RX 1TUWA 3OFFA 4ZA1A 1KDNA 2BBEA 4S0MA 3IWNC 4A8FA 1OY6A 2B51A 2E5LJ 1NKCA 1S48A 4QR2A 1H7XA 3DRSB 3IM8A 3H40A 2OFHX 3HDSA 4C8MA 1HQUA 4E2FB 3KYLA 5GADI 2ABYA 4KJIA 2XNRA 5D4NA 1PKUA 4OX9J 3S8SA 5BYSA 1CG2A 2KXFA 1X4BA 2IVMA 1N32F 2VFRA 1X4FA 2MJUA 3IWLA 4LF7J 1LWFB 4WCEQ 2XZWA 5J2NB 1CVJA 3MOZA 3W60A 2HFZA 3J7ZT 1T7PA 2V8GA 4ZVRB 5KFYA 1GT8A 2Z56B 2AYBA 3MEDB 2IM0A 4A8YA 3V6HA 4QWCA 3VAKA 3MMBA 4K4ZA 2XY7A 2OUGA 3R2CJ 3QLHB 5CYQB 3V81B 3PNIA 2KXHA 2LVWA 2E66A 2FB0A 4OX7A 4BWJA 2MGZB 3Q86A 5ETMA 2VG6B 1S9EA 1BHNA 3H0PA 4CM2A 2B9YA 2FYXA 3M30A 3IG1B 1SKSA 1FNMA 3OPKA 1FWLA 2W9CB 3EX7B 3HFKA 2F5GA 2P6TA 2QSWA 2X7IA 3HVTA 5GAEU 3CCWA 4DL7A 4HDGA 5HP1A 2Y0BB 4F8RA 2DK2A 2B56A 4O3PA 4G6VB 2ZH4A 2CDRB 1ZAWA 4USWA 1RKJA 4Y2IA 1WOSA 1TV6B 2W4CA 3QT8A 1TL7B 2W2NP 1U8WA 1D09B 2GQCA 2N3LA 3S6EA 1IBMF 3VAJA 4PQUA 5KFBA 4OYIA 1HBMB 5F8LA 2IC3A 5J1NA 2MLYA 1UVNA 3DN9A 5KOWA 2DNOA 4Y6IA 4E0DA 3QJPA 2OELA 4DPYA 3RZAA 5KG7A 2M7SA 3PHEA 4FZVA 5C7PA 3C6UB 4JUZA 3WX8A 1RAEB 2N4DA 1TL1A 2PE8A 4B9TA 3BF4A 4OI3A 3VAHA 5E0OA 4QOTA 2W25A 2AKWB 2AZ3A 5D8HB 1X9SA 1IN0A 2UXBF 4QYZK 1RT7A 4PWWA 3P45B 1T9XA 2WVFA 2HGLA 3J7AN 2DNYA 4KGKA 5HI7A 1TZ0A 4FBUA 4J7CA 3DU5A 3LQVA 2CPFA 3K8VA 1EJ7L 3AB4B 3SCIE 1C1CB 2ROEA 1IWGA 4WFXA 1VQOS 2PFFB 3FEYB 4EBEA 3J7YI 2OSQA 2XM3A 4ETZA 5RUBA 1FESA 2QMUB 2R7XA 2RS2A 5BXIA 4LSZB 4LF1A 1H2TZ 2WVDA 3ITHB 4PZVA 1KKHA 4RU9A 4LF5F 1U45A 1XNRF 2JZ5A 1JLGA 2D7SA 3OTDA 3TVYA 2D69A 4RUCA 4YDDB 3IS9B 4PG4A 2OJ3A 2COLA 3GIIA 2A6OA 4ZP9A 3GSIA 2O1PA 1WD6A 3FFIA 4DV1F 5DG7A 1DTQB 2MHEA 3R97A 2IJNA 4FXVA 3ONQA 3OJUA 1E6VA 1NNDA 4MFBB 2KU7A 4ILRA 4RBTA 2NXJA 1YIJS 2E1CA 1BWVA 4CLSA 3LAKA 1DARA 1NH7A 2F40A 4DI6A 1H73A 4E8UA 5A2QU 4OZNA 3F44A 2ATLA 3KDNA 4RWWA 5HO4A 2J0WA 3NS7B 5C2CA 4YR0A 1LW0A 3BZQA 3MAHA 2ASJA 5IS2A 1WKJA 1RTDB 1EIYB 4IOAQ 5DGBA 2PFDA 4CRJA 1RHJB 5J1EB 2ZD1A 1TKZB 1N33F 2GAHC 4B02A 4DQIA 3H8YA 2Y1JA 1MW7A 2XULA 4ZVEA 4JV0A 3FSXA 3GIMA 1RE1B 4AL7A 2R7RA 5KT5A 1YRUA 2UVRA 2AW0A 4TY8B 4EFAC 2R8HA 4C0HA 4JI5F 3GIRA 3N6NA 1H6KX 4WTYA 5ETSA 5HMYA 2UUTA 2ZNYA 4W92B 3PX4A 1DRZA 5B7WA 2MZ1A 2VC0A 1NAQA 4U7CA 3HHLC 1VRTA 4X4OA 1OSCA 4NE9C 1VHFA 3GU0A 1HW8A 1T0TV 3IR6B 5GMDA 5EWGA 1F5CA 2AX0A 1DQ8A 1ZTTA 2LXIA 1VGYA 3NLCA 1KLNA 4ELTA 4NPOA 5CH7B 3W66A 5FDLB 1GXUA 3OV7A 2ADCA 1N0UA 2W24A 1ACMB 4X4QA 1K1QA 4L6V3 3AB2B 3W2VB 5LM7E 2OGUA 9RUBA 3LTOA 1TVRB 2F3JA 4BHQA 2A2CA 1L3KA 2OPPA 5ETLA 2CVEA 1C4AA 1RJJA 3KWMA 1B0TA 4RBUA 3PRVA 1NK0A 3G6XA 1YITS 1WDTA 4OYZA 5A76A 4JV5F 2FLLA 1FFGB 2HK2A 2GC8A 1XR5A 4AE5A 3QO9A 3TAMA 3V5RA 4NLPA 4ZJQA 1SCJB 3HHNB 4A46A 1MMLA 3Q23A 4ILLA 1X5OA 3BH7B 2ZZMA 1NKEA 4OZ2A 3I5AA 2KG1A 4Q5VA 2V69A 4A8OA 4JI6F 2ZDOA 1XC9A 5K20B 3TAQA 1FDDA 1JWWA 4C4WA 1TELA 2XC9A 4ZPWR 5IT9U 3OXLA 1VQ6S 3OR1A 3T9NA 3KG4A 2HHHJ 4DQPA 1X0PA 2PI4A 2Y1LB 4B3RJ 1IBLF 3CD7A 1VBZA 3FSIA 1M5SA 1DURA 1UPPA 1YDLA 1NK4A 1VC0A 2VODA 3KJVB 3H2VE 2MMYA 3MCOA 3TZYA 5KFSA 2OEJA 2YH0A 2XHCA 4F50A 2VC1A 3KNAA 4GRSA 2IBOA 3G96A 4YB5A 1L3TA 2CJKA 2OEMA 2I5JA 3OD2A 4BC9A 4ZN1A 2HHQA 2HBRB 1FJ7A 5A8KB 2Y8YA 5LL6d 2BEFA 2D74B 1J5OA 5EHHA 2VBWA 4UQTA 3MZIA 3S7RA 4A8QA 1TU0B 4CLUA 2BJ1A 1GFWB 4ZP6A 4DR5F 2HHUA 2HQCA 2OTJS 3DU6A 5IWAJ 4WPAA 4WF9Q 2RIJA 2FUG9 1U8SA 1QSLA 1CLFA 2I2YA 4I67A 2H5IB 4LF9J 1XR6A 3DRXA 2ZJRQ 2CXEA 1CC8A 2MHNA 3SBMA 4XPEA 4JB8B 5G0RA 2AJ1A 1HNZJ 3PW5A 3AOCA 3SSSA 3KK2A 3R6LB 2NZCA 1RWOB 4EWTA 4P71A 3GILA 4QU6A 3QJLA 1KFDA 2WSCC 1BMQB 5H9EJ 5ETQA 3A4TA 1GNKA 3FJ2A 3MAAB 5CABA 5AXMA 4DPXA 1X31C 4ECXA 2XS2A 3QT6A 1ULRA 2GGPB 2WVBA 1K47A 5KFKA 5F9NA 2LKZA 3WC0A 2VZ9A 3MM9A 5L8RC 3CO0P 1R0AA 2MKKA 3PR4A 4ZIVA 2GMHA 1SKWA 2BM1A 2CQDA 2OPQA 4JBCA 4NCBA 1LWEB 3MF5A 4P52A 1WTBA 2HVHA 1VK8A 1RU1A 4DS4A 1QSSA 3T1AA 4EEYA 3MR6A 3FBEA 4OMFG 1JNZB 2WCXA 2EG1A 5BR8F 2HBZB 2ILZA 2HNZA 2DTJA 3IRWP 1NK7A 2IRUA 3ISNC 4RX6A 1P9QC 4DG1A 3C16B 2LU1A 1HI8A 3A3PB 4HKQA 3BQ0A 1S77D 5IQQA 4M5DB 1N32J 2KYZA 3VF0B 3MECB 3IC1A 2AZ1A 3FBBA 4KHRA 4DR6F 1U2FA 4DX6A 3KMSA 3TO8A 2LU2A 4IUFA 3THTA 2UXDJ 4LRBA 4R5PB 3KKFA 3MMJA 4JI0F 3WC2A 3OTBA 1C0UB 3UO0A 3OVSA 4LSLA 2DNMA 4PXBA 2GA7A 1IQTA 3ZXWA 2D3OR 1XN9A 4U7UK 3CCZA 1S1VA 4ANCA 5E41A 3EPGA 2YNHB 1WHXA 5ETKA 1HBUA 4U6PA 2R2RA 1YRXA 3T5LA 1VJQA 1HHSA 3W3SA 3L4BC 3NBPB 2D3O1 4PUOA 1SQEA 1G3OA 1HNVB 3R5AA 4IDKB 1VBKA 3LP0A 2FD2A 3W8PA 1V6HA 1NBEB 2HRTA 3ISZA 4MK7A 3FNNA 1PBUA 3VZHA 3X3UA 2C2KB 4K4XA 1TK8A 3MD1A 2VKZG 4TXSA 2GJFA 4HL9A 2ZJPQ 1VK3A 1AZSA 4ECYA 4K4SA 4DV4F 1L3SA 2KVQE 3VVUA 4NXMF 3R1HA 4BCAA 1IBMJ 1NLKL 4DX5A 2CNKB 3DI6A 3OSPA 1S6PB 1EX8A 2B4PA 1RISA 1XWLA 3PHTA 3CCVS 1SC1B 2LMIA 4P2MA 3L95X 4BBYA 4FVCA 1K73T 1IKYA 4J9OA 3PFOA 4RW4A 3F56A 4Q44A 3VGVA 2RRNA 3NAHA 4IG0B 3FGVA 3OL7A 4MK9A 4UUXA 2H4WB 1DY3A 4IFVB 3HI9A 2HSEB 1WEXA 4O3OA 1D9FA 2GIFA 3TUIC 1SXLA 4IRCA 3RB4A 2UXBJ 4MAKA 4P74A 4LRCA 1MSWD 3MTKA 4LIWA 1XBWA 2IHR1 3K5PA 4ZVUB 5KT7A 1RT6A 4CH0S 3BKFA 1IKVA 3BPDA 1ZZFA 4ZK7M 4C0OC 2W2MP 4YHHJ 4LF6F 3ADAC 4AT1B 4OV1A 4F0HA 4ID8A 2UVUA 1GTHA 2DNGA 4CLYA 2VG5A 1K8AT 4IR1A 2WONB 3HT0A 3J80U 4EK2A 4WFYA 3PY8A 4CO2A 5IM0B 4Y2AA 2C2NA 1QAJA 5LSLA 5IC4B 1QUPA 2XS7A 4IKAA 2DHXA 1T8EA 4FF4A 3IR7B 1FRLA 3ICLA 2C2EA 4YR3A 4B3TF 4KC5A 1I51B 4AUKA 4CH7A 2ZNZA 3UR3C 4NZ6A 4LF5J 1BLUA 4KQZA 2MZTA 4F3OA 4W4MA 1B0VA 2VD3A 1U1OA 2GW8A 4OHZA 1X4DA 1QD1A 2KG0A 2R7TA 4M1KA 4EYHB 2DY1A 2X1GA 2FLPA 1X9MA 2MY7A 1SJ1A 3D6HB 4OI0A 1M5OC 1XEZA 2BJ8A 3MEGB 3AJ2A 1JXEA 4YOEA 5FJ4A 3PEJA 1LWCB 4RLEA 3MMAB 3OT9A 4ANDA 2B4UA 4A8SA 2LQ8A 1N6QA 2OPRA 4C8NA 4OJ3A 5LXYA 2HHSA 2Z4PA 2UVVA 3CCMS 4WE1A 1BQXA 4R8UB 2ZM6F 2XLJA 1D8YA 1X8DA 3HD1A 4CO1A 4TVAB 2K3KA 2RF2A 5E3RA 3JSMA 2GHVC 2M70A 5B0EA 1EKSA 1Z4UA 3TRGA 4X4UA 4F4ZA 3CVKA 1YTYA 3SEOA 1ZS6A 3DDKA 1HQEB 3CULA 1AUSL 2WVEA 4CNYA 3VAMA 2J7WA 2IMWP 4N41A 2OMOA 2DR5A 1YZ6A 1RT1A 4EBCA 3DYAA 1RT3A 3MMCA 1N33J 4DX7A 3GYXB 3C66A 5I3UB 1RAHB 5D15A 1G4CA 2LXUA 4MKAA 1MN9A 1FJGF 3TA2A 1B3TA 1WF1A 3UVJA 2E7XA 2Z57B 3SSQA 1T02A 4JI5J 4FS2A 4ENOA 1ZBTA 3KLVA 5HLFA 3RW6A 3K7RA 1RYRA 4U8YA 1RKIA 1NK9A 4IFYA 3I5BA 1JLFB 3D6MB 3KG0A 3TYTA 2HYIB 2A18A 2VF3A 4Z7CA 1RHMB 3BDPA 2JJ4D 4B3OB 2JHEA 1LW2B 1M5VC 1RT5B 4TN2A 1VRQC 3Q8VA 1S0VA 3QMQA 2DD8S 2R7OA 5F3TA 2IRXA 1AUDA 4EUVA 5L38A 4XIUA 3DOMB 1DTTB 5GADU 2B6AB 5H9EK 3WQPA 4OX8A 3TWZA 3JSBA 2YNFA 4NXNJ 3CJQA 4JI2J 3ZZUA 3ILJA 2IIHA 3DC2A 4A47A 4LFAF 3UDEA 1LK7A 1XQIA 2YQ3A 4NLOA 4TY9A 2GS8A 1NDKA 4Q45A 2HAIA 3W1YC 2CG8A 2X1FA 1VQ9S 4I7FB 1HNWF 4YR2A 4JV5J 1U0SA 3G71S 2XSJA 2FZKB 4KFBA 5D0EA 2YH1A 1SIWB 1FA0A 2XYGB 3GFXA 2XGQA 3MOJB 5L9XA 5HANA 2MB0B 1FXDA 2PA8D 4F4YA 1SJRA 1URRA 2ILYA 5K9FA 3SV3A 3PO5A 1S72S 4DL3A 3PKMA 5KFXA 4I56A 4PRFA 4OLPA 2FVSA 2YKQA 2CA9A 3M8PA 3UCGA 2LECA 4ZLJA 4DV6F 3GV7B 4OHYA 2RH3A 4DF8A 4WZMA 3UDCA 2VG7A 5G4DA 5H1SV 2XB2D 2IMOA 2DNZA 5KFFA 1X4EA 3ZTPA 3KMQA 2N3OA 2YX7A 2LQ5A 2AV5A 2GCFA 1CS4A 2MQLA 2KXNB 4LT6A 2DCUB 2HNYB 3GQCA 1MU2B 2PO4A 5A6PA 3PCOB 5DQHA 3Q22A 1NO8A 4G1QB 2X3DA 2G2ZA 1XMQF 3P6YC 2HNDB 2YPZA 3TA1A 5JVHQ 4CT9A 4CWBA 2EBGA 1G1XA 2J9DA 2Z58B 1IVZA 2GVDA 4LFCF 2V8VA 5F41A 3EUNA 5K8PA 2HEKA 2IA6A 4AXJA 1JKHB 4WFZA 1S5ZA 4ILMA 1YKWA 1XNQJ 3HULA 4RBVA 4AXIA 2HKEA 3QBCA 1N88A 4F25A 2HS3A 1RCXB 2R8KA 5KT4A 4OHWA 2V2VA 4C2MA 3R3TA 3CJKA 3GJSB 3PW7A 2EI5A 1N52B 5F8HA 4B9MA 2RHSB 3DMJB 3D68A 2XWXA 5C24B 2I1RA 2VBZA 3EGVA 3DRSA 4WK3A 3K58A 1SI9A 3UW1A 2RSQA 1FJCA 3PEHA 2EWHA 1TTHB 1WTFA 1R7IA 2QLWA 1JQGA 3DHWC 4P73A 3NXZA 4UOFA 1LWFA 1JLGB 3RR7A 2WB1D 2O67A 4MYTA 2EFVA 5J2NA 4D3HA 3BN4A 2F9DA 1SJFA 1R43A 1UVJA 3GR1A 4RO0A 2IFXA 1TAQA 1HLWA 3VCDA 5DG8A 3MEDA 1YSJA 3N28A 3PIPQ 3M05A 4PEOA 2BE7D 5KFUA 2DNLA 3T5JA 5D0GA 3QLHA 5CYQA 3M7VA 3KLFB 2NXNA 3V81A 4F67A 4OI4A 1R6VA 1RHUB 5GAEI 5HVGA 2VJVA 3P4UB 5L1IA 2MGZA 2VG6A 3AOBA 4NLXA 3IG1A 4KPYA 2KT5A 2MEWA 2XTJP 4TYAA 2VFUA 4Y34A 4FBTA 2C2RA 3BREA 2RRAA 1MROB 1LW0B 2YX1A 2L9WA 2V68A 3CJ0A 2BYCA 4NLWA 1TV6A 2P9CA 1TL7A 3M9MB 1HNIB 2YX4A 1I94F 3UE2A 4LRAA 1HBMA 3KJNB 3OSNA 1FTRA 4WTOB 1H72C 1LWXA 2ALYB 4QIEA 1J5EJ 3JYTB 1QUVA 2EFQA 3RAQA 3JTNA 5CZXA 5GAHU 1WC6A 2DYAA 3IA0A 1TL3B 2EW9A 3DRYA 1KQFB 2W2QP 3C6UA 3TP2A 4HI2A 2CDQA 4JYAJ 2VFTA 2OPSB 3NCRA 4Q2MA 3P8BB 2M8HA 2JLGA 3H90A 2UUBJ 3QIPB 3D5MA 3DXSX 3IN5A 4DR1J 5DQIA 2RUSA 2WK4A 3PYGA 1SC3B 4DWIA 4JI1F 3T6BA 1KVJA 1UTAA 1P8GA 2CNLB 3O5TB 3NWRA 1GX5A 4FNHA 5HK4A 4KGXB 5ETPA 3GPAA 3NMRA 2VUGA 5JXSA 1RTHB 1M1HA 3MURP 1X4AA 1REVA 4X62F 3E3XA 2C22A 1F5AA 1JLCB 4J9KA 1GTEA 3W9HA 1RTJB 1C1CA 1N5YB 2AEMA 4LBHA 2F4VF 4P75A 4DR7J 1YJWS 1C2PA 5AXNA 1VDHA 4CYUB 3FRYA 1GXTA 3G9CA 3UQSA 4DFJA 2VA3A 1UWBB 4DV4J 1NB7A 3R27A 3VWSA 2RS8A 2J9EA 1RB0A 4CLPA 2CQPA 3BR8A 2ZH8A 3HPOA 3IWXA 1C4CA 4ZVGA 4K5RA 3ITHA 2FHKA 1RP5A 4RW8B 3NMAA 3T1HF 2BX6A 1Q1KA 4JP8A 4A8WA 2FC8A 1HYSB 3IS9A 4FF2A 3J80Y 2ROGA 3DOLB 1Q8LA 1JJCB 3BM7A 3CD0A 3EVOA 2EKYA 3ZNUA 2WZ1A 1FVQA 2UXCF 2EKNA 2CJYB 3DLJA 4ECTA 4MFBA 1GK8A 4MIWA 1SJ4P 4GVBA 4USTA 2ZBPA 2GO9A 3THPA 1WACA 4DUYF 2I9SA 2DBBA 4DL0C 4CO0A 2QV6A 2GJ2A 2ZWOA 4USVA 1SC4B 1PBAA 3L7UA 4EO8A 3CCRS 2FY1A 3HO1A 4DR2F 3TUZC 5K14B 2QA2A 3LANA 3QAEA 5AJ3J 1NHUA 4AFFA 2QZ8A 3GFHA 1RTDA 2G4BA 4OV6A 4RU2A 2IBKA 1T05B 5J1EA 2XEXA 1TKZA 1M5PC 3H4BA 2HLTA 4HR2A 4FNIA 3NS6A 3AD9C 1FERA 1S79A 3LGHA 3HLUA 1NK8A 4L3NA 2D3ZA 4NRTA 4GO7X 4TY8A 2ZZTA 2C2OB 3AHPA 4ED2A 3QRRA 5L1LA 4ZCMA 4DL4A 2XLKA 1JLAB 1UZHA 1YQHA 2KO1A 1LFPA 5F8NA 3GIKA 2OFGX 3AA8A 2E5LF 2VBXA 3Q89A 4UOCA 4X66F 4NLUA 5JJBA 1W2IA 5BYQA 1AA1B 2G0CA 4J37A 2FVRA 4EU0A 4C8LA 1F3VA 2ASLA 3R5DA 2B4VA 4C8KA 5A8RB 4RW6B 2FY8A 5FDLA 2QL9B 4KYZA 4LF7F 4L72B 5ADZA 2FTRA 4RW7B 3W2VA 3B4DA 2A0FB 2PEHA 3HSZA 3P5BP 1SL2A 1TVRA 3NGUA 1F60B 4OZ5A 3NAIA 3G6ES 2MKYA 1EHWA 3DLLQ 3CC7S 1R8AA 2DNRA 3GONA 3QSYB 2W2PP 2FZCB 4X2BA 3S01A 4OLOA 2MQMA 3SV4A 3T1YF 1P27B 2QL5B 4M5MA 2V4JB 3EJMA 3HHKA 3JQKA 4EGLA 2XG8A 3I31A 2BANB 2KM8B 4UTGA 4QIGA 2UUAJ 2HVZA 3GYNA 2MLZA 1LQ9A 1RLCL 3QGIA 2KJWA 2HLUA 2JEFA 5KFDA 3QRQA 1DFDA 3C14B 2PC6A 5KFQA 3DRRB 1HARA 1FVSA 4M5LA 1IJEB 1A7GE 4F4AA 4DG1B 4CH1A 4DV5J 3CUNA 2XMKA 2EC2A 4FPIA 4JI7J 4ERDA 2DGUA 1HBNB 4K4WA 3JS9A 2ZUGA 3OFEA 4TKTA 1VJWA 1VQNS 2C3PA 3KJVA 5I42A 1R0CB 2LFVA 3E8OA 2LEBA 2HVEA 4FYDA 2XSFA 3VAFA 1RYSA 3GSDA 1R8PA 1HQ2A 2UZAA 3VGTA 1I6JA 2WW8A 1IKWB 2NZ4A 2KFYA 3LUYA 2ZOGA 5A8KA 4URGA 1YJUA 5KFVA 4KB7A 1Q8IA 1U2RA 4LF8F 1DQAA 5KFEA 4DXLA 3EYZA 2JNJA 4DOZA 3Q8RB 1T03B 4HT7A 3MR7A 2ZBRA 2PA3A 3LAMA 1KWMA 1LK5A 1IM4A 4RWXA 2MTLA 1QLNA 4H4KC 1HA1A 3RBEA 2V94A 2J6SA 3RTVA 3DI6B 3LH2S 3PRBA 3EXYA 4NA3A 3O44A 1RWXB 3JAMU 4USMA 4IR9A 4K4UA 1VQYA 1YG0A 3RR8A 1GMVA 3HP6A 6FDRA 3H59A 3E51A 2ZJQQ 3P3DA 5LT5A 2D9PA 4HVZA 3MAAA 1WORA 2Z8QA 2CJ9A 4HACB 2NXUA 3RGIA 3L9ZA 4QW9A 3KK3B 3EWGA 2GGPA 4NWBA 4YY3F 2IVYA 2ZE2B 1UFWA 2DITA 2DCLA 4OJHA 4QIVA 1UVIA 3EGWB 4WXOA 1KLMB 1PILA 2C42A 2E5GA 3H98A 5A8WB 1JJ4A 5CAAA 1Q78A 3KXDA 4TQRA 4GKJJ 1PJ6A 3AAWB 4OZ1A 3BO2A 2YWWA 4PXEA 2AGQA 3SXLA 1UVLA 4CLZA 2PT0A 2FVPA 2VU5A 2BR0A 2JC0A 2XZDB 5KFPA 4B9UA 2NPIA 2XMJA 2VJUA 4CT8A 4PG7A 1JB0C 1DAXA 1B0PA 2K1RB 4HDHA 4USJC 2NXEA 3C16A 5BJRA 2RU3A 2R42A 5JMNA 4JI4F 4ELUA 2OI2A 1WF2A 4M5DA 4KSEB 3MECA 1TKTB 1DZ5A 1XERA 5DLGA 2LLZA 2DXDA 3ZTSA 4R5PA 3CJ2A 4L74A 1EAYC 4RR5A 1WG5A 1IM6A 1HWLA 3T5KA 1UFLA 1C0UA 4LQ3A 3EZOA 5LSRA 3CJRA 3UDVA 4EZ9A 4ZHRA 5F0UA 1P1TA 4ZS6A 2GQQA 2DO0A 1S9FA 3MGJA 1NJXA 2H51B 3NWGA 3BDEA 2FPHX 1N6QB 2OPRB 3OVBA 2HFOA 1HBOB 1FDAA 4KTQA 2RQKA 3NBPA 1R3NA 3MCSA 2DVIA 4JI8J 1X4GA 1HNVA 4IDKA 2ZH6A 3BN7A 1Y5NB 3V6KA 4J90A 2RF2B 3JSMB 2YNGB 3GMGA 4P10A 3L7PA 3V4IB 4L75A 4B3SJ 5D0HA 4DV2J 2H48B 5HMXA 2CJQA 3ZC4A 2HQFA 4KPCA 2CJXB 3D0HE 3H20A 1Q5YA 2Z30B 2ZBQA 2J0XA 4ECRA 1YBTA 4X4RA 3FCVA 1RAIB 2J9CA 5E33A 4N7TA 1SH0A 5KG1A 3MMCB 5HROA 1RQ0A 2XCAA 3PX0A 5B0FA 3KLGB 2AJ4A 1S6PA 1RAOA 2R4FA 3TUPA 3T5HA 3HSDA 3M8YA 3WDOA 3M2RB 3CIMA 3RRKA 3M2VB 2DKOB 2JDJA 3UVJB 3KUGA 2R7SA 3NGSA 3AQOA 4QR1A 5CYMB 3RBXA 2E1RA 4EZ6A 4IG0A 1G2EA 4QU7A 2V67A 1RT2A 4M5IA 2XS5A 3KHRA 2DHSA 3ENVA 3EE3A 5D4LA 4Y3CA 3LGMA 1LNQA 1SQGA 4IFYB 1NSAA 5LMNJ 4Q8EA 4Q8FA 1S4EA 2Q6CA 2A6MA 1QAIA 3HKWA 3TVZA 4J91A 4DV3J 2HHHF 1QY7A 1VFJA 1JLQB 3FC9A 3HHLA 3TW0A 1U6FA 4B3RF 2CQBA 4V19J 5KG5A 4N47A 2ACYA 1VQ5S 2NLWA 4WWSA 4RL1A 4X62J 4DEZA 4CP5A 1ZPWX 4LRDA 4WKYA 1FXRA 2WONA 1R6YA 3QGPA 5HQ8A 1U1MA 5KT6A 4O0NA 2F4VJ 2LEPA 4DZ6A 1EQ0A 3VAIA 3KUHA 5IM0A 1VRUB 1AW0A 2AJ2A 4RPFA 4ALZA 3A8EA 3UCUP 3M32B 2XSJB 1Y5LB 3ILIA 3LA0A 4YB6A 1S76D 1X5TA 3DLHA 1TFYA 4PYAA 4WFBQ 4URQU 2CJBA 1Q8BA 1R8BA 1S1UB 5T41A 1CEZA 3I0SB 2F65A 1M1KT 2XI3A 2XI2A 1VBYA 2IJFA 3VTIA 5DO2A 1HKAA 3MEKA 1NJZA 4HHUA 3CGIA 4F4KA 3VV2B 2AEJA 3MEGA 3I32A 2JEJA 2KT2A 4NYOA 4A48A 4YMEA 1NH8A 1LWCA 5IWAF 4TQSA 1A0OB 3A13A 3MMAA 3C2PA 4ZVHA 3K0JA 3N9UC 4B9SA 4RNMA 4GO5X 2O01C 4A8MP 3CT9A 3QIDA 1D1UA 4DUYJ 1VS3A 3B54A 1OPZA 1HNZF 2POKA 4RKUC 4R8UA 3BSAA 4Q0BB 1U1PA 4ED4A 4FXDA 2R8GA 3I6PA 4GC6A 5CD4A 2OLWA 3PV8A 4DHVA 4WIIA 2ZFHA 5KOXA 2UU9J 2X51A 1HQEA 3N79A 1S6QB 5KFGA 1YJVA 3HM9A 2H9ZA 3T3FA 2JFDA 2RQMA 4ED6A 1MLAA 5I3UA 3CCLS 3K5LA 2HFSA 1U1NA 1KHVA 2P8IA 4KHPF 3D66A 5B08A 2QA4G 3M2UA 4NLTA 2FHOB 4ZDNA 1U49A 3THVA 3IAS9 4CLTA 4QCLA 1KEKA 1U02A 3V4MA 3BH6B 1JLFA 4DSKA 4X66J 2HZCA 3PW4A 4Q7AA 1EETB 1GAOA 1PC4A 3MPVA 2CQCA 5KFRA 3MUVP 4B3OA 4DCOB 1LW2A 2MQ8A 4H4MB 4OI2A 1RT5A 2QC3A 3JQJA 5A6WA 3D4JA 4ZPVR 1REGX 3BV8A 3PTWA 1NCLA 2LXFA 2AGOA 4PPDA 3DOMA 1DTTA 3HFZB 1S0MA 1UWAA 2UXDF 2B6AA 3NOCA 2O5DA 4ZVPB 1FFWB 3CJ5A 1RAJA 2EFNA 4ZPTR 2FJEB 4PG8A 5DZ6A 3HD2A 3FCHA 5L39A 4FKYA 5EN1A 4I7FA 4K0KF 3T1YJ 2MLXA 2BQRA 3K89A 3M8SA 1NM2A 3HK2A 2YTCA 5CHCB 2VFVA 3QSIA 3WIUA 2KFZA 2ZITA 4IO1A 2AU0A 1RUSA 1Q16B 1LXNA 2HFNA 3VALA 2D41A 2F7VA 3HVRA 1VHIA 1DBDA 3M1VB 1FFSB 2AWZA 1N8RT 5E3CA 5AE2A 1H7WA 2VPXB 1OQ6A 4O0IA 5AXLA 2M88A 1UPMB 1P9YA 3AY0A 3N6MA 2GIRA 1F0XA 3ILLA 5E7OB 3CTRA 4X4SA 1RWPB 3FRZA 5D78A 3ZFVA 1CPZA 5GVQA 2HNYA 1MU2A 2WOMB 1PAUB 4G1QA 2HVDA 1ZM9A 3WX4A 4DSFA 4PYDA 3GV8B 4ECWA 2HNDA 5DDQC 3ZZPA 2HQIA 4GC7A 3PX6A 2CPYA 5C5JA 3AA9A 3VR1A 4DS5A 2DPIA 5B0AA 3GG0A 4IQXA 1JKHA 1UFKA 2RMLA 1EP4B 1BQMB 1HI0P 3JAMY 1WHYA 2N82B 5HVFA 3R5JB 4M5GA 3OQ2A 4ZPDA 2V8PA 4YHHF 1REVB 2DGWA 1FKOB 1G6BA 2IJRA 2GO8A 5IOLA 1NDCA 4LF8J 1KTVA 3BQ1A 3BBBA 4A4JA 4HTIA 4RUAA 3SI8A 3DMJA 4YS2A 5C24A 5C2GA 4ECUA 3LOUA 2YWGA 1FI4A 3TZWA 2KL8A 4G1PA 2ZC4A 4M5JA 1RZMA 2FZGB 2YKOA 3M8QB 4Z7YA 2ATCB 1TQLA 4F0MA 5CZVA 2CPEA 4LSNB 4UOHA 1NDPA 1W25A 3SSRA 2DGSA 3R5GA 2R8IA 3TJ9A 1F2HA 4C97A 1R89A 2VOPA 1JJHA 1WOPA 1UMJA 5CXTA 1NUEA 1MG7A 3EVMA 3QT5A 1N5TA 1ZM3A 2AJQA 2LDYA 2X1BA 1NJIT 3DOKB 5IT4A 2G2YA 4NCAA 4YY3J 2M0GB 4JI3J 5IQ6A 3KLFA 3UNYA 4GVBB 1CJTB 3NGDA 3OL8A 2ROPA 1M90T 1QTNB 1JLEB 2ASYA 1PSDA 1OY9A 4K5SA 1VQMS 2CUYA 5D4PA 2C1EB 2H1YA 4CM0A 3EPIA 3K5MA 4DPUA 4Y0FA 2HRYA 4Q2LA 2CJAA 2ZC3A 5KTQA 1U1QA 2DNNA 4LVOP 1Z1ZA 1RT4B 3LALA 1MROA 5KG2A 2E9ZA 1ELOA 1U47A 4A8XA 1RTIB 3IXQA 2KH9A 4R0EA 1JLBB 3GP9A 4ZVOB 4DR4J 3D7SB 5GAHI 1HNIA 2JX2A 2CZVC 4LVNP 2QA4S 4JI4J 1E6YB 1CJKB 3GJTB 4K59A 3DXBA 2BQUA 3JYTA 2HQGA 2CQ0A 2GMLA 2DIVA 5EX3A 1N0VC 4C6AA 5F0WA 1TL3A 1VLYA 2IVFB 4CNZA 3EICA 1B7FA 2RD5C 5B0BA 3NCQA 5HN0A 2DIUA 1VYAA 1TMJA 1H74A 5I3QA 2OPSA 2ZHBA 5HATA 3QIPA 3NNAA 3OLAA 5CYJA 4DCPB 1KQSR 1HNXJ 1HR0F 2W9AA 1FWPA 3SQGB 3CJ8A 1DLOB 4XAKA 2YQ1A 1S99A 2JRSA 4KKOB 4CTAA 4P72A 1KBRA 3QPIA 2MDAA 3NS5A 5DZ7A 1D3WA 1RTHA 3OW2R 3ZZRA 2K7KA 4MH8A 1JLCA 1RGVA 1T3NA 1RTJA 4NXNF 4DUZJ 4JI2F 1N5YA 2CADA 1RXOB 1SH2A 3PM9A 2WW4A 5CCLA 4CYUA 5DQGA 3M9OB 3P96A 1UWBA 3MPDA 4X4TA 4TYBA 2PN6A 2RKIB 2EFPA 3VAGA 3GG1A 2QJ3A 3FMWA 1F1BB 4XTTA 3GJRB 3OFGA 5MLCV 2IM1A 2MPUA 3RB0A 2RT3A 4CLWA 3UD4P 4RW8A 4USUA 2BDPA 2Q66A 4HHJA 2VOOA 4FDFA 2WVCA 2J7UA 1HYSA 4DPTA 4NLYA 2CQ2A 1FHTA 3SDEA 4ZIWA 2MY8A 1BC6A 3UDLA 3DOLA 1HHTP 2N4CA 1D0EA 2FHJD 2L41A 3FBFA 1RWMB 1CQMA 1LKZA 2IM3A 2B7BB 4ZLPA 4QQBA 1D9DA 2CWXA 2MKSA 3OHBA 1FD2A 3I9V9 4NLRA 3W65A 3R5CA 2L9DA 3FUYA 4WFNQ 3CCUS 3DKDA 1MMNA 1NZAA 2DNPA 1R8CA 4KV8B 2DO4A 3PW0A 2W1BA 2UVWA 2LQBA 3UNGC 2JOQA 4NX9A 3TX0A 3PJWA 4ZPCA 5K14A 5I42B 3KG1A 2LEAA 5DJBA 4DQRA 2R3VA 3LO3A 1V9OA 1OIAA 4ZVTB 2CPJA 5KFJA 1V3SA 1UVMA 3D2WA 3BKUA 1T05A 3R7SB 2CZ4A 3NG8A 3QNWB 1VLOA 1XTZA 2YXLA 1WKKA 1T9WA 4RZRA 5U47A 2ZVIA 5DG9A 1Y11A 2FDNA 1XNQF 4NCGB 2KVIA 1PG5B 2BJEA 2HK3A 4B08A 2JH3A 3IGVA 2FJVA 3BO3A 1OYEA 4ZITA 2AP6A 2LP4A 2W9BB 1JLAA 2Y1IA 1IBKJ 1D8ZA 4PG6A 4ZLLA 2V8HA 3DDIA 1X9WA 1N5VA 1U1KA 2V6AA 4IYQA 3AFGA 1ZETA 4WKRA 2ZH1A 4KE5A 3CDAA 2W8KA 6AT1B 1A9NB 5DDPC 2CPHA 4ATNA 5A8RA 1OS5A 3OUYB 2ERRA 4RW6A 2DNKA 1VISA 3NCPA 2NXCA 3CJTA 1C1BB 3FKBA 3JSYA 4KO0B 1Q8KA 3J7Z5 4RW7A 1VQ7S 3CE8A 5AXKA 3W63A 4AYBD 1C0TB 3BJYA 3NRBA 3JXOA 3MUTP 2WBRA 5CA5A 3A8JA 1L5UA 3M6VA 3D6TB 4P7VA 4EBDA 4CLFA 5D0RA 3GFYA 1H98A 3TQEA 2DY9A 3D28A 1RHQB 4LRFA 4MT1A 2V4JA 1YJRA 3MPWA 2W2OP 4DU8A 2EEYA 2HFUA 4NEYA 3LW5C 1CULB 2PMWA 3SCJE 5KFTA 2BANA 2QTWA 1G7CB 4QWDA 3M6WA 4KHPJ 1KRPA 4QWAA 3BGOP 2HQDA 1K0VA 4DLGA 4LUBA 3BPSP 4NOHA 3HVWA 3NOGA 3C14A 1AROP 3DRRA 1YJNS 1GQEA 1K9MT 1F6TA 3SIPB 3PG9A 1Y10A 1FKPB 2AQ4A 2JEIA 3CDWA 1LFWA 3EZUA 2GZOA 4ECQA 1R8HA 5HL7Q 1KQGB 4IO9Q 4FYVB 1WI6A 2N7CA 1YZ7A 1RAGB 5ITHA 1HBNA 1RCOB 2KKHA 2J0SD 1J5EF 2JEGA 3UN3A 2V4RA 4GMKA 4NI2B 2KJVA 3K5NA 4DN0A 3QJJA 4UZBA 1KVKA 1FT8A 2XNQA 1ZA2B 2LCWA 4NASA 2RNEA 1F2GA 2H4YB 4JYAF 2FGCA 2H3EB 1M1GA 2UUBF 2A3JA
chains in the Genus database with same CATH topology
2RILA 4RW7B 3W2VA 1GXLA 1YIJS 3B4DA 2KM8C 2PEHA 3ZZZA 1S9GA 2E1CA 4ZHRB 4DR1F 1UJ6A 3DM2B 2HVIA 1S4FA 2QO3A 1SL2A 1TVRA 2VH7A 3LAKA 1DARA 4FN5A 1HFEL 3I96A 4O4GA 1NH7A 3KLEA 2W7AA 2AYEA 2F40A 1F60B 1PC5A 4OZ5A 1T94A 3NAIA 3G6ES 2YWHA 1RT7B 3K8WA 2RQCA 2C3OA 4LMZA 4E8UA 3LP2B 1VQ4S 4OZNA 3DLLQ 3F44A 4CI0B 3KK1A 3CC7S 2ATLA 1R8AA 2DNRA 3MDFA 3TVKA 1IKWA 3Q8SB 2E9TA 3K2YA 4RWWA 1M0SA 2BXJA 2J0WA 1O0PA 5HO4A 1XR7A 3KLHA 4YR0A 3UPFA 4X2BA 2KDOA 2NSCA 4DSEA 2ZH3A 3S01A 1VBXA 4OLOA 3RYLA 2MQMA 3SV4A 3PR5B 3T1YF 1KOOA 1LW0A 3BZQA 1P27B 3MAHA 5KFAA 2JLFA 2ZHAA 2V4JB 2ASJA 3TARA 2BVZA 5IS2A 4HI1A 2CFXA 4ETXA 3Q8QB 3G6VA 3QAUA 1RTDB 5IT0A 1U1RA 4IOAQ 2HHPA 3HHKA 5DGBA 4EGLA 2XG8A 2WAQD 2DR8A 2D9OA 3I31A 4C3LA 2BANB 4H4OB 2KM8B 5J1EB 4QIGA 3IRXA 2OIHA 4C0BA 3CF5Q 2HVZA 3MM5A 3GYNA 2YNIB 4OIXA 2ZD1A 2XO7A 4DR7F 1TKZB 1R27B 1T03A 1N33F 1LQ9A 4B02A 4DQIA 3DFEA 2HGNA 1TKDA 3QGIA 3CXCR 3H8YA 2Y1JA 2KJWA 2HLUA 1MW7A 2XULA 2JEFA 5KFDA 4ZVEA 4O23A 4JV0A 3FVYA 1DFDA 1O51A 2PC6A 3FSXA 5KFQA 3DRRB 1HARA 2IYIA 5LMUF 1TK0A 3GIMA 2HHVA 2F8HA 2JVRA 4AL7A 2R7RA 5KT5A 1YRUA 2WRMA 2UVRA 1FVSA 2AW0A 4J9SA 4TY8B 4EFAC 2R8HA 3J81Y 4C0HA 5HROB 2MZSA 4JI5F 3MPYA 3N6NA 1H6KX 1IJEB 4WTYA 1A7GE 1S49A 4JOUA 5HMYA 2UUTA 2ZNYA 4UUWA 3J7YU 2BACA 3PX4A 1Y4ZB 1DRZA 3SFGA 4W92B 5B7WA 2MZ1A 1IBKF 2VC0A 5SUHA 4DG1B 4YUDA 1NAQA 2AX1A 3I9ZA 4NLVA 4CH1A 4U7CA 3HHLC 2B9WA 1L3UA 1VRTA 4X4OA 3CUNA 1OSCA 2XMKA 3CDUA 1VHFA 2VBYA 4WFAQ 2Q1LA 5F3ZA 4ERDA 1HW8A 2DGUA 1HBNB 3GIJA 4K4WA 2GMJA 3IR6B 5EWGA 3DNCA 1F5CA 2ZUGA 2AX0A 1YGYA 1DQ8A 2E44A 5A0YA 3FFIB 1RT2B 4LQ9A 4CQ1A 3CJ3A 1ZTTA 3TAPA 2LXIA 3OFEA 4TKTA 3KK3A 1VGYA 3NLCA 2K8GA 1KLNA 1VJWA 1VQNS 4ELTA 2C3PA 1T95A 1WWHA 4NPOA 5CH7B 1TR0A 2Y1RI 4O3QA 3KHGA 3MWBA 1KQKA 1E6VB 5D4OA 1JJ2R 3KJVA 4I0WA 5FDLB 5I42A 1GXUA 3OV7A 2ADCA 1N0UA 2W24A 2ZE2A 2XHWA 3MEEB 2HHWA 3E8OA 2LEBA 4X4QA 1Y5IB 3CCES 3PKYA 4FYDA 4J9PA 4DR3F 4E98A 2GNKA 2XSFA 2J0QD 3C3LA 1K1QA 2VPYB 3VAFA 1S97A 4L6V3 1RYSA 3AB2B 3MR2A 1KLMA 1SL1A 3W2VB 4DL5A 3GSDA 4PWDA 2O66A 1R8PA 2B43A 1QM9A 3HHLB 1TVRB 2F3JA 4BHQA 5A8WA 1SUQA 2A2CA 4O4GB 2MKCA 3KLEB 1L3KA 2OPPA 2UZAA 2PMHA 4DLEA 1I6JA 2L9NA 2WW8A 3BB5A 2CVEA 2FGOA 1C4AA 4QW8A 2UP1A 4PKDB 2W9CA 3KK1B 1IKWB 2HRUA 1RJJA 2NZ4A 4DN9A 3KWMA 5JVGQ 1B0TA 2R2SA 2LQJA 3HHLD 3KLHB 2KFYA 3LUYA 4RBUA 2ZOGA 1HL6A 1NK0A 3L09A 2ZOMA 3G6XA 1YITS 1FCAA 2YWEA 5A8KA 4URGA 4ITSA 1YJUA 1WG1A 3U1MA 4JV5F 2FLLA 1F5BA 2OKQA 3HF5A 2GC8A 1XR5A 5AJ3F 2EVZA 5KFVA 4B9NA 1B64A 4AE5A 3QO9A 3TAMA 3V5RA 2ZZNA 4KB7A 5KG3A 1VQKS 5I3PA 4NLPA 4HYKA 1Q8IA 3HHNB 3N5BA 1U2RA 4LF8F 1DQAA 2K1RA 5KFEA 3EYZA 3IRXB 4V19X 4DOZA 3Q8RB 4A46A 3MM5B 2ZD1B 1MMLA 3Q23A 1GH8A 1T03B 3ZZYA 4HT7A 2G13A 3VQSA 4OHVA 3BGLA 3MM7B 1ZZNA 4ILLA 1X5OA 2BABA 2RVJA 3R1LA 1JK9B 2E5IA 2PA3A 3LAMA 1FK9A 1LK5A 2ZZMA 1IM4A 4DQSA 1NKEA 5M2UA 4DBQA 5D3GA 3HHDA 4N8NA 1TKTA 4RWXA 1QLNA 4H4KC 1HA1A 3I5AA 2KG1A 3RBEA 3OL6A 4Q5VA 1JX4A 2V94A 2J6SA 1S6UA 4A8OA 3RTVA 4JI6F 3I87A 2ZDOA 3DI6B 3LH2S 3PRBA 3J7A1 1XC9A 3EXYA 3CO9A 3CD6S 1NRKA 4FF1A 3CD5A 1Z2LA 2EK6A 4NA3A 2PD1A 2APOA 3TAQA 1FDDA 3O44A 3LPYA 3IAM9 1JWWA 1UJ4A 4C4WA 1QJHA 4KIAA 2XC9A 4LFBF 4ZPWR 4OJGA 3OXLA 1VQ6S 3OR1A 1VRTB 2OH2A 3T9NA 4IR9A 4K4UA 2MSTA 3KG4A 1IQZA 3NP5A 1VQYA 4TLQA 1KFSA 1YG0A 5D6GA 5FLXY 3RR8A 4N5SA 1MMDA 1SC6A 3MM8A 6FDRA 3HP6A 3ETOA 4DQPA 1ZAVA 1X0PA 3H59A 1UEVA 2PI4A 3E51A 2ZJQQ 2MXYA 3P3DA 3CMES 1IBLF 5LT5A 1W2BR 3CD7A 2D9PA 4OI6A 4JV2A 4TU9A 4HVZA 3FSIA 1VBZA 1URNA 2F9JA 2Z8QA 2CJ9A 1M5SA 2NXUA 3RU0A 3N6LA 1DURA 4QW9A 4FS1A 4Y28C 3KK3B 1NK4A 1VC0A 1U25A 1HW9A 2GGPA 1HBOA 2P6SA 4NWBA 2J5AA 2J9DE 4YY3F 5KFIA 2IVYA 2P9EA 2VODA 3KJVB 2ZE2B 4OI1A 1UFWA 3H2VE 3SCLE 2DITA 2DCLA 2MMYA 3P5TL 2PIIA 4OJHA 4QIVA 1UVIA 3CIZA 1WF0A 5KFSA 2YKNA 5LJ5Y 3EGWB 1V3RA 4WU3A 4IH6A 4WXOA 1KLMB 2QA1A 2A2DA 3UR0A 2XWYA 2PSZA 2V4QA 4PWDB 4YFUA 2YH0A 1PILA 4F50A 2C42A 1JIHA 5F9LA 2E5GA 2KN4A 2J76E 2VC1A 3H98A 2YNGA 5A8WB 4ECVA 1JJ4A 4F4XA 3KNAA 2YWFA 1FE0A 1Q78A 2IBOA 2OPPB 2CRLA 2VASA 3G96A 3V4IA 4YB5A 1LV5A 2UUWA 4TQRA 1L3TA 4PXCA 1FRKA 4DJBA 2V2KA 2VQEF 2CJKA 3PRDA 1SV5A 3AAWB 2NR0A 2I5JA 4OZ1A 3H2LA 3BO2A 1HD0A 4BC9A 4PXEA 3W2WA 2AGQA 3SXLA 2HHQA 5B0DA 1UVLA 4AQYF 1FJ7A 2UV8A 1LXJA 2PT0A 5A8KB 2V0NA 2FVPA 5LL6d 2XMVA 1S6OA 2JC0A 4XPCA 2BR0A 2VFSA 1CC7A 2D74B 1J5OA 3VZIA 4F3QA 2KHDA 4ED3A 2LA4A 2QEXS 2FIUA 1R31A 3QO9B 3TAMB 1QAYA 1AXQA 3HMJG 3KLGA 5KFPA 4B9UA 2NPIA 2XMJA 2Q79A 3WBZA 4CT8A 5EHHA 2VBWA 2R8JA 4PG7A 3TA0A 1JB0C 4UQTA 3FZBA 1S1TA 3MZIA 3M2RA 1DAXA 2FVQA 1B0PA 3S7RA 5C25A 2K1RB 4A8QA 1QTMA 4HDHA 1UKUA 3M2VA 4USJC 4YB1P 2NQPA 2XMMA 2UUAF 5K8MA 5BJRA 2VPZB 2RU3A 3RB3A 3BQ2A 4DSJA 2QT7A 1VQLS 2DT9A 4JI4F 4ZP6A 4ELUA 4DR5F 3M2UB 1WF2A 3LGNA 4M5DA 4PWUA 2HHUA 2OTJS 3DU6A 4QPXA 2HGMA 4KSEB 3MECA 1FK9B 5CYMA 4WF9Q 2RIJA 3FQKA 2FUG9 1TKTB 1U8SA 1QSLA 1CLFA 1DZ5A 2K2PA 2J6UA 2I2YA 4I67A 1XERA 5FIIA 1DTQA 1XR6A 3DRXA 5DLGA 2ZJRQ 2LLZA 2R2UA 1CC8A 2MHNA 4RUHA 4R5PA 3CJ2A 2Q3PA 5EGYA 2DNHA 2OSRA 3KNGA 4XPEA 5G0RA 5KFMA 2AJ1A 2R7QA 1WG5A 1N54B 3PJXA 1HWLA 4QIFA 3PW5A 2OTLS 3SSSA 3KK2A 3T5KA 1UFLA 1FDBA 4EWTA 1C0UA 4LQ3A 4UQGA 4PXDA 4IRKA 5LSRA 2Y0SD 3CDEA 4DV5F 1IKXA 3OR1B 3GILA 4EZ9A 4ZHRA 5F0UA 1P1TA 4ZPBA 4JI7F 4N8OA 4ZS6A 4QU6A 3D1QA 3QJLA 1JLQA 1KFDA 2GQQA 3MM8B 2DO0A 3MR3A 1S9FA 3MGJA 1NJXA 2JL9A 2WSCC 2WBMA 2M4MA 1H38A 4QWBA 5H9EJ 3NWGA 3BDEA 1GNKA 2DH9A 2NPFA 3FJ2A 2UV8G 4ED0A 2FPHX 1FF2A 5AXMA 1N6QB 1SJQA 2DHAA 2OPRB 4ECXA 2XS2A 3OVBA 2QMWA 4BWMA 2HFOA 3PIOQ 4J9RA 1ULRA 2GGPB 3FDSA 1HBOB 5KG4A 1FDAA 2E29A 2JWNA 3RRHA 4KTQA 2RQKA 3ZZOA 2MKIA 3NBPA 1R3NA 4QJVA 5KFKA 3MCSA 4IH5A 5F9NA 1WELA 3L7OA 2DVIA 1KSPA 2LKZA 1X4GA 3WC0A 2VZ9A 1HNVA 3MM9A 5L8RC 6FD1A 3BSNA 2RDJA 1R0AA 4IDKA 2MKKA 2ZH6A 4C11A 2YKNB 3PR4A 2GMHA 2KT3A 1SKWA 3BN7A 1Y5NB 1VRUA 1NK5A 2DGOA 2BM1A 4DX8H 2CQDA 4X4NA 2OPQA 4JBCA 5KFOA 3V6KA 3I4PA 4NCBA 2CPXA 2RF2B 3JSMB 1AFIA 1LWEB 3MF5A 2YNGB 3GMGA 3QYYA 3CEDA 1WTBA 2HVHA 1VK8A 3L7PA 3V4IB 1OWXA 3HZGA 2CIMA 3M32A 1FD8A 4DS4A 1QSSA 4FVMA 3T1AA 4EEYA 3I0RA 5HMXA 4TU8A 3NNCA 2CJQA 1SV5B 1X7VA 3ZC4A 3MR6A 4DFMA 2HS0A 2I5JB 2NS1B 4OMFG 5IXUA 3W2WB 1JNZB 3D0HE 3H20A 4YEAA 1MWYA 4K50A 4NMLA 3TQ1A 2WCXA 1BQNA 2EG1A 4OFZA 2J0XA 4ECRA 4X4RA 5THWA 5BR8F 3UFCX 2DHGA 2J9CA 5E33A 1QE1A 4ED7A 1KR4A 1QAXA 5J2PA 1S1UA 2ILZA 1SH0A 1J5OB 2JFKA 5KG1A 3MMCB 1U6ZA 2HNZA 1WHVA 1RQ0A 2E5HA 2YKMA 3I0SA 2XCAA 3MR5A 3PX0A 5HROA 5B0FA 3KLGB 2DTJA 2AJ4A 1S6PA 3IRWP 1S0NA 2R4FA 1NK7A 1K73T 3D0GE 3T5HA 5E3AA 3I5CA 1UW4A 3WDOA 2IRUA 3ISNC 1S1TB 4RX6A 3M2RB 1P9QC 2RE1A 5C25B 4F2SA 3CIMA 4DG1A 5F8JA 1WI8A 3M2VB 3RRKA 5AE1A 2LU1A 2OD6A 1HI8A 4ZCLA 2DGQA 2E7WA 2JDJA 2EG2A 1ROFA 4HKQA 1J2VA 3CMAS 3BQ0A 1TFWA 1S77D 2QLXA 5IQQA 4M5DB 5T14A 2R7SA 1HWUA 2KYZA 3VF0B 1X5PA 3AQOA 3MECB 4QR1A 2DGTA 3IC1A 5CYMB 2E1RA 4EZ6A 4IG0A 3LWLA 1G2EA 4QU7A 2FJBB 4KHRA 1RT2A 4DR6F 2XS5A 1U2FA 3KHRA 2DHSA 3ENVA 4OX9F 3KMSA 3TO8A 2LU2A 4Y3CA 5D4LA 3THTA 4IUFA 1Q7LB 3LGMA 4MJKA 3MD3A 4R5PB 4IFYB 1Y0HA 4C8OA 2MJNA 4Q8EA 4H54A 3KKFA 5CD4H 4ICLA 5G0RB 4Q8FA 3MMJA 2BV3A 3H5YA 4DV0F 1TK5A 4WXWA 4Q0BA 3MEEA 5GAGI 4J5OA 4JI0F 3QZ7A 2Q6CA 1QAIA 3WC2A 3KK2B 4R0JA 3HKWA 3OTBA 1C0UB 2RUGA 4I6YA 1ZPVA 1UETA 3OVSA 1FJEB 4LSLA 2DNMA 1OPIA 2BW2A 4I1TA 2HWTA 3TVZA 3MXHP 1IKXB 2HHHF 4PXBA 5HBMA 1QY7A 2GA7A 1VFJA 4B9LA 1JLQB 4BC7A 3HHLA 2ZVSA 4F4WA 4MK8A 2JC1A 3TW0A 1IQTA 1U6FA 2J7KA 3G86A 4NZ0A 4B3RF 2WHOA 1RWUA 1VIOA 1XN9A 1P6TA 2CQBA 3TNVA 5KG5A 2D3OR 4V19J 4U7UK 1M5KC 3BSOA 3CCZA 3SFUA 1TUVA 2ACYA 4N47A 1S1VA 3X1LB 3HT3A 4G3IA 4DL6A 5E41A 3ISND 3EPGA 1VQ5S 2NLWA 1WHXA 2YNHB 3TX8A 1S6QA 4PCQA 3JTPA 4ZP8A 1HBUA 4DEZA 4U6PA 2R2RA 1ZPWX 1YRXA 3T5LA 4WKYA 3P49B 1HHSA 2RRBA 3W3SA 3KLIA 3NBPB 4OL8A 1FXRA 2LDIA 2OAUA 2WONA 1R6YA 2EPIA 3QGPA 4I64A 4PUOA 5HQ8A 1U1MA 1SQEA 5KT6A 2W4DA 2NUUG 1G3OA 1HNVB 3R5AA 4OHXA 1O5JA 3MM9B 2L08A 3KOAA 2LEPA 5CQGA 1R0AB 1MNEA 4IDKB 4X65F 4C11B 3VAIA 2MKHA 3LP0A 5B0CA 5IM0A 2FD2A 1VRUB 2HWIA 1V6HA 1KD1T 4TNOA 1FRIA 2OPQB 2KTQA 3ISZA 1OQ3A 3FNNA 3DLGA 4MK7A 1AW0A 2Z0GA 3VZHA 3X3UA 2N7YA 2BQ3A 4ALZA 3A8EA 4K4XA 1JXLA 1TK8A 3MD1A 1X5SA 3UCUP 1NJYA 2VKZG 4I6WA 3M32B 4C98A 2XSJB 4KT0