3OFVA

Crystal structure of peptidyl-trna hydrolase from escherichia coli, i222 crystal form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
190
structure length
190
Chain Sequence
TIKLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLLVPTTFMNLSGKAVAAMASFFRINPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRIGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAARCTEMWFTDGLTKATNRLHAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Crystal structure of peptidyl-tRNA hydrolase from Escherichia Coli, I222 crystal form
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 56
structure length 190
sequence length 190
chains with identical sequence B, C
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 3ofvA00
4Z86A 1RYBA 2Z2IA 4JY7A 4JWKA 4FNOA 1RYMA 4FYJA 3KK0A 3NEAA 4JX9A 5IVPA 4FOPA 2LGJA 4ZXPA 2MJLA 5IMBA 4DHWA 4ERXA 4FOTA 4QAJA 3V2IA 2NAFA 4JC4A 2Z2KA 4QT4A 4QD3A 3TD6A 4YLYA 3TCKA 4DJJA 2JRCA 5EKTA 3VJRA 3KJZA 2PTHA 4QBKA 3P2JA 4HOYA 4P7BA 3OFVA 4IKOA 3TD2A 1RYNA 5B6JA 2Z2JA 3TCNA 4OLJA 4LWQA 5IKEA
chains in the Genus database with same CATH superfamily
2VI5A 3PCXA 1PBTA 1JTEA 1JTFA 2FH5B 4X8LA 4I4LA 1Q16A 1W36C 2DSTA 2VWHA 2NU8A 4S3MA 2C5LA 5EUCA 1Y63A 4JYMA 4KP7A 3QUTA 4EVQA 2YYZA 3LX8A 5DHFA 1ZGJA 1G5TA 2GQ0A 4DA0A 1RNLA 4WUTA 1KZ4A 1G7RA 1XO1A 1ZVKA 2DJ5A 4ZV4A 5I4IA 3V1TC 3BGVA 2BSXA 2J3KA 2VBGA 5KQPA 2I76A 4CI9A 3S8YA 1U99A 3DBLB 4NE9A 1K66A 1C14A 3MTGA 1Y7LA 4QEZA 4RY9A 1E0KA 1J1ZA 4DB2A 2QIPA 4EHNA 4V0MA 1AGRA 3GP8A 3TE6A 1TM1E 3UK1A 1RYNA 1E96A 3EGIA 4O2RA 1IXKA 1A5TA 1CY1A 1MH9A 1T9ZA 2C4NA 3E70C 4QGHA 1L7DA 4TLLB 5A71A 5GIPE 2DU8A 2CSXA 4TMFA 3IO5A 1LNQA 5KI6A 4II7A 3EEFA 4D9CA 3GPCA 4ZGWA 4WOPA 3ORSA 3WGQA 1N9ZA 3ETJA 1W30A 3NM6B 1XZQA 4GPD1 1A69A 3GQVA 4AKHA 2QF7A 2I4TA 4OM8A 4AZ3B 2MT9A 2W43A 2B25A 2JAXA 1VKNA 2XJ9A 2VYFA 3H5AA 4POOA 3HXPA 1JJBA 3BEOA 2J9XB 3QTLA 4P7KA 3JS5A 2V5AA 5EIOA 3WL7A 4C7VA 4G0MA 4HYQA 4COKA 4BFTA 5CA0A 1MX9A 2BM1A 2E4VA 4N5LA 2P5TB 3ROPA 3ENKA 3COSA 4KFSA 2PT9A 1Z3IX 3QW2A 4UDXX 1NVVR 1N7GA 3B1ZA 4J8PA 5THXA 4D0GA 3ZCPA 3R3WA 2ZTHA 3K9FC 1FQJA 1J2YA 3PICA 4ZREA 1GV1A 3WAKA 3U4QB 2RAUA 4F21A 1R5BA 4E5UA 4ZJZA 1LLCA 2PX0A 3KDAA 5JS1A 2K2QB 4J1NA 4IICA 5FBHA 1GZUA 1WKVA 3MWLA 3WYEA 3VKVA 1W36B 1CVLA 4FEYA 1KZ9A 2HEGA 3RTDA 1N0IA 2G08A 2OD7A 3U16A 1E9RA 2Z2KA 5KTNA 2HWXA 1G63A 2ZBGA 4GVXA 4JI2B 1W0CA 1DKPA 3GI1A 4I36A 4O1MA 3M6AA 4EZIA 2TMDA 4N39A 3FUWA 4J7AA 5K20A 1M72A 1X74A 1XJCA 2O6LA 3GJ8A 1WE2A 3DHVA 3ICPA 4M7WA 3S8MA 2PPVA 4U2DA 2C4MA 2O8FB 3CPSA 3K8QA 4AJLA 1G66A 3FMGA 1RE1A 4LZWA 1H6DA 1T29A 3I9NA 2IJGX 5J4LA 3MRSA 1E94E 3L7JA 4Q5IA 2GXUA 2VYCA 3KJGA 4K0RA 5FTWA 1IN7A 2A1UB 1QRTA 1CUHA 1EEXB 2FX5A 1Y80A 2VO1A 1VG9B 2WTXA 4RLHA 5D6OA 4D57A 5AW8A 1NF8A 3F8TA 3FCEA 4IGFA 4PFQA 1QC5A 1KRWA 3LX4A 2P1ZA 5F9HA 3I72A 3Q1LA 4MYCA 4GC5A 2ID8A 4G85A 3H2GA 1N6LA 2ZT6A 3G9TA 2DTEA 3S2IA 2VSFA 1MAUA 1C4KA 2P4EA 5CXUA 3C3PA 1T8SA 4NYMR 3ILXA 1UDXA 1KKLA 4LZOA 5F1YA 1PO7A 4ZXFA 1GRCA 1WB5A 3IMFA 4Z4EA 3LYHA 1VIDA 2PL5A 3S99A 3T5MA 4C07A 4CCAA 5HWSA 1U0RA 3KWLA 3FTNA 3EGXB 3FCXA 4CU2A 2C7GA 1TO1E 4IDFA 3VR6D 2IYUA 2FP4B 2V7GA 1OVGA 4MR9B 4CNQA 2J7PA 2HDNB 2A0XA 5KB3A 2OBBA 4RUKA 3K8YA 2PVCA 3TR6A 2IIVA 4I55F 1YJXA 1QBKC 1MVNA 3BCSA 3KIPA 4CMAA 4BAGA 3FWKA 4LXTA 2CT8A 1B26A 2ECPA 2I22A 3V4SA 1BS1A 2Y1CA 5BMOA 1FW6A 1ITZA 2IKQA 3LYUA 2I1VB 5EXDA 3P4XA 5EJ2A 1NN5A 1BSVA 3VR4H 1X7WA 3LHKA 4DE5A 3P32A 3KJZA 4L1KA 1NF9A 2COKA 1NW3A 3GNQA 3M0EA 1XTPA 3T0GA 4IL5A 3EC7A 5HKBA 1YC2A 4YCCA 3M49A 1QTRA 2DT5A 2HIMA 5LYYA 4S1WA 3A26A 4OXNA 1MG5A 1E9SA 4ZOLA 3OJLA 3HJUA 1Q11A 5IWAB 1XTKA 5DTQA 4PO3X 2CXOA 3FVVA 4M0UA 2P2GA 3C3EA 1WR8A 1ESMA 3VYWA 4LCJA 2PYDA 1NU6A 3QA9A 2IZOA 2VWQA 4N8EA 1U3TA 4EJMA 1RC0A 3C5CA 3FVQA 2NTNA 3OZRA 5CXSA 3THXB 2G0AA 2PTGA 2VBCA 1IBRA 2CVZA 4UE6A 1IHPA 2V9ZA 3EIXA 1LZKA 1ZK1A 3QKTA 5F64A 1TQ8A 3SMQA 1P1IA 1KAEA 3WGGA 3NHKA 3L8MA 5EIWA 4E30A 2O8BB 1VMEA 2EZ9A 4PYLA 1X1DA 3N05A 3WTCA 1H1LB 4X1OA 5J40A 1R10A 2IU3A 4CL2A 5KWJA 2UKDA 3S1AA 2QQ5A 3OX3A 5G0TA 4DM3A 4ETNA 4O2BA 5JJ5A 4ZAWA 4DV7B 3FVWA 1JTVA 1O87A 3HGTA 1EYZA 2L2QA 3ZBPA 4TQAA 4EOGA 3GAFA 4B3XA 3O3MB 5C46F 5IVHA 1FLAA 1QF6A 3F6RA 3D8RA 2YHAA 2VDPB 2POCA 4DANA 4BNLA 4W99A 3Q5DA 4XUGB 4KRFA 3EUFA 4MULA 2IY9A 2QTBA 3CX3A 3IERA 3MJTA 2VK2A 1UK8A 2JB9A 1Z2AA 5LOVA 2FQ1A 3GP5A 5EINA 2G5CA 3IQXA 1I7QB 3GEDA 3TRIA 4JGIA 3KD2A 5K01A 2ETXA 1K89A 2R5WA 3AHIA 3COYA 5KAPA 3MJDA 4FC6A 1NVXQ 4PYIA 2E5FA 5FUMA 5E4TA 4EMSA 3LH5A 3AFHA 1M34B 3OA0A 4WX2B 5FQNA 1J21A 2C1XA 2QM8A 3MMNA 2W2LD 1UM9B 2A9OA 4GPTA 4IGKA 1K5GA 2PUEA 4RHEA 3CVJA 1FS4A 3K1ZA 1G6HA 3LUCA 5KO2A 4TMTA 4U9UA 3LIPA 1Z2DA 3P20A 5CURA 2Q6IA 2HH9A 1DJMA 5AVKA 1SM4A 5H83A 3W1WA 1F8GA 3HPQA 3LC7O 3AZQA 2O3SA 2E5WA 1QJCA 2Q49A 3H9GA 1PQPA 1UR5A 2J8ZA 4PGMA 5TIIA 2UU9B 2PGXA 1H3EA 2BFWA 3ONNA 3L93A 4G5FA 5ALLA 3X1XA 3LC2O 2WUWE 2QRMA 4JUCA 4A3SA 4YT8A 1T5SA 4EGJA 1RWOA 3VSDA 4CF4A 4LBZA 1ES9A 1JNXX 5JYBA 1L1EA 1MA3A 3ZOZA 5BN5A 1MC5A 1VKZA 1C9YA 1NW8A 1TCVA 1ZD4A 3GOQA 4BO3A 5EKUA 5FKJA 4E5MA 4I4CA 4LDAA 5TJ9A 2B4TO 3IULA 1XAGA 2LCIA 3DMGA 3OWOA 3QFHA 4DR7B 3ZWBA 5DGXA 1MRZA 1VIVA 2GYVA 2XDQB 2R1UA 4LYEA 2YVKA 2ZQ5A 1N2CB 1P5ZB 2DY0A 2WTAA 3KPVA 3L7DA 3NIBA 3QKRA 4XVRA 5JT1A 3B3QA 1KI1A 2IYXA 4A0QA 1GZ5A 4KWEA 2I6TA 2A4MA 4L2IB 4UTOA 2OBXA 4KHPB 1Y8RB 4K9LA 2ATIA 1FDRA 1ONBA 2HSGA 4KQXA 1DEXA 4H4DA 4MR7B 2WT8A 1WDLA 3NIWA 4P7GA 4B3IA 4Y6RA 3A3OA 2NZ8A 2NZUG 1QHNA 4NP6A 1J97A 4BTEA 4B8WA 2WIGA 1MCZA 2X1MA 1SOWA 5CR9A 4B4WA 4HEQA 1E3TA 2DR0A 4GNKA 3O0TA 3QU2A 5I9SA 3CRQA 3PLRA 2FXVA 2OTCA 3KYBA 4B3FX 4CTNA 5LVAA 1ZX1A 4JLBA 2V8OA 4DGSA 4HUJA 1M67A 1FL9A 4D74A 1WAMA 3W8EA 3L8EA 3BE8A 3N2ZB 1I5OA 2HMSA 2NQ8A 3T9AA 1A9ZA 4DLSA 1WMBA 2BMFA 2PIAA 1P29A 5KYXA 1P0MA 1EWYA 4UEWA 4C05A 2QB5A 5HVNA 1H9BA 1WNTA 5KTPA 3CHYA 3LM8A 3UYKA 4C4YA 4M22A 3SHVA 4KVAA 4ITRC 2Y8EA 3LQKA 1W87A 4R5HA 1EFKA 1UANA 2EC5A 3K6JA 1AKEA 4Y2YA 4GYJA 1RAFA 4IOMA 1JH8A 1SCQA 4RY2A 4R8VA 1NF3A 5B3AA 1LJUA 3GEHA 3AR8A 1CUZA 1QPBA 4WV3A 1Y6RA 2H31A 2VF4X 2QD5A 3KZVA 3R3HA 4L3WA 2CLOB 3TLBA 1OCEA 3I1YA 2C31A 1U7OA 4QUDA 2EP5A 1O6FA 1YA4A 1R66A 4HPXB 2UZ3A 3R5TA 5JMPA 1USIA 2W9XA 1F3OA 3UB3A 3D3KA 4LBVA 1C7RA 5FPTA 1X1EA 5K0NA 3QNMA 3PQ8A 4NU6A 3IOYA 4B1FA 1X38A 1TLFA 2BD0A 2FEAA 2HWUA 1D4OA 2WMOB 4KFTA 5GMOA 3IESA 1ORRA 1J5PA 1PJSA 4IWYA 2P4SA 2BTEA 2NSHA 2QE7A 2PEZA 1SC1A 2NZYA 3O21A 1EP2B 1M6HA 4PS0A 2QR2A 3EIFA 4NZOA 3WRYC 3EDRA 2MJLA 1TB4A 4QGSA 2YCBA 4FN5A 5DN6A 1AUXA 1RADA 3TQTA 3R6GA 2QI9C 1YZQA 2LDXA 2VZ9A 3FFBA 2GEUA 4TOIA 2H51A 5BYBA 1FYVA 3F67A 1KMHA 2W2VA 3CZ9A 4E5KA 2OLJA 3V1KA 3G2HA 4TQ9A 3HJHA 3KXKA 1JKJA 2W8BA 1PT7A 1KAMA 4ZOBA 3ZDYB 1FRZA 4YRPA 3FLAA 3AEKA 2C7RA 1F12A 2MHCA 4R2WA 4MVWA 3LFHA 4UDOA 3WB2A 3OOSA 2TMGA 4G0YA 1FSPA 3NC1C 3K73O 2ZRGA 2FVXA 2Q8QA 2L69A 4DCSA 3IHLA 5DBFA 4YRTA 3JQEA 1Y1KE 1WLSA 1C30B 2FOXA 3GEBA 5ALGA 1UBFA 3C3WA 3Q7PA 4N7MA 4UCQA 3PNSA 4B33A 3TSAA 1BWSA 3TQHA 3WIBA 3OVMA 4JC4A 4PXYA 1CCWA 1KIAA 2XRYA 3NVAA 4GEGA 3V4PB 4HAXA 1TM4E 2ASVA 4N03A 3W5JA 1R0WA 2W6QA 3BWCA 3R6WA 4RVDA 2CXNA 2YQ5A 3P9YA 5K3SA 3WYGA 2DZDA 1ADJA 4TXHA 4EGSA 2JAQA 2HMVA 4OOFA 3KB2A 3FYCA 3E3NA 4BN4A 4BRWA 3ZE7A 5GVRA 5AIBA 2I3ZA 3QVLA 1TCBA 3ZQ6A 2C9MA 2ZRQA 2GHIA 3PPWA 4L85A 1YJ8A 4ID9A 3VR5A 3IAS1 5TT0A 1D8AA 3LA8A 4IYJA 1SXJE 3RADC 4BQEA 2QN2A 4YR9A 1AT1A 4JUDX 4MLDA 3BN3A 3IEUA 4H0NA 3T95A 4ZZ3A 3MGAA 1XVUA 721PA 3JAWA 4WWHA 4YQEA 4MB6A 3QX7A 2CC2A 1R1DA 2P9JA 4K9DA 3PHLA 4NYJQ 5K0LA 2EHJA 4RMGA 3W5AA 4CYMA 1MIOB 5J43A 1ULSA 3E7FA 4LHEA 3R0VA 3KQNA 4J0IA 4XPIA 2WAXA 3NHZA 1HORA 1CHDA 5EJIA 1O89A 1DV2A 3TEJA 3BDVA 1ZP6A 3FDZB 1P8JA 1U6IA 1YZYA 3G0GA 1EZ4A 2WU0A 1Z4PX 3C6MA 3K96A 2J9ZB 2HDHA 2AN1A 1PGPA 3BGDA 3M89A 3D3JA 4MXDA 5I7FA 4HXEB 1HFWA 1V0JA 3FGNA 2OP1A 3C15C 3QOYA 4UHJA 3IQZA 4WEQA 3WR5A 4W1SA 4YUWA 1YS2X 4FCCA 2HLDA 4LXXA 3RE1A 1EK6A 5L3QB 1BMFD 4JUBA 4RENA 1XZMA 4XW2A 4O4JB 3M6MD 2FG7C 3NW9A 3INGA 5K99A 3BFPA 5DJ5A 3KSZO 1QU3A 3ENNA 1KDOA 4FE7A 4HEA6 1I4TD 3IEXA 4XARA 5FDFA 1EFCA 3GY0A 5HQ3A 2FDCA 5AK0A 3JAKA 4A92A 1ACMA 2VVTA 4NOJA 4NY1A 1S1CA 4PSCA 4XSGA 4DC9A 5AP9A 5FI3A 1QQ6A 4A0FA 4P9NA 3FBWA 3GJZA 4BKRA 5CFOA 3I04A 1JX6A 2GFQA 3LPCA 3LO8A 3VC2A 1TYBE 3SOZA 4A2QA 4GE0A 2X1LA 2WU3A 4MR8A 4RV9A 2B1IA 2DBQA 3ZNPA 3TQCA 4JKYA 2PGIA 2ZIZA 2QR5A 2YNMA 1LLQA 4HMPA 2A5LA 5JXJA 1NIJA 2R6JA 2BW0A 4R7TA 3OZIA 5EJAA 2VNJA 2Y6VA 2FZVA 4JU8A 3QWIA 1JDZA 3TKLA 3WKCA 2DMRA 5G53C 1PFKA 4C3UA 4ML3A 3PE3A 4QQKA 4BASA 4EHAA 1Z0IA 1JJVA 2ZSHA 1GEGA 5HQTA 1M1NA 1HYHA 1W6RA 5G40A 4EW3A 5JCPA 1NV8A 1Q77A 4F2HA 3WBJA 1U0HC 1T25A 4DSUA 4EG5A 4ZHQB 3SJBA 1SHUX 1A7KA 2H07A 1I2ZA 1WRBA 2XB4A 2ZBFA 3OI7A 2OSVA 1XNJA 3TQSA 1X9HA 3WHPA 1KFKB 2D2EA 2WDZA 5FNVB 2J3QA 1SB9A 1I6LA 1MO2A 3N39C 4YV1A 1T2EA 1QORA 3OSZA 1QF9A 3MQ2A 4Q1EA 5IDWA 3MS2A 2ZXUA 1GJRA 4WK0B 1NZDA 4ERNA 3ZS8A 3IDFA 5C80A 4H3VA 1SXPA 1WB9A 1LS1A 1XR3A 1SO8A 2XHEA 3AWIA 4FDLA 2GJ4A 1O1YA 1VHDA 2OO3A 1J0DA 4WJLA 2AYZA 2EW1A 2HA2A 3KX2A 3F8WA 3RNOA 2C5BA 2F43B 5DX0A 3KXLA 3L7MA 1PFVA 1G3MA 4OK5A 4NQZA 2CWWA 4DV1B 1NL3A 5GJCA 1J2UA 4O4IA 1L7NA 4RJTA 4JN6B 2XVYA 1BMQA 3RRXA 4X20B 2SCUA 4HQRA 2I8LA 4U2GA 4DR2B 3PE6A 1MO5A 1GZVA 2KBEA 2CD9A 1KJNA 1MPXA 1ORWA 1U6KA 2OUIA 3FB1A 1VRVA 3ENWA 3GJ0A 4OAOA 4XCXA 2MSDB 4RF5A 2XIQA 2OWDA 3OZBA 4BFUA 1DBIA 4BEVA 4CV1A 5IP5A 1RKXA 1Z75A 1PLKA 5J5CA 2I5PO 1EK1A 1QRRA 1GUAA 1NUTA 2GZHA 3CRW1 4WZ6A 5TLSA 2NACA 3L1IA 1OBFO 2GKOA 3BK1A 4ZTZB 2AOTB 2XF2A 4MGKR 1MTZA 2DVMA 1YRBA 2ES4A 4O0LA 5AHRA 4AG5A 2FCAA 2P68A 4OQQA 1BCRA 4YQYA 2QRNA 1MFPA 1G41A 4A0SA 4LSZA 4FOLA 1EFAA 4FBGA 2Y1DA 4LX0A 1MB0A 1D8TA 1AZLA 1UPUA 3FSGD 4FMDF 4ARZA 1XVAA 2C1EA 2CLMB 1FEZA 2VQSA 1MLDA 5F52A 4D42A 2JGIA 4D5GA 4JI8B 1JAXA 1GA6A 1QYVA 2FSUA 3OAAA 1IHUA 4PPNA 4ZCLA 3RHFA 1XVVA 3VPXA 3ZCRA 4UCFA 5JZ9A 4A8JC 3JZIA 1CR2A 1SC3A 4ZMBA 3OE4A 2I6FA 4XM2A 1BX3A 1R0XA 1K6JA 3AXSA 3HZHA 4YCNA 4ZAYA 1QKIA 2PN1A 1NXTA 3C2QA 1Z6QA 1M2GA 3L0BA 3O8BA 3PQEA 4M6WB 3RSQA 4MB0A 3TR0A 3OOJA 2BI7A 1IUNA 1CF4A 2C0PA 3W6UA 5B4VA 1JBKA 3FUUA 4JLWA 4OFXA 4C0BA 1J56A 5LQSA 3UEOA 4TTPA 2DUJA 1DXQA 3O8QB 5IT9A 4WLVA 1CDDA 1FVFA 2KQUA 1WM1A 3CUYA 5KQMA 4FHEA 2YKGA 4GOXA 2Z5FA 3HA5A 3FOZA 4Z3KA 1EWVA 1KOJA 4M8NE 3TJRA 3FMVA 2BF4A 1A88A 2FWJA 1LW7A 5KNDA 2VJBA 3JQDA 1ZUWA 1HEUA 1V8DA 3Q6MA 4BAUA 3CNHA 3DDCA 4ZYVA 2JVKA 3ZUPA 3I23A 5EHXA 2IX3A 1ENOA 1AKNA 1NV9A 3COWA 5DK4A 1VCOA 2IXEA 3TIVA 4YCBA 1PEYA 4P5DA 4C78A 1OHHA 4ZZ0A 3PR1A 4MV6A 2WZQA 1L4EA 5BW8A 5K6AA 1SVLA 1XL0A 4TLEA 4YNBA 1A04A 2PUFA 1EI9A 1DC6A 3NEPX 5DOZA 3NC4A 5EE9A 3V8RA 4G97A 4H15A 3RYIB 1Y1PA 4QE3A 1ZNZA 2YY5A 1YMUA 3NBQA 2QNBA 5AHOA 4J1SA 2GN8A 4LY6A 2CZQA 1FOEB 2VQ6A 1R6TA 4Y2GA 4YRNA 4C2TA 1M7BA 1A4IA 1Q5PA 4TTRA 2QD4A 3NT5A 1P74A 2QJFA 2ZB4A 1N0WA 2P75A 5BMVB 1YULA 1HPLA 4OI0A 1FPQA 1PL0A 2WD8A 4A8JB 3WGMA 4CFYA 1P80A 4EHKA 4EG4A 1ODLA 1WXIA 1KAQA 1A5AB 3FW1A 4L8LA 2P4UA 2ORWA 3NJ4A 3BWVA 1TUEA 8ATCA 2X0NA 2XWJI 2YV3A 1T1RA 5LA6A 1Z56C 3HWSA 3KTFA 3UOWA 4BVGA 2VPPA 1EFHA 4BWFB 5C4IA 2Y66A 3GJ3A 4LPKA 3ZW7A 2BY4A 4IY1A 2B0CA 1Q0SA 3NEAA 4YJFA 4RLFA 5FUVA 1IZZA 5HGXA 2ARKA 3KQOA 3RSZA 4X61A 3CRZA 2WJJA 1DKOA 3CNOA 1W29A 2XW6A 1UMBB 1Z2NX 4YLYA 2P9QA 3R74A 3U4CA 5I7SA 4RW0A 1PEDA 1WKBA 5DM60 2JG3A 1E2HA 1EH5A 3V8EA 4X1IA 4AO7A 3R77A 4DA4A 1POWA 2D0OB 2OZLB 4QECA 1GUDA 3TRFA 4AMYA 3PJGA 2XOKD 4DPKA 3C1UA 2GPNA 3E18A 1D07A 1P9OA 2E1RA 2XCUA 4R7ZA 4BL5A 3QF7A 4MW0A 5HOEA 3PHCA 4GR4A 4I99A 1NSTA 2O2JA 2X8JA 5FTLA 5M5BA 2ZUDA 4I19A 4KUGA 5IDQA 2G83A 2A0UA 2OV6A 2G4VA 3CZCA 4RANA 2IYOA 1CWUA 3K0AA 2C9ZA 1T9KA 2G0TA 4NL4H 5EZYA 2IS4A 5FADA 5HRAA 2PKQP 3O9VA 3HSSA 4ERXA 3UFXA 2X8AA 4CCWA 4RD2A 1IRIA 5BV7A 1CNMA 4RQTA 1W4AA 2V45A 4RPLA 2BKUA 4FGZA 2VHUA 2Z30A 4TQGA 1E7RA 1Q0UA 4UFPA 2AFIE 2HA3A 1XXHA 3C5WP 4D79A 3RR2A 2A9RA 3EBOA 5H82A 2FPRA 4MV5A 5HKLA 1RM4A 4MVJE 5F98A 2EP7A 1ISMA 3VUEA 1Z4QA 4X7PA 1MENA 4XM1A 2FPGB 5EYPB 1PHPA 2H8KA 4CF3A 4FWIB 2DCMA 3ROXA 2I0FA 3ZDQA 2I8AA 4M9SA 3STHA 2EJVA 1TZJA 1V48A 2ZR8A 3QA3E 1P0FA 2M6KA 3ER9A 3KEFA 3QEBZ 5CX1B 3SC4A 5INTA 2RHJA 5P8WA 1JPUA 1R74A 1YKFA 3WICA 4EO7A 2FSGA 1N8SA 3MPUA 3PGVA 1YH3A 3ZE6A 3ZY3A 2H6EA 4F0JA 5IM4F 5DHTA 4XTRA 3HABA 3UJ6A 4CEHB 1NP6A 3RU2A 3TVDA 2AG1A 4OAQA 3KJIA 3AY3A 3GELA 4OSEA 3WSWA 3PXXA 4D9FA 3OSUA 1SU4A 5IX8A 1LK5A 4CDMA 1X9GA 4MS4A 1Z12A 1LRJA 4FB4A 4IIBA 2VPYA 4M89A 5EWJA 5G3YA 3RC3A 3IP9A 4MKXA 3L1HA 4R69A 2Z2XA 3H5IA 1DEAA 3IHTA 3QENA 2WPDD 4N6OA 1COZA 4RV4A 4OP1A 1AC5A 4JWKA 2Z08A 2PO5A 4LJ5A 2HPVA 3ZU2A 3LWDA 2VJNA 3FPSA 3F4KA 2RB4A 5K3FA 4YAGA 3K0SA 1B8VA 3GLRA 4JBGA 1C7IA 1CJKC 3U0VA 2QK4A 4KKVA 1OBOA 4PINA 4RE5A 2PH1A 2HRBA 2ZTLA 5JI2E 1C8KA 3V1UA 1YRQA 2XECA 2VKQA 3QU4A 5F5LA 5B37A 1NRIA 1VG1A 3F6SA 1LBIA 4XQ9A 3FTFA 3EFHA 4Q05A 5KDDA 3RODA 1MGPA 1E4EB 2WTUA 1ML4A 3SFVA 2F00A 4MUGA 4EBFA 5H81A 2CHUA 3QBDA 4PEVA 2HAEA 2AD1A 2WYUA 4P54A 4Q3AA 1SUFA 5LZ5A 2NTEA 7MHTA 2IHBA 4AF6A 4AK9A 1Y1RA 1KAHA 3DOIA 2A8YA 2G9ZA 1O08A 4ER7A 3QOFA 3NNNA 4R1MA 1I1OA 1WVMA 3LBHA 3VKGA 4O4LA 3PDCA 4QXMA 3E2PA 3GRAA 3NYRA 2NNLD 1JL3A 4BFLA 4OTZA 4MV4A 2JC3A 3TVYA 2A9FA 3QNUA 4FGWA 5ALNA 1XN4A 2FZCA 2OV1A 2FPLA 2YFKA 2A0YA 3ESQA 3HYSA 4GT1A 2I7CA 4KTVE 5KSPA 5WRFA 1X14A 4F96A 1TZBA 3QLTA 4LF9B 5A0VA 2DOKA 3E8XA 3HKEB 4KYIB 2VUUA 4M0MA 3GNTA 2JASA 4HCJA 2FPIB 2QX8A 2LNDA 4RSGA 4BNDB 4BO5A 4BB9A 4DREA 4PN3A 3SBOA 4N4AA 1VECA 2ZLBA 3QJ5A 4EO4A 3FWYA 5KKCA 1XDGA 4N3AA 3UG7A 3T3IA 1ZSVA 3RSFA 4KX5A 2GLUA 3TBHA 4QTYA 1SH7A 1A8IA 5AUQA 3SZRA 3FB4A 3ZS9A 3SFTA 1M2KA 2GAIA 2YXLA 1ZN8A 4C0WA 5JSZA 2XMBA 1YR8A 2ZSUA 1ZZGA 2QSUA 2W6JD 1ZDMA 1R6VA 3LUKA 4F84A 5JYCA 2FRDA 2AC4A 4LSMA 4M9ZA 2PWPA 3IAUA 2NXCA 3EEIA 3FHJA 3TDKA 2DFPA 3WKAA 2IXBA 3ZV3A 1WSWA 3RRMA 4B5LA 3W9SA 1RWBA 1I3NA 1TW3A 4PBTA 2QXTA 3AI7A 4V1CI 1TFUA 2ZB7A 1NNI1 2AQKA 2VIIA 4BNVA 9ATCA 1NLUA 1ZIOA 3M4YA 3B9BA 2CLCX 3AEUA 4UC0A 3ZC3A 4DMRA 4IGIA 1M2WA 1C7QA 3L77A 4V1CB 3LVFO 1OIWA 2Q8NA 2XGOA 2GEKA 3QM1A 4JV5B 1RJ9B 2N75A 3QJYA 2JCVA 2PS3A 2JLBA 1XOIA 4RHCA 4F2GA 3SS9X 1CERA 2OV2A 5JALA 2PXAA 4RD6A 1LPSA 1G9SA 1NYRA 2E21A 2WKPA 3LXMA 1WDTA 3RS7A 3E7XA 1WETA 4DSZA 3N1UA 1OKKD 3G7UA 4P81A 4E08A 3M4JA 3LT0A 2IHTA 4TRMA 3UT6A 2F8LA 121PA 3I9V6 5TDHA 2R68A 3BCHA 1PL7A 1Z13A 1T0UA 2NTJA 2WM2A 3HA7A 5G2OA 1ODKA 3T3DA 3HCPA 2ZREA 3GJRA 4OJKA 4KXQA 1P72A 2IBTA 4P38A 1Y5NA 3QUCA 4Z3DA 3DKRA 2JFHA 3HYLA 4MTLA 1U0NA 4UTXA 5LYJB 2QP9X 4MV1A 5EHQA 1J5XA 4JZKA 3WNQA 4B32A 4CKBA 4HH4A 5HP4A 1C29B 2XYVA 4F4UA 2Y1XA 3BT7A 2O3QA 4BZXA 3OMLA 4QREA 3RIYA 3UMBA 4YHBA 3CNQS 4FCVA 1NI5A 1X7XB 2O4CA 4Q4HA 4KN8A 4CXMA 5CG2A 3FRJA 3T52A 5AK4A 1JYSA 2DPHA 3GMTA 3IAM1 2JFBA 4J29A 4PR0A 3GAAA 3WRXC 5JQGB 4NF2A 2CSUA 4LC1A 1QH0A 1ULBA 2PL3A 4M3NA 2EKBA 4Z86A 5D5HA 4JEIA 4DY4A 4F2DA 1B3RA 1VSQA 1Y4DE 2R8ZA 3ACBA 3PDJA 4KL8S 1L7OA 1L9XA 2J6IA 4L7VA 1IU9A 1DAIA 3MA0A 4DYDA 4UUOA 2IV7A 2YWDA 4GVLA 5JFGA 1VI2A 4QUIA 4WZAB 5JYDA 2JBHA 3DM9B 1E3WB 3B7GA 3AB3A 3MTQA 3JCZA 1D6JA 4G37A 1F60A 2HQSA 1N92A 1UMCA 1Z16A 3OPVA 4IIXA 2BHLA 2HD4A 3RF6A 3IR6A 1E2PA 4WINA 2Z6VA 3WGJA 3RFTA 5L4SA 3IE1A 4KN5A 2HN9A 1QFXA 2JKZA 1C3OB 3H5VA 5E38A 3WHLA 1FRQA 3ONEA 3VYUB 2ZAYA 3HR8A 2GN2A 4BGIA 3DBHA 2GEJA 3GVIA 3L6DA 3NH9A 2GNPA 4A5SA 3FMFA 6ABPA 2IZZA 1X3SA 2G7ZA 3O83A 4RC9A 2VQFB 1XU7A 3FZYA 1XQWA 3FPKA 5EXXA 2IHNA 2BBWA 3A27A 9MHTA 2BR3A 2VFAA 3NGXA 4TS4A 4QPPA 3D0KA 4B81A 1ZA2A 2COUA 4EYKA 3UJ7A 2GETA 4MOWA 3MCZA 2GB4A 3SIPA 2O7SA 5GPBA 1PFYA 3TZEA 4PN7A 5I8WA 3ADBA 1HDXA 4YIKA 2GZSA 3HFRA 4M54A 3VOBA 2FSVA 2EW8A 3C8ZA 5J1SB 4LI0A 4XVHA 2NO7A 2ALJA 2YWHA 3LK7A 5CDTA 1E3JA 1HRKA 2Y1FA 5LQKA 3IA2A 2ZR9A 4QYIB 3ASVA 3RRJA 4DR6B 1P81A 1P33A 4WL0A 4HP8A 4RYLA 2GRUA 2HPHA 5IYZA 1Y34E 1IY0A 8ABPA 4YRAA 1ND5A 4IINA 2O05A 2H16A 1IL0A 2FK7A 2WI8A 1H4VB 4XD7A 3W4IA 2IU4A 2TMKA 1VMIA 4QJBA 4P2GA 1TAQA 4ZOAA 3H2BA 3W7VA 2XNDD 4Y9RA 1MT3A 5G4KA 3S27A 4AQYB 1NVKA 4X64B 3U62A 3OT1B 2WF5A 1OT5A 2X13A 2I3AA 1R6XA 2NAPA 4HGPA 3A3PA 1A50B 1CY8A 2CVQA 3K6RA 3JTEA 1V1JA 2YUTA 4HYEA 4X91A 3RVJA 2Q3MA 1E3SA 1LSSA 3FYSA 3AF5A 1F9EA 3DVAB 1VGQA 4M2LA 3RIHA 2ZYAA 2XUHA 1U0EA 1NBWB 1G8SA 3R5HA 2H92A 4M8KA 3K70D 5FAXA 4WA8A 1A5SB 3HUFA 2DETA 2NO9A 1T4BA 2Y9MB 3UHAA 1DAOA 3PK0A 4P3OA 5BV2P 4FKBA 4D80A 5FI5A 2IOFA 2WOJA 3MJSA 1JEQA 4RZIA 3P0IA 4X1YB 5JE8A 3GQBB 1TQ4A 2YIJA 3LK6A 4HVLA 5JH7F 3HR7A 4UATA 4G5HA 1B6RA 3TUIC 4TXNA 5IAAA 2R1TB 2LRHA 2FFAA 1OAOC 2XUQA 2PKWA 1WUIS 3KB8A 3OY7A 1B4DA 3VO8A 1FU4A 1LJLA 1BJTA 4Z1MD 4HN4B 2IIPA 2QU8A 4M7RA 3TL3A 5HIAA 4Z53A 2OR3A 2IEYA 5TJHA 4UBNA 1WCV1 2BR5A 4FYVA 1Q0TA 3DBLA 4OHBA 5LNK6 3RJZA 1L6IA 1QIDA 3WLAA 3E05A 1Q1GA 1G18A 2J3MA 4AJOA 2O57A 4BVFA 2EKDA 4S1TA 1F48A 4FYYA 3R0XA 5AVQA 1ESCA 1JLLB 3MWJA 3PP8A 3VOSA 4RXUA 3D4LA 2ZYSA 1B43A 1YR2A 3HU2A 2KB0A 4K6FA 3B1KA 4EMBA 1WPQA 1PNQA 1T6YA 4J1QA 5JUWA 4UPDA 3H65A 2ECQA 3JR7A 4J7CA 4GZMA 2DHDA 4ON9A 4E51A 1TQ2A 1PU2A 1Q0LA 4D3DA 4ESOA 2MIIA 4AZ3A 4AJJA 1A27A 1OE0A 2GEBA 2VOJA 3HL0A 3EIOA 5CVDA 3HNRA 4QLOA 1A72A 2C94A 1JR6A 4W9MC 5KVAA 4EY6A 3ZGVA 4EW1A 2PH3A 2X2FA 3EVGA 4TVOA 5K0BA 3U5TA 5FUBA 1GILA 1S8FA 3E2MA 3L79A 1R9GA 3HNOA 3WNBA 4OHOA 5LQRA 4G07A 3GJTA 3Q8MA 3D7NA 1E2NA 5TMPA 2RAFA 2P30A 1DNPA 2GD6A 3DV9A 4E1BA 4ZI7F 1I9GA 2J45A 2JK1A 3R6LA 3TF5A 3U4QA 2E85A 2W71A 2X4LA 3C41J 1WW2A 3RUPA 5LKAA 1IXSB 5J2TB 3ZCUA 4QXAA 1C50A 1ETHA 1GSHA 2QPLA 1EFTA 3BEDA 4MUFA 4EX6A 3KHKA 4C0SA 5HA5A 4JB2A 2YXNA 1NQWA 3ZXUB 4YP6A 3KU1A 1SQ6A 4W8GA 4CIDA 2K87A 4YFYA 1KVUA 1D9ZA 2ZITA 3OLZA 1V3TA 3SZGA 1T2AA 1C80A 3LZ6A 4KLCA 5KOYA 4RTKA 2XQFA 3ECSA 5I4BA 4RZ2A 4HLCA 2VK8A 4KE9A 5EZ6B 3V2HA 4DG8A 3L6CA 5FOTA 1NYTA 5KKAA 5THQA 2Q3JA 2PWYA 2C4WA 4LHZA 1EJBA 4Q6BA 3DEYX 4TXMA 1UEJA 3NAMA 5E0KB 1RWXA 4E07A 5DNAA 2O8FA 2H3HA 2ZU6A 3I39X 1L4BA 2LV8A 3KBOA 5HE9A 1D6NA 2HA0A 1TO2E 5F77A 3NOQA 3K09C 4Y98A 3N6XA 5KTMA 5HJ5A 2FDRA 5DI3B 1ZRMA 3ZWWA 2XEDA 3UKOA 5DEIA 2A1UA 4ZD6A 4DZTA 1DBPA 4OIFA 5D84A 1U1CA 3M70A 1SUSA 1X0XA 2P5SA 4TSFD 3BH7A 4JGBA 1HDOA 4IR7A 4QYSA 4S2UA 4A0HA 4NHOA 2X3FA 3KYJB 2ZTVA 3O9ZA 2B1RA 3VNVA 1R50A 1ZR2A 1SWWA 2J5RA 1B73A 2QA5A 3GA0A 1XA0A 1ISIA 3KPWA 3RAPR 5JQWA 2DM6A 2LKCA 3EWNA 5P21A 4WECA 3U7GA 3QBVA 4L16A 1TPZA 5KTRA 3MHTA 3M6FA 3IJEB 3W2FA 3I2JA 1SVMA 3SIXA 3EGXA 3UUEA 3FNFA 5LQUA 1W2GA 4GLFA 5K0GA 3DEFA 4AL4A 2GBIA 3FHLA 3UOAB 1SR8A 1O8CA 3P2YA 1C1HA 4EYEA 1KHHA 1TD1A 1ZL2A 2NYAA 1JWBB 2C3OA 2ZRHA 3CUVA 4B5KA 3ABIA 2ZM6B 4CQNA 1GNLA 1AD2A 1L5YA 1V39A 2D5BA 5EXEA 4MHTA 1HUQA 3BL6A 3I0NA 5EFZA 1XF1A 1YGPA 1U2DC 4I4TB 1GGHA 4UCWA 4G0UA 3B6ZA 2I2BA 1EFRA 3AV3A 1V41E 2XJ4A 3D4IA 4I3GA 4JI6B 1UAYA 5E6UB 1AQNA 4GR9A 4QNNA 2ZZNA 4Y2RA 1FFHA 2C98A 1QRSA 4JI3B 3FNGA 3GFRA 1PTKA 2O4UX 5B3JA 4PRLA 1VSBA 3PNQA 3JVVA 4TKUB 2IP4A 2IYZA 3LW7A 4WPGA 3TW0A 3DP9A 3EQ6A 3KQTA 3CMMA 2WC1A 3LVBA 4KWCA 3ZTYA 4M1YA 4EATA 3ZOKA 1P3DA 1ZD2P 2RGNC 5FP0A 4UFOA 2G09A 2NPFA 3ZWVA 4D9NA 4XB1A 4HFRA 5I3ZA 1GTG1 4FS3A 4C7KA 4HUTA 2BSAA 4CIYA 3D4PA 4MV3A 1J0EA 3MNFA 4D2IA 3KB1A 3LCJA 5BW4A 1CR4A 2PUCA 1LLDA 4UASA 2X0DA 3IUYA 4J3JA 5LP1A 4MKZA 2OL4A 3UY4A 1PFGA 1P0PA 2PD4A 3DC7A 4PCUA 5ADVA 2O8BA 4YXWD 1OLXB 1AB5A 1GQ2A 1T5DX 3PFGA 4U0KA 2P7HA 2OGTA 3SSAA 3ZLTA 4Q02A 2WOOA 3PRKE 4FQ5A 3BRWD 3I4FA 3DZIA 3ELWA 3Q15C 3ESYA 4UOZA 1IQRA 2OAGA 4LXUA 1KFCB 1RHUA 4IYRA 4RHUA 4I1SA 3V6LA 1SBIA 2W6PA 1S01A 4AZSA 2AZXA 3LOUA 3WHKA 4EJSC 5MGNA 4BECA 4F6RA 2W2TA 1NW9B 5KX5B 3CLSC 1FP6A 3W9BA 4UEJA 3OQPA 4NAVA 1V1MB 1KR2A 5AKHA 2EFHB 3QWFA 4WZBB 2N46A 3UH0A 1G6KA 4UMVA 2WD9A 3USCS 1I6KA 1KMNA 1JHAA 1M6VB 1SKBA 1XMXA 2XUIA 4R9NA 3WQQA 4ALNA 5IXYA 1ZK4A 3ZK9A 3QUQA 3JYOA 1FSFA 1U8AA 1XG5A 1XVIA 2NTYC 1VE6A 3ABOB 2WKWA 3DMPA 1ZD5A 4X8HA 4D6XA 5KYKA 1SG0A 3GBVA 4PZYA 3SXPA 2X1VA 1E1RD 3JWPA 4A6EA 1UM9A 5KNBD 5IRCD 3PLNA 1YCDA 1ZD1A 2A67A 1A98A 1G5HA 5EQJB 1R3UA 1AKQA 2D4AA 3G0HA 1CUWA 5FWAA 2DEUA 3HYTA 2ZSJA 4E5PA 2GGSA 3PHJA 3ETLA 4L0MA 4LDZA 4DV3B 5LQCA 4L5CA 2XB9A 2HYDA 1UWKA 3I6YA 1W1WA 2O0LA 4MDEA 3ER6A 3FGZA 2EDAA 1Q7RA 4CJXA 1N6PA 2MR5A 1DJOA 1NP3A 1AQUA 3VNQA 3R3YA 3Q7QA 4ZN6A 4DDMA 2ZATA 4MUKA 4DB4A 2PLFA 3DSRA 3G5TA 4BLQA 3EYWA 5B64A 5M3BA 4UHDA 4BNTA 5HKAA 4TYNA 1DTEA 3U3OA 3EN0A 2XKJE 4K46A 1COWA 1YAJA 5CIWA 5HNKA 4FGJA 1S5PA 1L5MA 2XADA 3D4NA 3ZE1B 4Z4CA 4EA6A 2O23A 2DTXA 4QUJA 2I99A 4HAWA 5L45A 2YL2A 4QJ4A 1WCYA 2JRCA 4K9KA 4KYTA 3I6QA 2PUHA 1M1YE 5EXPA 1DDGA 2VPIA 3X1DA 4TMYA 3DZFA 2R9VA 2IYRA 3CZQA 3I04M 1FXWA 1QVVA 2OP0A 3EIQA 2XDQA 4REQB 4IBOA 3B9QA 5F7OA 1DBWA 4U7FA 1N2CA 2QUIA 5B55A 4BZPA 1NX6A 1W85B 4WLUA 4PLPA 1JR4A 4EJSB 3M5DA 1PW5A 4L2IA 3ANSA 2YHIB 2YIMA 4F5EA 1FJ2A 1Y8RA 1Z7BA 2E89A 1A9QA 3IRVA 3LKZA 3MN1A 1UBOS 4OLFA 4LMAA 1SUBA 3FOAA 2C97A 3OIWA 2AKAB 5E3HA 4AJ4A 4Y6PA 4EH1A 5MFZA 4IG9A 4NPCA 5HFJA 3VA7A 4IRUB 3ETNA 2HHCA 3O2NA 2ZWMA 5JIBA 1Z0ZA 2IF0A 3OM1A 1DRVA 3SJCA 4ARZB 4R2JA 2B8WA 2RD2A 3U09A 4KVFA 1OXTA 2QIOA 1HLFA 2I4LA 2QUZA 1GNQA 2PBZA 1YBVA 2FJPA 2PKQO 5TSDA 5HUHA 1F4LA 2LWIA 2O2HA 1Z5NA 3ETDA 4JITA 2YY7A 4PLHA 4F5WA 2C84A 1MABB 2QY6A 4EY4A 5BOSB 6YASA 2IUFA 3SQWA 1HZZC 1T4CB 2RJ3A 3C5HA 3G7SA 4OJQA 4DMCA 4JY7A 2GHTA 1RIFA 3KJHA 3L1VA 3QE2A 4UBOA 3WV4A 3C97A 1ESDA 2Z3ZA 2IXDA 4FWBA 3AHDA 4LMRA 4PU0A 2V7TA 4BV2A 4EL5A 1QHFA 4IHAA 2RHHA 4PG8A 3DW3X 3O7MA 3JQ8B 4BO9A 3WYAA 2QVZX 4AZ0A 5HZMA 4PFKA 4YWHA 3I1FA 5JYEA 2SKDA 1JU4A 2AX4A 3EG9B 5AI9A 2XB2A 3T1QA 5DLYA 3GJQA 3ES9A 1FA9A 1DCTA 1HNZB 2DHRA 2O2YA 5AW2A 4DLNA 2GKSA 3HVHA 4PFJA 2DGDA 5KNCA 3NALA 5U1PA 1XUOA 3VSAA 1S2IA 1LBHA 4FNAA 2SBTA 3CO0S 2V4ZA 5CM8B 1P6QA 2Q5HA 2QX9A 2HK6A 2V1XA 3HJRA 3AR7A 3NP7A 4IXMA 4E4TA 5AJTA 1SBTA 1UKAA 4MVJF 4YRRA 3NHMA 1P0IA 4IJ5A 4A6PA 3E9ZA 5FLXA 1MHTA 4B46A 3SHTA 5A2QA 1KPHA 2HR1A 3F5MA 1YI8A 2P8JA 3LNTA 4GYWA 1FX1A 3JV7A 5AIAA 3KOWA 2B8TA 5CDUA 1ZR4A 2ZCJA 5BN3B 1HKHA 2YDXA 5HE8A 1W5SA 5L7YA 1KXJA 4FIZA 3CWZA 4JEUA 5LQMA 1EAMA 1UXGA 3FF4A 4BUZA 2K5UA 5A6SA 3REOA 1GZ6A 3OQ1A 4XUDA 4R1QA 3MZ0A 3QBJA 2DWOA 4PYJA 3CGWA 3U56A 4K8RB 1PL6A 1C8LA 4LN1A 3D4OA 4AXBA 1JR3D 4OMUA 4LWQA 3PC7A 4F4CA 3HJGA 3W79A 4DDWA 1ISGA 4TKZA 4C6TB 4W7HA 4JNCA 4R3UC 1LEHA 3A1VA 4I4IA 3CWCA 3F9CA 1RPAA 4JS0A 4LTDA 3PKIA 5AW7A 1IPHA 3IAEA 3GT7A 3DL7A 4J07A 5BXQC 4HGYA 2X76A 2IH5A 1VBKA 3KT6A 1ZQ9A 4P33A 4KNVA 5KYTA 2G9QA 4R1PA 1Q1ZA 3ZZMA 2IY7A 3IP8A 4YMSA 1G16A 5IFLA 2WSLA 1C30A 4GS5A 2W6OA 4YB8A 1OLUB 2JGNA 1K06A 1Z83A 3GLKA 5IXJA 4LF6B 3X1YA 4HH0A 3ON5A 4L9SA 5GADl 2REQB 4MUHA 3HGQA 1HSZA 2FFHA 2AZMA 3RFCA 4A73A 5BV0A 1I8TA 4DSAA 1B1CA 2X41A 2R66A 3AGPA 4FMBB 1NBOA 3G8DA 2ZVDA 5JDCC 2VSYA 2PH5A 4UHKA 4P4TA 1KI6A 3UMGA 1OFGA 4AP5A 4DM4A 1TFRA 4DLXA 5KJFA 5IABA 5IKPA 3CZMA 5JTTA 4J3FA 5KREA 4PBRA 2ZVQX 5JS7A 4X94A 5E6SB 5E7JA 1A3CA 1KY3A 1Z8DA 3VI4B 4AMUA 3ADCA 5JAMA 1J22A 5HTKA 1R00A 3MUEA 3A1FA 4A23A 4NFLA 4P7FA 2GLXA 4FI3C 1JKMA 2HFKA 2IVZA 1UOOA 4G8CA 4TWIA 2GBGA 3FYHA 4MJLA 3DONA 4FYXA 3HKBB 3LXXA 3A70A 1MC1A 3LCRA 1Q0QA 2HCRA 4Q1DA 3WRYA 4AICA 1GYRA 1U3DA 4EHHA 4YDQA 2ODWA 1EDZA 1MIOA 2BCJQ 3MT9A 1XMIA 5DM4A 2C7OA 1RWKA 2YR0A 1EX7A 3Q3GE 2ST1A 2VDLB 4I50F 2FRXA 1ZU4A 2VDNB 5DSZA 1OTYA 4NYJR 4B9EA 3MMSA 3IQDB 3G5LA 3IFSA 2LGJA 2IITA 3GB9A 4V0KA 4DMKA 4BBAA 3CNEA 4RL4A 2GK4A 2PYIA 3H1BA 3SSMA 2CHGA 5A3VA 1XZGA 2EG9A 2O1XA 3LCVB 1XZDA 3NWBA 1U7UA 4NARA 2EKLA 4QU8A 1QV9A 4EK9A 1WCIA 3JQAB 1Z8HA 3ZDBA 2BV3A 4FYWA 2VJKA 4TL7A 2QDXA 5L3QA 1N5OX 2VHWA 1RCTE 3LUHA 3OZVA 1EIZA 4O4JA 3COZA 5DSTA 2UVDA 3E5NA 1CV2A 4INJA 2RG7A 4M0DA 3THOA 3ZE9A 1E7SA 3DVLA 1P9NA 1PZEA 3KS9A 4BFWA 1PX2A 2JAWA 5CGZA 2C54A 5TT1A 2PXXA 3KK0A 4W8HA 3TTSA 5IK2D 5AW9A 3C6QA 3CKYA 3PEYA 5JAQA 1FFDA 1QIIA 5BQOA 4BVHA 1TCAA 3DMTA 1XRRA 2V55B 2IYPA 4GOND 2QY9A 4HZGA 1E6MA 1RBQA 4OKNA 4TUYF 5LB4A 3SQDA 4QDUA 2V0GA 5JC1A 2VKTA 2AYXA 2VAXA 2YZMA 3FM9A 3K1AB 4FQ7A 3VR3A 1IG3A 3ZZ1A 1M5UA 4KPYA 3TFQA 3LPMA 3A06A 1J23A 5CX4A 3B1VA 3Q98A 3RV3A 2XWSA 3BILA 2HRCA 2BFFB 3N53A 5T4BA 4B79A 5ECWA 3WLTA 2GM3A 3LXRA 4DCVA 5I7OA 2O8EB 4IEFB 3WL6A 3OJCA 4M83A 4FJ1A 2W93A 4ZHQA 2JIOA 3EB9A 4TS1A 1HFEL 3NCTA 2XMZA 3V46A 2XRZA 5FNVA 1G5PA 1UC5B 2J3JA 2B4AA 1KU0A 3KUKA 1W0KD 4MQ5A 3GFOA 5K0JA 1JV2B 2Y99A 1P9RA 4Z7QB 1EFUA 3ZZUA 4XJTA 2XGMA 2OE2A 3DCJA 4DV0B 4H1UA 3TZHA 3M4NA 3ZY5A 2F43A 3VU8A 4IZHA 3HUTA 3JD3A 5DGHA 3KWMA 3EJ6A 1VJRA 3B8HA 1NWHA 3LHFA 2XGGA 4JODA 4LQLA 3H8VA 1STOA 1SPBS 2AUTA 2A6PA 1AU9A 1ECCA 1CUEA 1Z6PA 3FCOA 3H9UA 3LS2A 4X20A 3UGQA 3BC1A 3T7EA 3F6BX 3H16A 3PIDA 1DCMA 1Z5VA 3M1LA 1DTSA 4JT2A 5NLLA 5JHGB 1V4BA 2FUEA 2VYVD 3BREA 2I4NA 1D2HA 1GQRA 3MMZA 3FSEA 1U81A 4OL9A 1X8JA 2Y4OA 4NS1A 3W06A 5FHQA 4DQVA 3B85A 3PNLA 1YK0A 4WT7A 1F7UA 5JPCA 2E4ZA 4LQDA 4CKZA 2HSDA 2HSZA 1H2ZA 3KYCB 2O2ZA 4MEJA 5H4GA 1FPMA 3LCCA 2P4HX 3JX9A 1VJCA 3DEZA 5CNIA 2CJYA 5FOSA 1EDEA 1T5LA 4MWTA 2R6FA 5K6RA 2AOTA 5HX7A 2PV0A 2CXHA 1SVOA 4BNZA 4H0FA 2YZNA 1BCSB 4YV0A 3AUUA 1ZKMA 2C2HA 3ESXA 3P4UA 1E8DA 1AKMA 2BI8A 3GJ5A 1R0YA 1NXWA 2C59A 4XSHA 3EPKA 4DLBA 4FMCB 4EAQA 1LZLA 1PGQA 2B69A 3ITEA 1HTWA 1MN6A 4QJ5A 1I7NA 5AW5A 2UUPA 4CLXA 2VCHA 3K9QO 5BSWA 4HGRA 4ZU6X 3O3NB 4J16C 1Z5ZA 2RHOA 2GCPA 1G3RA 2AXNA 3MAGA 1BKSB 3O3CA 2OCKA 1XRLA 3GXOA 4ZO7A 2WPNA 3WA6A 4IDPA 1KEVA 3HP7A 1FFCA 3BRCA 4OJYA 3F98A 1LPPA 1PS8A 3EULA 2BJHA 1KYQA 1P4SA 1SBZA 4H6PA 1A9XA 4BDTA 1FLVA 4H35A 3RSOA 4GPIB 1EINA 4DWOA 3O8QA 1DZIA 1YO6A 1N5IA 1FQWA 2Z5VA 3IBCA 2P27A 1KEEB 4JLVA 1GR1A 5L8VA 1YJAA 1UF9A 3FHCB 2FUCA 4OMCA 3RS4A 1ZW1A 3RWOA 4F9FA 2OXCA 3N3AC 4DL9A 5HFAA 3RHSA 4EG6A 3DZBA 1QKKA 1TUBB 2AL7A 2QN8A 4MUEA 4Q3CA 3L4EA 2TS1A 3BFVA 1LC0A 2P6PA 1BOOA 1M8GA 1J09A 1UL1X 2YTZA 5CH5A 4F9TA 4L5AA 4EI9A 5COQA 2FY8A 3U2QA 4ZARA 4UQLA 2NV0A 2OHHA 5J4HA 1U04A 2B8JA 3M5CA 1Y1TA 2LDBA 5CYPA 4Z4GA 3AKCA 3T12A 4HDRB 3CO5A 3O8DA 1UBMS 1MRNA 2IIBA 2JLQA 5ED0A 3DE2X 3TCXB 3UWDA 3U3ZA 4N7BA 1IY9A 5CNKA 1BRMA 3T9FA 4LF7B 2WM8A 3H6GA 1HYEA 3LDAA 3RYIA 1AA9A 1RMYA 3F5FA 5DCUA 2ZJ4A 5E0OA 1KAGA 3WB1A 4D9EA 1SZJG 1U3UA 3GIDA 1CQJB 3IVGA 1Z0AA 5FA5A 4QGAA 3ZY4A 3S81A 4NXNB 1S4MA 2I4IA 1EXWA 4M0CA 2O8CA 3I3SR 4U7HA 4ZGGA 1B8PA 1VYHA 5BMVA 3H2HA 4FINA 1IUOA 1GAWA 1TXGA 2GO1A 2ZBPA 3CKKA 4BZWA 4YX9A 4E5DA 2F1JA 4A8JA 3TGPA 2TYSB 2WM3A 3PQ7A 5F51A 2DUUA 5EPEA 5CA0F 5F9FA 2XUFA 2DBYA 3DAPA 3QVMA 3B2QA 4EHLA 2JJ1A 3VQTA 3U7QB 3MSXA 3RIMA 2BELA 3G88A 4LJ9A 2VF8A 3NCHA 2PRYA 1NR1A 4O2AB 2OKGA 1XLUA 3AUFA 3ELBA 1PT9A 3B89A 2VP2A 1E3LA 2WJ6A 4X97A 4I9NA 5IAKA 3YASA 1W1UA 1GKIA 3RUDA 3UK0A 1FJHA 1ONOA 1FLDA 4M9CA 1TJ3A 3SR4A 1P1JA 4IDAA 5JXHA 1W34A 2ON6A 2OZKA 1XCJA 2P4QA 3E6AA 2MYTA 3GUYA 1TVMA 2BEKA 1VGVA 1CUAA 1FFBA 3IJ5A 8LDHA 4CEJB 3HP1A 2A14A 1LPOA 2EERA 3F3KA 1G9TA 3R5XA 3BTSA 1CQWA 1W8DA 2D13A 2Z4SA 2MDTA 2P35A 4G5OA 4KRYA 4S1NA 5CH3A 2NZWA 2OZLA 4PSUA 2ZK7A 1PR6A 3O91A 2ZRIA 2E4YA 2LKDA 2LIVA 1IVYA 1ORIA 1N77A 1Z28A 2Y1GA 3ZCSA 3VYSB 5LIPA 2YN4A 4Z49A 1ARZA 1TMKA 1PZNA 4MCJA 4MPDA 2O8CB 5CHYA 1M6EX 3PIIA 3VSBA 2WWFA 4CL3A 3GMIA 4D4LA 3MWDB 5C5IA 2YV1A 4GYKA 4X66B 4JCCA 5T4EA 1SQFA 2R7KA 3CLUD 4KXLA 4GKAA 5D85A 1IMJA 2V7WA 2SKCA 3I83A 3A2LA 3PQCA 4FGSA 2CUZA 3QMVA 1GPWB 5PNTA 3HSKA 3T4EA 1I01A 1FDSA 1Z8FA 1E7WA 2VP9A 3JQ6A 3T3MB 1P31A 2UDPA 2WWIA 3FBTA 4YGXB 1PK7A 1JZTA 1XRJA 2DFVA 2FRVA 1VE3A 2YWGA 2FPGA 4Y2PA 5FYDA 4E2XA 4CTOA 2VPWA 1T5BA 3OPNA 4DHWA 1FMTA 5TRTA 3ZK8A 5A1JA 1ZWLA 4LV5B 4IZOA 3ZDXB 5TY0A 3LY7A 4LRUA 1HYGA 2Q1WA 5CIQA 1SULA 1N0HA 1QDUA 5CX1A 1SK8A 5EKSA 3VJKA 3NGMA 3G79A 4R2IA 3SIRA 1FJGB 5J2UF 1J07A 3N0RA 1IH8A 3Q7EA 1U5BB 2Z1MA 3KTDA 3GO4A 3IPLA 4RLQA 4CKYA 3UGJA 1N7IA 3RAEC 4CEHA 1XMOB 4M8IA 3C4QA 2X6TA 3E4DA 4RCYA 5K2MA 1ZUIA 2P9GA 3BD6A 2Q8PA 1IN6A 2Z2IA 3FTCA 3HUUA 4LXHA 3DBOB 4ZO4A 1GUZA 4IDGA 1U2EA 2QS9A 2QTTA 4QOHA 1KJ9A 1CZLA 1PJAA 1M2HA 5FBWB 2H2FA 4CM5A 1LVGA 1UEIA 3OJFA 3DF9A 3SYLA 4KC0A 4B34A 3ROQA 4P4LA 5CCEA 1WV1A 1YASA 4NK4A 2MMGA 1MJ5A 4WNYA 3KSUA 1G2QA 4BMPB 2DSNA 4RJJA 1BFDA 1T6BY 4KI7A 1UK7A 3IUNA 1R4AA 3KUUA 4GFDA 3F3SA 2OC4A 4EF5A 2EOAA 4BVLA 1T34A 4KR2A 4LHSA 1ZHHA 2C9OA 1O94A 2JFZA 3H7AA 4KIWA 3K31A 4B3SB 1F5NA 3OUTA 2P67A 5LR6A 3IGFA 2ZJ6A 4HDSB 4UBMA 4ZEWA 1Z6YA 1BC5A 3OOHA 1E4EA 4RVUA 4IIFA 4N6GA 4F11A 2Q2VA 2BGIA 4O3MA 3F9RA 5KHOC 5AVSA 5TQ2B 1EZ1A 4GICA 3DYVA 4B6SA 2CVPA 3AL2A 4Q16A 2B83A 3ZJ4A 1EESA 1J8QA 1L5GB 1NX9A 1S2DA 2XQGA 4MW2A 4RELA 2ZTSA 1ISPA 5D1NA 2BE9A 5DTEA 5E4FA 5LOVF 1Q95A 1YCFA 1AKRA 2OO5C 2DBRA 3T4UA 3PHHA 4PLVA 3M34A 2VZLA 3JVUA 4OUDB 3IKMB 4DNFA 3JRWA 5CA1F 1ZMBA 2F17A 4XYBA 3FWNA 2XQJA 3AZOA 4P0TA 4W5JA 4YJ2B 3WGLA 1JU9A 2P3LA 5L40A 4CHTA 5KWIA 4Z4FA 3A6KA 2A9JA 3WWOA 4I9FA 3DOOA 1PAUA 2WTEA 3HKEA 1JS1X 2R47A 2H4JA 1JMVA 4AJ2A 1ESNA 4BNDA 2ZUUA 1EUDB 4Q03A 5J4KA 1OZ0A 2HM7A 3BTOA 3BPSA 1P7CA 5BORA 5GQSA 3ISJA 4KSBA 3WISA 3H6HA 4D25A 5D00A 2XZPA 5BSTA 3KLNA 1K8ZB 4LY9A 5LMNB 3QX9A 4IDHA 3UT0A 1Z4OA 1O95C 2OBLA 1DJLA 1KIFA 2F9LA 3M6UA 5SZIA 2X0IA 4KQ1A 1JEEA 2RB5A 1YFZA 2PMBA 4IO1A 2PFGA 4JL8A 2VSOA 1X0VA 2XCOA 3PC3A 4X84A 3BCRA 3UZUA 1B2LA 4YJDA 2QE6A 2J59A 2X7XA 3E82A 2WLSA 3P2KA 4N65A 5K0ZA 5ICFA 1PZGA 4NZPA 2JGDB 2EFJA 2H11A 3ABRB 1A9SA 3C45A 4OB7A 3U49A 4CVNA 4QA9A 2P9YA 2C2OA 5TX7A 3LMKA 4ZMRA 3GEMA 3EZ6A 2GRJA 3LKVA 4DSOA 4V1CA 1UT8A 2XT9A 3EHEA 3U4AA 3PDIA 3D1VA 5EIHA 3ZX4A 3OLCX 2BVNA 3NHUA 4MICA 3V3TA 3FPLA 1XT6A 1ZRNA 3DVSX 3IXLA 2WJPA 1S3GA 4NU5A 1O3YA 3FKJA 2NTVA 3GFTA 1OI2A 5ENDA 5A7HA 3UV6A 1GRQA 3O4RA 1A96A 4QU5A 1KJJA 1YACA 5HOQA 3Q9LA 4ZT5A 3J80A 1TM3E 2QM7A 5IH3A 1OA1A 4MVJH 4DRYA 1MU0A 2GR9A 4BTVA 3I64A 3ACDA 4JB8A 1CSEE 1T2FA 2ZCUA 4ZMSA 5KSWB 3PRJA 4GQIA 3ONFA 4JNKA 4N0DA 2XB6A 3HMKA 3AF3A 3DFMA 4XI9A 1L1QA 1XZCA 2PKYX 2WUEA 3ONVA 4HC4A 4CMEC 3Q7IA 4B45A 1IAQA 3WWPA 3OQMA 2Z95A 1Y6FA 1CR6A 3L7CA 1M8KA 4N40A 5H7XA 4Y6QA 3LQRA 3FMOB 1I94B 5LYJA 2XBMA 4HJXA 1IZ7A 4L76A 3UH1A 5E4JA 5KOIA 3HJFA 1LS6A 4XPZA 5K3EA 3HY3A 3V4LA 3OJEA 3WK6A 3MWKA 5L3SB 1SEPA 3KEGA 1PZFA 4M1SA 1R5OA 2FWMX 4JK3A 4S05A 1LQ2A 1Q57A 2BCEA 5DWVA 2Q0XA 3ZV7A 1F0PA 3G23A 2HK8A 3DLBA 4UNQA 1X7XA 2YXEA 4L0DA 3TLZA 4R41A 3F73A 1RXYA 2JJMA 4ZFNA 1JEAA 2BDUA 4Z7OB 4KODA 2FW7A 2HXSA 4RHTA 5EC8A 4Q48A 3F6PA 2FPPB 5JQGA 3PNYA 1SBYA 4LOJA 4K5QA 4OM7A 2P0AA 2NT3A 4DMMA 2HJ9A 5CFMA 2PSJA 1UCFA 4HZIA 5C81A 2B2CA 1ENZA 1J8VA 1QCZA 2NQ2C 3O4HA 5CBKA 3CLUC 3EXHB 1QTQA 4KMOA 3CEHA 4V38A 3G2KA 4CG3A 1I4LD 4JSYA 4WZAA 4AJ9A 2J7KA 1NF2A 1E3WA 4YRQA 1UBTS 1B00A 4DA8A 1VPWA 5DNWA 3KQQA 4QELA 2UYGA 2Z6AA 2DPLA 3FYDA 3HCDA 3DQZA 1GKUB 1KDRA 5FORA 2Y1KA 3UFBA 1EUCB 1R0CA 3HU1A 3IBYA 1ZYUA 1C3OA 4G4IA 4BNYA 4UNIA 5TPZA 2YJ5A 4AZVA 3TSZA 3EWIA 4F6CA 3O2SB 3K6SB 1N1MA 3ISVA 1YS4A 1YXMA 2YHSA 4NLLA 3BERA 1E62A 4EENA 2JLXA 3PKZA 1BQEA 3U48A 4BMXA 2NVOA 2FG6C 4FNGA 3SM3A 3GHYA 1T2UA 1Y5RA 3NM5A 1GU0A 3W6OA 2QMYA 3PZRA 1B0ZA 3KKQA 4PLTA 4CM7A 5EE3A 1G1MA 1TUIA 2BGNA 5H8WA 4C1BA 4UU8A 4MQUA 1VA4A 5A06A 3W3AH 5CCDA 5FTMA 4CMIA 5ALSA 4IIVA 2HLPA 1TJ5A 1V5FA 2ZRNA 1YOVB 4MNTA 1QG0A 3MINB 4NTZA 4PX5A 1WXEA 2JEYA 3CCFA 4HUQB 4A15A 1O03A 1R5JA 3PXCX 2O8NA 5FOXA 3UXHA 4AW9A 3U9LA 4AN1A 4BNGA 1RYZA 1X8LA 1M6NA 2QRZA 2W58A 3N8HA 4QYIA 4WMLA 4ZEVA 1RC8A 3R7WB 2G80A 3ADKA 4HD8A 2HIAA 3O4VA 2FW0A 4A7PA 5C3MA 1WQ3A 4QTTB 4XVUA 1MT0A 1KIMA 1LSUA 1P44A 3KPUA 3D4BA 2IV3A 4ZDJA 4ND6A 5DM0A 3E61A 2W7TA 1B8OA 2FWPA 4Q7QA 1V8OA 1C1DB 3P0RA 4NBKA 2VDJA 1V43A 3JQRA 1PP4A 5C51B 3BG5A 4RCZA 4CTJA 4ZVUA 3DP7A 3L92A 3WKEA 4M1QA 5A6VA 3KTAB 2ORYA 3OT1A 1UZLA 3DDHA 2IHZA 1X8KA 2Y92A 2BBTA 2B35A 2JGMA 5HS4A 3PFKA 2JZNA 3OZDA 2FMKA 1Z2CA 1U2PA 1Y9JA 3JATB 3VPGA 1DMSA 3ZWQA 1AV7A 3BKXA 2C04A 3DVAA 3IJPA 5ENVA 3IIKA 1Z15A 2FKNA 2P9FA 2VTDA 3KWFA 3BGSA 3JASB 3TZKA 1RPZA 1POXA 4RYDA 3STUA 3J81k 2XXJA 1J2TA 2WWGA 1G7CA 1MV5A 2GOYA 5BRAA 2PUBA 1ZI8A 4X1YA 3WNVA 3G5UA 1T9AA 2IGBA 3O6VA 4A8TA 4G5XA 1CRLA 2NU9B 3GQBA 4R8LA 1GCIA 1BH6A 13PKA 2GJSA 3VOAA 2EFDB 5BQ5A 4B74A 2XUPA 2H1VA 2HLHA 3WP0A 1X1SA 4PZAA 2V96A 2JBAB 4M1KA 5BNZA 3GLIE 1ZVQA 1SUWA 3GJSA 1TCCA 1ABEA 3AL3A 1TVCA 3NX4A 3QFSA 4AX4A 2WLTA 4A91A 4ZU3A 2XGSA 2O9JA 3MYYA 3Q2OA 4LE0A 2WQ6A 1NQAO 2ZUWA 5AT1A 4DJDC 2H3EA 4BP1A 1UDAA 4AJHA 1IJFA 1U4SA 2XMDA 3BIWA 4EGCB 4LOHA 4OJMX 3GUCA 1GTVA 3ABQB 3LWZA 3TLMA 3ZDFA 4DLAA 4EY7A 5FOUA 2NZXA 4MYDA 1NGSA 3HP4A 1JLLA 2PZKA 4PC6A 5HF6A 3TAHA 1DOAA 3NBZC 4Y2QA 4AZWA 4ER5A 3KQSA 2DXIA 2AMVA 1QE5A 3SR3A 2HJVA 1OWPA 1KGDA 2BHTA 3O90A 2GJ8A 1ZSNA 2B4RO 5DRTA 3UAZA 1Y37A 2XCTB 4AUKA 4BLRA 3WGTA 1SCNE 3VKWA 1WXXA 1OXUA 1XAJA 1OXBB 3V1LA 3RYHB 4WCFC 1MVOA 2FZKA 5D7BA 3SYNA 2HOQA 1PQWA 4QX6A 1YMVA 8MHTA 3QITA 2JJ2A 4KBYA 3MQ4A 1DPGA 5EJ9A 5A9TA 4ZRDA 4P53A 4C0XA 2NPOA 2HXGA 3P94A 3W5UA 1NXQA 3N7TA 2D1RA 2V6BA 4JEHA 5H3CA 4ISCA 1YL7A 1QGOA 2IIQA 3HFGA 3ONDA 4BS9A 2H4HA 5B3LA 4URUR 4AP9A 2GVNA 5FQOA 3RRNA 1JXQA 7MDHA 3SHWA 5J2TA 1MXHA 1QU2A 2BCGY 5IEBA 5DZSA 2DKFA 1TTPB 3MTJA 4ZVVA 3TTYA 2ID7A 4R71A 1H8ED 4LYJA 4RZUA 1WMAA 3K5PA 3ETGA 2XMRA 3NJRA 4P31A 3RS2A 3T3HA 3UWPA 5EIXA 3INRA 5G02A 2X8WA 2ZWPA 1YZTA 1OAOA 5MN4A 2QDKA 1N3YA 1RZRA 2GN1A 4FT2A 4PCAA 3TIFA 3AEZA 2P79A 3PHIA 1XZBA 1A76A 1L8AA 4DCNA 4XLZA 1GPDG 5BRJA 1G6OA 1ID8A 4BE4A 2J4FA 1HTTA 3RJ5A 3TIGA 2K7FA 1DWUA 3TQQA 4B6FA 3VJRA 3TDNA 5DI3A 4QUKA 2C7QA 1VL8A 1KSJA 2RK3A 3UJBA 4WBNF 1JALA 1AGNA 2JDID 3HDVA 1ZGHA 2BTQB 3GJ7A 1A4RA 3LCUA 3G1WA 4IDQA 4CTMA 3K53A 4G1MB 1KU6A 3V4ZA 4JJ7A 5ALFA 4WKPA 3P5BA 3C3BA 2V97A 2W6CX 5T5QA 2I7DA 1MZPA 2VRWA 1MEJA 3A4LA 4PPGA 2EHDA 2I7TA 4QRIA 3H83A 3KVYA 4L8WB 4WCFB 1HNNA 1OYWA 2YICA 4IOJA 1WUYA 4OXRA 4XYMA 5K0EA 1KYYA 1NJGA 2OVFA 3R23A 2RHBA 4ZYUA 3BWMA 3SQNA 4EY3A 4TYYA 2X6QA 3EC2A 1WB4A 1I2AA 3WIEA 3VDXA 1AK2A 1RAIA 3SKXA 1JKXA 4JLMA 4L3VA 5AKIA 3DOHA 5A7FA 2Z2JA 4PCLA 4TS9A 1OKKA 3U7RA 5E8RA 5REQB 3UIEA 5EHGA 1FFEA 1KVSA 2CMKA 4DLWA 1HKUA 3EOZA 4PRYA 1BYUA 3OQOA 1GPNA 1IIRA 5DHRA 1PZXA 4O8ZA 4BFSA 3O3OB 3SS7X 1QYXA 1V47A 4I4TA 2CDNA 4RBNA 4F4DA 2CL7X 5HM8A 1CQZA 1IN8A 2HF9A 1OF1A 3HV0A 3DUFB 1FVOA 5E6UA 3CONA 4YREA 3UWMA 2WT4A 3PFHA 1RWNA 1L6RA 4G2TA 2IYYA 2OWEA 4Y2VA 3PEEA 3QI2A 4EEKA 3NVMB 3DZGA 4RCVA 3VKUA 1JSLA 3ZWXA 5KYNA 3DOCA 4B44A 2IW1A 2WAAA 3MD9A 4TKUA 2MTBA 2O8DB 2BKLA 2C8VA 2NYVA 4DCGA 3H4MA 1KYVA 3GLFB 1IB0A 4ESVA 1S2OA 3AR2A 1ZONA 3QY9A 3IQGX 2ZB3A 4ESEA 4EQ6B 4GMDA 4BGEA 5HEKA 5C1DA 2R87A 2I8CA 3EEBA 3HDGA 2H4YA 2C7PA 2YXPX 2HF2A 3ASUA 3PUKA 5DM1A 1ECFA 3JR3A 4OHMA 4G4SP 3TOVA 1XV5A 1SU7A 1CR0A 1Z17A 2H7XA 4UU1A 1SUEA 1HFJA 2ADMA 3O4IA 1JFTA 3ODPA 4YRZA 1OBCA 3TD6A 1OLXA 1SCIA 1KP9A 3RU3A 4C7BA 2HMAA 3JPWA 5CHEA 3S40A 3A2KA 3ME5A 2JFXA 4AN0A 3UXMA 4KO8A 1TADA 4KE8A 1YR3A 4F3CA 1VCMA 1QVAA 2KLHA 1H0SA 4QXPA 5C7YA 5MHTA 1OBHA 4E70A 4HN9A 1Q7EA 4KQJA 5HF5A 4LZLA 4E46A 2D6FA 3VH2A 2D0DA 3D8HA 1ORHA 3LUFA 1AQYA 2RH5A 2BGRA 4ND7A 5ALEA 5E2AA 3RPEA 1G8PA 4DCCA 2GCGA 3NBUA 5KX5A 3QJGA 3R6DA 2XDAA 3NASA 2VDQB 3NBKA 4UVIA 4AG3A 4FXOA 3U39A 4EPWA 3E1KA 4V02A 1M2NA 3K2QA 4TZ6A 4HX5A 1MFZA 1M6VA 3VR6H 4C4RA 4EDHA 4XOUA 3JSXA 1U2DA 3DJYA 4DJJA 2V98A 1CEYA 2PD3A 5A0FA 3P9KA 2QMHA 3BAZA 4OGWA 1E20A 3A25A 1NLYA 1NOKA 4JELA 3I4CA 1O6BA 2XMCA 2ZE6A 3QRWA 8OHMA 2W00A 1THTA 3ASYA 4FGKA 2P9ZA 4GI3A 4URZR 1SKMA 1D6SA 3EE6A 3WGNA 1B7GO 1Q3HA 3CRVA 4GGOA 1L5VA 4JJZA 4TLAA 3WK4A 2BFNA 2TSYB 2OGSA 4GXNA 4LC0A 3SKVA 4DUYB 2PZAA 1QPGA 3CTMA 4JBYA 2JLYA 2M6RA 4FFWA 2P2YA 2CF6A 5AJXA 5L6MB 5IZCA 3R4VA 4D81A 4M1TA 1AQ6A 4A2PA 1RKUA 3SM9A 1UBNA 2J9GA 4HEA1 4RF2A 1WOYA 2I2DA 1OZFA 3NFRA 5GONF 4JENA 4FDAA 4OHUA 1J20A 2X8BA 1Z22A 4NBSA 2HSWA 4GSKA 2WUFA 2XCQA 2XYPA 3RH0A 3TTTA 1GEEA 5K8IA 1RRGA 5EY5B 5AVRA 4FGUA 4REMA 3ZV6A 1YDFA 3MELA 2WVJA 1DIOB 2ZIVB 4FS8A 1L4KA 3AEQB 1NUHA 3NWJA 4FHZA 4H7JA 3HLTA 4X3PA 4XWYA 4RMHA 5TR9A 3UHFA 1TJNA 3W9UA 4JXZA 3HSYA 5ITWA 1CZUA 2VUIB 4GWLA 1Y4UA 1W85A 1ZOIA 2ILVA 1WOMA 2WYWA 3PBKA 3HHPA 3PGMA 4H3HB 4HB3A 4RVCA 3AKZA 1NYQA 4D97A 3IOCA 3L4KA 2IS1A 3GA7A 2YHIA 3O73A 2BMEA 1JILA 1U0GA 2EQBA 1GNVA 2X40A 2UZ0A 1DAHA 3FPAA 1Z35A 1W76A 2P0EA 4YO8A 5AKEA 2CKMA 5EZYF 3U3DA 3ZZTA 5KC9A 3IDOA 3L4JA 1H3FA 4N3CA 3ZX5A 1OU0A 4ONEA 2BGLA 5JEEA 1E92A 5CK4A 1QVWA 1M0SA 4MX8A 4TRNA 2I91A 2HWKA 4IRXA 2WYVA 3QBEA 4ZVMA 3HJNA 1K3FA 3SE0A 3O2JA 4CN9A 2CW5A 1Y0BA 5B6IA 4QIHA 2OB2A 5BWCA 4KIUA 3I76A 1C7EA 3PE4A 4AY6A 3IQHX 2OK8A 2DLDA 1MABA 2V6JA 2AS0A 1A9PA 2AB0A 2GTPA 2OM2A 3N2KB 3PTLA 1T4CA 5BOSA 4D6PA 7YASA 2ZUVA 3QK7A 1QUEA 4NVRA 1QHXA 3OHPA 4L02A 5LDDC 3EAQA 4XVQA 2HT1A 4Q6WA 1JAIA 3IURA 1Z6TA 4JIGA 3HA3A 3HJTA 1M8PA 2OHJA 3BFJA 3JQ8A 4FX2A 3ZXIA 4KH1A 3QG1A 3P9CA 2FN8A 1QZXA 3QPCA 4ZCPA 4R9RA 2FX2A 1MF7A 4RFSB 3EVEA 4DUGD 2JLUA 3KPYA 4RE6A 3EG9A 4INAA 1SCBA 3TBKA 5HUJA 2CUKA 1N2HA 4JQSA 4FEAA 1EWQA 3L8DA 2NW6A 3BIXA 3VGPA 5A5EA 4C01A 5KQLA 3QWBA 1OWOA 2ISCA 2OAEA 2ZYUX 4U6QA 3PEWA 1GTSA 2VUTA 4NAHA 1KFJB 2H08A 3HV2A 3SQMA 4YO7A 4QRDA 1O58A 4EY8A 1HNWB 2PUWA 4GQAA 1K3TA 2BDEA 2OMEA 4P93A 1Z4KA 3ZU5A 3EDOA 2QUBA 2G71A 4M88A 4RJ2A 4TLCA 4DIUA 4UOEA 2BBSA 4DV4B 4POAA 2DHQA 4YV2A 1FUKA 2F3PA 2EFYA 3GVXA 1QSGA 2VDMB 4OHXA 3VHXB 5BN3A 1SC4A 3D6AA 2UAGA 4ALIA 1GT91 2GYWA 1MW9X 1ZM4A 1XTIA 1GVHA 4DIEA 4ENRA 2WJAA 4AI6A 4E22A 1N8TA 4NBLA 1FYEA 2OK7A 1V6AA 1L7RA 3IEPA 4FFBB 4FZJA 3K6KA 4G4JA 4B3JA 1N6IA 1XTUA 3NS7A 3NV9A 3A6EA 1XVLA 3AINA 2DJIA 3F74A 3TUJC 4CUJA 1PT8A 3SEFA 2IOYA 1M54A 5L4NA 2R8XA 5SYMA 1ZUNB 2A9KA 2CCJA 2GARA 3PD0A 1K0UA 4C6TA 5HILA 3RIEA 4I4NA 4BP9A 1TT5B 4N76A 3PV0A 1M6YA 1P73A 2GUWA 3BA6A 4GM4A 5BVHB 1J25A 4YIHA 2I71A 1T3HA 2FMFA 1L4MA 4UBJA 5EZ5A 5IU6A 1OFTA 1SHKA 3MFYA 4Q3DA 2P2LA 5SY6A 1N1EA 2VRCA 5KYUB 3HCEA 3MS4A 4P34A 3U1BA 1RHRA 1OLUA 4J6FA 1U0FA 5ILOA 3WLNA 3FIUA 4ZVOA 3OE5A 3KV3O 2REQA 1EG2A 4Q01A 4QOJA 4OLAA 3VH1A 2WF7A 4G89A 5T3YA 1SVNA 2GWHA 2OXRA 3LPDA 2QVBA 4C5CA 1I1QB 4NMMA 2ABWA 1Q7CA 3V4RA 4FQ8A 4PNHA 3EXG2 1XRQA 4WFJA 3SNKA 4YPOA 3BMNB 3OO0A 5A4DA 3LE8A 2XWBF 3ZE0B 4OYYA 4UBIA 1KPGA 4C6SA 3PD1A 3V48A 2VTKA 3WLKX 2QJOA 1QG4A 4EI2A 1QHIA 1QVRA 1ZM9A 5E6SA 5BOVA 3C1TA 5IJWA 3E0QA 1PT5A 4MMYB 4UZFA 1N57A 5E2IA 2W2KB 1RKVA 3CJQA 1EB8A 2NX2A 2VWPA 3FTDA 2JI6A 3IJRA 3FOWA 4GZ6A 2WNIA 3V3KA 3WB9A 1WULS 1N6HA 1XZLA 3HB0A 4BNXA 2VZEA 3HKBA 3FFTA 1JHOA 2OILA 3K4QA 1JAHA 1TU0A 3DXYA 4TZKA 5JNSA 1Y33E 4NKRA 4P3YA 5TF4A 1WJGA 3TRHA 1CUSA 3GN2A 3JQFA 3L41A 4KBFA 4Z8XA 1VE5A 2GWRA 2ODBA 3PXEA 3SZMA 3ESRA 4HRYA 3PQFA 4N47A 2YZGA 2A7XA 2HXYA 1RRMA 3KQPA 1DTWB 1QKJA 1IQUA 1ZAYA 2CHQA 2QSZA 3O0DA 4IS3A 3EIHA 1XAHA 1TAUA 4DCJA 4MCAA 4PG5A 4F85A 2AQHA 3QVVA 3A6PC 2EIXA 1M2VB 3L0IB 1FNBA 2W8ZA 2NZJA 3JQAA 3DWEX 3U6KA 1BVRA 5KHAA 4O59O 2Q3CA 4XA8A 4HQ6A 3ICQB 5HFNA 1Q17A 1V9CA 1XE3A 2VATA 4LV8B 4EFMA 5GJBA 1W5EA 2VEOA 2INGX 3CRRA 3BHIA 5JZOA 1EVQA 2AWOA 1S96A 2FI1A 2J6HA 2ZT8A 3JZFA 1AK9A 1KY2A 3OU7A 3WAGA 1KY4A 3V2UA 1GN9A 3MXOA 4LRQA 3LZCA 3VZDA 1TK3A 4ZZ2A 2D0PB 3GJYA 5LZ9A 1KS9A 3IVAA 5JDCA 3I1IA 3DAYA 1TKBA 1JG3A 4MVJP 3EQ8A 4JVSB 2PMEA 2EKPA 1THGA 2RGCA 4KNYA 4RVGA 1P2DA 3DW1X 5CD9A 5ALZA 3K1AA 2VCEA 3T06B 4FNOA 4AKSA 2W4QA 1JT9A 2XB8A 5EWLA 5ED4A 4DR5B 3RU7A 1KYIA 4QEKA 4YMIA 3PX7A 3GNSA 4OI1A 3AF2A 4NABA 1LSOA 4NZZA 2XSZA 4INZA 1PJCA 1JQDA 1Q83A 2BFFA 3HDYA 4JR1A 4KN9S 4O63O 5FLYA 2Z1DA 5FTKA 1C0KA 1PDVA 1WXHA 3HXTA 3L5KA 2O8EA 1L4UA 1QCCA 1QHYA 4I1RA 4C2BA 1DL5A 3IXQA 3OE7D 3RC9A 1AB6A 5K3AA 3DFUA 3EMBA 4YPFA 5AVXA 4K3VA 3TQOA 5FPSA 4B2LA 4E94A 4PHTA 2R11A 3LDHA 5KNBA 3DYIA 3DLHA 2QRJA 3A10A 3FA2A 1X1TA 5KSZA 4N54A 2D1QA 2PWZA 3T4PA 3PDWA 1JF8A 2WSBA 2ODAA 1SVKA 3OKAA 1TJ4A 4AMBA 4UUQA 3P7MA 1T9GS 1E2IA 2XVXA 4OQNA 2G1AA 1QP0A 3KEQA 5ALQA 4HH3C 2QUAA 2QPTA 3U4IA 5BPHA 4QPCA 1K4KA 4RFLA 1OYOA 3LUAA 3TXYA 4B3CA 4YQFA 2FN7A 1XZHA 4EA9A 2AJCA 4CI0B 4KOAA 3PYLA 4K7JA 4K9PA 1LTKA 3CIOA 3PPIA 1KI7A 3DZJA 3FPJA 3VAAA 3AW9A 5EEGA 1VGRA 2P2NA 2RI0A 2WMNB 1G20B 3FPHA 2Q1UA 3W5VA 4I46A 5FL7A 5KTKA 4P58A 2ZSAA 1IRXA 2XVZA 1RBMA 5ABPA 1RBYA 3O03A 3NHYA 3KYCA 4QICA 5FPQA 1W44A 2EBUA 4FD3A 1K7EB 1MEOA 1YS1X 2HIGA 2R6ZA 3LQFA 2XKAA 4ZQGA 1AMUA 1FX0B 1CUXA 4LECA 3PQ4A 4DQLA 3BVPA 5JY6A 2ISSD 5IMBA 2DQZA 2ZSIA 4YAJA 2GA9A 2WYIA 5FBKA 4ASUD 1CY0A 3E22B 3WYBA 1TEXA 1SCDA 4MIYA 1BCSA 3QTTA 1ABBA 3DDUA 2Q07A 2EZ8A 2VP0A 1ZUD1 4MH0R 5G0SA 2P9BA 4Q4LA 1GAJA 2NU6B 2RCNA 3A4NA 4V39A 5LQDA 2HT6A 2GVDC 2GFHA 3FPGA 5BYKA 1G8JA 1G291 4EITA 1X13A 1P2VA 5EI5A 2AI2A 4NH0A 1RMTA 1K5DA 2O14A 2IBSA 3AIIA 4JOQA 4MPPA 1YR1A 4QOSA 5EXTA 4UM8B 3TRKA 1W9HA 1RYHA 2PAFA 4CT0A 1QR2A 4Q9KA 3ZY2A 3R24A 1L8OA 1RI1A 2UVQA 1UPFA 3NBYC 2OGZA 4FMDB 1THZA 3ENQA 1AKVA 2D06A 4RPJA 3QX8A 1U8UA 1P1BA 1K63A 5CAEB 4AY2A 3R0JA 3SJZA 1UJMA 1EGMB 2PVSA 4S2EA 3OETA 4LJLA 4DQKA 3LX5A 1KEEA 1J06A 3DCYA 3JWGA 4BLUA 5ALMA 1RJGA 2X5JO 3BSWA 4DVGA 3H6KA 3OKFA 1Y9DA 2H1SA 1C8BA 4OP2A 3L8CA 3QE0A 5B3KA 1TUBA 4IG4A 2ZB2A 4OHWA 4ZZIA 3HCRA 1DO8A 3Q3VA 4LHWA 1U7HA 3R7AA 1OR8A 1Q84A 1K98A 1X3LA 1FDVA 4G24A 1OY1A 4PGAA 4WKGA 4XDYA 3P9SA 4H1WA 4OBBA 1SRRA 1HTBA 2OB1A 2WVAA 2YWBA 1ULAA 5A3QA 4B35A 1UIRA 4EI8A 3J7TA 3IEVA 3G1TA 3AVQA 2PGDA 3HBMA 5IDYA 4W63A 3RK1A 3U60B 4BCDA 1KP3A 4HDRA 3RTCA 2PGJA