3OG4B

The crystal structure of human interferon lambda 1 complexed with its high affinity receptor in space group p21212
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
199
structure length
197
Chain Sequence
PRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAEHHCLSARTIYTFSVPKYSKFSKPTCFLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex of human interferon-lambda1 with its high affinity receptor interferon-lambdaR1.
pubmed doi rcsb
molecule keywords Interleukin-29
molecule tags Cytokine/cytokine receptor
source organism Homo sapiens
total genus 29
structure length 197
sequence length 199
ec nomenclature
pdb deposition date 2010-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3og4B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3og4B02
2DM2A 5JW4N 4JVPA 4K8RD 5D7SL 2X1XR 4JN1L 1T83A 1Z0NA 2CDEB 4CN6A 1UYWL 4KHXL 4XPTH 4PV9A 2DI7A 3HMXA 3MFFA 1CLZH 4FMKA 4DGVL 1CIUA 3SCMA 1UM4H 2QHRH 1FO0H 3VXPA 4LDOB 4X0KA 3VGAB 1OWRM 2BNRB 1FHGA 1K5NA 1I4FB 5ENWA 4KTDH 1I7ZA 2AXGA 3WIHL 1AHWB 3RVTD 3ZHKA 4P9HH 3O2VL 1ORSB 3NPSC 3WS3A 4LGPB 5ALBL 1HXYA 3Q1SH 1FPTL 5GS1B 1D5ZA 3HZKB 3KPSD 3IDJB 3UBXG 1SEBB 2QLVB 5CMAA 5AUMB 3RZWA 2VXSL 4KRLB 4QWWC 2XXCB 4M1GH 4D0BA 3T0DA 1OAUH 2Z8RA 1HYSC 3N1MC 4G8FB 3WSQH 2DQJH 3EO9L 3H3KA 4XVTH 1GOFA 2I27N 4LIQE 1G84A 3VD5A 2BNRE 5E4IA 5TE4H 4U3HA 1LO0H 2BK8A 4Y5YB 1U3ZA 3RDTD 5I16A 4JZJA 5EZJA 4MXVE 2F74A 5C8JB 2C26A 5JUEL 1MHHB 2ZZUT 4HCRA 4GXVL 3STLB 4B5EA 2XRAH 2D9CA 1XF2A 5K9JL 4MSWB 4CN1A 4OD1L 4RMSA 5HJ3B 4GBXA 1ADQL 3EYVB 4FZ8H 2IBBA 4E0RA 1A7RL 2KUTA 4E41B 2ADIA 4R9HA 4OZ4B 4LVNC 3L95B 3WO3B 1E4XH 5I1IH 3MREA 1IGTB 4JO1H 4X98A 3O6KH 1TLKA 3RA7L 1IJ9A 4PJGA 3X12B 5I8KL 3HE6A 1RZKL 1R5IA 4ODHL 2FH6A 1HSAB 4EIGB 3DIFB 4E9LA 3QDMB 1F6AB 2HTKC 4I3RH 4K3JL 4YHKL 1UJ3B 1INDH 2ITCB 3BDXA 1P7QD 2LTQC 5HYSB 1B3JA 5KVGH 4PR5B 2V2TA 5EO1B 4NQXB 2M2DA 3QBTB 1MCOH 4KUZL 4PB0H 4LPYA 5DI8A 2IBZY 5EU5B 3PP4H 4DZBA 4OGYH 3GHBH 4Y4KB 1JK8A 2EKSB 3LQAL 4M43L 5GRWA 1BD2B 5DMKB 4TVPD 3MRCB 3SDXF 4QRUB 2F9BT 2A6IB 4NO0A 3LN5A 1I1YA 5GRYA 4LRNH 3KNBB 4TVPL 3JUZA 1KJ2L 3QDME 3SDDD 4P46B 2Q7YA 2WLYA 5D1QB 1PVHA 1T7YA 2PTTB 4KK9D 5C6TL 4PP2A 1F58H 1ZEAL 3CK0H 4WNQA 4ZSOE 1HHJA 3BH8A 3KPMB 3LEVH 3GBNH 3ARDB 4YHNA 1F4HA 2IANB 1K8IA 1YY8B 4G9FE 4X6DE 2PCPA 2V5TA 1NQBA 5EBWB 1J87A 4WHTB 3R1GH 4Q2ZA 4YK4C 3ULVE 5DURD 3VXUA 1EHLL 5FCUL 4BFBD 5J12C 1IKNA 4HIIB 4ODWA 2XWJB 3VCLA 3OAYK 1ZA6B 3PWNA 3ME0A 2DJUA 3QUXB 4P5TB 4POUB 3QQ4A 4GRMB 1CICD 4U1HB 1XF5A 3QUYD 1PBYA 3L3GB 3TCLB 2F19H 2VLRD 2OR7A 2DQEH 4YDIL 3ABZA 4S1SH 3RVUC 3IGAA 5I1CL 1N64L 3UYRH 3HI1B 4BZ2L 3X3GL 4ETYA 1J12A 3KPRA 1CFNB 1ZGLA 5BVPH 2IANE 1H3PH 2H6PA 2FYYB 3O2DH 3QEUA 4WFHD 3MLWL 4H8WH 3SKJH 5B21A 2B0SH 2C1PB 1J1XH 2ZOKA 4ZODA 1MH5A 4RFOL 4YZFF 4G80B 4QRRD 4RMTA 3VXSE 1QR1B 2AEIT 2AJXH 3UJTL 3V4UL 4HKBA 3BGMA 4K9EL 4U4BA 2QKIB 3O45A 5F88B 1WT5C 1CDIA 3O4LA 1RZGB 1S7TA 4JQXA 1OLZA 3O41B 4U7SA 1J8HA 5KVMC 2XFXA 1U36A 3BESR 2GAZB 5ESAB 4HQQL 2E7BA 4HKXB 4NQDB 3TGXA 5E6IA 5JHLL 5D7LE 1U41A 1T4KB 4KHTH 4XP9H 3MLPA 3MUHL 2P42B 5J89A 1KCSL 5DZNA 1RHHB 4QHMB 5D71H 1E4WL 2F5AH 4PY7A 5ANMB 3EZJB 4XNXH 1UXSB 2VDML 4OZHF 2VZSA 4WI4A 4PJHF 4RQQB 3H0TB 3SKUD 2P5EB 4DKEH 1RV6X 3RPIB 5A16A 4Z18A 1IEHA 3A0OA 5C0CB 3A6BL 3EIFA 2R23B 1FJ1A 5GGQL 5DRZA 4OCRL 3SHSA 2FO4A 3WMSA 3H3PH 3ZZ1A 1K2DB 1MCRA 4LAQH 2NY3D 2ICWI 1N8ZB 3OXSB 3B5HA 3VWJD 4Y16B 1DBAL 3DVGA 1UB6A 3FQNA 4TNWK 1T1YA 4Y5VC 5CILH 5SX5K 4P2OC 4GFTB 5ANME 2BSRA 3Q6GL 2JK5B 5L0QB 1SEQL 3V6ZA 4F33A 4BSWA 3LV3B 2M1KA 3OAZH 3OR6B 3SCMD 1DQQB 4NHUB 3VDAA 4PRIB 1CLOL 3IKCA 3N1PC 5C0CE 5DHYB 1RVFL 2BY1A 1MIML 2H45A 3HMXL 1FORH 5I1GH 1RUML 3DV6A 3UYPA 4IMKC 4PJ7B 3PHSA 2H2SD 3PP3H 3VXOA 4D9QD 3MROB 2C7UA 3BP5A 4KU1A 5HYQB 2MHAB 1U8IA 1WCBA 3DJ9A 5GHWH 4XWGL 4HZLA 1HHIA 2Q6WB 4JO4L 2AJSH 1WAAE 5HHVL 2AW2A 2NPLX 2NY0C 3TA3B 1I9JH 2FIKB 1XIWC 2I9LA 4DQOL 3WV0A 1TZIB 5F9AC 1E6OH 4K3EH 1CFSA 3OGCB 4D8PB 5GGRA 3BGFB 3AAZA 4GKZB 3NZ8B 3O6FA 5AWNH 1HHKB 2YBRB 4JFZH 5DK2B 4IRJA 4E42B 2OSLB 3QXDB 4RRPG 3PHQB 4HCRL 3PQYA 3TO4A 4GBXD 3U9PH 2B1HL 3HS0A 3CDYA 4JCMA 4KKLD 4OZGB 1OTTD 4M5ZH 4CU7A 1KCUH 4X7SH 5T33H 3DGCR 1EBPA 3GMMB 4J7RA 2BHUA 2P44B 5IV2B 4LQFL 4WTZG 5HGHB 4FFVD 4F15B 3HE6D 3ZE2F 4ZFFB 2EIEA 4KY1L 5DR5L 4EI5A 2ENYA 1NGXA 4GH7B 5IB4B 2HJLB 1D9KC 2WWMD 4RDQG 1CFBA 4GSDL 1K8DA 4XPBH 5E5MB 1WF5A 4FQCH 4G6MH 1BIIB 1CLCA 2IFGA 3QWOB 3ZSSA 3JUYA 5GGUA 1NMAH 4IMLB 3R4DA 3ZDZE 3MO1B 2Y9RT 3HC0A 4RDQF 4TQEL 1DR9A 4CVUA 1R3HB 4HGWB 4G6FB 4LLMA 5DS8A 1RK0B 4F3FA 1DQDH 2F8XC 2UY6A 5L88H 2HAZA 4NO0D 3V52L 5DZLA 3U4EB 2PW2A 3GKWH 1U8PA 4JFFA 2V17H 3QR2A 4OLYH 2BRQA 4W68A 4C54A 1NANI 5ACZA 5KN5B 3SEPA 3ULVH 3FQUB 3E2HB 2EDQA 5L2JA 3HN3A 4M5YH 4PJAF 1JHLH 4FG6C 3BJ91 2WBWB 4LSTL 1YPZB 3VXUD 3ARBB 2IALA 1UH4A 2CIIB 3ZDXF 3TT3H 2EE9A 2R2BB 3EOBB 5KSAA 1XMWA 1F4AA 4J1UA 3TVMA 4V1DB 3WIIH 5FOBB 1F45A 4M6NH 4H26B 1IGCL 1RFDL 1NCDH 3VDCA 1UWEH 4J3WA 5C0FB 1UH3A 5FM5M 3KPRD 1NC4B 1I7RB 2I24N 3KYKL 4LKCB 3EAKA 3BE1H 3DMMB 3WFEH 4U0RB 5SWQB 3L3OA 1FGVH 3MRKB 4FQHB 1VB9A 3DRTB 5JPMA 2R1XA 1U58A 1BAFH 2CD0A 4PP1C 5CGYD 2X40A 3SDAC 4K7PY 4QHLA 1A9BB 1IAKA 4V1DE 3ECBB 4WW2C 3F58L 2FX8H 4WFFD 5CZKA 3ILPB 4O4YL 5TDOB 3PGFH 3FB7A 5CJQL 3V4PL 3O4LD 5CZXD 1WZKA 1RZ7H 1I9IL 3W11C 1YUHB 1J8HD 5C09B 5CD5C 4WIQA 3BZFA 2A1WL 2WANA 1KJ3L 5E6ID 3M1BA 3I75B 3CU1A 4OZIA 3RU8L 1OAKL 5IVXB 1MPAH 3CFDA 5HDQH 3GJEA 3SQOL 3S35X 1T03H 1IAOB 5D1ZA 4OQTA 2OL3H 3KPOA 3C6SA 2F58L 4IRZH 4XPFL 3G5YB 3K8MA 5I19H 2EH8L 4C57C 3MNZA 4W4OC 1Y0LB 2VLME 3KLSA 4DGYH 3NIDF 4IBLT 3FQRA 1KEGL 2B4CH 2O5XL 4N9OB 5E2JA 4RGNB 2J8UA 5JIIA 2NY5L 4LSSL 5C09E 1KBGL 5B38B 3EOTH 5HYJE 1JZ6A 2D3VA 5DK0A 2IGFH 1KNOB 1R3LA 2X4PA 3S35L 4DZ8A 1MAJA 5IVXE 4KJYB 2AV7A 2AKRA 3ES6A 3N85H 5FYJE 5HSFA 4PJFF 1MREH 1BVLA 4LEXL 1KT2B 1F4XL 3LS5H 5BW7A 4PRNB 2Y06L 12E8H 1FAKT 1UWGH 1OAXH 3NCJH 3B9KA 3D0VA 2YUZA 2GY5A 1NEUA 3RNQA 1HOCB 2FL5B 3DECA 4MJIB 1BBJB 1W8OA 3B2UD 3HB3C 2J12B 1VGKA 3W9DB 4LDEB 3V7AG 4F7CB 2E6JA 1MVUB 1OVZA 2ZSWB 2IQAA 2H26B 3ARZA 2YPVL 1EEQA 4IRSC 2R2EA 4YHIB 4KI5D 5JXEC 1CVSC 4AENA 3PL6A 3VWKC 2O93L 4FZEL 5JW3H 4DCQB 3MLUL 3G9VA 4I13B 4OLVL 5ITFA 5E4EC 1MFCH 1T0NA 5DC4B 2VKWA 1UC6A 3P4OA 1LEKA 4WENB 1B2WH 5FUZH 4E5XA 3A67L 3GSRB 4XPAL 1OAYH 3EDDA 5GSVA 5IMOA 5TF1L 5T1LA 4P2QA 5C9JA 4OGAC 4MJIE 3LIZH 5DD3H 5E2WL 5EWIH 4JKPH 4RIRA 2DQTH 2FEEI 3FN3A 3HAEG 2A83B 1MFAL 3HPJA 3MA9L 1KPUB 1OGAE 2A6JB 3D39B 1EZVX 5HY9B 2KL6A 5I15H 2OTUB 3VH8B 5DZOA 1MRDH 3O6FD 4HULB 1MCJA 4IRJD 4NQUA 3D25A 4OKDA 5IG7A 3PQYD 1X5IA 2QSQA 4FHBD 3TO4D 5JOEA 3IXAB 3ZYIA 1L6XA 1QP1A 4P5MB 2H2PD 4NP4L 1A3RH 1IL1B 2VLKB 3IDNA 5JDSA 4P3DB 4LPUA 2BDNL 3MRRA 5HGDB 1A6AA 3HI5L 4R2GD 3MV9A 2GTZB 1GAFH 5F6HI 2JJSA 1BVKB 1VENA 2EDYA 4CVWA 4G6AD 2IJ0C 5FO8B 1L9NA 2E9JA 3C5JB 3ZO0A 3W2DL 4EI5D 4XBPA 4WY7L 5I1DA 3LVEA 1BZ9A 3MV7B 3D39E 3JTSB 2VH5L 3WXWL 2DQHL 3UP1A 1YEGH 1B0GB 4MX7B 4FTVB 3I84A 4XGZA 3BIAX 3EO1A 3D18A 1M7DB 1FNFA 2Y6SD 5EORL 1ES0A 4P23C 4H0GA 3C60C 5F93C 1TQBC 4R4BA 4NZDA 1SMAA 2VLKE 1JYVA 4J4PC 2BX5A 1NLDL 3TH3T 3QFJA 2CRZA 1I1AB 3W0WB 2XNAB 3I50L 5E1AB 1FSKB 4XVSL 3BMWA 3U36B 3OPZL 4HBCL 5IQ9B 2H8PB 3O3DA 5B3NA 3MV7E 3BSZL 1EFQA 4GQPH 1KLUB 5I6XC 3DUUA 4JFFD 4Q0XH 3KXFB 5LCVH 2ZCHH 1YEKL 3MRBA 3HR5A 2UWEF 3ARPA 5J1AB 1XGYL 1E6JH 4N8VA 1JJUA 4FXLA 1D5MA 5T5NG 2R4RH 1E0OB 3MLZL 3E8UH 5DLML 2CRYA 5GGSY 2QSVA 4NNYB 1CQYA 3ZKSD 1QRNA 2UVEA 4XNQA 3MCKA 3QO1A 2WBJB 3QO0B 1CGXA 2Z91B 3QHZH 3T09A 2CMRL 3PHOB 5I8EA 2O26U 5T5NF 5KSAD 2PXYC 4Z7VA 3TVMD 1MVFA 3MLYL 2PW1A 3RWFA 5J6GB 1FZOA 2NY2B 3T4AA 3GRWH 2HLAB 6FABL 3KYOB 2APWA 2IH1A 3HMWL 3G08A 3VW3L 1QLRB 1WTLA 4U1KA 5GIRA 3QCVL 1VDGA 4G7VL 2E8ZA 4UUJB 2X4RB 4TNVF 4HK0A 5K9KA 2ZUTA 1I3UA 4PJCB 1HEZB 4U7KA 2SEBA 2HKHL 4LLVB 2BVOA 2VDKH 3O2DA 5IF0A 3QQ9C 1A9EB 3RKDD 1H9VA 2EC9T 4L8BB 4EKXA 1HHGA 2VABA 1GL4B 1Z9LA 4Y19A 3IS0X 4NPYB 2AJ3B 3T1FB 1CFTB 5F7FA 3TZVC 1TJGH 2VO5A 4KK6C 3ZSTA 3IFPB 2PO6C 4OF0A 1X4YA 3UTSE 4QXWA 4U6VH 3SN6N 3OAUL 5CEZL 3GSQB 4PGZA 4IIQA 3PV6B 5D1ZD 3NPSB 4L29B 1HQ4A 3INUH 4L8DA 2VE6A 2WIIB 4ZUUA 3MLXL 1JZ8A 1VFAB 5EO0A 4OQTL 4R3SB 2JB5H 4S1DC 1QTYT 2CGRL 3T3ME 4JFEA 5C3LD 5DQDL 3QNXA 2QHLA 2JJVA 4CKVX 5INDB 5F7DA 3K2UL 3G04B 5KS9F 3U2SB 4OZFA 4NKMB 3QEGH 4XXCA 5TH2A 3I9GL 5JHDA 1MCQA 4N0UE 1YQVL 3TBTA 5D5ME 3OJDA 2I60L 2RIKA 1RJYB 5FYJH 1OTSC 1T5XB 2ORBL 1UZ6F 4XAKE 2QV2A 3EJZC 3P4NB 4PJBA 4FQ1L 4ODVH 3B8SA 3HC4H 4YHLL 5DRXA 4QEGA 5HDBE 5KBNC 4JFDB 3B9KD 2VSCA 1RUPH 3FL7A 1HH9A 3QZWA 5E00A 3FQXB 1AD9B 2CK0L 5K9OA 4Q9RH 4JY4A 1QO3A 2CO6B 1UKSA 3K3QA 4GLRH 3MRPA 4X7TB 4LVNB 3ROLA 4WHCA 4ALAH 3VXQB 1NDGA 4MAYC 5LGJB 3PL6D 5L9DL 4N90E 3UXFA 1UM4L 4ESKA 3K8LA 4ZXBC 2H32B 5E8EB 4OF7A 4KTDL 4KI5F 1QBMH 1NBYB 2QJDA 3IF1B 4JFDE 4NRZA 3MUZ1 5EOCH 2JIXB 2ZUWA 4G7YL 5T1LD 4P2QD 2LTQB 5GS3A 4I8DA 3L9RA 1RZ8B 5FB8A 5D96C 1NGZB 1AHWA 1J0ZA 1P5UA 3JV4A 4M1GL 3GFUA 4Y8AA 2UUDH 4WWID 3ZTJH 2DLIA 4WO4C 4GKOA 4KRPD 3TYFA 2R0ZL 3HZKA 2VZUA 1NCCH 1R24A 1RIHH 3H9ZA 4L3CA 3FONA 4JG1H 3IDJA 4R7DA 4HKJB 2J6EA 1LP9E 1QHPA 1W72B 5TE4L 1LO0L 4GAYB 4AIOA 5GGSB 1FLRH 4NUJA 4G5ZL 4OIIH 4NJ9L 2ZPKL 3MRNA 3MV9D 3HNVH 1AGCA 3S97C 2GJ6E 1QD0A 1RZIB 4MVBD 1C5BL 2XZAH 2C3VA 2D03H 4LU5H 3RWDA 5LJYH 1D5BA 4YK4B 4ZOCA 2DIJA 1H3WM 1T3FA 1PKQB 1BFVL 5GRVK 4NFDA 5J12B 4HJGA 3WXVL 3O6KL 2X4NB 1NEZB 4C58B 3RVTC 3T08A 2CKBB 2QQQA 3QFJD 4XH2A 4OZ4A 4OI9A 4PG2C 3WFZA 2X4QB 1A6ZB 1C7TA 1UJTA 4I3RL 1LK3H 4FQIH 4G6KH 1INDL 3FAWA 1ZANH 8FABA 3VFGH 3RIAK 4ISVB 5KVGL 1GH7A 1XR9A 3ZMRA 3U46A 1EJ6A 1HSAA 3DIFA 2FGWH 4PB0L 4XHQA 3CDFA 3QDMA 2CJUH 3P30H 1WWAX 3PP4L 1EO8L 4OGYL 3GHBL 1IGJA 3K0WA 2MTPA 2ITCA 3TBWB 3NIGE 2BMKA 5EA0H 4UTAL 4ZSOA 4LRIC 4PR5A 1CDUA 3RDTC 3FFDB 4K7PH 1QRND 4AQOA 3QEHB 4EOWH 3QPQD 4LRNL 4WFGE 1MCSA 4G9FA 4X6DA 3GSWB 1YZZA 1X5FA 5D93C 3ZT7A 4BK5A 2XA8L 5DMKA 4NCC1 5BVJB 5HVFB 3CK0L 2DKSA 4FQLH 1TJHH 1MIEH 1LK2B 1VERA 1W0VA 1KFAH 2VAJA 3QG6B 4GW4A 4Z78A 4HPYH 2MOVA 1VPOL 5JOPD 2PNDA 3R1GL 5DO2D 1CTNA 1AI1H 4UIMA 1J0KA 2GFBB 4BA8A 2ITDB 4U1MA 2AABL 3KPMA 3VFVA 5KZCD 4N9GB 2IANA 1QFOA 2DM3A 3NCYP 5EUOB 5JW4R 2PR4H 1C08B 3L5HA 5IHBA 2YWZA 5E08H 4WHTA 5C0JA 3UTTB 2F19L 3EGSA 4OFPA 1IGFL 4DN4L 3BXNB 1ZVSB 1FQ9C 3GSUB 2X4UA 4PJDF 3QHFH 3VXSA 5DJXA 3UYRL 5MENE 3U6RB 1H3VA 4ELME 4P5TA 3FQWB 5BVPL 2YPKB 3LH2H 5I75C 3O2DL 4U1HA 4Y5VB 1QSZA 4P2OB 2IADB 2BVYA 2BNUA 2FJFB 3NAAH 5EU4B 4Y19D 2XIDA 2B0SL 4XP5L 1J1XL 3WS6C 2CLZB 1F4YL 3ZDYF 3UC0H 3BPNC 4CRPA 2VR5A 5F9DC 3DURB 2FYYA 3WIFB 5D7LA 3DYPA 3SY0B 4Q9QH 5DJ2B 4K3HA 4KK9C 1A7NH 5D72H 4ZFZA 4Y7MA 5E8DL 3QNZB 4OLZH 4Y8DC 5HHPA 4G80A 3MRGA 1X5HA 3HKFA 1YYML 4U1SB 5K33A 1VGEL 5CAYB 1OSPH 5GZND 4JFED 2QKIA 5F88A 4KHTL 4XP9L 15C8H 5E7FA 4FFZH 1HKFA 2OL3A 2A0LD 1FL5A 5JHDD 4HWEH 3O41A 2NY0B 4LSQL 4MXQC 4KGJA 4XXDB 5EUKA 1F13A 4LK4A 5JNYA 3QA3B 2X70B 1CICC 3IU4L 3QUYC 5FGSA 5GJSH 1BWMA 1DJSA 3CFCL 4HWBA 1H8OA 2XPGB 4UQ2B 2YC1A 5EFIB 4YXHH 1K85A 4PY8I 2NY4B 2QQLH 4RQQA 4S1QL 3ARVA 2P5WA 4NSKB 5CINL 4Y4FA 1GC1L 1XH3B 4YDJA 5C0CA 1T0MB 1AE6H 3LOWA 2I07A 2XACC 4K9EC 2B2XH 3X14B 4LHUB 5E9DB 1VACB 4RAUB 2MPAH 3LPWA 2JTDA 4KVNH 2B7DT 3QUMB 1ZT4A 2PYEA 4M4RA 2YD8A 2FR4A 1SJVA 1D9KB 3QULB 4XNYH 1WAAA 2D4FA 4N0FA 1BJ1H 3DO7A 3GMNB 4QHKI 2VZTA 1ZA3A 2WUCH 3LKRB 4H20H 5E9DE 1ERNA 4LIQL 4BSVA 3U7AA 4QHNA 3BHBA 1I8IB 1K3ZA 3H8NA 3T2OA 1B4RA 2Y36H 2WSKA 2CSPA 2P8MB 4ETQB 3PIQB 1YEDB 4HZAA 3GM8A 4S1RH 4DKFH 1ZT7B 2FWOB 1BFOA 4FN0A 2J6EL 1EERB 1JZ5A 5DQJA 3RWEB 3TA3A 3MXVL 2FIKA 2NY3C 4HV8B 4MYWB 1YEHH 4Z7QF 3VWJC 4MNGB 3FMGH 5AWNL 1ONQA 4JFZL 4RA3A 3V8OA 3NCMA 4NWUH 2WW8A 4P0DA 3UMTA 1RIUL 2X9YA 4R8WH 3U9PL 1W72H 1CGTA 3JVGC 3R0MA 3SCMC 4HXAH 2JJUA 4H88H 1KXVC 4ZO6A 1HDMB 3HCVB 5T3ZE 4MNGE 1NFDF 1HNGA 1IM3B 4F37K 5IT2H 5FA4A 5IV2A 4I48A 2HN7A 2OR8A 1INEL 4FQCL 4MJ2A 2OXGA 2NX5A 4RBPH 5HI4C 5IB4A 3U0WH 2PF6A 2CKBH 2OI9C 4F58L 1X4XA 4N8VG 5INCB 3QDMD 3NA4A 4D9LL 3IJHB 1LO2H 4NQCB 1LO3H 1QFWM 4JEGB 4O02H 1BIIA 4NKIH 4WUUE 5BOPA 3HZVB 3X13B 4IMLA 1SJHB 1R0AH 3MO1A 4S2SA 4JZJC 3EZ8A 5EULV 4UILL 4G9FD 5FF6A 3UCRA 4KV5F 2D31B 1FNGA 4OLYL 3PG2A 32C2A 3NH7H 5EO9B 1AC0A 4AIZB 4GBXC 2IPUK 3GSVA 3FQTB 1OTTC 2VN7A 1FNEA 3T3PE 3JWDC 2MCG1 2DBLH 4M5YL 4Z7VF 5DFTA 1YECH 4ZYKA 3DTXA 1IAIL 3VFWB 3VDBA 4TSCH 4OF5A 2VIRA 1HQRB 4GG8B 3FQUA 3TT3L 1MQ8A 1XR8B 4LCUA 1FYTB 2IAND 1INQB 2WWMC 3G6AA 2BSTB 3GRWA 4XBGB 5EG6C 2R9HD 5C0NC 5E99H 5CLWA 5I76A 2CIIA 1TXKA 3QQNA 3VFRA 1NCDL 3EOBA 1UWEL 3H2WA 3GHEH 4ODUB 2C4XA 3VXSD 1GOHA 1NC2A 2EDTA 3WO4C 4P5TD 3KS0J 2H3NA 3BE1L 1LD9A 1JGUH 1NUNB 3ZHLA 1FFNA 1FGVL 1M1SA 4M7KL 4Z0XB 4QF1A 4DK6A 2IH3B 2Q87A 3MJ8A 1BAFL 1G6RA 5HVGB 4JFYB 4R0LA 1HINH 1QEWA 4LCWB 1I7RA 4LKCA 3NABH 5D7LD 4QXUH 1HSBA 4FQHA 3MRKA 4GAGH 5C2UB 3DRTA 4IEFB 3PGFL 4WTXA 4JLRA 3BKCH 1ULVA 1E27A 3V0VA 3RTQA 3TNNB 2ICWJ 3MGTA 1RZ7L 1X3DA 2AEWA 5F9JA 3UJIL 2GSGB 5K59F 3STZB 1BHGA 4OZFG 2ATKB 3QCUL 3W9EA 4YO0B 3ILPA 3VWKB 2ADFL 3U7WL 4NRXA 1T7VA 4ODBD 4KJQD 2VDLH 4GS7C 2XV6B 5E4EB 1JGDB 4L8SA 5HDQL 4HFWA 1P53A 3ARGB 1X5XA 2V7HB 2OL3L 5HHMB 5HYJA 4LCWE 1HNFA 1JCKA 4IRZL 4OB5L 4X4ME 5I19L 1F4WH 5IUSA 4K2UH 3H9YA 3AXLB 4DGYL 4J8RB 5FHAH 5GRJL 3RUGB 3MRJA 3SE9H 3NACH 5BQ7A 3RL2A 3QIUA 2YXMA 1JGEA 1ED3B 3C08H 3CUPB 4K07A 5BMFH 5KTEL 1D5XA 5I0ZA 1F3JA 4HWBL 1LEIB 3QZWG 2P5WD 4PRBB 2APVA 4Y4FD 3CVHB 5C0CD 35C8L 5ALCL 4NRYA 3OMZA 1T22A 3N85L 9CGTA 4Z95L 1C16B 2AJYH 5HHME 5B8CA 5J57B 1U8JB 4WDIA 1MREL 2F15A 4PRHB 5IM7A 5DMIH 3OB8A 5F7MC 3ULUC 1QFWI 1MCPL 1OB1B 2E27L 1UWGL 3NA9L 1DN0B 1OAXL 4EI6B 4JO3L 2PYED 5E2UH 5CZXC 4XT1C 3RAJH 1P4LA 2VJXA 3TBYA 3BP4A 2ZG3A 4PJ5B 4QT5A 3I6GB 5E6IC 4B50A 2LVEA 2K7QA 4RAVA 2YS4A 2WK2A 4P23B 1MF2H 3C60B 3SJVB 1TQBB 4Q6IB 2AK4E 4X5LA 3IDMB 1XCTB 4EZMA 3QUMH 1DLFL 1MFCL 4GMSH 2DYPA 3WD5L 1OGAA 4KQ3L 5FUZL 2NY5C 2RFXB 1XGRA 4MXVF 4DCQA 3B3IA 1TIUA 2ZUUA 3UBXB 3SE8H 1FIGH 4LHJB 3IDIB 5I6XB 3CFBA 1ORQA 1KCRH 4YIQB 3TA3D 3R06A 4U0QB 4L3EE 4EXKA 4AG4L 3GSRA 5IB1B 1I1FB 5E6ZA 2HG5A 4JHZA 1ZLUK 3SJVE 2DB8A 3H7LA 5FUOL 3JV6A 1U95B 4CVXA 2A6JA 5HY9A 5DVLA 1H0DA 2ADJA 3WEXB 4XX1E 3F65A 1K3IA 2PXYB 1JPSH 4MAUH 4JB9H 4O51A 3B2UC 1OW0C 1ZGLP 3TBVB 1LWRA 4P5MA 3L5IA 2VLKA 4G6JH 2C3XA 2IBGA 4P3DA 1OD7A 2VB5A 4PRPE 4WUKH 5HGDA 1JNLH 3LKSA 1U0QA 4YWGH 4DN3L 3V6BR 5FO8A 2NX5D 3EOYG 1JF1B 1WIPA 4C83A 2X4SA 2EXYC 3MV7A 4UB0L 3FKUS 4Y1AE 3JTSA 2WINA 5DYOB 2NQCA 3GSOA 2YZ8A 4DK3A 3KLHD 1GGCH 1YNTB 4MB4A 2YD2A 1CK0H 1EHAA 4RFEA 1ZLVH 1T1ZB 1FGNH 5FGCE 4M02A 4XP6H 4KXZI 3S96A 3EHBD 2DQGL 3O6FC 4Q0XL 3FTGB 1S7VB 1T2JA 1FAIL 3B6SA 4YHOH 4YHPB 4X6DF 2H2PC 2G5RA 5F9WC 3TZVB 2W0FB 4CUCA 1S9XA 4JHBA 1YYLH 3ULVF 3JTTB 4QRQB 2PO6B 3D85B 2AXJA 1B0WA 3CPLA 4R2GC 4I5BA 3U0PB 5D2LB 4DEPC 1C5DB 1WVZA 1MFEL 1XGTB 4AMKH 4JN2B 4P3CL 4G6AC 3QUZC 2OMBA 2OR9L 1D6EB 1KTDA 3ZKXC 1KN2L 3H9HB 4PJXB 5TQ0L 3T65A 1QBBA 3O3BB 3S3JA 1V3LA 4AEHH 1T1WB 4GKNB 4QXTB 4ZTPH 5I30H 3L5JA 2WBJA 4ZNCD 5KSBB 1WBZB 3GRWL 2EYSA 4XMLH 4WGVB 4I0KA 1DVFC 3ZT6A 5FKAA 2VL5A 3WLBA 1NC2D 5CBAA 1A14L 5DVKA 2A77H 1FZMA 5D7JC 1G0XA 5C70A 4Y5XC 2P47B 2AI0L 2EDJA 2NTFA 1A21A 2IAMA 3KYOA 4X6EA 3SO5A 4PJXE 4KZDH 4PTTB 3CZFA 1G6RL 5HPMB 4WJ5B 4UUJA 3OWEA 1S7WA 5KSBE 3DLQR 3UTSA 2J5LC 3RTQD 1IC7L 1DN2A 4HGKC 1IC4H 4LPWA 5KVEL 3BKML 3GSNA 3ZLQC 5DJ8A 2VLMD 1G7HB 1TJGL 4MAYB 5D2NB 3SOBH 1UM6L 2IFFH 4M61B 1CG9A 5CCKL 4EN3A 2X10A 5HHNA 4ONGH 4U6VL 4ZXBB 2Y4SA 5KSAC 4NZTH 5HYJD 2AERT 5D70H 4N0UA 3T1FA 4RWHA 3INUL 5D5MA 1Z9SA 4WW1A 1TVBB 1N0LA 1Y18B 1S5HB 3QFDB 3ALPA 4LOUD 5IB5B 2R69L 1PLGH 4PJHB 4K23L 1MEXL 3QIUD 5D96B 3WFCH 1Z3GH 3PV6A 3HZYB 4L29A 2FHCA 5FYJD 3QJHB 1RIVH 4EDWH 3KWWB 2LU4A 4WO4B 3I3BA 1NDMA 1I7TA 2VXTH 4PJ9C 5FYJL 3CLFH 3MJ9H 4JREC 2FB4L 3VG0L 2YN3A 3LPFA 5AYUH 3L7EB 3HC4L 4I2XB 3BD4A 2CQVA 2E3VA 3DVIA 1Q9WB 4Z7WA 5ICXB 1HN1A 3MJ6A 3MLVH 2C3HA 2YMXH 1FFOB 3RKDC 1T2XA 3C8KB 5B3JE 3CC5B 3CVHH 1BEYH 1U92A 1FDLH 3LD8C 4NQVB 2OJEA 1KLFA 5HI3D 4UV7L 1X4ZA 4JFDA 2E9IA 1OPGL 4ALAL 1WAAF 1X7QA 4FFYH 4ZS7L 2Q8BH 3BOVA 1DANT 3VU2A 3FQXA 5JIHA 2FECL 5D1ZC 2EYTA 5I8OH 5F6HJ 4DKAA 2DYPD 2QADC 1A3QA 1A1MB 3MRHA 1OGAD 3C8HA 1FZKA 4X7TA 3MJ7A 3KPSB 1DEDA 3IFOB 1VKXB 2NLJB 2ZOLB 5ISZE 5CLTA 4OCWH 4LSVH 4PJ7F 5J06A 4P99A 4HHAA 4JPWH 3T0AA 2GK0A 4B41A 4Q9CA 5FV1L 4PLJD 1MCLA 1I8LA 1LP9A 2V5MA 5IESH 5IKCA 1NBYA 3K4AA 3NBNA 1FV1B 1I9RH 1B6UA 2XQYG 2GJ6A 1JV5B 1RIHL 3B9AA 2EH7L 1AFVL 2NYYC 1TETH 3RDTB 1FG2A 2F53E 1ZOXA 1FVCB 1JRHH 4JDZA 3UX9B 3KPSE 1FLRL 3DX9B 5IBUG 3FT3B 4JFXA 4OIIL 3B9KC 4W6WB 2LU3A 5D93B 4OT1H 5GZOD 1MFDL 2V7NB 2CXKA 4JFPB 5FA3A 5I2IA 1JPFB 3O3AB 2VLKD 1JHTB 5DVMA 4PGCA 4G8GA 5D9SA 1MQKL 4HPOL 4CADB 2V2XB 4QXGH 4LU5L 4R96B 3HNTH 3ZDZF 1EXUB 3BKYH 5JW4M 3VD9A 3UO1L 4WI8A 4PGJA 2YRPA 4D0CB 3BD3A 5AD0B 5KVDL 2FBOJ 3Q5YA 3MV7D 1WEJH 1PD6A 1S7SB 2Q7NA 4YFEA 2O5YH 1QFUH 3CMOH 3BPOC 5ADPH 4C59B 1RZFL 4K7PX 5DMJB 3W5MA 3VFSB 2Q76B 1LK3L 4I4WB 4FQIL 2FBJH 1E28B 1ZANL 2Z31A 3VFGL 5FGBC 2MSPA 5M94B 1EJOL 5I75B 4XZUB 4JPVL 4TRPL 2FEDD 1N0XL 4GG6E 3BN3B 2VC2L 2CJUL 3U0TB 5EIQA 3P30L 3DO3A 3EW3B 5D4QA 3TFKD 1KJ2B 2CR6A 1NKRA 4L8CB 3BPNB 5GRVL 2WV3A 1J86A 3B5GA 1EMTH 3SDDB 4YGVA 3ZE0E 5GSRB 3C8DA 5FO9A 1IEBA 3IXTB 3OG4B 2JJSC 3P9LB 1JIBA 3WHE1 4DVBA 2X41A 4MVBC 1KB9J 5DJ6A 4MHHG 3S37H 1AC6A 3REVB 5CP7B 1QSFE 5E2VH 2X7LB 3LAFA 3QEHA 1C1EL 1TJHL 3LZFL 1A7QH 2WBJD 4FQLL 4UOJA 5DURB 1BJMA 3GSWA 4UV4H 3QXAA 1KFAL 3P0YL 3GBLA 1N3NA 2FATH 5FFLA 2WWKO 5I9QC 3CH8A 1AI1L 5KANG 2LVCA 5J6HB 3T2PA 4JRXB 4EQ3A 5MENA 1KTLB 1CICB 3FO2A 3QUYB 4D3CL 4ELMA 3BAEH 4HUVB 3LB6C 2VLRB 3TPUB 1BJ1J 1MLCA 1R3JB 2IAMD 2W9LA 2W92A 5E08L 4KWUA 1H3UA 3J8F7 4FA8A 1QYGH 4UTBH 2BFVH 1M05A 5LWYH 5FO7A 4LLWB 1YNKH 4UNUA 1C7SA 3QHFL 4MJ4A 1MRFL 1C08A 3UTSD 5ELIA 3LH2L 5F71A 3S36H 5E94A 2W60A 3NAAL 3P3YA 1KIPB 4XBEL 5AAMA 1RAMA 4XNUH 3W39A 4HKZA 4LGSB 1IGIH 4JRXE 3GKZA 1XGQA 4Z7UA 2A6DB 2RQ8A 3QPQC 1AD0B 4EN3D 2VLRE 3LQZA 3GSNL 2CUMA 2OQJB 4IOSD 5JW4Q 4Q9QL 2IADA 4Z0BH 4YHZH 4AY0A 3MYJB 2JF1A 1ZHKB 1A7NL 1CXKA 4WFHE 4U7MA 1NAMA 3F5WA 1NLBH 5DJ2A 1G7MA 5JQ6H 4FFZL 4KGLA 4YX2H 2FDBP 4YR6A 2RCSL 2ILLA 4HWEL 3JV5A 4PJIE 5IVXF 1ZGLM 4GRLC 1BOGB 5IW3A 3OQ3B 5DEGB 4NQSB 1CFVL 2B39A 3IVKB 3TNMB 5B38G 4X6CB 5GJSL 2EZ0D 4KDWA 3BDYH 1MCDA 1HYSD 4P59H 1Q9LA 3CXDL 1JN6B 4XXDA 3L7FA 3BRGC 2NY3B 1XIWA 3OJ2C 3VWJB 4PJFB 2QQLL 4OM1H 1KLGB 3QA3A 5F1NA 2DWEB 3L5XH 3BO8A 2X70A 3DROA 1TTGA 3FB5A 4N90D 3OHXA 3N06B 5DGRA 1Q38A 3HRZA 2WP3T 4D9RE 1OY3B 1RJZB 4TSAH 4B7IA 2B2XL 4PV9B 2WM0A 3RX5A 3MFFB 4GUPA 2NY6C 4JFDD 4W4NA 3SCMB 3MYZA 3VXPB 1QSEE 3BKJH 4GT7A 5ICYA 5ENWB 1XH3A 1I7ZB 2AXGB 3U9UA 4IIQC 3HI6L 4LMQI 4YPJA 1T0MA 1UYWH 1A7PL 3X14A 5E9DA 2EO9A 1M7XA 4DGVH 1VACA 4RAUA 1D5ZB 1EVUA 5GZNC 2VZVA 3RPKA 4WI2A 3PWLA 3ZTJG 3O2VH 4XXCC 4D0BB 2A0LC 1JNJA 2P8LA 5DD6A 5ALBH 1FPTH 1D9KA 2OI9B 3QULA 1M71A 1A8JH 2FO1A 3CFJB 1VFMA 2GJ6D 3BIKA 1SBBA 1CL7L 5F3HA 4BH8A 2BNQE 5I16B 4JZJB 5EZJB 4DKFL 2F74B 3EO9H 2DD8L 4D9QE 2XWBA 1GC1C 1I8IA 1VCAA 1NFIA 2W1NA 3O11B 4TUKL 3MGOA 1XF2B 1FLTX 1BPVA 1CF8H 3EDFA 4XC3L 4GBXB 3PIQA 1YEDA 3FMGL 1YN7A 4E0RB 3TN0C 4ZAKA 2ADIB 4G8GD 4NWUL 2CPCA 4GXVH 3RI5K 1B6DA 3SKMA 1VFOA 1AIFB 4YFDB 3MREB 4X98B 4R8WL 5K9JH 2JCCE 4OD1H 2DM7A 4PJGB 4OGXL 4YPGA 4MNGA 2X9WA 1ADQH 2EDEA 5MERA 2YK1L 1G1CA 1A7RH 1JMXA 4H0HB 5H35A 1R5IB 4ONOA 5CIPB 3LHPL 3UZQA 1L0YA 3WNOA 4GKSA 5HBBA 2XKUA 1RI8A 4F9PC 1MJUL 2RAMA 3P4MA 3S88H 1REIA 2P24A 3VA2C 1KYOJ 5J1TC 4ODHH 3MLRL 5IT2L 2V2TB 4WUUA 3S3SA 1P6FA 4XC1L 2Z31D 5DI8B 3WO4B 4DZBB 2CH8A 2GSIB 4K3JH 1JK8B 4YHKH 2XXMB 4WFGD 4F80A 4P4RB 1LO3L 3RVUD 2MQ3A 4O02L 5GGRY 4NO0B 3REWA 1CGSH 1I1YB 4OF8A 2XY1A 3FAXA 4PREA 3U7YL 4M43H 4AEIH 1A6UH 2Q7YB 3RWGA 1XZ0A 3NCCB 2APTA 3BISA 2XN9E 1IBGL 4LSRL 2DMCA 4WNQB 1HHJB 1J0JA 3SDAA 3SKOA 1PEZA 3X13A 4NJAL 1K8IB 1KJ2H 4WW2A 4WEBH 4XNMA 2PCPB 4NCDA 4Q2ZB 1EZVY 3VXUB 4GS7B 3PE9A 4P2RE 4TPRH 5C6TH 5EH1A 4M7LL 1ZEAH 4ODWB 2J2ZA 3VCLB 4TSCL 3PWNB 2VXVL 4O9HL 1IT9L 4H1LA 5MEND 1XF5B 4FS0A 1EHLH 5FCUH 2W59A 1TPXC 4ZOEA 1CD0A 3RNKA 3VFWA 4MXWH 5I74C 3IGAB 4RMQA 2D7TL 3KPRB 4U1IA 2H6PB 2YA2A 3QEUB 4PYGA 2GJJA 3QCTL 3B43A 4J3UA 1INQA 4X4YA 5DHVA 4QCIA 2Z35A 1MH5B 5I1CH 1JGUL 4BZ2H 4MWFA 2YD7A 3VGGA 2DIBA 5BV7L 1CXEA 3BGMB 3DHMA 2NZIA 4BUGA 1HINL 4PJCF 3QXWA 5LAXA 3NABL 3O4LB 5GS0C 1S7TB 3IETA 4PY8J 2NNAB 5SV4A 3VFTA 3UJTH 3V0WL 3V4UH 1HHHB 4K9EH 4FRWA 1QFPA 5E6IB 2HP4A 3QIBA 4S11A 4I1NB 1WSST 4OSUL 2XKSA 2YRZA 5D5MF 4ZUSA 1CU4H 4HQQH 1NAML 1Q72H 5BS0E 2AJUL 4XCCH 1N5YL 5B39B 4LVHC 1MJ7L 3ULUE 4IRSA 2F8VA 4PB9L 3ESVF 5KVFL 3O4LE 5F3BB 1E4WH 1OP5H 1M6OB 1LO5A 1FJ1B 2QSCH 5HDBF 1MHCA 4QHKJ 2FO4B 2NY0D 1ETZA 3C08L 5BMFL 2CK2A 1XIWD 4YBLC 1FL3A 3A6BH 3RVWC 4ZDHA 1JF5A 3DVGB 3AXLA 3FQNB 1T1YB 5GGQH 3LKPA 4OCRH 4ERSL 3SKNA 3AMKA 2VN4A 4Z7OE 3CMGA 4F33B 4BSWB 1JWSA 3MOAH 4DUWA 1ZLWH 1QR4A 1DBAH 4PGBA 3IKCB 4PRBA 3CVHA 5E95B 3MUGA 3Q6GH 2KBGA 3DV6B 1UACL 1SEQH 3BP6A 2AK4A 2GY7B 4OKVA 5E9DD 5ERWA 3VXOB 2F5BL 2C7UB 3BP5B 4U6XA 3P9WB 4L4JA 4LARL 4PLOB 1RVFH 3IDXH 3HMXH 4DKDC 1RUMH 4HZLB 5C0GA 4P49A 2EC9U 4JKWA 2P45B 3F6IA 5K93A 1MWAH 1D9KD 3UDWC 1IAMA 4KUCF 2I9LB 3CVIL 1CGYA 4AH2A 3NFPA 1MUJA 2V5YA 2VUOA 4L3EA 4XWGH 4LFHD 5BCAA 4JO4H 4WU7A 5D7KE 1CFSB 5AZEH 3SJVA 1Q0YH 1ZWIA 2FX7H 5GGRB 2Z92B 1QLFA 3AAZB 3RWCB 1MELA 1FE8H 1LHZA 5F72S 4DQOH 1FIGL 3O6FB 1UZ8B 3K2MC 2IWGA 4Y4FC 4I3SL 1AQKL 3PQYB 3TO4B 3VE0A 1T1XB 5IR1A 3UJJL 3HS0B 4ZAKD 4NC2B 2OTPA 4POZD 1NFKA 4WHDA 3P11H 5GXBB 4ZPTA 4R2GB 3FOLA 4DEPB 4N1HB 5T3ZD 4PRPA 3FO9A 1PGRB 4L5FH 2B1HH 2HFFA 5L2KA 2DN7A 3MV11 5T3ZL 4MAUL 4RZCB 1NGXB 3ZKXB 1IGYA 1AKJA 3L3IB 4U1NA 1K8DB 5DDHB 1G7LA 4YXLL 4LQFH 4Y1AA 3JWDH 2ZSVA 4WUKL 1NEZG 5GGUB 4N1CA 4KY1H 4PPTA 3WEXA 2PXYA 4WUUD 2CRIA 4GSDH 4GAJL 1NJ9B 4LLMB 3S98A 5DS8B 5CIPH 1RUKL 2J8HA 4Y5XB 3NIGF 5HVWA 4F3FB 1WZMA 2P4AB 4MQXC 2APBA 5E56A 3H9SE 4BFIA 2DMBA 4TQEH 4QRSA 3AU1B 3HUJE 3DHJA 3BPCA 1GGCL 2YWYA 4PRAA 1S9VA 2PW2B 1CK0L 3LKNA 1IARB 4X6FB 1LQSR 2J5LB 4JJHA 1LO4H 4PP1D 1ZLSL 1XGPA 3SDAD 1KB5B 1CGUA 5L2JB 1UM5H 1DTUA 4AYFA 4YHOL 2OM5A 3OKNA 3IJYA 4JRYE 2IC2A 4I18C 5DUBB 1S9WB 3Q3GA 1I7UB 1SJXA 2IALB 4JY6B 5DEFB 3QHTC 3OB0H 2EDHA 1NMCC 3W11D 5KSAB 1A7OH 2VRAA 2CR3A 4AMKL 3WHE0 4LSTH 2DQIH 3E3QC 4UDUA 2PO6A 3TJHD 4Z7NE 2O5ZL 4HF5H 1CR9H 5I30L 3U0PA 4Z9KB 1A5FH 1C5DA 1U8MA 1CWVA 1KYOK 4XMLL 5C6PB 3DX7A 3VD3A 3L3OB 2RJMA 3QQ3A 4WFED 4PJ9B 2YXFA 5JPMB 2HT3C 3O3BA 2J88H 1RFDH 3MRFA 2R1XB 1U58B 2A77L 4GO6B 5FAAA 2R0WL 3KLHC 3AS3A 5KSBA 5LBSL 5FIEA 4P48A 3U79A 2VYRE 3KYKH 4QHLB 1IAKB 3B5TA 3EDKA 5TGBB 3BUTA 4KZDL 3GM0A 3EFDH 3MOQA 4TUJA 1S7UB 1A47A 2VZ1A 2A9NH 3C5ZC 1JPST 3BZFB 3M1BB 2GJZA 1SMOA 1IC4L 2BOCB 3QIBD 4OZIB 5CJQH 4ORGA 1GSMA 3V4PH 4U6YA 5HPMA 25C8L 1I9IH 3GJEB 3ULUH 3FO1A 3HB3D 4XI5D 5D1ZB 3KPOB 2QADB 4JDTL 1X5YA 2A1WH 1KJ3H 4PUBL 3MNZB 4NZTL 4IRSD 5HXMA 5D70L 3FQRB 4LLDA 3QH3A 2XZCL 4MAYA 3LS4L 3M8OH 1MRCL 2CXGA 2J8UB 4M61A 4X83A 1F6LL 5J13C 3PWPE 1PLGL 4APQA 3WFCL 3DV4A 5JPNA 3F7RA 4YHML 1TVHA 5DK0B 3HC3L 4YJZL 3MBEA 4W6XB 5CEZE 4OZIE 1RIVL 4U05A 3X17A 1R3LB 2X4PB 1KEGH 2QEJA 3TYGL 1GGTA 4ZS6C 4OGAD 2NY5H 2AV7B 1BP3B 2AKRB 3SGEH 3ES6B 4PYHA 5DVOA 4LSSH 3CLFL 1KBGH 3NN8A 4R90L 3ARFC 1BVLB 1FBIH 1CXIA 2BSSA 4R0LC 1KOAA 5JA8B 5MEPA 3N1FC 2G2RA 4IS6B 5AYUL 4GMTL 3B9KB 3WDHA 3D0VB 1Q0XH 3AGVA 1AGDA 3RNQB 2YHGA 2VLJE 5HGAA 1S7QA 4LHUG 2NMSA 3RTQC 3IKKA 2AK4D 2IQAB 5DFVC 1WQVT 1FVEA 4XP4H 4Q74A 2HFEA 1KIUA 3AY4A 4RWYL 4AENB 3PL6B 1T04A 3DSFL 1JI2A 2NY1D 1OP3H 5ISZA 1U42A 5ITFB 4ZO7A 1T0NB 4FFYL 4L8SC 4JQVC 3CC5A 2COQA 3P4OB 2Q8BL 5JOFA 1LE9A 4WV1C 4E5XB 4NQVA 4GW5A 1E4XI 1NGPH 1CD8A 5C9JB 5IMOB 4L3ED 4LOUC 4P2QB 3C9NA 1YMMB 3MLUH 1JNNH 5IW1A 4OLVH 1DLHA 4ZFOA 3KPQA 5CZVL 3SJVD 1EH9A 4RIRB 3QIUC 2BRRH 4G9DA 3O3EB 3HPJB 1WBXB 1G9ML 2W0KA 5IP4A 3A67H 4LPTA 3OF6A 3M07A 2F53A 4XPAH 4Z76B 3UZVB 1H3XA 5TF1H 4KRPB 4PG2A 4EDXB 3D25B 5E2WH 1VKXA 3KLAA 1I9RL 1MFAH 3MA9H 1PW3A 4RSVA 5JDSB 1TNMA 2PTVA 5B8CC 1TETL 3MRRB 2G75A 3FRUA 4JG0L 4Z77A 3MV9B 2D7MA 4PRPD 1JRHL 1YMME 3DGGA 1X6NA 3L3HA 4NP4H 5L2KD 1OAQL 3U1SL 4XBPB 5KG9B 5I1DB 1JV5A 1BZ9B 3TIEA 1AKJD 5HD8D 1RHFA 4LRIA 3H7BA 2DIAA 2DTML 5DMGD 1IVLA 4Y1AD 5DF0A 3MRDB 4LASH 4XGZB 1JYXA 5BRZE 3EO1B 3D18B 4L4VE 3RIFK 3ZHDA 1ES0B 2VNCA 4PGEA 4MQTB 3W2DH 4HUKB 2PXYD 4WY7H 2V7NA 5I9QB 3HNTL 4TVSa 3BKYL 2AAVA 4PD4K 2VH5H 3WXWH 2DQHH 2OZ4L 3JBG7 4HUWA 1FCGA 3MV9E 1NCNA 2R2HA 5EORH 1QFUL 3NIFE 1T5WA 4GG6A 2VL4A 3O3DB 2A74B 4NKQB 2CDFA 4PLJC 5C1MB 4JZOA 1CYGA 1P7KA 2WQ8A 2GEEA 5D6DA 3MRBB 3I50H 2J7LA 4OCXL 2P8PA 4XVSH 3S37X 4N8VB 4HBCH 4OJFL 3NMEA 1D5MB 2KQNA 2GHWB 4YBQD 1W0WA 2BVQB 2Q76A 2XOTA 3GNML 2YUVA 5TPWH 1F3DH 3I6KA 4XNQB 3MCKB 3QO1B 2UZIL 1QSFA 4XZUA 1R3KB 1XGYH 1EMTL 5I73C 2B1AH 5I8EB 4WW2F 4JHAH 4MZ3A 5E8NA 3U0TA 3EJYC 5DLMH 5DD0L 5IFHH 3WS6A 4L4TE 2H1PH 2PW1B 4KKAC 1L7TH 1KB5H 3L3KA 4DGIH 5JXAL 5I17A 3S37L 1TTFA 2PO6D 3T4AB 2CMRH 5GSRA 4JPKL 5E2VL 2IH1B 4UV4L 3QDAA 3J7HA 4HDIA 4U1KB 4ZUVB 2EC8A 3OKOA 5GIRB 1DBKL 3GJFK 2MKLC 4GRLB 1U6AL 3VGDA 4KRMB 5KZCB 4S1DD 3S36X 4OFDA 5E5RB 5CSZB 3HMWH 4H25B 2WIMA 3WUZA 4M9PA 4ONHA 3WN5A 4X4XA 3NTCH 4K3DL 3QCVH 2BVOB 4JR9L 5IF0B 4HIXL 1OTSD 3MNWA 3TBSA 5JMOC 4HJJH 4JRXA 5HHQA 5LWYL 1YNKL 1HHGB 1GIGL 2IPTL 1Q1JL 4Y19B 1R3JA 2EDWA 3PWUB 3VRJA 3TF7C 2HKHH 3BZEB 5ADOH 1DUZA 3TFKC 3S36L 1P6AB 5DTFB 5ACMA 5HVHC 1EBAA 4OUUA 4LLWA 4XNUL 1ZE3C 1OGTA 4IIQB 5L8LB 3GMRA 2D7NA 1PG7W 2BVTA 2E5EA 4F9LC 1HQ4B 4V2CB 4L8DB 2VE6B 4ZUUB 4YHZL 1KIPA 3CFEA 5EO0B 4PJIA 2UVFA 4JFEB 3OAUH 4MAYD 5CEZH 1RU9H 1G7QA 1NGWA 4OZFB 1B4JH 1T6WA 4OCLC 2OQJA 4HUMB 5TH2B 3WHXB 1GRWA 4APQD 5JHDB 2OLDA 3U4AA 1EX0A 2HWZH 3TBTB 1G7JA 3OJDB 4OQTH 1KXTB 4WCYH 3TP4A 3MBED 5C7XL 4OBSA 4LDLB 4DTGL 4PJEB 1YY9D 3K2UH 4X4ZA 4PJBB 5DRNA 3I9GH 3T8XB 4NBXB 2IAMC 3NFSH 1HYRC 1YQVH 5DRXB 3RUGF 3KR3L 4JFEE 1IMHC 1BOGA 4FXGA 1JPGA 1HH9B 3QZWB 4WEUD 2YUWA 5E00B 1QSEA 3MC0A 3TNMA 4JM2A 3L5XL 5BO1L 5JHDE 5LXGL 3EO0B 1AGBA 3DVFA 3MRPB 3KJ4C 2AEQL 3ROLB 1U9KA 4PJEE 1NDGB 3G6DL 5C0AE 2F54E 4LLYA 2ESVA 1KLGA 4LNVA 2DWEA 4EN3C 5ISZD 4PJBE 3V8CA 2EDKA 3K8KA 3BKJL 2EIZB 1UENA 2ZCKL 1RJZA 5FYKU 4NRZB 2VXUH 4KK8C 2L4OA 1JZ4A 5L9DH 1BZ7B 3JVGA 3L9RB 1O7VA 5FB8B 4JFOA 2BJMH 4M1DH 5JDJA 2VDNL 4CW1A 4ZFOL 1MWAA 3JV4B 3C09B 2I5YH 3OF6D 2BNQA 2F53D 4G7YH 4NHCL 3TYFB 4XX1G 1EO7A 1R24B 4L3CB 3FONB 5EOQL 4XCFH 1UWXH 4R7DB 4CMHC 5HPOA 2FHFA 1LVEA 1HCFX 4OFVA 3WKNA 1H5BC 4AIXA 1TQCC 4M62H 5ILTH 2EZ0C 4NUJB 3EOAA 2H9GA 5TE7H 3MRNB 2R0ZH 4D94A 1T20A 1AGCB 3VGFA 1GZQA 3BZ4A 3D5OF 2E6PA 4BK4A 4HUXA 2JCCA 3CFJA 2ICCA 1CF8L 1ZAGA 2C3VB 4G5ZH 4NJ9H 4OIAA 2ZPKH 1OD9A 3RWDB 4HH9A 2E6QA 1D5BB 4NO5B 1T3FB 2B5IC 2XQBL 1C5BH 3O11A 1DE4B 1A6PA 4HJGB 4WRLA 3Q48A 3STBA 2HVKB 5HHOE 1ACYH 1OSZB 5A2JH 4KPHL 4HAGA 2EIBA 1D5IL 4YFLF 4XH2B 1RJLB 1U8NA 1F5WA 1AIFA 5HGBB 1BFVH 3VMPA 3GB7B 1G6VK 1EEUA 1L0XA 1TPXB 3WXVH 2CO7B 4YHYC 5C2BH 4MD0B 5AYQA 8FABB 3S88L 3ZE2E 5SWZE 1I8LC 1XR9B 5CIPA 2DQUH 3AMLA 3U46B 1LE5A 3CH1A 2J1KA 5DVNA 4R26L 1IGJB 4AEFA 2BMKB 2CKNA 2XN9A 4JJ5B 1RMFH 4GJTB 1BREA 4ZSOB 3MR9A 4JO2L 4LF3B 1CGSL 3ZL4L 4G9FB 1QSFD 1EO8H 4X6DB 2GSIA 3G9AB 4AEIL 1FVDA 1A6UL 5JW5A 4P2RA 5GGTL 4P4RA 4UTAH 3RX7A 4BZ1L 5F6IC 1UCTA 3L5WA 3OR7A 4OFKA 1TZHA 1M4KA 4AM0B 1W0VB 4GW4B 1CTOA 1WZ1L 4Z78B 4WEBL 2XA8H 4IHOA 2VAAB 4ELKB 4TPRL 1WBYA 1X5KA 4UIMB 3UPRA 4U1MB 3GBML 5D2LF 3VFVB 3CDGA 1U3HA 1VPOH 4H0IA 1R5VA 3TIDA 4TUOA 5ETUA 4H5SB 5C0JB 4I0PA 3EGSB 3FFCD 2YD1A 4C4KO 5TDPA 4PJXF 3DBXA 3ZDXE 5GRZA 2GT9A 3TH4T 2X4UB 2AABH 4MXQD 4MXWL 4LLUA 1G9NL 3VXSB 5DJXB 2Z31C 4KJPC 1S7RA 5KSBF 4HJ0D 4JRXD 3OBAA 1BBDL 3OKMA 2BNUB 4FQXC 1IGFH 4DN4H 1S78C 1V3JA 4YQXL 3LKQB 3X3FL 2IEPA 4FOMA 5D7LB 1YNLL 3E6HA 1N26A 2GIYA 4XP5H 1XF1A 2GW5A 4KZEH 1BMGA 2EE2A 3F8UB 1F4YH 4ZFZB 1P69B 4P57A 5HHPB 3CFIC 3MRGB 5BS0A 2ZJSH 6CGTA 1OT1A 3T0XA 3TWCH 3OAYH 5AEAA 4P4KA 1UVQA 1A3LH 2OL3B 1FL5B 5E8DH 2NNAA 3DRQA 1NBZA 1YYMH 5EUKB 1VGEH 1CU4L 1HHHA 1Q72L 1T21A 5JNYB 5HYEA 3AB0C 4XCCL 1ZTXL 5BZWA 4RGMC 4N0CC 3K81A 4HS6B 3WE6B 4OZFH 4LSQH 3GIVA 5IROC 3OKLA 4PLNC 2YC1B 4XHJD 2QSCL 4D9RD 4ZMAT 1PEWA 1WC7A 2P5WB 3IU4H 5B3JF 5B39A 4Y4FB 4JKLA 4YDJB 1QSED 4N0YL 3CFCH 4JM2D 5F3BA 5BV7C 2I07B 2XZQL 1BFSA 3QT2A 5DWUL 1M6OA 5CJOH 4S1QH 1S7XA 4L3AA 2V5RA 5CINH 4M93C 1GC1H 3MOAL 2R0LL 1CS6A 2ESVD 4YAQA 2CUHA 1UT9A 3O9WA 1ZT4B 2PYEB 2R0KH 2FR4B 3V4VL 3ROOA 2VITB 4LSPL 3BH9B 4CNIB 3RWJA 2D7PA 4N0FB 1CD9B 1F42A 5D7IB 5AG8A 3DO7B 4JVUA 4OGZA 2P5WE 2C4FT 2EEDA 4KMTL 4JY5H 2BY3A 2EDFA 3IDXL 1ZA3B 1OW0A 3TPKA 4BSVB 1A1OB 3M17A 2BNQD 3BHBB 1QNZH 2WUBL 2FX9L 3FHAA 4QHNB 4QHUA 5CJXC 1K4DA 3P77A 2NR6D 2YD6A 1MWAL 2IMNA 2DAVA 3LKOA 4NNXA 2VXQL 1HH6B 3SE3C 5GGVH 2PYEE 5TQ2L 43CAA 4RISL 4X8XA 1BQLH 1I1RA 4EBQH 4LIQH 3V5DA 1BFOB 5SX5H 2R4SL 5AZEL 5HI4D 4O2EA 1Q0YL 3MRMB 2FX7L 5EPMB 4NM8L 5CJ8A 5DQJB 5D7IE 3AROA 1FE8L 4Y88A 2VDQL 5FDYA 1ONQB 2Y25A 3A6CL 4HW6A 1WIUA 3IDUA 1CVRA 3MRLA 5A2KH 3MACH 2J6EH 3NOIA 4M8QA 2LAGB 4YDKL 4F2MB 2Z92A 3S7GA 4I18B 4NKDB 5I1HL 1L7IL 3GDBA 3MXVH 3RWCA 2ZUQB 5KOVC 1CDBA 2PETA 3P11L 1UZ8A 1NMCB 2BOBA 5IBUB 3ARTA 3ET9F 5EZOL 1RIUH 5I1LA 1T1XA 4L5FL 5BZDB 4ENEC 2NY7H 1NCBL 4HIHA 1X9QA 1UB5B 3OZ9L 2ATPB 3PV7A 4CN4A 4F57L 1I9EA 2HT4C 3DX6A 5FA4B 4I48B 3JWDL 2HN7B 1MCFA 3QUZA 3H9SA 4Q58C 2NX5B 4NQTA 3BEWA 3VFNA 3HUJA 4RZCA 2ZUYA 3L3IA 3SDCC 5DDHA 3O6LH 2DRUA 4MHHI 5C0ND 3HZMB 1INEH 2XN9D 3MBXL 5EIIA 2DDQH 1LDPH 1DANU 3I02B 1NGQH 1NGYB 1DVFA 4S2SB 3ZE0F 2W38A 1LNUA 4F58H 3E3QE 4D9LH 1NJ9A 1CXFA 4JRYA 5FF6B 5D7JA 1FNGB 4Y5XA 1OOAA 4Y5YC 32C2B 4P2RD 3C5ZB 4JCLA 2NX5E 2YN5A 1LO4L 1DQJA 3GSVB 3PJSA 4ZAKC 3AU1A 4O5LH 1IKFL 5FEBA 1FNEB 2VERN 4ZO8A 4UILH 1UM5L 3V6OC 4P2YA 4POZC 1PYWA 4ZYKB 4N5UA 2DI8A 3DTXB 2AGJH 2DWDA 4X6FA 4NKOA 2BVPA 5GS0H 5IQ7H 3F12A 2VIRB 1KB5A 1A7OL 3OKDB 4LCUB 1ZS8A 1SVZA 3NPZB 1U3HD 3G6AB 3VXME 5DUBA 4DWHA 1S9WA 3TEUA 1IAIH 2DQIL 1I7UA 4I0PD 5J13B 1U8HA 4JY6A 3WUWB 3QDJE 5DEFA 4LLQB 5I76B 4HF5L 1CR9L 4LCCA 3U82B 3VFRB 5CHNA 1A5FL 4FP8H 5C07E 4MA8L 4PJ8A 1NC2B 2VWEE 3VGHA 4QY8A 3F7YA 1OM3L 2H3NB 1LD9B 5FK9A 1FFNB 4QF1B 2J88L 3ARFB 2X1WL 3ARUA 3MJ8B 3FT4B 5ECJE 1G6RB 3SGDH 4R0LB 4MS8D 1QEWB 4J3SA 3KHOA 3QRFM 1P5VA 2A73A 2BVEA 1NPUA 3JZ7A 1HSBB 5IGXH 2CDGA 4M7KH 4PJ9A 3MFGB 4JDVA 4JLRB 1E27B 3V0VB 3RTQB 4A6YH 4JKKA 1W2KT 3G6JA 3MGTB 4UBDD 3PGCB 3EFDL 2O61B 5F9JB 4TULH 1MCWW 1MY7A 3B83A 5BS0D 2A9NL 4HXBL 3KPPB 4P4KD 3EDJA 3W9EB 3QWQB 2YZ1A 5D1QC 3ULUD 5TGBA 2VISA 4NRXB 1GXEA 4HS3A 2AK1L 4L8SB 4UT7L 4BUHA 4HFWB 4GXUN 3ULUL 1S7UA 4WV1B 3UJIH 3PWPA 3WFHA 3ZTNL 4GLRI 4BQBA 4ZD3L 5HYJB 1U93B 3QCUH 1P4IH 3MV01 3RZCC 2BOCA 4RGOL 2ADFH 4OUOA 3U7WH 4UNVA 1MCIA 4OV5A 3MRJB 5IMLA 3TJHC 5BQ7B 2N1KA 4U31A 3RL2B 3CX5J 2UYLA 3QIUB 1T7WA 1JGEB 1JFQH 5IK3B 4OAWA 3M8OL 4J23A 5DQ9A 1D5XB 4OB5H 1F3JB 1RUQL 3TJEL 3GGWA 4S10A 2X2YA 4NC1C 1OF2B 1SVCP 5GRJH 5F70A 1BFTA 1WWCA 4LAJH 5JO5A 2VLJA 4NOBA 5KTEH 4NRYB 1HI6B 1L0QA 1V5JA 3SGKA 1T22B 5C3TA 3T2QA 4HWBH 1JGVL 5B8CB 1QSVA 2D0GA 4WDIB 5IM7B 4GQ9L 1FBIL 3T0WA 2HFGL 4X6CF 1IZJA 2N7BA 4MD5A 1EDQA 4MJ6A 35C8H 1A0QL 3O9WD 5ALCH 4BQ6A 1Q0XL 3QP3A 1P4LB 1EEZA 4Z95H 3TBYB 3BP4B 5EZIL 5CWSA 3BDBA 4QT5B 4HT1L 4KQ4L 3QIBC 4IS6A 1AO7E 1MCPH 4RAVB 2E27H 3NA9H 4XP4L 4JO3H 1II4E 1BECA 2C5DC 1MHEA 3EYQD 5EB9A 3GMOA 1NSNL 2FJGA 4XI5C 5D7KD 1MI5E 2XKNA 4OBRA 3C2SA 2DYPB 1OGAB 4MGXA 1C5CL 2D4DA 3D9AL 2CLVB 3O8XA 5T1KA 4HEME 5CEYA 1NGPL 4MNQE 1XGRB 5CP3H 1JNNL 3B3IB 1DLFH 1CCZA 3WD5H 5EC2A 3CFBB 2Q8AL 1ORQB 4KQ3H 2BRRL 4XB8A 1CT8A 2EXYD 5E8PB 3R06B 3MLTA 2ARJA 4Q6YA 4MA7L 4FQJL 4GRWB 2HG5B 3KJ6L 1MHPL 5C08A 2X4TA 1YMMA 2BCKA 5HTSA 1YDPA 2OMNA 3O3EA 1IM9A 3JV6B 1WBXA 4CVXB 5FGBA 1I3RA 5ID1A 1F8TH 3QDGE 3PF2A 5H2BA 4AG4H 1H0DB 2ADJB 2P1YA 1BGXH 4DOHB 4KROD 4Z76A 5C0IA 5I73B 1PX3A 5GJTL 4L4VA 5BRZA 4EDXA 4O51B 3WYRA 5IW6A 5FUOH 2HJKA 2VOTA 2WZPD 1YEEH 4G8IA 5E7BA 3S34L 3TV3L 2FH8A 3U83A 3LKSB 2HYMA 3AS2A 4GRWE 1FNLA 5JIPA 4LASL 1Y6KR 4XMKH 5AZ2L 2NY1C 3QUZD 3P0GB 3EFFA 3IFNL 3H9SD 3ETBF 3BEVA 4HEPG 2X4SB 4C83B 5KG9A 4PJGF 4IDLA 2WINB 3OKEA 2EDDA 1FRGH 2ERJC 3GSOB 4DOHE 2V9QA 1YN6A 4R4FL 3BWAA 3GI8H 3MRDA 4DN3H 4MD4A 1UADC 5B4MD 1G9MC 1P84J 1XT5A 4U49A 1DVFD 3G5XA 4RFEB 4UB0H 1RQ5A 3S96B 4JRYD 5EZLA 5CD3A 5D7JD 2IG2H 3CJJA 2VQTA 3FCTA 3B6SB 2A6KA 1TNNA 5IVNA 1S9XB 4L4TA 5CUSL 2A74A 4NWTL 5HVHB 4LVOC 5T5FL 2DQGH 2IMMA 1A6VL 1YJDL 3CPLB 3ZKMC 4I5BB 5TPWL 1DBJH 4M9OA 4TNVK 3SPVA 1FAIH 1GGBL 1NCUA 3GSXA 1J5OH 4P9ML 2B1AL 4L9DA 1OARL 4JHAL 3LRHA 1KTDB 5HD8C 2BVQA 5IFHL 1V7NL 3T65B 5F7YC 2H1PL 1L7TL 1KB5L 4DGIL 2L7UA 4R6UA 5DMGC 1MFEH 4P3CH 2KZ1B 2J8OA 1R3KA 5H8DA 4U2ZA 2EYSB 2OR9H 5HHXL 2EEAA 1F02I 5FKAB 4O2CA 2VL5B 1KN2H 4PJ8D 5TQ0H 3WLBB 4X8JA 5CBAB 1HXMA 1FZMB 3OSKA 2VDRL 2XT1B 2NTFB 2VDPH 2IAMB 4X6EB 1P2CA 4J3VA 3ALWA 5LQBH 2EEBA 3RWHA 1S3KL 1A14H 3NTCL 4ZUVA 2XI9A 3CZFB 4GRLA 4XMPL 3MA7A 3TT1H 5FOJA 2YR3A 4PJ9D 1S7WB 4RA0C 2AI0H 4HJJL 3UTSB 3IFLL 4YC2C 5CSZA 4H25A 2R1YA 5AAWA 3KJ4B 4YBQC 5ADOL 1G6RH 3GSNB 5KOMC 4MDIA 4QNPE 5DJ8B 4XB7A 4G3YH 1CG9B 4EN3B 5HHNB 1IC7H 3DXAB 3D87B 3PWPD 2DLTA 5KVEH 3PWUA 3BZEA 3ULUF 3BKMH 4NN7C 4QOKE 1NUDA 4N0UB 2ZG2A 5D5MB 4WW1B 2ICEA 3ARXA 2ZCLL 5CEZD 3HG1E 1UM6H 4OLXL 5DTFA 5CCKH 3BT2H 4XCYB 3OJVC 3UPCA 4KVCL 4B0MM 4FABH 3ARRA 1RU9L 4NIKB 4X9HA 1B4JL 2QADD 4PS4H 4XPGH 5B39G 3WNMA 2YKLH 2HWZL 1NDMB 1I7TB 1N59B 4WCYL 1CDCA 2R69H 4PG9A 1DSFH 3VXNA 1P1ZA 4K23H 4Z7OF 1MEXH 3VFPB 1J1OH 1MFBH 2VLJD 4UU9A 5GS2D 1O7SA 1IE5A 3DXAE 2Y5TB 3T0EC 1H5BB 3KGRA 1KULA 4U1JA 3WHXA 5F1IB 3NFSL 2YD3A 3OX8A 1CBVH 3EYFA 5DMYA 3RWIA 4Z7WB 1PZ5A 3L3JA 4X99A 4PJEA 5C0AA 2FB4H 3VG0H 4F7EA 2F54A 1U92B 3F7PC 3T8XA 2NYYD 3PWVB 5DSCA 5JLZA 2OJEB 5HYIA 5IEHA 3E6FB 1JBJA 3ORJA 2NW2A 1O5DT 2B5IB 2ZUXA 5C6WH 1X7QB 5GISL 3Q6FB 4LBEA 2EYTB 3EO0A 3TN0A 3MRHB 5DJZA 1KIQB 4UV7H 1A6TA 1FZKB 2DOCA 3MJ7B 2KPNA 1OPGH 3NFNB 4Z7WE 4KMLB 3O8XD 5T1KD 4MLIA 4YHYB 4ZS7H 2DQCH 4MZ2A 2VXUL 4URTB 3CCHB 4HHAB 2GK0B 3CX5K 2AXHA 1KC5L 2FNBA 2BJML 4APQC 1LP9B 4M1DL 5CEXA 3LPGA 1QACA 2EIZA 5FECA 5IKCB 3DSNA 4YLQT 2I5YL 3MBEC 4GW1A 2VQ1B 4F9PA 4HD9A 4Z6AT 1YY9C 5C08D 3T0BA 3S5LB 1YMMD 2GJ6B 1BZ7A 5TDNA 1I8MA 4XCFL 4HFUL 1IM9D 1FG2B 4M6OL 3RGVC 1FL6A 4JDZB 3VFOA 4M62L 5ILTL 3F62A 3KG5A 1WISA 5IOPA 4JFXB 1PY9A 1QA9A 5GRXG 2HH0L 5TE7L 5BRZD 4L4VD 1QFWL 2EH7H 1AFVH 3WFDH 4PV8A 4GRWH 5FA3B 5F6IB 4N8CL 5IJKA 1RJCA 5I2IB 2QBWA 5HHOA 2BC4A 5ID0B 1EV2E 4NUGL 5DJAB 4PGCB 4G8GB 3WNPA 1AR1C 2JJWA 4RNRA 5D9SB 5F7EH 1FCCA 3QJFB 4LL9A 3LN9A 1MFDH 3AY4C 5DJDA 1NKOA 2FJHA 1WUNT 3BMVA 5SWZA 1ACYL 1Q9OA 2Q86A 1MQKH 2JELL 4HPOH 1OTUC 4P5KA 2FGZA 4WHYH 1JI1A 4QYOA 4NO5A 3UO1H 4AZ8A 1DE4A 3BVNB 2OK0L 5DD1H 5KVDH 5C2BL 2HVKA 4AEEA 1OSZA 2Z31B 4G8GE 3I6LE 1GZPA 2GUOA 1RJLA 2NXZD 2DQUL 1JUFA 1RZFH 3SGJA 3LB6D 4FQXB 3ZE1E 3X11A 5HGBA 5CBEA 1NFDE 3GB7A 2YRLA 1IGML 5FYLD 1KUMA 4HS8H 4MD0A 1CE6A 1O0VA 4L4TD 1RMFL 1EJOH 3ZYJA 1EK3A 5FYLL 1H15A 3IRPX 4JPVH 5A2IH 1Q94A 1QLEL 4TRPH 4YGVB 1C8PA 1VEOA 3OJMB 1IEBB 1N0XH 5FO9B 1GPOH 2VC2H 4OI8A 5EC1A 1D7FA 3V6FA 3A6OA 4DVBB 5DJ6B 4JJ5A 4OD2B 5IWLC 1OHQA 1GCFA 2X9XA 5IB2A 5EOTA 4Z7NF 3FZUC 4LF3A 8CGTA 2V2WA 4HIJB 4TTDD 1MCCA 3QXAB 1G9EA 3U4BH 1MCKA 1N3NB 3HLAA 3BWUC 1N2RA 4OI7A 3UTZA 2AJZB 3AB0B 4RMRA 1C1EH 3LZFH 3OXRA 5SWSB 5MENB 3FO2B 4ELMB 1PG7L 3JWOL 3WDIA 3LEXB 4AM0A 2AP2A 4EIZC 1MLCB 3P0YH 4RGMB 4EUPA 3RL1B 2VAAA 4ELKA 1P84K 2DKUA 3ZKND 1GGUA 4LP5A 1M05B 5FO7B 4GRLD 4ZUTA 4D3CH 1CQKA 5D6DC 2A9MH 5C0BE 5BV7B 4H5SA 4DFIA 1DBBH 5E94B 2W60B 1VADA 4QTIL 4IOIB 3W39B 4HKZB 3Q5TA 1AGFB 1XGQB 4FNLL 4M93B 5SWSE 4Z7UB 1MRFH 1D3CA 3F7QA 3D3VB 4FQQA 3LQZB 4A6YA 2AJVH 4UIKH 1PJ9A 4WI9A 4XBEH 4AT6A 4KZEL 4MA3B 1S9YA 3LKQA 1U8QA 2NY6D 4PRDA 1EHXA 2ZJSL 3IU3A 3GSNH 2QL1A 3TWCL 5I1JL 3TO2A 1NAMB 1WWBX 4ZUWA 3F5WB 1G7MB 1JWUA 1A3LL 4OZIF 3QAZC 1IEAA 4YR6B 1PDKA 3B9DA 2DMKA 4PGDA 2AQ1A 2OP4L 5C0EA 4Z7UE 3D48R 3D3VE 2K1MA 4WU5A 5K9QG 3V7MA 1G9NC 1BOYA 3WN5C 4M6AA 2RCSH 3LN4A 1JE6A 1Q9LB 2FIRT 3L7FB 3UDWA 3C5SA 1CFVH 1XIWB 2J8UF 4OD3L 5DFWH 2EXWD 1T6VN 4HJ0C 5F1NB 5C0AD 1PX4A 3BO8B 3UEZA 3DROB 3FB5B 3AS1A 2F54D 3OHXB 1VFUA 3EDEA 3HRZB 2AEPL 3FB6A 3CXDH 4HS6A 3WE6A 5FKPA 7FABL 4GUPB 1N7MH 5CJOL 1RK1A 3RY4A 3BFOA 2DLGA 5ICYB 1V8HA 4MCZB 2VDOH 5IB3B 3U9UB 4HC1A 1VSCA 4K8RL 5DUMH 4IDJH 3TN0D 2R0KL 3D69A 4C56E 1F11B 1EEYA 3O4OC 4JM4L 1C12B 3H6JA 2LAAA 3VI3E 1KTRL 4M1CD 4BH7A 3PWLB 4G8EA 1ZHBB 4JY5L 3HI6H 5DD5H 1A7PH 2P8LB 5DD6B 3VD7A 2JB6B 3WDJA 4AJ0A 2HVJB 2VITA 3AS0A 1I1CA 3SDCB 1M7IA 3BH9A 3HRPA 4CNIA 4KDTC 1SYSA 1M71B 1QNZL 5D7IA 1KIRA 1U91A 4NO2B 5CP3A 3BIKB 2G5BA 5F3HB 4BH8B 5GGVL 4EBQL 1BQLL 3KPTA 1V7ML 4XHJC 1A1OA 2XWBB 1NFIB 3I3DA 2HTLD 3MGOB 3QXUA 1AQDA 5DJ0A 5DXWA 4IOFC 1HH6A 1CL7H 1DQML 1WK0A 1X44A 4BM7A 4JM2C 1YN7B 5HHOD 4ZAKB 1F00I 2DD8H 3HAEA 4YGAB 3SKMB 3U30C 2H41A 3MACL 1SM3L 3MRMA 2W9DL 4L1DA 5EPMA 4TUKH 3IDGB 3F7VA 4XC3H 4YPGB 3RJDA 5MERB 4FFWC 3WL9A 1UFUA 4K7FA 5H35B 4DW2H 5SWZD 1A7BA 3CSYA 4GKSB 3N1GC 3PDOB 1RURL 3L3DA 4F2MA 5FYKE 1FH5H 2NY7L 4I18A 4NKDA 1TENA 3NIFF 3P4MB 1BQHA 2M8XA 4OGXH 2YK1H 3G5ZA 2P24B 4ODTL 43C9A 4WUUB 5EBMA 3LHPH 1A64A 3TESA 4DUVA 3N1QC 3V6OE 2L0DA 5BZDA 4Z5RA 1MJUH 2NR6C 4LPCA 1UB5A 1KPVB 1K6QH 2ATPA 3O6LL 4G43B 3MLRH 4E41E 4NO3A 4G42A 4YBHA 4EVNB 4XC1H 3REWB 4RX4A 2HT2C 4PREB 2MWCA 2DDQL 1LDPL 4NNPL 1EO5A 2G60L 1NGQL 1ACZA 3G5VA 3EYUL 3RWGB 1XZ0B 5F7HA 5C0RH 1B90A 2YA0A 3HZMA 4DUXA 3MZTA 5KSVA 1E4KA 2UWEA 5KW9L 4LKXA 3SDAB 3K1KC 3SKOB 3I02A 5LVEA 4WW2B 1NGYA 3U7YH 4XNMB 4O5LL 3GMLA 2GYSA 2BZDA 5F9OH 1H3GA 3DVNB 1P7HL 3VXMA 1IBGH 5GS0D 4LSRH 2AGJL 4ZFGL 3QDJA 4CAGA 1I85A 3C5ZA 4NJAH 5GS0L 4NN5C 5IQ7L 5C07A 3RZCB 4H1LB 2Q3ZA 3D6GA 1W8NA 4NGHL 4HH8A 1BD2E 3GK8L 4M7LH 2BVUA 3RNKB 2X1QA 5KJRL 3K4ZA 2VXVH 1GHFH 4O9HH 4U1IB 1IT9H 3OKDA 3VGBA 4FP8L 5IHLB 4XP1L 4X4YB 5DHVB 5DA4A 2NXYD 4QCIB 5KAQG 3RQ3A 2Z35B 1KG0B 2YEZA 1JTOA 4LNRA 3B8YA 2D7TH 3WUWA 4LLQA 3OG6B 3PWJA 4MWFB 3NCBB 1ZV5A 1J9CT 4Y2OA 1K4CA 1N5AA 3QCTH 4M3JA 4M03A 1CD1A 4HAFA 5KAQF 4ODXA 5LAXB 4MNHB 3RVWD 4TSBL 3IETB 3DPBA 5IGXL 4P3WA 3VFTB 3RHWK 3AREC 1T89C 3ARFA 5BV7H 4A6YL 3FT4A 5JMRA 3HPLB 1CIDA 3TCXA 1JYNA 3QIBB 4JFQA 4NC1E 4TULL 4WFEE 1QOKA 2DL2A 1XCQA 2OS7A 4WGWB 3GO1H 5D8JH 4NZRL 5MEOA 3S4SA 4ZUSB 3V0WH 4RAHA 5ICZB 1RY7B 3PGCA 2O61A 4NDMA 3RY5A 4IRSB 1YEFL 3KPPA 1AXTL 1U3HC 4OSUH 1JNHA 1P4IL 1HCVA 1LO5B 2APXA 4I0PC 1MHCB 1NAMH 5KS9A 4UINL 3OAZK 4XPHH 4JQVA 1LEGB 2AJUH 4WV1A 1ETZB 4HIEA 1JFQL 1N5YH 1MJ7H 3KPLA 3PGDA 4PB9H 1FL3B 5FXCH 1U93A 4ZPVB 5KVFH 1JZ7A 3V5KA 4U33A 4ZDHB 2WWKT 5SX4H 4L1HA 2Z8SA 5GPRA 3RHWF 3LKPB 3QUKA 3PP3K 3SKNB 3PABA 4NQDE 5IK3A 4PJEF 1WFNA 1DQTA 3HTLX 5DA0B 1JWSB 5F7WC 4MS8C 4CU6A 1JP5A 4PJBF 4PGBB 5DRWA 1I8KA 1HWGB 2V6HA 1AO7A 1OF2A 1VEPA 1KPRA 4ERSH 2EDOA 3MUGB 5F89B 3WKML 5I1AA 3BP6B 2AK4B 1Y6NR 1HI6A 3HNSL 4OKVB 4UBDC 2ENSA 2P5EE 5ERWB 3UBXI 1MI5A 2F8OA 4HC1L 1JRHI 3KDMA 3LMJH 1ZVYA 3QWRA 4KAQL 4XCEB 4U6XB 4P4KC 4NQEA 3MMEA 4M6MH 5F8QC 4DAGL 2NY1B 1UACH 5C0GB 2LABA 1OCWL 4MNQA 1G7IB 1S8DA 2F5BH 1UG9A 1GJIA 4Q9BA 2QQNL 2AV1B 4AH2B 4BFEA 4LARH 1B9ZA 2ERJB 3NFPB 1MUJB 3SE4A 4K71C 1QQDB 5E5UB 4L9LC 4L3EB 5I1EH 4YFLI 3GMPA 4WU7B 1ZWIB 3C6LA 3AM8A 3MRQB 1QLFB 1KELH 2ICWB 2Y7QB 3T77A 3D0LA 3CVIH 4X7DC 4PRIE 4TNWF 4LLAA 1U8KA 3QDGA 3N0PB 4GOSA 4MQXD 4R7NB 2N7AA 2CLVA 1X5ZA 3VE0B 5IR1B 4MA1C 5D6CA 2X44D 4PJ7E 4KJWD 5F44A 2NY4C 4PLKC 4LVOB 3ULSA 1TCRA 4ZPTB 3FOLB 5E8PA 2ZKHH 4I3SH 4PRPB 1AQKH 1F8TL 5FYKH 3FO9B 1BGXL 3O9WC 3UJJH 2HFFB 5L2KB 1YMHA 1F6FB 1TMCB 1IFHH 1IGYB 1AKJB 3BD5A 4U1NB 1HILA 1YEEL 1G7LB 2B8OT 4Y1AB 3GI9H 2WAHA 1SY6H 2ZSVB 1KENH 5T3ZH 3EYQC 3LQMA 2VR4A 4YEFA 4XMKL 1NCAH 4YXLH 2XTJD 4HK3J 3FRPA 5FGCB 4CMMA 2W65A 1J05A 2ED9A 3MOBL 2VLLB 3SBWA 1QKZH 2X09A 1FRGL 2HKFL 4BFIB 4OZGE 3GI8L 5L2KE 4ZQKA 4QRSB 1ZLUH 4RX4D 3BPCB 1VFBA 4GAJH 3QIWA 4PRAB 1S9VB 1G7PA 1RUKH 1T66C 3KLDA 3ZT5A 3LKNB 3HE7A 1KJMA 2HT3D 4Y2DA 1YEIH 2IG2L 4YC2B 1AP2A 4ZOAA 4OLEA 1XGPB 1CDHA 3KAAA 3QPXL 4LCYA 4UQ3A 1CXHA 3OKNB 3IJYB 4JANA 2HA1A 1IQDA 4XTRD 2QQKH 5MP6H 3Q3GB 4KKNA 3QISA 3VXMD 5I71C 4KROC 5IBTH 4U1GC 1ZLSH 2VZOA 1DBJL 3QDJD 3C5ZD 4JQIL 4CDGC 4NN7B 1J5OL 5T3XD 2VZ3A 5C07D 4QRTA 1NCTA 2FZ3B 1KEML 4EUPG 4UDUB 3T2NH 4ZNEE 5F21B 1HZHL 5T3XL 1U8OA 2KDGA 3BUYA 5DT1L 3TM6A 1U8MB 1Q9KA 4QGYA 5F96H 4F9LA 5EN2A 3GUTA 2GQHA 3BIBX 3DX7B 2C1OA 1U8LB 1CE1H 2NW3A 2R1WA 3QQ3B 1CFQB 4HWZA 1FZJA 2O5ZH 1A4JA 4H1LH 3MRFB 4HWUA 1NCWH 2DF3A 3FO0H 2RGSA 3T0EB 4CBPA 5B4MC 2X1OA 3P0VH 1JHKH 2VDPL 5IFJA 3I85A 3V9FA 1YPZE 1FNSL 5LQBL 5ITBL 5EU3A 4PJDA 2X05A 4ZS6D 2R0WH 3TT1L 4TUJB 5DHVH 5LBSH 2FSEA 3KYNA 4I0CC 5EOCJ 4OLUL 5J11C 3ARFD 3W5NA 1YJDC 4J3TA 2GJZB 4MQ7A 1MJ8H 4JAMA 4QOKA 3LCYA 3MTRA 4ORGB 5CGMA 4ONFH 4U6YB 1BJ8A 5IIEB 3HG1A 4NYLA 2QSTA 3FO1B 2GITA 4G3YL 3T0EE 4JHWL 3HA0A 1BX2B 3BN9C 3C2AH 5DFVD 2XICA 1CN4A 4BQ9A 25C8H 5EU6B 4LLDB 2XWTA 4AL8H 3QH3B 1NL0L 3BT2L 3LSOA 4JDTH 4APQB 4LCCC 3DXAA 3DV4B