3OGCC

Kcsa e71a variant in presence of na+
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVATATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for selectivity-inactivation coupling in KcsA potassium channels.
pubmed doi rcsb
molecule keywords antibody Fab fragment heavy chain
molecule tags Membrane protein
source organism Mus musculus
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ogcC00
2IH3C 4LP8A 4PA9A 4WFFA 5CBFA 3LDCA 4MVOA 3ASNC 4DXWA 3OUFA 4MVUA 2YEVA 2HVJC 4J9ZB 1G4YB 2AHZA 5EC1C 1JVMA 3E8FA 2HFEC 1R3LC 5EBMC 3AG3C 5KUMA 4MSWC 2W0FC 2WLKA 4X8AA 3FB6C 4RUEA 2KB1A 4MVZA 2EIKC 4R7CA 2EIMC 3TETA 4MW3A 3X2QC 2HVKC 2EILC 4QE9A 5CBHA 3STZC 2DWEC 2ITCC 3FB7C 3K06A 3IGAC 3K08A 4HZ3A 4HYOA 4UUJC 1P7BA 4MTOA 4F4LA 4MW8A 3SPJA 4X89A 4LCUC 1R3IC 2EIJC 2X6CA 4H33A 4XDKA 3T4DA 5KUKA 3LDDA 1OCRC 3E83A 4CBCA 3RVYA 3T4ZA 3VOUA 3SPIA 1KKDA 2IH1C 4GX0A 1OCZC 3JYCA 2WLLA 2WLNA 4GX2A 5BZBA 3E89A 3R65A 2WLHA 4P30A 3AG1C 2X6AA 2ITDC 2WLIA 4P9PA 2A79B 2DYSC 3OR6C 2WLMA 4GX1A 4MS2A 4QNHB 3SYAA 5EBWC 1XL6A 4MVRA 1R3JC 3AG2C 4P9OA 4MTGA 4BW5A 3LDEA 2WLLB 2HJFC 4I9WA 4LBEC 2Y69C 4RUFA 3PJSK 3FB8C 4WFHA 1J95A 4JTDB 3ZRSA 5CBGA 2ZXWC 1V55C 2R9RB 4J9YB 3ZJZA 3FB5C 3TCUA 3RW0A 3E8BA 2AHYA 3UM7A 4KFMA 3EFFK 4MVSA 4RAIA 4X88A 5EBLC 5B3SC 3ASOC 3T1CA 3WG7C 5B1BC 4WFEA 1M57C 2X6BA 4MVQA 4TWKA 2HG5C 2A0LA 5E1AC 4ZBMA 2ATKC 3SPCA 3HPLC 3STLC 1M56C 5B1AC 3T2MA 1XL4A 2Q69A 3SPHA 3KG2A 4R8CA 2OCCC 2DYRC 4PDMA 3K0GA 4XDJA 3ABLC 4G27B 3SJQC 3E86A 4PA7A 4GX5A 1V54C 4RO2A 1K4CC 5IY5C 1BL8A 2Q68A 4EKWA 1QLEC 4PDRA 2BOCC 1ORQC 3IFXA 4PA4A 4QE7A 4R6ZA 4H37A 2JK5C 2QKSA 3SYPA 3OGCC 4PA3A 2Q6AA 1ZWIC 1OCOC 2WLIB 4JTCB 3SYQA 4JTAB 2Q67A 5J9PC 3K03A 2BOBC 3RVZA 2NLJC 4MVMA 5EC2C 2K1EA 2P7TC 3SPGA 1OCCC 3RBZA 4OXSA 3ABMC 3AG4C 3F5WC 3GB7C 3LUTB 3OUSA 2QTOA 2WLJA 4PDLA 4R50A 3E8HA 2H8PC 4WFGA 3OR7C 2EINC 3K0DA 4G28B 3BEHA 4P2ZA 4MTFA 1K4DC 2A9HA 1LNQA 2DWDC 2ZD9A 3SYCA 3K04A 3F7VC 4PA6A 3F7YC 3SYOA 1R3KC 3UKMA 4XDLA 3E8GA 1S5HC 3ABKC 4PDVA 3LNMB 5EK0A
chains in the Genus database with same CATH superfamily
3FYEB 4PA9A 1F4MA 2PYJA 3ASNC 1Y66A 3K79A 4GZRB 3A0BZ 3ABMB 4X20B 2ZE5A 1VQ6V 4WCEV 1VARA 1MZFA 2KB1A 4N23A 4MVZA 3ZHUA 4ABMA 1SRYA 3KCXA 2EIMC 3GWKC 3FKSG 2DWEC 1N34O 2G38A 4UCRA 2GTAA 4DV3O 3J7AU 3CCVV 4GYCB 2IU0A 1GK9A 1LR1A 4X64B 3T4ZA 3ZHQA 4NXNO 3JAWA 2GUZA 1L0NH 2JGUA 2LFRA 2QM7A 4DR4O 1Z5VA 3E35A 2Q7EA 1XBLA 5IDJA 4DV4B 2HJFC 2N05A 4I9WA 2Q0OC 5H5NA 4WFBV 2ZXWC 2CDYA 2AHYA 1Y76B 1AR5A 3ASOC 2JGDB 3WG7C 1R1BA 1FD9A 2HEPA 1Z2GA 4JZ2A 3RYCA 5JCOA 4EEQA 2HHHB 4GT1A 1FXKA 5EZYA 4NTXA 4JGSA 3DSQA 3AK2A 2LW1A 4GKJB 3B8NA 1YF2A 1OCOC 4DK1A 5KMGA 3VQWA 2UUCB 5EC2C 2IM9A 3BA9A 1JA8A 1S3JA 2YSUB 3HKBB 1DTOA 4KP4A 1Q3EA 1XI1A 1SQFA 3VQVA 4EB6B 4ZI7A 4CBCA 4YIOA 3F7VC 3B2EE 3JD3A 2GHYA 4LFBB 4J11A 1AR4A 4O2BA 2V7QG 2BSKA 3G6EV 2DN9A 1PKXA 4D7TA 3RGBA 3ICXA 4U7NA 4K3AA 3FFQA 1Q5OA 1MABG 4O2BB 2IU3A 3DGEA 4NKGB 2FTKA 3B77A 3QF7A 1ZX3A 2B5UA 4O4IA 4UXNA 1R3IC 5ITZB 2QWPB 3RVYA 2IH1C 1WNSA 1B3QA 4DV0B 2XTAA 1VF6A 1BSMA 3JARA 3CXHF 3OW2U 4P9OA 1RPOA 1WA8B 3FAVA 4KUMA 1XNRO 2CTWA 2P22C 4O2AA 4DV2B 2E3CA 4AILC 1N8RW 1IBMO 4LF8O 5EIBC 1TVKA 1NTKH 3MHHC 1M57B 3TCUA 3RW0A 3H9VA 3RYFA 3AG1B 1XQ8A 2ZNJA 3HKDA 3QVNA 2W0XA 3O9OA 4LNUB 4X1IB 1GTOA 1Q6IA 1P49A 2ZE7A 3K0GA 3AG2B 2JS3A 3QO7A 1W0JG 4Z1VA 5IJ9B 1K8AW 3IFXA 4QE7A 1G8MA 2WLIB 5B3SB 4QPKA 4JTAB 4B3RO 1N32O 2BE3A 3DXRA 1K34A 3K03A 3J81N 1FKAO 4UCUA 1DGSA 3AG7A 1WP8A 3H1IH 5JCOC 2OTJV 2EZOA 5BXZA 4R50A 5J2UA 2QKAA 1FXKC 1MMMA 2H8PC 4DR2B 3D3QA 1K92A 3BEHA 3ABKB 2DWDC 2BTQA 3JATA 3L71H 4LR3A 3OD4A 1AI7A 2E76B 1IBKO 2HVJC 3K57A 4TSFG 1AJNA 2DMXA 3RFRA 1QVGU 1BT8A 2BTQB 2WLKA 4X8AA 2KKWA 2PI4A 4JI1O 2Z3YA 1MNGA 2ITCC 5JH7B 1PNLA 5LXTA 2F43G 2R9IA 3WB1A 4TUYB 1HR0B 3SPJA 4LCUC 4FFKA 1Z5WA 2R70A 3I5DA 5AG2A 2ZIMA 3DC5A 2P06A 2PGGA 1KKDA 4DV7O 4DR5B 4JV5B 2Q8VA 3MAQA 2LO1A 1FYJA 1GN2A 5LXTB 4P30A 4J42A 1TGOA 2DYSC 4B3MB 2AZ0A 5EBWC 4X1YA 4OPHA 4NYKA 5LBQA 4PHZA 1J95A 5CBGA 2C2AA 4I50A 1VF6C 3TXQA 3K5OA 3P32A 2FMLA 3TK1A 1M57C 3DTUB 3JALA 1XL4A 2CE4A 4G27B 4I50B 5A2QN 1K7DA 1RPRA 4DV1B 1K3EA 3CXCU 3EHBB 3K5LA 2UUAB 1ZLZA 1EBOA 2UXNA 2BOBC 4LFAO 5JVDA 3RYIA 3SDLA 1QQCA 2VRZA 2N74A 3ABLB 2RQ6A 5BR8B 5DN6G 4D6TH 4JAAA 3CCSV 3T1HB 3ZMVA 1D5NA 2V4DA 2RNBA 1G1XB 3ABKC 2VQFB 1GO3F 5EK0A 1US6A 5IWAB 4LH7A 4B7EA 2H94A 3ZS8C 2UXCO 3CHXA 2ZDIA 3QO5A 1PP9H 5CA3A 5L3FA 5HFLA 5LMNO 2W0FC 1XMOO 2DOSA 2VS0A 4IL6Z 2CGOA 4ZIBA 5LHGA 3OTOB 4JYCA 3R66A 4OX9B 4LF4B 4DUZB 2PZSA 1Y67A 4DV6O 4PJ0Z 4H33A 1BCCH 1OCRC 4FLWA 1EZVH 3OTFA 3TJTA 3VOUA 2GDSA 3CCQV 1K9MW 3QNEA 3F5TA 3R65A 2UUBB 2X6AA 5BMVA 2MK3A 4CS4A 3MD0A 3SYAA 1QBZA 3CCRV 2XT9A 1NI8A 4RUFA 4QIWF 1J5EO 4WFHA 2IJIA 5BMVB 4BIZA 1V55C 2WPDG 2O57A 2JDIG 4JI5B 1B06A 2VQEO 3CRMA 3CYOA 2A3QA 2A0LA 4ZBMA 5JWPA 3FX7A 3ZMUA 1VP7A 2PF4E 5KAIZ 4NXMB 5GW7A 5KX5A 5H9CA 1N0JA 5FPRA 1M90W 5H6QA 4FFBB 1PL4A 4DR3B 1OCCB 2Z0AA 3IC9A 5IJ0A 1FFTB 3DC6A 1KP3A 5B1AB 5KHJA 2OCCB 4DR1B 1MG1A 1HNWB 5GTIZ 4CH3A 2QSAA 4J7JA 4P2ZA 1KB9F 3E22B 3SYOA 1XHXA 4DO2A 4LF7B 1RSOA 4NR1A 1XOUA 4CH6A 1S77D 2B1IA 4N21A 4DXWA 2QWNB 4J9ZB 2CGNA 2AHZA 5K1XA 1IVSA 4IYHA 1RSOB 4O4HA 4QJFB 5LYJB 4EFBA 1WLEA 1WPXA 4R7CA 4K0KO 4JYAO 4QE9A 3STZC 5KHGA 1N34B 1AI4A 3ASNB 3JD1A 1B6QA 2EIJC 2ZDIC 4DV3B 3TGUH 4DUYB 3U0ZA 2ZKOA 4AI8A 4NXNB 4GX2A 2Q5ZA 4BWAA 4L8JA 1VQ7V 4W4KA 1KP2A 2EIMB 2HP8A 1YTFD 1EM1A 2ZQMA 1XREA 3B40A 4DRXA 1X4TA 2P67A 4TV8A 3UM7A 5LMUO 1IBLO 1S5JA 1K73W 4TWKA 2DYRB 2HG5C 2DQ0A 3HPLC 3STLC 3T2MA 2VWKA 1H2GA 4TV8B 4LF9O 1Y6XA 3KCYA 1NU1H 3Q4HB 1A32A 5L3GA 1L1FA 4JI3O 2Y48A 1H2MA 2ZXWB 2JVDA 2K9PA 3ASOB 5HFMA 3AG4B 3ZRWA 2B1GA 4O4JB 3SPGA 2F66C 1LUVA 1OCCC 3M7MX 2EX3A 2ZCEA 1COWG 3ETGA 1VEWA 1F51A 3RWRD 1WP7A 1M9NA 3L9DA 4LC1A 2EINC 2YXHA 2Q4PA 1JFFA 4LWSA 3N2KA 2CH7B 3SPCA 3ABUA 3LNMB 4WFFA 1IURA 1OCOB 3D3IA 4CC5A 3W7TA 4MVUA 1R6KA 4AHCA 1JFFB 4LWSB 1PM9A 1CXZB 2X7RB 2XAQA 2JJ1G 4RUEA 4Q20A 2VWJA 5C8YA 4U3JA 3CJHA 5DECA 4I0XA 4TQDA 1VQ4V 2WWWA 2X6CA 3T4DA 4B7KA 3LDDA 5C8YB 1HNXO 3O65A 3E89A 2F4VB 1NBMG 4KHPO 1UFIA 1BQ0A 3ZRVA 2BCCH 4ZHQA 3C3TA 2GSMB 1B04A 4UV9A 4RQEA 4KL1A 2IJKA 4LBEC 3JAKA 3FB8C 1KC8W 2ZM6B 4JTDB 1IBMB 2YIAA 3QG5A 1KQSU 2ZR3A 1MSWD 1GM7A 1K5SA 5B1BC 3G4SV 4WBNA 5KHIA 1M56C 2ILMA 5KHHA 4NVPA 4R8CA 2DYRC 3JD2A 4TOIA 2QA4V 3H01A 5IY5C 4WBNB 1QLEC 3JAWB 1ORQC 4JI6O 2GUZB 3JCZA 2JIZG 3OT7A 5FL7G 3ZX6A 4I5SA 3L74H 3L72H 3ZMTA 1N32B 2IW5A 2K1EA 2P7TC 5IYCO 4ZOLA 5B1OA 3AG4C 4JI7O 2F23A 4UFZA 4UCSA 1XMQO 2A9HA 2XASA 3SGIA 3JD4A 3CS5A 4ZOLB 1XILA 4GKKB 1VQMV 4YXWG 3CCMV 4IYIA 3RYCB 3K9SA 2OTLV 1SQQH 1U96A 5LOVA 1FXKB 1VMGA 2ZINA 3ZMSA 5EZYB 3ZHVA 1NVPD 4X62O 4FM1A 3T1YO 1SETA 4JI1B 5KMGB 4HZ3A 5LGNA 1JCHA 1SKVA 5JJNB 2AW9A 3E83A 3SPIA 2RJZA 1OCZC 4DV7B 4ZI7B 2WLNA 1H2LA 1R73A 3WB0A 3SJCC 4JASA 1PD3A 3OM3B 2BSKB 3K5MA 1XL6A 4LFCB 5CB4A 5H6RA 1JOYA 2JEUA 3G67A 1K5QA 2ZE8A 1PV0A 2XOKG 4WFEA 5E1AC 2DYSB 1OZ0A 4O4IB 1WAZA 4JZGA 2FB5A 3P3PA 2QJ1A 2AZ2A 3VQYA 3HKEA 4GX5A 3ZHSA 4FJCC 4DK0A 2BOCC 4HAMA 3N2GA 3OGCC 1VQ5V 3JARB 4UVCA 3G80A 1N33O 1M93A 4IIJA 3W7UA 3RBZA 4C7UA 4LFAB 3FAVB 3GB7C 3LUTB 4O2AB 4YIPA 2GTSA 3ZHRA 2P5OA 2W6JG 1TVKB 3RYFB 1PPJH 1XNQO 4FLXA 3HKDB 4LP8A 1CEZA 1KYOF 2F95B 3BFRA 1YVWA 2WAMA 2UXCB 1KMIZ 2IBZH 1TUBA 4RWUA 2P6JA 1WB8A 5LMNB 2DQ3A 1XMOB 2EIKC 2P4KA 4DV4O 4BAYA 3DXRB 4B08A 1TUBB 2Q0AA 4DV6B 4YJ3A 1W59A 4XDKA 1NH2D 2OWOA 5J2UB 4CS2A 1HWYA 3JSNA 3OMIB 2ZE6A 3W7SA 3OGIB 4X1KA 2KG7A 5LL6Y 5KA6A 3JATB 4YJ3B 4GX1A 4MT8A 2HHHO 4DV5O 1ZAUA 4UB8Z 4UVBA 4X9QA 5DM6V 1KUQA 1OCRB 3A0HZ 5LGTA 1YJNV 1EN6A 2ODMA 2LQTA 3I56V 2YDEA 4MVSA 2CUGA 2VQEB 4JI8B 4K35A 1AI5A 1GM9A 3UCSC 3BRCA 3ZIAG 1Q82W 2WSSG 4XDJA 1FS0G 5GTHZ 1BE3H 4GLXA 4LFBO 1F4NA 2BTOA 3RYHA 1V55B 2EZPA 3UO3A 5B5EZ 4FLZA 5B1NA 4JTCB 3CCJV 1GN4A 2Q67A 3QTCA 3JASA 3CC4V 4X1YB 3HKCA 1S5LZ 1SQVH 2YXLA 4G28B 2WA3A 1WN7A 1LNQA 2ARHA 3UT5A 3F7YC 5JQGA 4FZ1A 3JALB 2CTRA 4FLVA 1SERA 3B09A 1I0HA 1GKFA 1P4RA 2EBOA 1RM1C 3UT5B 1R3LC 4UV8A 5JQGB 4ZKIA 3FB6C 4FPPA 4I9QA 3BCCH 1PNKA 1VF7A 5KHKA 4K0KB 3IGAC 5JVDB 4MTOA 2YS8A 3RYIB 2UXDB 5LGUA 4J7ZA 1M5IA 1HNZO 1S0VA 2LP7A 1NTMH 4DR6B 1QHTA 1ENVA 5FNVA 2ITDC 4YY3B 4JAUA 2UU9B 1JJOA 4H44B 2DE0X 1QNMA 3W7XA 4FLTA 2EIJB 4QPJA 5FNVB 3PJSK 1CP9A 3WU2Z 3CRCA 4K8XA 3JCUZ 1QU7A 5EBLC 1FPOA 2QM4A 5LMUB 3T1CA 1I94O 1IBLB 4HNAA 2ATKC 1T5EA 1VQLV 4B3TO 3LSQA 3ZMZA 1IZ3A 2JS5A 1YJWV 3ML0A 2P4VA 1FFXA 3E86A 1V54C 4RO2A 1FJGO 3G71V 1L8DA 5IYZA 4PV1B 3KZIZ 4HNAB 4ICGA 5EYPA 2W6IG 4JI3B 2X0LA 2ETNA 1Q81W 4J10A 1K33A 2CK3G 2E5LO 1AILA 2EJRA 2NLJC 2FL4A 3JD0A 2OT5A 2OCHA 5IYZB 4WFGA 3A2FA 1E79G 2MW2B 2ZD9A 3UKMA 2WA4A 1D5AA 2QEXV 2IH3C 5JJEB 1KD1W 1R6NA 4FM2A 5EC1C 1Q43A 4LF6O 5L3DA 1EFRG 1I7FA 3AG3C 5KX5B 2R9AA 2EINB 3AK3A 1H8EG 3APOA 1BMFG 4PI0A 2NNUA 5DEDA 5IJ0B 4HYOA 1QLNA 1Q90D 1P7BA 4CC6A 2Q7GA 1G6UA 3FYIB 4O4LA 3CRRA 2QTSA 1EZJA 4FM0A 2YXYA 1LUWA 4FLYA 4ASUG 3EVKA 1HNXB 5BZBA 4I7ZB 2EJ7A 5CA1A 4KHPB 1H8HG 4P9PA 3OR6C 4AQYO 2RN9A 3BHPA 2GV9A 3B4SA 3C3SA 1AI6A 3CC2V 2Y0IA 4CH4A 2RCVA 4F6EA 1SZXA 5CA1B 4O4HB 5LA6A 2EULA 3EFFK 4IHJA 2PTMA 3KG2A 3L73H 3U10A 4E4EA 1SQXH 1F23A 5LA6B 5A9GA 2YC0A 1VF5B 4DR4B 3BABA 4PA7A 2VQFO 2PY5A 1HDJA 4I4TA 3ZN1A 4J80A 1WB7A 3OMNB 1Y4MA 3TXSA 4JI6B 4DR7O 5B1BB 1Q6HA 5GONA 4J41A 1XEQA 2Z5UA 5J9PC 1M56B 3UQ8A 4I4TB 4Z1MG 4DRXB 5E79Z 5J2TA 3K0DA 1Q7YW 4H13B 5IY5B 1Q86W 3CRAA 5LP6A 1QLEB 1M1KW 1XMQB 4DUZO 3E8GA 3QO8A 3EXAA 5KAFZ 3LDCA 3OUFA 3NR7A 2YEVA 1N4CA 3A0RA 3AEIA 1ZL8A 3BAAA 4JI4O 1VIBA 3MHSC 1NS1A 4TQFA 2Q73A 4XBFA 1N36O 5FLXN 2ZNIA 3T1YB 4EFEA 3ETQA 4X65O 2A06H 3HR0A 2YEVB 3WB2A 4DYLA 1KKCA 3ZRWB 3K08A 2AXTZ 5D5PA 4I55A 1IDSA 3JSLA 2CAZC 2Y4TA 2LGQA 4FK5C 4JI2O 3ZN0A 1L0LH 3LNNA 2YIBD 1URFA 3N2KB 1YZBA 2WLHA 3AK1A 1ZUQA 4PELA 4JYYA 4FMTA 2QKCA 4MVRA 1SQGA 2YICA 4JI0O 2HR3A 1PNMA 4WFAV 1Y74A 4TV9A 1OCZB 3FB5C 3I55V 1O9HA 1OHHG 4U3JB 1H2SB 3CJHB 4DR1O 1VQPV 2AGAA 4I0XB 3SJBC 5H2FZ 1Y74B 4PDMA 1FXVA 1VQOV 4X20A 1DF5A 2OIGA 3SJQC 5L3CA 1I5XA 5F2VO 2LGWA 3GWOA 1XNRB 2QKSA 4PA3A 4LF8B 3SR2C 4ZHQB 3BVOA 4MVMA 1N33B 1ROPA 3D36C 4DW1A 2M7WA 2XHBA 2PUSA 2QTOA 2WLJA 4DW0A 2YI8A 4G2KA 3JAKB 3IC7A 3K3WA 4L87A 3LSSA 4B3SO 1XNQB 1S5HC 3H1LH 4TT3G 1D2DA 3K58A 4DUYO 1SS3A 4B3RB 3OFNG 1TUEB 3OAAG 4LF5O 5EBMC 1BQZA 1IXMA 5LP6C 3G6BA 4PD4F 2EILB 1Y76A 2E75B 3W7WA 2JGDA 4MW3A 5CBHA 1BZKA 1V9PA 3FB7C 2D2CB 2QR4A 5C93A 3M99B 4D7SA 4F4LA 4KXRA 2QWQB 1IBKB 1MZEA 3CE2A 2EIKB 4X66O 4YHHO 3OE7G 1AVMA 4QNHB 5K1PA 4DV5B 4U3FH 2Y69B 3UO2A 5B66Z 3HKBA 5LOVB 2B9ZA 4W4LA 3BA8A 2YI9A 4EB6A 1I08A 1THZA 5IE9A 3N27A 1NR7A 2Q69A 2UXBO 1JJ2U 5IYBO 1KECA 5L3EA 1XHZA 2V1DA 1Q8IA 4R6ZA 2JK5C 3SYPA 2JEXA 3VBBA 3APQA 3MDSA 3K9AA 1S76D 3ABMC 1SZTA 3CC7V 3WFVA 5ITZA 5CB4B 3ZHTA 3E8HA 1GH6A 3OR7C 3SYCA 1E1RG 1R6TA 3H1HH 1YCIA 4HBNA 2HKOA 3SYQA 3NXSA 4F6RA 1QCEA 2Y0PA 3IJ4A 1WA8A 1G4YB 2F4VO 1HP8A 3HKEB 3X2QB 3N2GB 4F6RB 3LSUA 3TETA 2ADQB 2EILC 1BS3A 2OIEA 2NN4A 4IIJB 4LNUA 4X1IA 2HJDA 2ZM6O 2RMKB 3OMAB 2ZR2A 4X64O 1HNZB 1RM1B 3OEEG 4GX0A 1UJWB 5IJ9A 2WLIA 1S72V 1XDCA 3B8MA 1OV9A 4JPRA 1YTFB 4A5UB 2H3OA 5IT9N 4IT5A 2Y69C 1E1QG 2ZIOA 2M6YA 1YXBA 1GAXA 3M8AA 2QE7G 3ABTA 1GM8A 4X88A 2HLDG 3KKYA 4BIOA 1I94B 3CP1A 1WPBA 2Y4UA 1MA1A 4Q6GA 4B3TB 3OEHG 1DK1A 3K59A 5TISZ 1JMKC 1BL8A 4EKWA 1W2BU 1FJGB 1SC5B 4X1KB 2KG7B 2IJHA 1VQ9V 4GKKO 4GKJO 3E2EA 1J5EB 4CH5A 2UUCO 4JYBA 1MSDA 1KBHA 5JH7A 2E5LB 3IAYA 4TUYA 3ZEDA 1YI2V 2PI5A 3F5WC 3P30A 3CSXA 4PDLA 1YIJV 3H1KH 1SESA 3PN1A 3FD9A 1V54B 3JAMN 3K04A 4PDVA 5CBFA 2YIBA 5CMUA 2DW4A 1EN5A 1AR1B 1GMGA 1AB3A 2HFEC 4LF6B 2QDOA 2XAHA 2XAFA 2YIDA 3RYHB 1JX9A 3CMAV 3P3NA 4LFCO 3X2QC 4UCVA 2P90A 4UUJC 1CPYA 3JASB 4BR6A 1TA8A 3HKCB 1H2KA 2XUMA 4MTXA 2F1MA 1RFYA 1NR1A 3AG3B 1YITV 1BGYH 4DV0O 4J7KA 3AG1C 2KSDA 3L70H 1JPXA 3H1JH 2WLMA 2E74B 4OPAA 2ZT9B 2Q9LA 4AQYB 1YHQV 3AG2C 4JYAB 3LDEA 4DV2O 3GVMA 3S3XA 2R9RB 3ZJZA 4KFMA 4RAIA 3CX5F 5B3SC 4UVAA 4MVQA 3S3WA 1M4UA 1NJIW 4FIPC 4QGPA 5EIBD 3CMEV 5KLVH 1PL0A 1OJHA 1ZSPA 1K4CC 2Q68A 4PDRA 4NTWA 1XUQA 4JF3A 1UPGA 4H0LB 4H37A 1ZWIC 4GCZA 1GRJA 4DR7B 1VQKV 3ETDA 4DR2O 4U7OA 2R72A 1ZTEA 1H38A 2GBOA 5JJJB 4MTFA 1K4DC 2YUAA 4LF9B 2IJJA 1YDXA 4FZ0A 4MVOA 2FYUH 1JQ0A 4OGQB 3J80N 2N04A 1JR9A 1IX9A 3E8FA 2QWRB 1FFXB 4YJ2A 2A7WA 5KUMA 4MSWC 4JI4B 5EYPB 3CCUV 1EN4A 1N36B 3CEIA 4X65B 1NVPB 1HR0O 2CTQA 4YJ2B 1TAEA 2PYLA 2QWOB 2JJ2G 4DR5O 4JI2B 4JI8O 4JV5O 3JYCA 2WLLA 3RN4A 5L3BA 1MOFA 2CTPA 3K5NA 4UCTA 4FFBA 1RP3B 4B3MO 2FKXA 1K97A 4PI2A 4BW5A 2WLLB 4JI0B 5CN0A 2XAJA 4K8ZA 1H2NA 5BY1A 2NR5A 3L75H 4J9YB 3E22A 1NZ6A 2RDCA 4FVMA 1N0NA 3VQXA 2ADPA 4O4LB 3SPHA 2UXXA 4CZZA 1SQBH 1AJQA 1QR9A 1AJPA 1DLBA 3ABLC 1X59A 1KU9A 5LYJA 2F93B 3CWBH 4DV1O 3BY6A 2UUAO 3THOA 2Q6AA 3A8TA 3CCLV 3CB2A 3RVZA 1U97A 1HW7A 1QR8A 5BR8O 3T1HO 3D36A 3CCEV 2OYQA 1FXHA 4PA6A 4B3SB 4XDLA 2LJ2A 3ZBHA 1NT2B 2UXDO 4IHJB 3BPZA 5D5QA 5IWAO 4RQFA 1DF4A 1Q6UA 1GN6A 4DR6O 1YSCA 1AP6A 1JVMA 4LF5B 1AP5A 4YY3O 1VQNV 4NB5A 4BIUA 2UU9O 4JI7B 3CRQA 1NQTA 4UCOA 3OTOO 2HVKC 5GONB 4LH6A 3K06A 4LF4O 4OX9O 2QM8A 3ETEA 4MW8A 1NTZH 3C90A 4X89A 5CA0A 1VQ8V 5KUKA 5J2TB 3ZRXA 2L35A 3U11A 4UB6Z 2XAGA 3Q4HA 2JRIA 1I5YA 2DJVA 5LP6B 1QVFU 1NH2B 1W0KG 2UUBO 2QGNA 4X66B 5CA0B 4FLUA 4YHHB 2A79B 4MS2A 4O4JA 5FPOA 4X62B 1FAFA 1R3JC 5KA5A 4MTGA 4BW9A 1P7GA 5LHIA 1P84F 1ZL8B 1BHAA 2KQXA 2LFSA 3ZRSA 1NKDA 4NTYA 3WG7B 4JI5O 3RT3C 3E8BA 2CH7A 1SA0A 1BHBA 3SJAC 5LHHA 2X6BA 2Q7HA 3D8CA 3CD6V 4CS3A 5B1AC 2LW7A 4I55B 2OCCC 2UXBB 4NXMO 1SA0B 1O9GA 2D3OW 4Z2WA 5IYDO 4GUNA 4PA4A 3HB3B 1F7YA 4DR3O 1WJZA 1GN3A 2XNDG 4IGGA 4WF9V 1AROP 1SQPH 4OXSA 1HNWO 3OUSA 3ZCCA 3CPWU 4E2LA 1IXBA 2L6LA 4TV9B 1YJ9V 4LF7O 1SF9A 1R3KC 4JAVA 1YEWA
chains in the Genus database with same CATH topology
3FYEB 4PA9A 1SERA 1S77D 3NXSA 1F4MA 1QCEA 2B1IA 3ASNC 4N21A 4DXWA 1Y66A 1GKFA 3K79A 4J9ZB 1P4RA 1G4YB 2AHZA 2EBOA 3ABMB 1RM1C 1R3LC 4UV8A 1VQ6V 4ZKIA 4WCEV 4QJFB 3FB6C 4FPPA 3X2QB 1WLEA 2KB1A 4N23A 1WPXA 4MVZA 4R7CA 1SRYA 2EIMC 1PNKA 3TETA 2EILC 4QE9A 3FKSG 3STZC 2DWEC 3IGAC 4MTOA 1AI4A 3ASNB 3OMAB 3JD1A 5LGUA 1B6QA 2EIJC 2ZDIC 2ZR2A 3CCVV 1S0VA 2LP7A 1RM1B 2IU0A 1GK9A 3T4ZA 3OEEG 4GX0A 1UJWB 4GX2A 1ENVA 1VQ7V 1KP2A 2EIMB 2ITDC 2WLIA 1S72V 1YTFD 2LFRA 2QM7A 4JAUA 3E35A 3B8MA 4JPRA 2ZQMA 5IDJA 1YTFB 3W7XA 2HJFC 2EIJB 4I9WA 4QPJA 2Y69C 1E1QG 3PJSK 1CP9A 2P67A 4WFBV 2ZXWC 2QE7G 3UM7A 2AHYA 3ABTA 1GM8A 4X88A 5EBLC 3ASOC 3T1CA 2HLDG 3WG7C 1K73W 4TWKA 2DYRB 2HG5C 2DQ0A 2ATKC 3HPLC 3STLC 3CP1A 3T2MA 1H2GA 1VQLV 3LSQA 3ZMZA 3OEHG 1YJWV 3ML0A 3E86A 4GT1A 1FXKA 1V54C 4RO2A 1BL8A 4EKWA 1W2BU 3G71V 5L3GA 1L1FA 4JGSA 2IJHA 2Y48A 1VQ9V 2W6IG 2ZXWB 2X0LA 3B8NA 1Q81W 3E2EA 1OCOC 3ASOB 4JYBA 5HFMA 1K33A 2CK3G 3AG4B 3ZRWA 2B1GA 3SPGA 2EJRA 2NLJC 5EC2C 3JD0A 1OCCC 1S3JA 2OT5A 2YSUB 1COWG 1YI2V 3ETGA 2PI5A 1F51A 3F5WC 3P30A 4PDLA 1YIJV 1M9NA 1SESA 4WFGA 1DTOA 4LC1A 2EINC 4KP4A 1V54B 1E79G 2ZD9A 4CBCA 3K04A 3F7VC 3JD3A 3UKMA 2GHYA 4PDVA 3ABUA 3LNMB 3SPCA 2QEXV 2IH3C 4WFFA 5CBFA 1OCOB 3D3IA 5CMUA 2V7QG 1KD1W 2DW4A 3W7TA 1AR1B 3G6EV 1GMGA 1PKXA 4MVUA 1R6NA 1R6KA 5EC1C 5L3DA 1EFRG 4U7NA 2HFEC 3AG3C 2XAHA 2XAFA 2EINB 2X7RB 2XAQA 1H8EG 2JJ1G 4RUEA 1BMFG 1MABG 2IU3A 4Q20A 1JX9A 3DGEA 3CMAV 2NNUA 3X2QC 2FTKA 3B77A 2P90A 4UUJC 1CPYA 4HYOA 1QLNA 1P7BA 3FYIB 2B5UA 1VQ4V 2WWWA 4UXNA 4MTXA 1EZJA 1R3IC 2X6CA 3T4DA 3LDDA 3RVYA 1NR1A 4ASUG 2IH1C 3AG3B 1YITV 5BZBA 3E89A 1NBMG 3AG1C 1JPXA 1H8HG 4P9PA 3ZRVA 3OW2U 3OR6C 2WLMA 2GSMB 1YHQV 4UV9A 3AG2C 1RPOA 4P9OA 4RQEA 4KUMA 1AI6A 3LDEA 2IJKA 3CC2V 4LBEC 3FB8C 1KC8W 1N8RW 4JTDB 2R9RB 3MHHC 1M57B 3TCUA 3RW0A 3ZJZA 1KQSU 4KFMA 3EFFK 2ZR3A 4RAIA 1MSWD 5B3SC 4UVAA 1GM7A 1K5SA 5B1BC 3AG1B 3G4SV 4MVQA 1M56C 1NJIW 1GTOA 4FIPC 3KG2A 4R8CA 2DYRC 3K0GA 3AG2B 1F23A 3JD2A 3CMEV 2QA4V 3H01A 3QO7A 1PL0A 4PA7A 1W0JG 1K4CC 5IY5C 2Q68A 3ZN1A 1QLEC 4PDRA 4JF3A 1ORQC 3OMNB 3IFXA 1K8AW 4QE7A 1Y4MA 4H37A 3JCZA 1G8MA 1ZWIC 2JIZG 2WLIB 5B3SB 4GCZA 4QPKA 5FL7G 4JTAB 5B1BB 4I5SA 5J9PC 1K34A 2Z5UA 3K03A 3ZMTA 2IW5A 2K1EA 1M56B 2P7TC 5IYCO 1VQKV 3ETDA 2OTJV 5B1OA 3AG4C 4Z1MG 2EZOA 4R50A 1FXKC 2H8PC 4U7OA 1H38A 3K0DA 1K92A 1Q7YW 1Q86W 3BEHA 3ABKB 5IY5B 4MTFA 1K4DC 1QLEB 2A9HA 2DWDC 1M1KW 2XASA 2IJJA 3E8GA 3JD4A 3QO8A 3LDCA 4MVOA 1JQ0A 3OUFA 1AI7A 1VQMV 2YEVA 4YXWG 3CCMV 2HVJC 3A0RA 2OTLV 4TSFG 1AJNA 3E8FA 3AEIA 1FXKB 3ZMSA 1QVGU 5KUMA 4MSWC 3MHSC 2WLKA 4X8AA 1NVPD 4XBFA 3CCUV 1SETA 2PI4A 2YEVB 2Z3YA 1NVPB 2ITCC 3ZRWB 1PNLA 3K08A 4HZ3A 5LGNA 2F43G 2R9IA 3SPJA 1JCHA 4LCUC 3E83A 4FK5C 2JJ2G 3ZN0A 3SPIA 1KKDA 1OCZC 3JYCA 2WLLA 2WLNA 5L3BA 1MOFA 1R73A 2WLHA 4P30A 4PELA 4JASA 1PD3A 2DYSC 3OM3B 4FMTA 5EBWC 1XL6A 4MVRA 1K97A 4BW5A 2WLLB 5CN0A 5H6RA 2XAJA 1JOYA 2HR3A 1PNMA 4WFAV 5LBQA 1J95A 2JEUA 5CBGA 1OCZB 1K5QA 4J9YB 3FB5C 3I55V 2C2AA 1OHHG 2XOKG 3P32A 4WFEA 3TK1A 1M57C 3DTUB 1VQPV 5E1AC 2DYSB 1OZ0A 1XL4A 3SPHA 2UXXA 4PDMA 4CZZA 1AJQA 1FXVA 1DLBA 1AJPA 1QR9A 3ABLC 4G27B 1VQOV 1DF5A 3SJQC 5L3CA 4GX5A 4FJCC 1K7DA 1RPRA 1I5XA 2BOCC 4HAMA 3GWOA 3BY6A 1K3EA 3CXCU 2QKSA 3EHBB 3OGCC 4PA3A 2Q6AA 1VQ5V 4UVCA 1EBOA 3CCLV 2UXNA 2BOBC 3RVZA 4MVMA 3W7UA 1ROPA 3RBZA 2M7WA 3GB7C 3LUTB 1QR8A 2QTOA 2WLJA 3ABLB 4G2KA 3IC7A 5DN6G 2W6JG 3D36A 3K3WA 3CCSV 3CCEV 4L87A 3ZMVA 3LSSA 1FXHA 4PA6A 4XDLA 1S5HC 3ABKC 1GO3F 4TT3G 5EK0A 4LP8A 1CEZA 4RQFA 1DF4A 2H94A 1YSCA 2WAMA 1JVMA 2ZDIA 3OFNG 1TUEB 3OAAG 3QO5A 5CA3A 5EBMC 2P6JA 5L3FA 5HFLA 1IXMA 2W0FC 1VQNV 2DQ3A 4BIUA 2EILB 2EIKC 1NQTA 5LHGA 3W7WA 4MW3A 2HVKC 4BAYA 5CBHA 3FB7C 3K06A 4JYCA 2QM8A 5C93A 3ETEA 3M99B 4F4LA 4MW8A 4X89A 1VQ8V 4H33A 4XDKA 5KUKA 1NH2D 3ZRXA 1OCRC 1HWYA 2XAGA 3OMIB 3VOUA 3W7SA 1I5YA 3CCQV 1QVFU 1NH2B 1K9MW 1W0KG 3QNEA 3R65A 2EIKB 2X6AA 3OE7G 5KA6A 2MK3A 2A79B 4GX1A 4MS2A 4MT8A 4QNHB 4UVBA 3MD0A 3SYAA 1QBZA 2Y69B 1R3JC 5KA5A 5DM6V 4MTGA 3CCRV 5LHIA 4RUFA 1OCRB 1BHAA 5LGTA 4QIWF 1YJNV 4WFHA 2LFSA 2IJIA 3ZRSA 1NKDA 3WG7B 4BIZA 1V55C 2WPDG 2JDIG 3E8BA 3I56V 1BHBA 1THZA 4MVSA 5LHHA 3CYOA 2X6BA 1AI5A 2A0LA 1NR7A 4ZBMA 3CD6V 1GM9A 5B1AC 3ZIAG 2Q69A 1Q82W 2OCCC 3ZMUA 2WSSG 4XDJA 1JJ2U 1FS0G 5IYBO 2D3OW 1KECA 5GW7A 5L3EA 5H9CA 1M90W 2V1DA 5IYDO 1F4NA 1V55B 5H6QA 4PA4A 2EZPA 3HB3B 4R6ZA 2JK5C 5B1NA 3SYPA 2XNDG 2JEXA 4JTCB 3VBBA 1OCCB 3SYQA 3CCJV 3K9AA 2Q67A 1FFTB 1S76D 4WF9V 3CC4V 1AROP 5B1AB 1KP3A 4OXSA 3ABMC 1SZTA 2OCCB 3CC7V 3WFVA 1MG1A 3OUSA 3E8HA 3ZCCA 3CPWU 4E2LA 3OR7C 4G28B 1YJ9V 4P2ZA 3SYCA 1LNQA 1E1RG 3SYOA 3F7YC 4DO2A 1R3KC 2HKOA 4JAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IH3 C;  4LP8 A;  4PA9 A;  4WFF A;  5CBF A;  3LDC A;  4MVO A;  3ASN C;  4DXW A;  3OUF A;  4MVU A;  2YEV A;  2HVJ C;  4J9Z B;  1G4Y B;  2AHZ A;  5EC1 C;  1JVM A;  3E8F A;  2HFE C;  1R3L C;  5EBM C;  3AG3 C;  5KUM A;  4MSW C;  2W0F C;  2WLK A;  4X8A A;  3FB6 C;  4RUE A;  2KB1 A;  4MVZ A;  2EIK C;  4R7C A;  2EIM C;  3TET A;  4MW3 A;  3X2Q C;  2HVK C;  2EIL C;  4QE9 A;  5CBH A;  3STZ C;  2DWE C;  2ITC C;  3FB7 C;  3K06 A;  3IGA C;  3K08 A;  4HZ3 A;  4HYO A;  4UUJ C;  1P7B A;  4MTO A;  4F4L A;  4MW8 A;  3SPJ A;  4X89 A;  4LCU C;  1R3I C;  2EIJ C;  2X6C A;  4H33 A;  4XDK A;  3T4D A;  5KUK A;  3LDD A;  1OCR C;  3E83 A;  4CBC A;  3RVY A;  3T4Z A;  3VOU A;  3SPI A;  1KKD A;  2IH1 C;  4GX0 A;  1OCZ C;  3JYC A;  2WLL A;  2WLN A;  4GX2 A;  5BZB A;  3E89 A;  3R65 A;  2WLH A;  4P30 A;  3AG1 C;  2X6A A;  2ITD C;  2WLI A;  4P9P A;  2A79 B;  2DYS C;  3OR6 C;  2WLM A;  4GX1 A;  4MS2 A;  4QNH B;  3SYA A;  5EBW C;  1XL6 A;  4MVR A;  1R3J C;  3AG2 C;  4P9O A;  4MTG A;  4BW5 A;  3LDE A;  2WLL B;  2HJF C;  4I9W A;  4LBE C;  2Y69 C;  4RUF A;  3PJS K;  3FB8 C;  4WFH A;  1J95 A;  4JTD B;  3ZRS A;  5CBG A;  2ZXW C;  1V55 C;  2R9R B;  4J9Y B;  3ZJZ A;  3FB5 C;  3TCU A;  3RW0 A;  3E8B A;  2AHY A;  3UM7 A;  4KFM A;  3EFF K;  4MVS A;  4RAI A;  4X88 A;  5EBL C;  5B3S C;  3ASO C;  3T1C A;  3WG7 C;  5B1B C;  4WFE A;  1M57 C;  2X6B A;  4MVQ A;  4TWK A;  2HG5 C;  2A0L A;  5E1A C;  4ZBM A;  2ATK C;  3SPC A;  3HPL C;  3STL C;  1M56 C;  5B1A C;  3T2M A;  1XL4 A;  2Q69 A;  3SPH A;  3KG2 A;  4R8C A;  2OCC C;  2DYR C;  4PDM A;  3K0G A;  4XDJ A;  3ABL C;  4G27 B;  3SJQ C;  3E86 A;  4PA7 A;  4GX5 A;  1V54 C;  4RO2 A;  1K4C C;  5IY5 C;  1BL8 A;  2Q68 A;  4EKW A;  1QLE C;  4PDR A;  2BOC C;  1ORQ C;  3IFX A;  4PA4 A;  4QE7 A;  4R6Z A;  4H37 A;  2JK5 C;  2QKS A;  3SYP A;  3OGC C;  4PA3 A;  2Q6A A;  1ZWI C;  1OCO C;  2WLI B;  4JTC B;  3SYQ A;  4JTA B;  2Q67 A;  5J9P C;  3K03 A;  2BOB C;  3RVZ A;  2NLJ C;  4MVM A;  5EC2 C;  2K1E A;  2P7T C;  3SPG A;  1OCC C;  3RBZ A;  4OXS A;  3ABM C;  3AG4 C;  3F5W C;  3GB7 C;  3LUT B;  3OUS A;  2QTO A;  2WLJ A;  4PDL A;  4R50 A;  3E8H A;  2H8P C;  4WFG A;  3OR7 C;  2EIN C;  3K0D A;  4G28 B;  3BEH A;  4P2Z A;  4MTF A;  1K4D C;  2A9H A;  1LNQ A;  2DWD C;  2ZD9 A;  3SYC A;  3K04 A;  3F7V C;  4PA6 A;  3F7Y C;  3SYO A;  1R3K C;  3UKM A;  4XDL A;  3E8G A;  1S5H C;  3ABK C;  4PDV A;  3LNM B;  5EK0 A; 
#chains in the Genus database with same CATH topology
 3FYE B;  4PA9 A;  1F4M A;  2PYJ A;  3ASN C;  1Y66 A;  3K79 A;  4GZR B;  3A0B Z;  3ABM B;  4X20 B;  2ZE5 A;  1VQ6 V;  4WCE V;  1VAR A;  1MZF A;  2KB1 A;  4N23 A;  4MVZ A;  3ZHU A;  4ABM A;  1SRY A;  3KCX A;  2EIM C;  3GWK C;  3FKS G;  2DWE C;  1N34 O;  2G38 A;  4UCR A;  2GTA A;  4DV3 O;  3J7A U;  3CCV V;  4GYC B;  2IU0 A;  1GK9 A;  1LR1 A;  4X64 B;  3T4Z A;  3ZHQ A;  4NXN O;  3JAW A;  2GUZ A;  1L0N H;  2JGU A;  2LFR A;  2QM7 A;  4DR4 O;  1Z5V A;  3E35 A;  2Q7E A;  1XBL A;  5IDJ A;  4DV4 B;  2HJF C;  2N05 A;  4I9W A;  2Q0O C;  5H5N A;  4WFB V;  2ZXW C;  2CDY A;  2AHY A;  1Y76 B;  1AR5 A;  3ASO C;  2JGD B;  3WG7 C;  1R1B A;  1FD9 A;  2HEP A;  1Z2G A;  4JZ2 A;  3RYC A;  5JCO A;  4EEQ A;  2HHH B;  4GT1 A;  1FXK A;  5EZY A;  4NTX A;  4JGS A;  3DSQ A;  3AK2 A;  2LW1 A;  4GKJ B;  3B8N A;  1YF2 A;  1OCO C;  4DK1 A;  5KMG A;  3VQW A;  2UUC B;  5EC2 C;  2IM9 A;  3BA9 A;  1JA8 A;  1S3J A;  2YSU B;  3HKB B;  1DTO A;  4KP4 A;  1Q3E A;  1XI1 A;  1SQF A;  3VQV A;  4EB6 B;  4ZI7 A;  4CBC A;  4YIO A;  3F7V C;  3B2E E;  3JD3 A;  2GHY A;  4LFB B;  4J11 A;  1AR4 A;  4O2B A;  2V7Q G;  2BSK A;  3G6E V;  2DN9 A;  1PKX A;  4D7T A;  3RGB A;  3ICX A;  4U7N A;  4K3A A;  3FFQ A;  1Q5O A;  1MAB G;  4O2B B;  2IU3 A;  3DGE A;  4NKG B;  2FTK A;  3B77 A;  3QF7 A;  1ZX3 A;  2B5U A;  4O4I A;  4UXN A;  1R3I C;  5ITZ B;  2QWP B;  3RVY A;  2IH1 C;  1WNS A;  1B3Q A;  4DV0 B;  2XTA A;  1VF6 A;  1BSM A;  3JAR A;  3CXH F;  3OW2 U;  4P9O A;  1RPO A;  1WA8 B;  3FAV A;  4KUM A;  1XNR O;  2CTW A;  2P22 C;  4O2A A;  4DV2 B;  2E3C A;  4AIL C;  1N8R W;  1IBM O;  4LF8 O;  5EIB C;  1TVK A;  1NTK H;  3MHH C;  1M57 B;  3TCU A;  3RW0 A;  3H9V A;  3RYF A;  3AG1 B;  1XQ8 A;  2ZNJ A;  3HKD A;  3QVN A;  2W0X A;  3O9O A;  4LNU B;  4X1I B;  1GTO A;  1Q6I A;  1P49 A;  2ZE7 A;  3K0G A;  3AG2 B;  2JS3 A;  3QO7 A;  1W0J G;  4Z1V A;  5IJ9 B;  1K8A W;  3IFX A;  4QE7 A;  1G8M A;  2WLI B;  5B3S B;  4QPK A;  4JTA B;  4B3R O;  1N32 O;  2BE3 A;  3DXR A;  1K34 A;  3K03 A;  3J81 N;  1FKA O;  4UCU A;  1DGS A;  3AG7 A;  1WP8 A;  3H1I H;  5JCO C;  2OTJ V;  2EZO A;  5BXZ A;  4R50 A;  5J2U A;  2QKA A;  1FXK C;  1MMM A;  2H8P C;  4DR2 B;  3D3Q A;  1K92 A;  3BEH A;  3ABK B;  2DWD C;  2BTQ A;  3JAT A;  3L71 H;  4LR3 A;  3OD4 A;  1AI7 A;  2E76 B;  1IBK O;  2HVJ C;  3K57 A;  4TSF G;  1AJN A;  2DMX A;  3RFR A;  1QVG U;  1BT8 A;  2BTQ B;  2WLK A;  4X8A A;  2KKW A;  2PI4 A;  4JI1 O;  2Z3Y A;  1MNG A;  2ITC C;  5JH7 B;  1PNL A;  5LXT A;  2F43 G;  2R9I A;  3WB1 A;  4TUY B;  1HR0 B;  3SPJ A;  4LCU C;  4FFK A;  1Z5W A;  2R70 A;  3I5D A;  5AG2 A;  2ZIM A;  3DC5 A;  2P06 A;  2PGG A;  1KKD A;  4DV7 O;  4DR5 B;  4JV5 B;  2Q8V A;  3MAQ A;  2LO1 A;  1FYJ A;  1GN2 A;  5LXT B;  4P30 A;  4J42 A;  1TGO A;  2DYS C;  4B3M B;  2AZ0 A;  5EBW C;  4X1Y A;  4OPH A;  4NYK A;  5LBQ A;  4PHZ A;  1J95 A;  5CBG A;  2C2A A;  4I50 A;  1VF6 C;  3TXQ A;  3K5O A;  3P32 A;  2FML A;  3TK1 A;  1M57 C;  3DTU B;  3JAL A;  1XL4 A;  2CE4 A;  4G27 B;  4I50 B;  5A2Q N;  1K7D A;  1RPR A;  4DV1 B;  1K3E A;  3CXC U;  3EHB B;  3K5L A;  2UUA B;  1ZLZ A;  1EBO A;  2UXN A;  2BOB C;  4LFA O;  5JVD A;  3RYI A;  3SDL A;  1QQC A;  2VRZ A;  2N74 A;  3ABL B;  2RQ6 A;  5BR8 B;  5DN6 G;  4D6T H;  4JAA A;  3CCS V;  3T1H B;  3ZMV A;  1D5N A;  2V4D A;  2RNB A;  1G1X B;  3ABK C;  2VQF B;  1GO3 F;  5EK0 A;  1US6 A;  5IWA B;  4LH7 A;  4B7E A;  2H94 A;  3ZS8 C;  2UXC O;  3CHX A;  2ZDI A;  3QO5 A;  1PP9 H;  5CA3 A;  5L3F A;  5HFL A;  5LMN O;  2W0F C;  1XMO O;  2DOS A;  2VS0 A;  4IL6 Z;  2CGO A;  4ZIB A;  5LHG A;  3OTO B;  4JYC A;  3R66 A;  4OX9 B;  4LF4 B;  4DUZ B;  2PZS A;  1Y67 A;  4DV6 O;  4PJ0 Z;  4H33 A;  1BCC H;  1OCR C;  4FLW A;  1EZV H;  3OTF A;  3TJT A;  3VOU A;  2GDS A;  3CCQ V;  1K9M W;  3QNE A;  3F5T A;  3R65 A;  2UUB B;  2X6A A;  5BMV A;  2MK3 A;  4CS4 A;  3MD0 A;  3SYA A;  1QBZ A;  3CCR V;  2XT9 A;  1NI8 A;  4RUF A;  4QIW F;  1J5E O;  4WFH A;  2IJI A;  5BMV B;  4BIZ A;  1V55 C;  2WPD G;  2O57 A;  2JDI G;  4JI5 B;  1B06 A;  2VQE O;  3CRM A;  3CYO A;  2A3Q A;  2A0L A;  4ZBM A;  5JWP A;  3FX7 A;  3ZMU A;  1VP7 A;  2PF4 E;  5KAI Z;  4NXM B;  5GW7 A;  5KX5 A;  5H9C A;  1N0J A;  5FPR A;  1M90 W;  5H6Q A;  4FFB B;  1PL4 A;  4DR3 B;  1OCC B;  2Z0A A;  3IC9 A;  5IJ0 A;  1FFT B;  3DC6 A;  1KP3 A;  5B1A B;  5KHJ A;  2OCC B;  4DR1 B;  1MG1 A;  1HNW B;  5GTI Z;  4CH3 A;  2QSA A;  4J7J A;  4P2Z A;  1KB9 F;  3E22 B;  3SYO A;  1XHX A;  4DO2 A;  4LF7 B;  1RSO A;  4NR1 A;  1XOU A;  4CH6 A;  1S77 D;  2B1I A;  4N21 A;  4DXW A;  2QWN B;  4J9Z B;  2CGN A;  2AHZ A;  5K1X A;  1IVS A;  4IYH A;  1RSO B;  4O4H A;  4QJF B;  5LYJ B;  4EFB A;  1WLE A;  1WPX A;  4R7C A;  4K0K O;  4JYA O;  4QE9 A;  3STZ C;  5KHG A;  1N34 B;  1AI4 A;  3ASN B;  3JD1 A;  1B6Q A;  2EIJ C;  2ZDI C;  4DV3 B;  3TGU H;  4DUY B;  3U0Z A;  2ZKO A;  4AI8 A;  4NXN B;  4GX2 A;  2Q5Z A;  4BWA A;  4L8J A;  1VQ7 V;  4W4K A;  1KP2 A;  2EIM B;  2HP8 A;  1YTF D;  1EM1 A;  2ZQM A;  1XRE A;  3B40 A;  4DRX A;  1X4T A;  2P67 A;  4TV8 A;  3UM7 A;  5LMU O;  1IBL O;  1S5J A;  1K73 W;  4TWK A;  2DYR B;  2HG5 C;  2DQ0 A;  3HPL C;  3STL C;  3T2M A;  2VWK A;  1H2G A;  4TV8 B;  4LF9 O;  1Y6X A;  3KCY A;  1NU1 H;  3Q4H B;  1A32 A;  5L3G A;  1L1F A;  4JI3 O;  2Y48 A;  1H2M A;  2ZXW B;  2JVD A;  2K9P A;  3ASO B;  5HFM A;  3AG4 B;  3ZRW A;  2B1G A;  4O4J B;  3SPG A;  2F66 C;  1LUV A;  1OCC C;  3M7M X;  2EX3 A;  2ZCE A;  1COW G;  3ETG A;  1VEW A;  1F51 A;  3RWR D;  1WP7 A;  1M9N A;  3L9D A;  4LC1 A;  2EIN C;  2YXH A;  2Q4P A;  1JFF A;  4LWS A;  3N2K A;  2CH7 B;  3SPC A;  3ABU A;  3LNM B;  4WFF A;  1IUR A;  1OCO B;  3D3I A;  4CC5 A;  3W7T A;  4MVU A;  1R6K A;  4AHC A;  1JFF B;  4LWS B;  1PM9 A;  1CXZ B;  2X7R B;  2XAQ A;  2JJ1 G;  4RUE A;  4Q20 A;  2VWJ A;  5C8Y A;  4U3J A;  3CJH A;  5DEC A;  4I0X A;  4TQD A;  1VQ4 V;  2WWW A;  2X6C A;  3T4D A;  4B7K A;  3LDD A;  5C8Y B;  1HNX O;  3O65 A;  3E89 A;  2F4V B;  1NBM G;  4KHP O;  1UFI A;  1BQ0 A;  3ZRV A;  2BCC H;  4ZHQ A;  3C3T A;  2GSM B;  1B04 A;  4UV9 A;  4RQE A;  4KL1 A;  2IJK A;  4LBE C;  3JAK A;  3FB8 C;  1KC8 W;  2ZM6 B;  4JTD B;  1IBM B;  2YIA A;  3QG5 A;  1KQS U;  2ZR3 A;  1MSW D;  1GM7 A;  1K5S A;  5B1B C;  3G4S V;  4WBN A;  5KHI A;  1M56 C;  2ILM A;  5KHH A;  4NVP A;  4R8C A;  2DYR C;  3JD2 A;  4TOI A;  2QA4 V;  3H01 A;  5IY5 C;  4WBN B;  1QLE C;  3JAW B;  1ORQ C;  4JI6 O;  2GUZ B;  3JCZ A;  2JIZ G;  3OT7 A;  5FL7 G;  3ZX6 A;  4I5S A;  3L74 H;  3L72 H;  3ZMT A;  1N32 B;  2IW5 A;  2K1E A;  2P7T C;  5IYC O;  4ZOL A;  5B1O A;  3AG4 C;  4JI7 O;  2F23 A;  4UFZ A;  4UCS A;  1XMQ O;  2A9H A;  2XAS A;  3SGI A;  3JD4 A;  3CS5 A;  4ZOL B;  1XIL A;  4GKK B;  1VQM V;  4YXW G;  3CCM V;  4IYI A;  3RYC B;  3K9S A;  2OTL V;  1SQQ H;  1U96 A;  5LOV A;  1FXK B;  1VMG A;  2ZIN A;  3ZMS A;  5EZY B;  3ZHV A;  1NVP D;  4X62 O;  4FM1 A;  3T1Y O;  1SET A;  4JI1 B;  5KMG B;  4HZ3 A;  5LGN A;  1JCH A;  1SKV A;  5JJN B;  2AW9 A;  3E83 A;  3SPI A;  2RJZ A;  1OCZ C;  4DV7 B;  4ZI7 B;  2WLN A;  1H2L A;  1R73 A;  3WB0 A;  3SJC C;  4JAS A;  1PD3 A;  3OM3 B;  2BSK B;  3K5M A;  1XL6 A;  4LFC B;  5CB4 A;  5H6R A;  1JOY A;  2JEU A;  3G67 A;  1K5Q A;  2ZE8 A;  1PV0 A;  2XOK G;  4WFE A;  5E1A C;  2DYS B;  1OZ0 A;  4O4I B;  1WAZ A;  4JZG A;  2FB5 A;  3P3P A;  2QJ1 A;  2AZ2 A;  3VQY A;  3HKE A;  4GX5 A;  3ZHS A;  4FJC C;  4DK0 A;  2BOC C;  4HAM A;  3N2G A;  3OGC C;  1VQ5 V;  3JAR B;  4UVC A;  3G80 A;  1N33 O;  1M93 A;  4IIJ A;  3W7U A;  3RBZ A;  4C7U A;  4LFA B;  3FAV B;  3GB7 C;  3LUT B;  4O2A B;  4YIP A;  2GTS A;  3ZHR A;  2P5O A;  2W6J G;  1TVK B;  3RYF B;  1PPJ H;  1XNQ O;  4FLX A;  3HKD B;  4LP8 A;  1CEZ A;  1KYO F;  2F95 B;  3BFR A;  1YVW A;  2WAM A;  2UXC B;  1KMI Z;  2IBZ H;  1TUB A;  4RWU A;  2P6J A;  1WB8 A;  5LMN B;  2DQ3 A;  1XMO B;  2EIK C;  2P4K A;  4DV4 O;  4BAY A;  3DXR B;  4B08 A;  1TUB B;  2Q0A A;  4DV6 B;  4YJ3 A;  1W59 A;  4XDK A;  1NH2 D;  2OWO A;  5J2U B;  4CS2 A;  1HWY A;  3JSN A;  3OMI B;  2ZE6 A;  3W7S A;  3OGI B;  4X1K A;  2KG7 A;  5LL6 Y;  5KA6 A;  3JAT B;  4YJ3 B;  4GX1 A;  4MT8 A;  2HHH O;  4DV5 O;  1ZAU A;  4UB8 Z;  4UVB A;  4X9Q A;  5DM6 V;  1KUQ A;  1OCR B;  3A0H Z;  5LGT A;  1YJN V;  1EN6 A;  2ODM A;  2LQT A;  3I56 V;  2YDE A;  4MVS A;  2CUG A;  2VQE B;  4JI8 B;  4K35 A;  1AI5 A;  1GM9 A;  3UCS C;  3BRC A;  3ZIA G;  1Q82 W;  2WSS G;  4XDJ A;  1FS0 G;  5GTH Z;  1BE3 H;  4GLX A;  4LFB O;  1F4N A;  2BTO A;  3RYH A;  1V55 B;  2EZP A;  3UO3 A;  5B5E Z;  4FLZ A;  5B1N A;  4JTC B;  3CCJ V;  1GN4 A;  2Q67 A;  3QTC A;  3JAS A;  3CC4 V;  4X1Y B;  3HKC A;  1S5L Z;  1SQV H;  2YXL A;  4G28 B;  2WA3 A;  1WN7 A;  1LNQ A;  2ARH A;  3UT5 A;  3F7Y C;  5JQG A;  4FZ1 A;  3JAL B;  2CTR A;  4FLV A;  1SER A;  3B09 A;  1I0H A;  1GKF A;  1P4R A;  2EBO A;  1RM1 C;  3UT5 B;  1R3L C;  4UV8 A;  5JQG B;  4ZKI A;  3FB6 C;  4FPP A;  4I9Q A;  3BCC H;  1PNK A;  1VF7 A;  5KHK A;  4K0K B;  3IGA C;  5JVD B;  4MTO A;  2YS8 A;  3RYI B;  2UXD B;  5LGU A;  4J7Z A;  1M5I A;  1HNZ O;  1S0V A;  2LP7 A;  1NTM H;  4DR6 B;  1QHT A;  1ENV A;  5FNV A;  2ITD C;  4YY3 B;  4JAU A;  2UU9 B;  1JJO A;  4H44 B;  2DE0 X;  1QNM A;  3W7X A;  4FLT A;  2EIJ B;  4QPJ A;  5FNV B;  3PJS K;  1CP9 A;  3WU2 Z;  3CRC A;  4K8X A;  3JCU Z;  1QU7 A;  5EBL C;  1FPO A;  2QM4 A;  5LMU B;  3T1C A;  1I94 O;  1IBL B;  4HNA A;  2ATK C;  1T5E A;  1VQL V;  4B3T O;  3LSQ A;  3ZMZ A;  1IZ3 A;  2JS5 A;  1YJW V;  3ML0 A;  2P4V A;  1FFX A;  3E86 A;  1V54 C;  4RO2 A;  1FJG O;  3G71 V;  1L8D A;  5IYZ A;  4PV1 B;  3KZI Z;  4HNA B;  4ICG A;  5EYP A;  2W6I G;  4JI3 B;  2X0L A;  2ETN A;  1Q81 W;  4J10 A;  1K33 A;  2CK3 G;  2E5L O;  1AIL A;  2EJR A;  2NLJ C;  2FL4 A;  3JD0 A;  2OT5 A;  2OCH A;  5IYZ B;  4WFG A;  3A2F A;  1E79 G;  2MW2 B;  2ZD9 A;  3UKM A;  2WA4 A;  1D5A A;  2QEX V;  2IH3 C;  5JJE B;  1KD1 W;  1R6N A;  4FM2 A;  5EC1 C;  1Q43 A;  4LF6 O;  5L3D A;  1EFR G;  1I7F A;  3AG3 C;  5KX5 B;  2R9A A;  2EIN B;  3AK3 A;  1H8E G;  3APO A;  1BMF G;  4PI0 A;  2NNU A;  5DED A;  5IJ0 B;  4HYO A;  1QLN A;  1Q90 D;  1P7B A;  4CC6 A;  2Q7G A;  1G6U A;  3FYI B;  4O4L A;  3CRR A;  2QTS A;  1EZJ A;  4FM0 A;  2YXY A;  1LUW A;  4FLY A;  4ASU G;  3EVK A;  1HNX B;  5BZB A;  4I7Z B;  2EJ7 A;  5CA1 A;  4KHP B;  1H8H G;  4P9P A;  3OR6 C;  4AQY O;  2RN9 A;  3BHP A;  2GV9 A;  3B4S A;  3C3S A;  1AI6 A;  3CC2 V;  2Y0I A;  4CH4 A;  2RCV A;  4F6E A;  1SZX A;  5CA1 B;  4O4H B;  5LA6 A;  2EUL A;  3EFF K;  4IHJ A;  2PTM A;  3KG2 A;  3L73 H;  3U10 A;  4E4E A;  1SQX H;  1F23 A;  5LA6 B;  5A9G A;  2YC0 A;  1VF5 B;  4DR4 B;  3BAB A;  4PA7 A;  2VQF O;  2PY5 A;  1HDJ A;  4I4T A;  3ZN1 A;  4J80 A;  1WB7 A;  3OMN B;  1Y4M A;  3TXS A;  4JI6 B;  4DR7 O;  5B1B B;  1Q6H A;  5GON A;  4J41 A;  1XEQ A;  2Z5U A;  5J9P C;  1M56 B;  3UQ8 A;  4I4T B;  4Z1M G;  4DRX B;  5E79 Z;  5J2T A;  3K0D A;  1Q7Y W;  4H13 B;  5IY5 B;  1Q86 W;  3CRA A;  5LP6 A;  1QLE B;  1M1K W;  1XMQ B;  4DUZ O;  3E8G A;  3QO8 A;  3EXA A;  5KAF Z;  3LDC A;  3OUF A;  3NR7 A;  2YEV A;  1N4C A;  3A0R A;  3AEI A;  1ZL8 A;  3BAA A;  4JI4 O;  1VIB A;  3MHS C;  1NS1 A;  4TQF A;  2Q73 A;  4XBF A;  1N36 O;  5FLX N;  2ZNI A;  3T1Y B;  4EFE A;  3ETQ A;  4X65 O;  2A06 H;  3HR0 A;  2YEV B;  3WB2 A;  4DYL A;  1KKC A;  3ZRW B;  3K08 A;  2AXT Z;  5D5P A;  4I55 A;  1IDS A;  3JSL A;  2CAZ C;  2Y4T A;  2LGQ A;  4FK5 C;  4JI2 O;  3ZN0 A;  1L0L H;  3LNN A;  2YIB D;  1URF A;  3N2K B;  1YZB A;  2WLH A;  3AK1 A;  1ZUQ A;  4PEL A;  4JYY A;  4FMT A;  2QKC A;  4MVR A;  1SQG A;  2YIC A;  4JI0 O;  2HR3 A;  1PNM A;  4WFA V;  1Y74 A;  4TV9 A;  1OCZ B;  3FB5 C;  3I55 V;  1O9H A;  1OHH G;  4U3J B;  1H2S B;  3CJH B;  4DR1 O;  1VQP V;  2AGA A;  4I0X B;  3SJB C;  5H2F Z;  1Y74 B;  4PDM A;  1FXV A;  1VQO V;  4X20 A;  1DF5 A;  2OIG A;  3SJQ C;  5L3C A;  1I5X A;  5F2V O;  2LGW A;  3GWO A;  1XNR B;  2QKS A;  4PA3 A;  4LF8 B;  3SR2 C;  4ZHQ B;  3BVO A;  4MVM A;  1N33 B;  1ROP A;  3D36 C;  4DW1 A;  2M7W A;  2XHB A;  2PUS A;  2QTO A;  2WLJ A;  4DW0 A;  2YI8 A;  4G2K A;  3JAK B;  3IC7 A;  3K3W A;  4L87 A;  3LSS A;  4B3S O;  1XNQ B;  1S5H C;  3H1L H;  4TT3 G;  1D2D A;  3K58 A;  4DUY O;  1SS3 A;  4B3R B;  3OFN G;  1TUE B;  3OAA G;  4LF5 O;  5EBM C;  1BQZ A;  1IXM A;  5LP6 C;  3G6B A;  4PD4 F;  2EIL B;  1Y76 A;  2E75 B;  3W7W A;  2JGD A;  4MW3 A;  5CBH A;  1BZK A;  1V9P A;  3FB7 C;  2D2C B;  2QR4 A;  5C93 A;  3M99 B;  4D7S A;  4F4L A;  4KXR A;  2QWQ B;  1IBK B;  1MZE A;  3CE2 A;  2EIK B;  4X66 O;  4YHH O;  3OE7 G;  1AVM A;  4QNH B;  5K1P A;  4DV5 B;  4U3F H;  2Y69 B;  3UO2 A;  5B66 Z;  3HKB A;  5LOV B;  2B9Z A;  4W4L A;  3BA8 A;  2YI9 A;  4EB6 A;  1I08 A;  1THZ A;  5IE9 A;  3N27 A;  1NR7 A;  2Q69 A;  2UXB O;  1JJ2 U;  5IYB O;  1KEC A;  5L3E A;  1XHZ A;  2V1D A;  1Q8I A;  4R6Z A;  2JK5 C;  3SYP A;  2JEX A;  3VBB A;  3APQ A;  3MDS A;  3K9A A;  1S76 D;  3ABM C;  1SZT A;  3CC7 V;  3WFV A;  5ITZ A;  5CB4 B;  3ZHT A;  3E8H A;  1GH6 A;  3OR7 C;  3SYC A;  1E1R G;  1R6T A;  3H1H H;  1YCI A;  4HBN A;  2HKO A;  3SYQ A;  3NXS A;  4F6R A;  1QCE A;  2Y0P A;  3IJ4 A;  1WA8 A;  1G4Y B;  2F4V O;  1HP8 A;  3HKE B;  3X2Q B;  3N2G B;  4F6R B;  3LSU A;  3TET A;  2ADQ B;  2EIL C;  1BS3 A;  2OIE A;  2NN4 A;  4IIJ B;  4LNU A;  4X1I A;  2HJD A;  2ZM6 O;  2RMK B;  3OMA B;  2ZR2 A;  4X64 O;  1HNZ B;  1RM1 B;  3OEE G;  4GX0 A;  1UJW B;  5IJ9 A;  2WLI A;  1S72 V;  1XDC A;  3B8M A;  1OV9 A;  4JPR A;  1YTF B;  4A5U B;  2H3O A;  5IT9 N;  4IT5 A;  2Y69 C;  1E1Q G;  2ZIO A;  2M6Y A;  1YXB A;  1GAX A;  3M8A A;  2QE7 G;  3ABT A;  1GM8 A;  4X88 A;  2HLD G;  3KKY A;  4BIO A;  1I94 B;  3CP1 A;  1WPB A;  2Y4U A;  1MA1 A;  4Q6G A;  4B3T B;  3OEH G;  1DK1 A;  3K59 A;  5TIS Z;  1JMK C;  1BL8 A;  4EKW A;  1W2B U;  1FJG B;  1SC5 B;  4X1K B;  2KG7 B;  2IJH A;  1VQ9 V;  4GKK O;  4GKJ O;  3E2E A;  1J5E B;  4CH5 A;  2UUC O;  4JYB A;  1MSD A;  1KBH A;  5JH7 A;  2E5L B;  3IAY A;  4TUY A;  3ZED A;  1YI2 V;  2PI5 A;  3F5W C;  3P30 A;  3CSX A;  4PDL A;  1YIJ V;  3H1K H;  1SES A;  3PN1 A;  3FD9 A;  1V54 B;  3JAM N;  3K04 A;  4PDV A;  5CBF A;  2YIB A;  5CMU A;  2DW4 A;  1EN5 A;  1AR1 B;  1GMG A;  1AB3 A;  2HFE C;  4LF6 B;  2QDO A;  2XAH A;  2XAF A;  2YID A;  3RYH B;  1JX9 A;  3CMA V;  3P3N A;  4LFC O;  3X2Q C;  4UCV A;  2P90 A;  4UUJ C;  1CPY A;  3JAS B;  4BR6 A;  1TA8 A;  3HKC B;  1H2K A;  2XUM A;  4MTX A;  2F1M A;  1RFY A;  1NR1 A;  3AG3 B;  1YIT V;  1BGY H;  4DV0 O;  4J7K A;  3AG1 C;  2KSD A;  3L70 H;  1JPX A;  3H1J H;  2WLM A;  2E74 B;  4OPA A;  2ZT9 B;  2Q9L A;  4AQY B;  1YHQ V;  3AG2 C;  4JYA B;  3LDE A;  4DV2 O;  3GVM A;  3S3X A;  2R9R B;  3ZJZ A;  4KFM A;  4RAI A;  3CX5 F;  5B3S C;  4UVA A;  4MVQ A;  3S3W A;  1M4U A;  1NJI W;  4FIP C;  4QGP A;  5EIB D;  3CME V;  5KLV H;  1PL0 A;  1OJH A;  1ZSP A;  1K4C C;  2Q68 A;  4PDR A;  4NTW A;  1XUQ A;  4JF3 A;  1UPG A;  4H0L B;  4H37 A;  1ZWI C;  4GCZ A;  1GRJ A;  4DR7 B;  1VQK V;  3ETD A;  4DR2 O;  4U7O A;  2R72 A;  1ZTE A;  1H38 A;  2GBO A;  5JJJ B;  4MTF A;  1K4D C;  2YUA A;  4LF9 B;  2IJJ A;  1YDX A;  4FZ0 A;  4MVO A;  2FYU H;  1JQ0 A;  4OGQ B;  3J80 N;  2N04 A;  1JR9 A;  1IX9 A;  3E8F A;  2QWR B;  1FFX B;  4YJ2 A;  2A7W A;  5KUM A;  4MSW C;  4JI4 B;  5EYP B;  3CCU V;  1EN4 A;  1N36 B;  3CEI A;  4X65 B;  1NVP B;  1HR0 O;  2CTQ A;  4YJ2 B;  1TAE A;  2PYL A;  2QWO B;  2JJ2 G;  4DR5 O;  4JI2 B;  4JI8 O;  4JV5 O;  3JYC A;  2WLL A;  3RN4 A;  5L3B A;  1MOF A;  2CTP A;  3K5N A;  4UCT A;  4FFB A;  1RP3 B;  4B3M O;  2FKX A;  1K97 A;  4PI2 A;  4BW5 A;  2WLL B;  4JI0 B;  5CN0 A;  2XAJ A;  4K8Z A;  1H2N A;  5BY1 A;  2NR5 A;  3L75 H;  4J9Y B;  3E22 A;  1NZ6 A;  2RDC A;  4FVM A;  1N0N A;  3VQX A;  2ADP A;  4O4L B;  3SPH A;  2UXX A;  4CZZ A;  1SQB H;  1AJQ A;  1QR9 A;  1AJP A;  1DLB A;  3ABL C;  1X59 A;  1KU9 A;  5LYJ A;  2F93 B;  3CWB H;  4DV1 O;  3BY6 A;  2UUA O;  3THO A;  2Q6A A;  3A8T A;  3CCL V;  3CB2 A;  3RVZ A;  1U97 A;  1HW7 A;  1QR8 A;  5BR8 O;  3T1H O;  3D36 A;  3CCE V;  2OYQ A;  1FXH A;  4PA6 A;  4B3S B;  4XDL A;  2LJ2 A;  3ZBH A;  1NT2 B;  2UXD O;  4IHJ B;  3BPZ A;  5D5Q A;  5IWA O;  4RQF A;  1DF4 A;  1Q6U A;  1GN6 A;  4DR6 O;  1YSC A;  1AP6 A;  1JVM A;  4LF5 B;  1AP5 A;  4YY3 O;  1VQN V;  4NB5 A;  4BIU A;  2UU9 O;  4JI7 B;  3CRQ A;  1NQT A;  4UCO A;  3OTO O;  2HVK C;  5GON B;  4LH6 A;  3K06 A;  4LF4 O;  4OX9 O;  2QM8 A;  3ETE A;  4MW8 A;  1NTZ H;  3C90 A;  4X89 A;  5CA0 A;  1VQ8 V;  5KUK A;  5J2T B;  3ZRX A;  2L35 A;  3U11 A;  4UB6 Z;  2XAG A;  3Q4H A;  2JRI A;  1I5Y A;  2DJV A;  5LP6 B;  1QVF U;  1NH2 B;  1W0K G;  2UUB O;  2QGN A;  4X66 B;  5CA0 B;  4FLU A;  4YHH B;  2A79 B;  4MS2 A;  4O4J A;  5FPO A;  4X62 B;  1FAF A;  1R3J C;  5KA5 A;  4MTG A;  4BW9 A;  1P7G A;  5LHI A;  1P84 F;  1ZL8 B;  1BHA A;  2KQX A;  2LFS A;  3ZRS A;  1NKD A;  4NTY A;  3WG7 B;  4JI5 O;  3RT3 C;  3E8B A;  2CH7 A;  1SA0 A;  1BHB A;  3SJA C;  5LHH A;  2X6B A;  2Q7H A;  3D8C A;  3CD6 V;  4CS3 A;  5B1A C;  2LW7 A;  4I55 B;  2OCC C;  2UXB B;  4NXM O;  1SA0 B;  1O9G A;  2D3O W;  4Z2W A;  5IYD O;  4GUN A;  4PA4 A;  3HB3 B;  1F7Y A;  4DR3 O;  1WJZ A;  1GN3 A;  2XND G;  4IGG A;  4WF9 V;  1ARO P;  1SQP H;  4OXS A;  1HNW O;  3OUS A;  3ZCC A;  3CPW U;  4E2L A;  1IXB A;  2L6L A;  4TV9 B;  1YJ9 V;  4LF7 O;  1SF9 A;  1R3K C;  4JAV A;  1YEW A; 
#chains in the Genus database with same CATH homology
 3FYE B;  4PA9 A;  1SER A;  1S77 D;  3NXS A;  1F4M A;  1QCE A;  2B1I A;  3ASN C;  4N21 A;  4DXW A;  1Y66 A;  1GKF A;  3K79 A;  4J9Z B;  1P4R A;  1G4Y B;  2AHZ A;  2EBO A;  3ABM B;  1RM1 C;  1R3L C;  4UV8 A;  1VQ6 V;  4ZKI A;  4WCE V;  4QJF B;  3FB6 C;  4FPP A;  3X2Q B;  1WLE A;  2KB1 A;  4N23 A;  1WPX A;  4MVZ A;  4R7C A;  1SRY A;  2EIM C;  1PNK A;  3TET A;  2EIL C;  4QE9 A;  3FKS G;  3STZ C;  2DWE C;  3IGA C;  4MTO A;  1AI4 A;  3ASN B;  3OMA B;  3JD1 A;  5LGU A;  1B6Q A;  2EIJ C;  2ZDI C;  2ZR2 A;  3CCV V;  1S0V A;  2LP7 A;  1RM1 B;  2IU0 A;  1GK9 A;  3T4Z A;  3OEE G;  4GX0 A;  1UJW B;  4GX2 A;  1ENV A;  1VQ7 V;  1KP2 A;  2EIM B;  2ITD C;  2WLI A;  1S72 V;  1YTF D;  2LFR A;  2QM7 A;  4JAU A;  3E35 A;  3B8M A;  4JPR A;  2ZQM A;  5IDJ A;  1YTF B;  3W7X A;  2HJF C;  2EIJ B;  4I9W A;  4QPJ A;  2Y69 C;  1E1Q G;  3PJS K;  1CP9 A;  2P67 A;  4WFB V;  2ZXW C;  2QE7 G;  3UM7 A;  2AHY A;  3ABT A;  1GM8 A;  4X88 A;  5EBL C;  3ASO C;  3T1C A;  2HLD G;  3WG7 C;  1K73 W;  4TWK A;  2DYR B;  2HG5 C;  2DQ0 A;  2ATK C;  3HPL C;  3STL C;  3CP1 A;  3T2M A;  1H2G A;  1VQL V;  3LSQ A;  3ZMZ A;  3OEH G;  1YJW V;  3ML0 A;  3E86 A;  4GT1 A;  1FXK A;  1V54 C;  4RO2 A;  1BL8 A;  4EKW A;  1W2B U;  3G71 V;  5L3G A;  1L1F A;  4JGS A;  2IJH A;  2Y48 A;  1VQ9 V;  2W6I G;  2ZXW B;  2X0L A;  3B8N A;  1Q81 W;  3E2E A;  1OCO C;  3ASO B;  4JYB A;  5HFM A;  1K33 A;  2CK3 G;  3AG4 B;  3ZRW A;  2B1G A;  3SPG A;  2EJR A;  2NLJ C;  5EC2 C;  3JD0 A;  1OCC C;  1S3J A;  2OT5 A;  2YSU B;  1COW G;  1YI2 V;  3ETG A;  2PI5 A;  1F51 A;  3F5W C;  3P30 A;  4PDL A;  1YIJ V;  1M9N A;  1SES A;  4WFG A;  1DTO A;  4LC1 A;  2EIN C;  4KP4 A;  1V54 B;  1E79 G;  2ZD9 A;  4CBC A;  3K04 A;  3F7V C;  3JD3 A;  3UKM A;  2GHY A;  4PDV A;  3ABU A;  3LNM B;  3SPC A;  2QEX V;  2IH3 C;  4WFF A;  5CBF A;  1OCO B;  3D3I A;  5CMU A;  2V7Q G;  1KD1 W;  2DW4 A;  3W7T A;  1AR1 B;  3G6E V;  1GMG A;  1PKX A;  4MVU A;  1R6N A;  1R6K A;  5EC1 C;  5L3D A;  1EFR G;  4U7N A;  2HFE C;  3AG3 C;  2XAH A;  2XAF A;  2EIN B;  2X7R B;  2XAQ A;  1H8E G;  2JJ1 G;  4RUE A;  1BMF G;  1MAB G;  2IU3 A;  4Q20 A;  1JX9 A;  3DGE A;  3CMA V;  2NNU A;  3X2Q C;  2FTK A;  3B77 A;  2P90 A;  4UUJ C;  1CPY A;  4HYO A;  1QLN A;  1P7B A;  3FYI B;  2B5U A;  1VQ4 V;  2WWW A;  4UXN A;  4MTX A;  1EZJ A;  1R3I C;  2X6C A;  3T4D A;  3LDD A;  3RVY A;  1NR1 A;  4ASU G;  2IH1 C;  3AG3 B;  1YIT V;  5BZB A;  3E89 A;  1NBM G;  3AG1 C;  1JPX A;  1H8H G;  4P9P A;  3ZRV A;  3OW2 U;  3OR6 C;  2WLM A;  2GSM B;  1YHQ V;  4UV9 A;  3AG2 C;  1RPO A;  4P9O A;  4RQE A;  4KUM A;  1AI6 A;  3LDE A;  2IJK A;  3CC2 V;  4LBE C;  3FB8 C;  1KC8 W;  1N8R W;  4JTD B;  2R9R B;  3MHH C;  1M57 B;  3TCU A;  3RW0 A;  3ZJZ A;  1KQS U;  4KFM A;  3EFF K;  2ZR3 A;  4RAI A;  1MSW D;  5B3S C;  4UVA A;  1GM7 A;  1K5S A;  5B1B C;  3AG1 B;  3G4S V;  4MVQ A;  1M56 C;  1NJI W;  1GTO A;  4FIP C;  3KG2 A;  4R8C A;  2DYR C;  3K0G A;  3AG2 B;  1F23 A;  3JD2 A;  3CME V;  2QA4 V;  3H01 A;  3QO7 A;  1PL0 A;  4PA7 A;  1W0J G;  1K4C C;  5IY5 C;  2Q68 A;  3ZN1 A;  1QLE C;  4PDR A;  4JF3 A;  1ORQ C;  3OMN B;  3IFX A;  1K8A W;  4QE7 A;  1Y4M A;  4H37 A;  3JCZ A;  1G8M A;  1ZWI C;  2JIZ G;  2WLI B;  5B3S B;  4GCZ A;  4QPK A;  5FL7 G;  4JTA B;  5B1B B;  4I5S A;  5J9P C;  1K34 A;  2Z5U A;  3K03 A;  3ZMT A;  2IW5 A;  2K1E A;  1M56 B;  2P7T C;  5IYC O;  1VQK V;  3ETD A;  2OTJ V;  5B1O A;  3AG4 C;  4Z1M G;  2EZO A;  4R50 A;  1FXK C;  2H8P C;  4U7O A;  1H38 A;  3K0D A;  1K92 A;  1Q7Y W;  1Q86 W;  3BEH A;  3ABK B;  5IY5 B;  4MTF A;  1K4D C;  1QLE B;  2A9H A;  2DWD C;  1M1K W;  2XAS A;  2IJJ A;  3E8G A;  3JD4 A;  3QO8 A;  3LDC A;  4MVO A;  1JQ0 A;  3OUF A;  1AI7 A;  1VQM V;  2YEV A;  4YXW G;  3CCM V;  2HVJ C;  3A0R A;  2OTL V;  4TSF G;  1AJN A;  3E8F A;  3AEI A;  1FXK B;  3ZMS A;  1QVG U;  5KUM A;  4MSW C;  3MHS C;  2WLK A;  4X8A A;  1NVP D;  4XBF A;  3CCU V;  1SET A;  2PI4 A;  2YEV B;  2Z3Y A;  1NVP B;  2ITC C;  3ZRW B;  1PNL A;  3K08 A;  4HZ3 A;  5LGN A;  2F43 G;  2R9I A;  3SPJ A;  1JCH A;  4LCU C;  3E83 A;  4FK5 C;  2JJ2 G;  3ZN0 A;  3SPI A;  1KKD A;  1OCZ C;  3JYC A;  2WLL A;  2WLN A;  5L3B A;  1MOF A;  1R73 A;  2WLH A;  4P30 A;  4PEL A;  4JAS A;  1PD3 A;  2DYS C;  3OM3 B;  4FMT A;  5EBW C;  1XL6 A;  4MVR A;  1K97 A;  4BW5 A;  2WLL B;  5CN0 A;  5H6R A;  2XAJ A;  1JOY A;  2HR3 A;  1PNM A;  4WFA V;  5LBQ A;  1J95 A;  2JEU A;  5CBG A;  1OCZ B;  1K5Q A;  4J9Y B;  3FB5 C;  3I55 V;  2C2A A;  1OHH G;  2XOK G;  3P32 A;  4WFE A;  3TK1 A;  1M57 C;  3DTU B;  1VQP V;  5E1A C;  2DYS B;  1OZ0 A;  1XL4 A;  3SPH A;  2UXX A;  4PDM A;  4CZZ A;  1AJQ A;  1FXV A;  1DLB A;  1AJP A;  1QR9 A;  3ABL C;  4G27 B;  1VQO V;  1DF5 A;  3SJQ C;  5L3C A;  4GX5 A;  4FJC C;  1K7D A;  1RPR A;  1I5X A;  2BOC C;  4HAM A;  3GWO A;  3BY6 A;  1K3E A;  3CXC U;  2QKS A;  3EHB B;  3OGC C;  4PA3 A;  2Q6A A;  1VQ5 V;  4UVC A;  1EBO A;  3CCL V;  2UXN A;  2BOB C;  3RVZ A;  4MVM A;  3W7U A;  1ROP A;  3RBZ A;  2M7W A;  3GB7 C;  3LUT B;  1QR8 A;  2QTO A;  2WLJ A;  3ABL B;  4G2K A;  3IC7 A;  5DN6 G;  2W6J G;  3D36 A;  3K3W A;  3CCS V;  3CCE V;  4L87 A;  3ZMV A;  3LSS A;  1FXH A;  4PA6 A;  4XDL A;  1S5H C;  3ABK C;  1GO3 F;  4TT3 G;  5EK0 A;  4LP8 A;  1CEZ A;  4RQF A;  1DF4 A;  2H94 A;  1YSC A;  2WAM A;  1JVM A;  2ZDI A;  3OFN G;  1TUE B;  3OAA G;  3QO5 A;  5CA3 A;  5EBM C;  2P6J A;  5L3F A;  5HFL A;  1IXM A;  2W0F C;  1VQN V;  2DQ3 A;  4BIU A;  2EIL B;  2EIK C;  1NQT A;  5LHG A;  3W7W A;  4MW3 A;  2HVK C;  4BAY A;  5CBH A;  3FB7 C;  3K06 A;  4JYC A;  2QM8 A;  5C93 A;  3ETE A;  3M99 B;  4F4L A;  4MW8 A;  4X89 A;  1VQ8 V;  4H33 A;  4XDK A;  5KUK A;  1NH2 D;  3ZRX A;  1OCR C;  1HWY A;  2XAG A;  3OMI B;  3VOU A;  3W7S A;  1I5Y A;  3CCQ V;  1QVF U;  1NH2 B;  1K9M W;  1W0K G;  3QNE A;  3R65 A;  2EIK B;  2X6A A;  3OE7 G;  5KA6 A;  2MK3 A;  2A79 B;  4GX1 A;  4MS2 A;  4MT8 A;  4QNH B;  4UVB A;  3MD0 A;  3SYA A;  1QBZ A;  2Y69 B;  1R3J C;  5KA5 A;  5DM6 V;  4MTG A;  3CCR V;  5LHI A;  4RUF A;  1OCR B;  1BHA A;  5LGT A;  4QIW F;  1YJN V;  4WFH A;  2LFS A;  2IJI A;  3ZRS A;  1NKD A;  3WG7 B;  4BIZ A;  1V55 C;  2WPD G;  2JDI G;  3E8B A;  3I56 V;  1BHB A;  1THZ A;  4MVS A;  5LHH A;  3CYO A;  2X6B A;  1AI5 A;  2A0L A;  1NR7 A;  4ZBM A;  3CD6 V;  1GM9 A;  5B1A C;  3ZIA G;  2Q69 A;  1Q82 W;  2OCC C;  3ZMU A;  2WSS G;  4XDJ A;  1JJ2 U;  1FS0 G;  5IYB O;  2D3O W;  1KEC A;  5GW7 A;  5L3E A;  5H9C A;  1M90 W;  2V1D A;  5IYD O;  1F4N A;  1V55 B;  5H6Q A;  4PA4 A;  2EZP A;  3HB3 B;  4R6Z A;  2JK5 C;  5B1N A;  3SYP A;  2XND G;  2JEX A;  4JTC B;  3VBB A;  1OCC B;  3SYQ A;  3CCJ V;  3K9A A;  2Q67 A;  1FFT B;  1S76 D;  4WF9 V;  3CC4 V;  1ARO P;  5B1A B;  1KP3 A;  4OXS A;  3ABM C;  1SZT A;  2OCC B;  3CC7 V;  3WFV A;  1MG1 A;  3OUS A;  3E8H A;  3ZCC A;  3CPW U;  4E2L A;  3OR7 C;  4G28 B;  1YJ9 V;  4P2Z A;  3SYC A;  1LNQ A;  1E1R G;  3SYO A;  3F7Y C;  4DO2 A;  1R3K C;  2HKO A;  4JAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...