3OGCC

Kcsa e71a variant in presence of na+
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVATATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for selectivity-inactivation coupling in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ogcC00
4MW8A 2DYRC 4PA3A 4MTOA 3EFFK 3STZC 1R3LC 2IH1C 3ASNC 3K04A 3OUFA 4GX2A 3JYCA 3SPIA 4MVOA 1P7BA 3HPLC 4OXSA 2WLMA 4RAIA 3SYOA 2HFEC 4PA7A 1S5HC 2AHZA 3AG1C 3LDDA 3K03A 2WLKA 4PDMA 2IH3C 3BEHA 3E83A 4JTAB 4PDLA 4WFEA 2EIJC 2A9HA 1XL6A 1J95A 5B1AC 1K4CC 4XDJA 1BL8A 1ORQC 2EILC 2R9RB 3IFXA 4H37A 3UM7A 3FB6C 3ZRSA 4G28B 4UUJC 4MSWC 5BZBA 3E8GA 2EINC 5EC2C 2ITCC 4X88A 4MVQA 1V55C 4GX1A 2ZXWC 4MTFA 3IGAC 3LDEA 4J9YB 4P9PA 3OUSA 5KUKA 2EIMC 3FB7C 1R3KC 4RUFA 3FB8C 2X6AA 3SYQA 2HVKC 2QTOA 3FB5C 1XL4A 4MVRA 4PA9A 5J9PC 2HVJC 4J9ZB 2JK5C 4R7CA 4WFHA 3AG2C 3E8BA 5E1AC 3UKMA 5CBGA 4EKWA 1R3JC 1LNQA 3K0GA 3K06A 4KFMA 4QE7A 3SPCA 3SPHA 2WLIB 1OCRC 3R65A 4X8AA 5B1BC 3T1CA 3GB7C 4MVMA 4RUEA 2HG5C 5IY5C 3TETA 4MVZA 4P2ZA 2QKSA 3F7YC 3OR7C 4JTCB 3SPGA 2AHYA 3LDCA 3F5WC 3RVZA 2WLJA 2BOBC 3K0DA 3SPJA 2Q67A 2WLLB 4R6ZA 4XDLA 2K1EA 3E8HA 2DWEC 3RVYA 4MS2A 4PDRA 3SYCA 2A79B 4ZBMA 2ITDC 3SYPA 3AG4C 4GX0A 3SJQC 3F7VC 3T2MA 4I9WA 3WG7C 5EBMC 5EBWC 3T4ZA 4P9OA 5EC1C 3SYAA 2W0FC 3ASOC 2WLIA 2X6CA 2WLHA 4PA4A 4PDVA 2A0LA 4RO2A 1OCCC 4F4LA 2HJFC 3ZJZA 1ZWIC 3KG2A 4HZ3A 3X2QC 4MTGA 4LP8A 2YEVA 3E8FA 2OCCC 4MW3A 3ABKC 3E89A 3LUTB 3T4DA 4MVUA 4DXWA 4TWKA 3E86A 3LNMB 2ATKC 3TCUA 5EBLC 2WLLA 3ABMC 2P7TC 1QLEC 3RBZA 4PA6A 1K4DC 2DYSC 2Q6AA 3PJSK 4G27B 4X89A 4LCUC 3AG3C 1OCZC 4XDKA 3OR6C 1OCOC 2NLJC 4WFGA 4QNHB 4P30A 1M57C 5CBFA 2KB1A 4QE9A 4MVSA 5CBHA 4R8CA 4GX5A 4H33A 3K08A 3STLC 3ABLC 2DWDC 1R3IC 4BW5A 1G4YB 2H8PC 2BOCC 2Q69A 3OGCC 3VOUA 1KKDA 5EK0A 4LBEC 4CBCA 2Q68A 1V54C 4JTDB 5B3SC 2EIKC 4R50A 4HYOA 1JVMA 3RW0A 4WFFA 2Y69C 1M56C 5KUMA 2X6BA 2ZD9A 2WLNA
chains in the Genus database with same CATH superfamily
2GUZA 4TV8A 2HKOA 1R3LC 3K04A 4I4TA 4CC6A 4X9QA 1ZAUA 2OT5A 3SYOA 3K03A 3FAVB 5IJ0A 1XQ8A 2WLKA 1VQOV 3CRRA 4EB6B 3K58A 3CYOA 1AROP 3JAKA 1FXHA 1V54B 1V55C 1PL0A 5L3EA 2LJ2A 2YUAA 4AILC 1B04A 2YS8A 4UV9A 4ZHQA 2EULA 4NXNO 1NTMH 2ADQB 3JD1A 3OAAG 4LF9O 5BR8O 2HG5C 1DF4A 5KA6A 5KX5A 1H2KA 1ROPA 4UCOA 3CCVV 4JTCB 1NT2B 4DV5O 3OD4A 1H2LA 3CSXA 3MHSC 4FFKA 4K35A 3RVZA 5A2QN 1H8HG 1LR1A 5KHIA 4O4LA 2HP8A 3ZMTA 3F7VC 2D3OW 4TQDA 4JI7B 4NYKA 1SF9A 5LL6Y 1MOFA 4LC1A 1NR1A 1YJNV 1Q81W 1MA1A 1QBZA 1M93A 1WNSA 3T1YB 3JARB 3OEHG 4FLWA 3F5TA 4BWAA 4Z1VA 1GM9A 1NVPB 2N04A 1PNLA 4QNHB 1KBHA 5CBFA 3RYHA 2DJVA 3BRCA 3ZMUA 1N36B 3FFQA 3ZHQA 2LFSA 1EN6A 4U3JB 1KD1W 2ZE5A 3B8NA 2ZD9A 3SPJA 4J7JA 3UT5B 5LGNA 2BTQA 2Z0AA 1JFFA 4DR3O 3OUFA 2JEUA 3SPIA 2Q5ZA 3HPLC 3BEHA 3GWOA 2ZCEA 2E75B 2EILC 3FB6C 2XT9A 2WAMA 3IC9A 3AEIA 3H1KH 5AG2A 3EXAA 1S76D 1F51A 1EFRG 1SQBH 1ZL8A 1M90W 5LHIA 3OW2U 2DOSA 1R6TA 3CC7V 4X1KA 2Y48A 5KHKA 1VQMV 1XNRB 3ZS8C 3TK1A 1EM1A 3ABKB 4B08A 1G1XB 2KG7B 5LA6A 3ZBHA 2K9PA 1JOYA 4NTWA 3ZMSA 2PI4A 3CP1A 4NXMO 1QR8A 2UUAB 4X1YB 4N23A 1H2MA 2YIAA 4FFBB 1I5YA 5LGTA 1KQSU 2PYLA 2UXCO 3BY6A 4X62O 1GM7A 5CA0A 2A06H 4YJ2A 1PKXA 2Y69B 1M56B 1Z5VA 5GTIZ 2A7WA 4CC5A 1QLNA 2UXBB 1CP9A 3MD0A 4B3TB 3SDLA 3K57A 4JPRA 1GN4A 3FYIB 3N27A 5H2FZ 2RMKB 1Q82W 3ABTA 1L1FA 5IYCO 3RW0A 2Y69C 5KUMA 1Y6XA 2WA3A 3EFFK 3HKEB 2R72A 4KHPO 1FFXA 3HKEA 3GVMA 1GKFA 1UJWB 5C93A 4BIOA 3S3XA 1YDXA 1QNMA 5IY5B 1TUEB 4UUJC 4LF4O 1X59A 4X88A 4G2KA 5F2VO 2KSDA 4GUNA 1GK9A 4MTFA 4KL1A 5IYBO 4DV1B 2QKAA 1WP8A 3Q4HA 1PD3A 3K0GA 4UCRA 2F95B 4O4HB 1AJQA 3T1CA 3G67A 2GV9A 5JCOC 1AILA 2QM4A 3JCUZ 2W6IG 4LF6B 5IT9N 1DK1A 4DK1A 5H6QA 2MK3A 2XNDG 5FPRA 2IJIA 3ZHVA 4FM0A 5L3CA 3CMAV 2HLDG 1OCRB 3A0BZ 1I08A 4YXWG 1SESA 5LXTA 1YTFB 3LSQA 2Q8VA 3I5DA 4HZ3A 3E8FA 1CPYA 3E89A 1QVFU 2Y4TA 5EZYA 4D7TA 1US6A 4XBFA 1S77D 4GLXA 2CTPA 3TXSA 3N2KA 2JS3A 3HKCB 4CS2A 1VP7A 5B1AB 2ZDIC 4GX5A 4LF4B 3HKBA 1HR0B 3ZHUA 4RQFA 2B1IA 1ZSPA 3DGEA 1N34B 4J11A 2Y0PA 4BIUA 1N32O 4EFBA 2P06A 1K8AW 5CBGA 4ZOLA 3D36C 2EZOA 2IH3C 2B5UA 1Z2GA 3CCLV 4FLUA 3M99B 5B1AC 4U3FH 3RT3C 4XDJA 5LP6B 2CE4A 4H37A 3ZRSA 4YJ2B 1I7FA 1YCIA 5CB4A 4LFBO 3DXRA 3IGAC 1DF5A 4FZ1A 1VQ4V 3FD9A 1SKVA 4LH7A 3CCQV 1GN6A 4WFBV 4X20A 1B6QA 4TV9A 4JASA 3BPZA 5J2UB 1LUWA 2R9IA 5B5EZ 1N4CA 5IY5C 1H8EG 3S3WA 1MZEA 4YIPA 1MSDA 1TAEA 3E22A 3TXQA 4LF9B 3A0HZ 1FKAO 4YIOA 1K97A 4NR1A 5CA3A 1HNXB 1NTKH 2D2CB 3AG4C 3JASA 3RWRD 3KZIZ 3G4SV 5D5PA 2Q7EA 1ZTEA 2QKCA 5CA0B 2R70A 4U3JA 1S5LZ 1KP3A 3K5NA 2YEVA 2FL4A 2F1MA 2YICA 3BAAA 2V7QG 2P90A 4GCZA 3OGIB 4B3SB 1BHBA 1RPRA 2YIBD 3AG4B 2RNBA 4FLZA 2CTWA 4JAUA 1NZ6A 1E79G 3K3WA 2LW7A 2Q69A 3OGCC 2Q68A 3RYCB 1YJWV 3DSQA 4HYOA 4KUMA 2EIMB 1JA8A 1ZUQA 4NB5A 4I55B 1P7GA 1U96A 3WFVA 3QG5A 3W7WA 2P22C 1YZBA 4K8ZA 1GTOA 1WA8B 4DW0A 3B2EE 2H94A 2FTKA 2IJJA 5L3BA 1VF6A 4J9YB 1QVGU 3CPWU 1SA0A 1WP7A 1HNXO 3AG7A 1XL4A 2KKWA 1VIBA 4DR7O 3K9SA 1KC8W 3K5OA 3AK3A 1GH6A 4KFMA 3JD3A 1OCCB 3QNEA 4K0KO 2YDEA 4KP4A 2XASA 3SJBC 3VBBA 1PP9H 3U10A 5LHGA 1NH2D 2DYSB 3SYPA 3FX7A 4I9WA 3VQYA 3T4ZA 3D3QA 2QM8A 5EC1C 3SYAA 1BQ0A 4MTXA 4F4LA 3RYHB 4JGSA 1JPXA 4MTGA 5KMGB 4AQYB 2VQFO 3LUTB 4MVUA 4TWKA 3RN4A 4PI0A 1SS3A 4LFBB 1FYJA 4CH4A 3ASNB 1XHXA 1QLEC 1XI1A 3BA8A 1OJHA 2NNUA 1IDSA 1K4DC 4NTXA 2RCVA 1OCZC 3DC5A 2NLJC 3ASOB 4WFGA 1M57C 4QE9A 3JAWB 3STLC 2XOKG 3ABLC 4UCVA 4AHCA 5JH7B 4JAVA 1QQCA 2YIDA 4UB6Z 2ODMA 4OX9B 1YIJV 4E4EA 4UVCA 4Z1MG 4ZKIA 1HWYA 2ILMA 1YTFD 2ZT9B 3ASNC 2P5OA 1KMIZ 4TQFA 4X62B 5IWAO 4F6RB 3AG1C 1Q90D 4JI5B 4X66B 4J10A 3HB3B 3A2FA 3FKSG 2XAGA 3DC6A 3IFXA 1SRYA 4DR2B 5CB4B 3CRCA 4DR5B 4PELA 4ZIBA 5JCOA 4O2AB 1S5JA 2FMLA 4PV1B 1VQNV 1KU9A 5HFLA 2JDIG 3J80N 3MHHC 4X1IB 4I9QA 1NVPD 4X1IA 3U11A 3BA9A 2M7WA 2IBZH 2EILB 3TETA 2QWRB 4MVZA 2V1DA 1EN4A 4YJ3B 4I5SA 2QWPB 4FVMA 2ZIOA 2VWJA 4X65O 1QU7A 2EJ7A 1BZKA 1XMQO 3OMIB 4BIZA 1N33O 2QSAA 3QO8A 1K5SA 1AJPA 1Q6IA 4F6RA 1XNRO 4P9OA 2A0LA 2YXYA 4IYIA 2QM7A 1IBLO 3W7XA 4OX9O 4O4IA 4FFBA 4MW3A 3ABKC 4FPPA 4JI6B 3T4DA 2RJZA 4B3TO 4LFCB 3CC4V 5FL7G 1CEZA 2DYRB 4GKJB 2C2AA 1UPGA 3N2GB 4G27B 4GKJO 1NR7A 2P67A 5IJ9B 1KUQA 1R1BA 2XAJA 3OTOO 1YJ9V 4KHPB 4CBCA 2ZNJA 3C3TA 4FLYA 1RFYA 4WFFA 4PA3A 3STZC 2OTJV 4IYHA 4H0LB 2AHZA 2QA4V 3BVOA 4JTAB 5EIBD 1XHZA 3APOA 3HKCA 5L3FA 1BL8A 1EZVH 3UM7A 2CDYA 2UUBO 4MSWC 4LWSA 4LF8O 2F4VO 4BW9A 5BR8B 3B8MA 2M6YA 4Z2WA 2RN9A 3Q4HB 3L74H 5KAFZ 1YI2V 1SQQH 4O2BA 2WPDG 1IBKB 2IJHA 3SYQA 3FB5C 3RYIA 4IT5A 1ZX3A 3AG1B 4GKKB 2X7RB 1OV9A 4BR6A 1V9PA 4B3MO 1Y76B 2GTSA 3K06A 2EJRA 4QE7A 1N34O 5L3GA 2Y4UA 3G6BA 1S72V 1R73A 2L6LA 2P4VA 3RYIB 1QLEB 1BE3H 1K34A 2DN9A 4ZBMA 5GONB 1SC5B 3T2MA 3CX5F 3TJTA 4B3SO 1XREA 1COWG 5JJJB 4LF6O 2VQEB 1G6UA 3GWKC 4LP8A 4X65B 4NKGB 5LYJB 4J42A 3TCUA 3ZRWB 4U7OA 3RYFB 3AK1A 1SQXH 3PJSK 4X89A 4LCUC 3WG7B 1NH2B 1IURA 5IWAB 2ZDIA 2YSUB 3H01A 4R8CA 2JS5A 1TVKA 4YY3B 2XTAA 1AR4A 5B3SC 5DN6G 3CE2A 4PA7A 3LDDA 1ZLZA 3OFNG 4OPHA 1L0NH 4ZOLB 3CJHA 2EIJC 3O65A 1VQKV 4LF7B 2ZM6B 3UO3A 2IU3A 2ZE7A 2JJ2G 2LQTA 4O2AA 4G28B 5TISZ 3K79A 2HR3A 1VQ6V 2JGDB 3E22B 2YI8A 3JARA 5LYJA 1Q86W 3WB2A 4JF3A 4PA9A 5IJ9A 2HVJC 1RSOB 3CEIA 1O9HA 5J2UA 3CRAA 2QE7G 4WFHA 3H1LH 4KXRA 2L35A 2PTMA 1R3JC 1LNQA 2AGAA 3W7SA 1AP5A 4QPKA 2UU9B 3X2QB 4JI0B 2QKSA 3SPGA 2AHYA 4UV8A 2ZM6O 4H44B 2WLJA 1H38A 1BSMA 3UO2A 5JVDB 2DQ0A 3K0DA 4EEQA 1BQZA 2WLLB 2N05A 3E8HA 1VQPV 1RP3B 5EBMC 3ASOC 4FM1A 2CGOA 1OCCC 1XEQA 1ZWIC 4JI4B 2Z5UA 4IHJB 3KCXA 5CA1A 1EN5A 2XAQA 5BXZA 4FMTA 4JYYA 1AI7A 4LFCO 4DR6B 4ZI7B 2GHYA 1JCHA 4BAYA 3I55V 1MABG 4J41A 1TUBB 1AI6A 2ZE6A 3AG3C 3N2GA 1FFTB 5GW7A 4P30A 1FS0G 4TV9B 4EB6A 5EYPA 4JYAO 1R3IC 5JQGB 3CRMA 2LGWA 3VOUA 5IE9A 1P4RA 2WWWA 4JTDB 2BTOA 2ZR2A 1BCCH 2DQ3A 4X66O 1OZ0A 3EVKA 2F66C 1N0NA 1SETA 2YXLA 1S5HC 3CCEV 1IBKO 3JCZA 4B7EA 2DMXA 2PYJA 1NQTA 3L73H 2IU0A 2UU9O 2E3CA 4IGGA 1FD9A 1K3EA 3E8GA 2EINC 1Y4MA 1HP8A 5J2TA 3HR0A 4YHHO 1VF6C 4DR2O 3FB8C 4DR5O 2HVKC 2IM9A 1SA0B 3EHBB 3JSLA 3E8BA 4O4JB 4JYCA 5H9CA 2QR4A 3FYEB 2E5LB 5CA1B 1JQ0A 2EX3A 3VQVA 5KMGA 2Y0IA 5EZYB 4DRXA 1AJNA 4J80A 2XHBA 1HNZB 1B06A 2QDOA 1PV0A 2ZINA 4PDVA 5B1BB 3CWBH 3X2QC 3ABUA 3ETQA 3CXHF 2OCCC 3LNNA 3OTOB 3JSNA 3OEEG 4X64B 1FXKB 3T1YO 5EBLC 1I94O 1PNMA 2W6JG 3P3NA 5J2TB 5KAIZ 3B09A 1QCEA 4LF8B 2VWKA 3SR2C 4CH3A 3ZX6A 3D36A 3AK2A 4MVSA 1N8RW 2LGQA 4MT8A 2V4DA 1AP6A 3U0ZA 1VQ7V 1OHHG 2OYQA 3J81N 2PGGA 1Y67A 1R6NA 1HW7A 2ZXWB 4E2LA 1IZ3A 1O9GA 4BW5A 2OIGA 5KLVH 1AI4A 3AG3B 3E83A 1VEWA 1AI5A 1M4UA 1M57B 4DV0O 2WSSG 1F23A 1GN2A 4J7ZA 3D8CA 5BZBA 1YXBA 1FPOA 2E74B 4GX1A 1RM1C 4LNUA 5IYZB 1NTZH 4DV6O 3OE7G 4DR4O 1K9MW 1NBMG 2FB5A 2P6JA 4MVRA 4IL6Z 1NJIW 4J9ZB 2JK5C 2LP7A 1YEWA 3RYFA 1FAFA 5E1AC 4WFAV 2BCCH 2UUAO 4OPAA 2QWNB 3RFRA 1KKCA 2EINB 5D5QA 4JI1B 1XMQB 4NXNB 3MAQA 1WA8A 4JI2B 4J7KA 5JVDA 5KA5A 2QGNA 4I4TB 2Q67A 2QEXV 4Q20A 4JI2O 3RVYA 1SZXA 4JI3O 4UCTA 5K1PA 4GX0A 3ZHRA 2W0FC 5LGUA 2X6CA 4PA4A 4QGPA 1VARA 3UQ8A 3CJHB 3QO5A 1Y74A 3L71H 4UFZA 3KG2A 1MMMA 5LP6A 5B1OA 1TA8A 1WPXA 2ZE8A 2FKXA 1XUQA 3E86A 2BSKA 2ATKC 1J5EO 2P4KA 2WLLA 2UXDO 2P7TC 3QVNA 1HNZO 5CN0A 3SGIA 4AI8A 4JV5O 3SJAC 1S3JA 1OCOC 1G8MA 4LR3A 4DV3O 1L0LH 1SQGA 1YITV 4H33A 4WBNB 3ZMZA 3H1JH 2BOCC 5EK0A 2E5LO 2JJ1G 4DV4O 2G38A 1DLBA 4R50A 3MDSA 3VQXA 1K73W 5J9PC 4MW8A 2DYRC 4TUYA 1SQPH 4MVOA 4PI2A 4X20B 4JZ2A 3JALA 3ZN0A 4ZHQB 3C90A 1KYOF 4FZ0A 4D6TH 4PDMA 5FLXN 1S0VA 1J5EB 1BS3A 4O4JA 4GYCB 1J95A 2GBOA 5BMVA 2OCHA 5B1NA 3HKDA 4HNAB 3A8TA 4I50A 2ZXWC 2CTRA 3FB7C 4FIPC 3P30A 5FNVB 2AZ0A 3N2KB 4FJCC 4R7CA 5ITZB 3CCJV 5JH7A 2HJDA 2FYUH 3SPHA 1R6KA 1AR5A 2CUGA 2NN4A 3JD2A 4DUYO 2PZSA 2IJKA 1SERA 2AZ2A 4L8JA 3WU2Z 2JEXA 4RQEA 3CXCU 3B77A 4K3AA 1P84F 1N0JA 2BOBC 4PD4F 4DV5B 3IC7A 2Q0AA 3SYCA 5E79Z 1GN3A 1THZA 1TGOA 2OTLV 3G6EV 3ML0A 2JGDA 2CK3G 4I0XB 4W4KA 4LFAO 1ZL8B 5H5NA 1W0JG 4U7NA 3HKDB 4DXWA 1GRJA 2N74A 2B9ZA 3ZHSA 1JX9A 1VF5B 1SQVH 5KHJA 2YIBA 1H2SB 3W7TA 5CBHA 3K5LA 4JI8O 4JI5O 5L3DA 4JYBA 2ARHA 5DECA 3OMAB 4JI7O 3ZRWA 2NR5A 4F6EA 2UUCB 3K9AA 2EBOA 4WF9V 4OGQB 3ABMB 4B7KA 1XDCA 1P7BA 1F4MA 4OXSA 3A0RA 5C8YA 1WB8A 2MW2B 4LFAB 3AG2B 1M1KW 5LMNB 5LBQA 2E76B 2A9HA 1Q6HA 3T1HO 2RDCA 2R9RB 1K33A 3OMNB 1B3QA 1D2DA 1QHTA 4UCSA 2ZQMA 3CHXA 4DV4B 4FLVA 3QTCA 1XBLA 4QPJA 5JWPA 1FXVA 3CCMV 1JR9A 3ETGA 1WN7A 1E1RG 2Q0OC 2X0LA 1Q6UA 5LOVA 1WLEA 5GTHZ 3DTUB 2CGNA 5B1BC 5CMUA 2LO1A 2Q73A 2EZPA 3WB1A 3BABA 2CH7B 3F5WC 3JD4A 4JI3B 3BFRA 3VQWA 2DWEC 3LSSA 4I7ZB 1M9NA 4DUZB 4JZGA 3SJQC 1D5NA 5EBWC 2PUSA 4YHHB 2GSMB 1IXBA 4UXNA 1L8DA 1YVWA 5BY1A 3NXSA 1XOUA 3L75H 2UXCB 3L70H 1X4TA 2B1GA 2VRZA 1Q3EA 3RBZA 4PA6A 3ZIAG 3ZN1A 2JIZG 4DRXB 4O4LB 4CS3A 2JVDA 3W7UA 3J7AU 3ZEDA 3O9OA 2KB1A 3L72H 3JATB 5JJEB 2WA4A 4O4IB 5BMVB 2H8PC 3BCCH 1KKDA 1P49A 2ADPA 1CXZB 2OCCB 3BHPA 2GUZB 1RM1B 1I0HA 1WPBA 3JALB 2BE3A 2IH1C 3IJ4A 3JYCA 4UVAA 4RAIA 4DR3B 4I55A 4PDLA 1Y76A 1HNWO 4NVPA 4HBNA 3ZRXA 2Z3YA 2ZKOA 3UCSC 3CCRV 4NXMB 2ETNA 4TOIA 2XAFA 2YXHA 3LSUA 4K8XA 2ITCC 3B40A 3JAKB 1IX9A 3LDEA 5FNVA 4P9PA 5KUKA 4DV0B 1Q43A 1R3KC 1BT8A 4RUFA 3FAVA 2OWOA 3AG2C 1K5QA 3CC2V 3R65A 1DGSA 4MVMA 1D5AA 5HFMA 4CH5A 3ETDA 2QJ1A 5JJNB 5A9GA 1AB3A 2GDSA 5IYDO 1K7DA 2K1EA 1VQ8V 4MS2A 4LF5B 2A79B 4C7UA 4WCEV 2UXDB 3ZMVA 3ICXA 1OCOB 2WLHA 3JATA 1I94B 3ZJZA 4I0XA 2QWQB 1GO3F 5KX5B 2F23A 3QO7A 2XUMA 1PM9A 4D7SA 3LNMB 3KCYA 2CH7A 1T5EA 4TT3G 1U97A 3OT7A 1Q5OA 4O2BB 2UXBO 4HAMA 3JAWA 2Q7HA 1H2GA 3JASB 2EIJB 3OR6C 4PJ0Z 1A32A 3K08A 5B66Z 4UVBA 2OIEA 1NU1H 1GAXA 4IHJA 1AVMA 2UUCO 2EIKC 1JJOA 5LMUO 4B3RO 4CZZA 1K92A 2WLNA 2PY5A 4GT1A 3WB0A 4GX2A 2HFEC 5LOVB 2A3QA 1HDJA 1Y66A 4NTYA 3T1HB 1SQFA 2YI9A 2CAZC 1ORQC 1UFIA 3C3SA 2VS0A 1WB7A 2JRIA 2Q4PA 4JV5B 3P32A 5H6RA 4FM2A 3I56V 4DV2B 1JFFB 1IVSA 2X6AA 5EIBC 5C8YB 4DV1O 3ETEA 1E1QG 1GM8A 5IDJA 1BMFG 1BHAA 1XNQB 4EKWA 4FK5C 1WJZA 4RWUA 4N21A 3ZCCA 3CRQA 3CB2A 1Y74B 1W0KG 4CH6A 1IXMA 4DR4B 1QR9A 1F4NA 4I50B 2W0XA 3E35A 4B3MB 2PF4E 4QJFB 1XMOB 1KECA 2VQEO 4PDRA 3E2EA 2ITDC 1JMKC 3ZRVA 1OCZB 2R9AA 2WLIA 2QTSA 4RO2A 1Q7YW 3ABLB 1HNWB 4DK0A 2CTQA 4ASUG 1PPJH 3SJCC 2UUBB 3CD6V 2GTAA 4PHZA 3KKYA 4DYLA 3ABMC 1LUVA 4JI4O 1EBOA 4DV7B 1MG1A 5FPOA 3TGUH 3JD0A 5EYPB 1IBMO 2HEPA 1H2NA 4DR1B 2F43G 1Q8IA 3H1HH 1G4YB 1PL4A 1BGYH 4LBEC 4LH6A 2HHHO 2ZIMA 4DR1O 4ABMA 4TV8B 1VMGA 3RGBA 4YJ3A 1W2BU 4MTOA 1N33B 3P3PA 1RSOA 2WLMA 1Z5WA 1DTOA 1MSWD 4ICGA 4DV3B 1VQLV 2UXXA 4X1KB 1K4CC 4HNAA 5JQGA 4DV7O 1JJ2U 4X1YA 1YF2A 1FJGB 4DUZO 4MVQA 5B3SB 2EIKB 5LHHA 4CS4A 4JI8B 4FLXA 2RQ6A 2EIMC 3CCUV 4UCUA 3UT5A 4Q6GA 4LF7O 2QTOA 4K0KB 2UXNA 5GONA 3UKMA 2PI5A 1NKDA 3HKBB 2QWOB 2H3OA 4X8AA 2O57A 3G80A 1SZTA 1TVKB 4RUEA 4JI1O 4P2ZA 4A5UB 3IAYA 1FXKC 2JGUA 2DW4A 3RYCA 5KHGA 4DW1A 3H1IH 4R6ZA 3ZHTA 3M7MX 1NS1A 2YC0A 1XNQO 4UB8Z 1FFXB 1VQ5V 4O4HA 1KP2A 5LXTB 4WBNA 2HJFC 3DXRB 4DR7B 3OTFA 4DV6B 2XAHA 4LWSB 4TUYB 1XMOO 1I5XA 1VQ9V 2Q9LA 3H9VA 3R66A 2ZNIA 2DYSC 2Q6AA 4X64O 4XDKA 3K59A 1W59A 4EFEA 4AQYO 5LP6C 4W4LA 1ENVA 3M8AA 4DR6O 1F7YA 1FJGO 1N36O 3K5MA 1V55B 1V54C 4GZRB 3B4SA 2BTQB 2LFRA 1M5IA 4LNUB 5IYZA 4H13B 3QF7A 1YSCA 4IIJB 2KQXA 4L87A 5K1XA 4JYAB 4WFEA 3CCSV 1XL6A 1RPOA 3NR7A 1MZFA 4JI0O 5DM6V 3CS5A 5EC2C 4FLTA 1XILA 3OUSA 2VQFB 1AR1B 5LMUB 4B3RB 1URFA 4DO2A 4JAAA 1GMGA 2F4VB 3THOA 3SPCA 3CMEV 2WLIB 1OCRC 3GB7C 4YY3O 2LW1A 1EZJA 4GKKO 4TSFG 3F7YC 3OR7C 5KHHA 5DEDA 1FXKA 1VF7A 3LDCA 1PNKA 2HHHB 2IW5A 2KG7A 5LA6B 1YHQV 4XDLA 5IJ0B 1KB9F 3WG7C 1WAZA 3L9DA 2DE0X 1MNGA 2F93B 5LMNO 1NI8A 2Q7GA 1IBMB 2AXTZ 4LF5O 4QIWF 1IBLB 2YEVB 3JAMN 3G71V 4IIJA 2BSKB 4JI6O 5ITZA 1HR0O 3OM3B 3APQA 3D3IA 1TUBA 4DV2O 2AW9A 2DWDC 4DUYB 4ZI7A 1N32B 3PN1A 2ZR3A 1JVMA 1M56C 2X6BA
chains in the Genus database with same CATH topology
2DQ3A 2EIMB 1OZ0A 2HKOA 1R3LC 2IH1C 3K04A 1SETA 3JYCA 4UVAA 4RAIA 2OT5A 3SYOA 1S5HC 3CCEV 3K03A 3WFVA 3JCZA 2WLKA 1VQOV 4PDLA 3W7WA 1NQTA 3CYOA 3ZRXA 2Z3YA 2IU0A 3CCRV 1AROP 1GTOA 1K3EA 2XAFA 3E8GA 2EINC 2ITCC 1FXHA 2H94A 1V54B 1V55C 1Y4MA 1PL0A 2FTKA 2IJJA 5L3EA 5L3BA 3LDEA 4J9YB 4P9PA 5KUKA 1QVGU 3CPWU 1R3KC 4RUFA 3FB8C 2HVKC 4UV9A 1XL4A 3EHBB 3AG2C 3E8BA 1K5QA 1KC8W 3JD1A 3OAAG 4KFMA 3CC2V 4JYCA 3JD3A 1OCCB 3R65A 3QNEA 3FYEB 5H9CA 4MVMA 2HG5C 5HFMA 1DF4A 3ETDA 1JQ0A 5KA6A 4KP4A 1ROPA 2XASA 3CCVV 4JTCB 3VBBA 3MHSC 3RVZA 1H8HG 5LHGA 5IYDO 1NH2D 1K7DA 2K1EA 1VQ8V 1AJNA 4MS2A 2A79B 2DYSB 3ZMTA 3SYPA 4WCEV 3F7VC 4I9WA 3T4ZA 3ZMVA 2D3OW 2QM8A 5EC1C 3SYAA 1OCOB 2WLHA 4MTXA 4PDVA 5B1BB 1MOFA 4F4LA 3ZJZA 4JGSA 4LC1A 1GO3F 1NR1A 1JPXA 3QO7A 3ABUA 3X2QC 4MTGA 1YJNV 1Q81W 1QBZA 2OCCC 3LUTB 4MVUA 4TWKA 3OEEG 3OEHG 1FXKB 3LNMB 5EBLC 1PNMA 2W6JG 4TT3G 3ASNB 1QLEC 2NNUA 1GM9A 1K4DC 1NVPB 1QCEA 4HAMA 1OCZC 3D36A 1H2GA 1PNLA 2EIJB 3OR6C 2NLJC 3ASOB 4WFGA 4QNHB 1M57C 5CBFA 4QE9A 4MVSA 3K08A 3STLC 2XOKG 3ABLC 3ZMUA 1N8RW 4UVBA 4JAVA 4MT8A 1VQ7V 2LFSA 1OHHG 1KD1W 1YIJV 1R6NA 4UVCA 4Z1MG 3B8NA 4ZKIA 2EIKC 1HWYA 2ZXWB 1YTFD 4CZZA 4E2LA 2ZD9A 1K92A 2WLNA 3SPJA 5LGNA 4GT1A 3ASNC 4GX2A 3OUFA 2JEUA 4BW5A 3SPIA 3HPLC 2HFEC 3AG1C 1AI4A 3HB3B 1Y66A 3AG3B 3BEHA 3E83A 1AI5A 3GWOA 3FKSG 1M57B 2XAGA 1ORQC 2EILC 3IFXA 1SRYA 2WSSG 3FB6C 1F23A 4PELA 5BZBA 3P32A 5H6RA 2WAMA 3AEIA 3I56V 4GX1A 1RM1C 1S76D 1F51A 1VQNV 5HFLA 1EFRG 2JDIG 3OE7G 1M90W 1K9MW 1NBMG 2P6JA 2X6AA 5LHIA 3OW2U 4MVRA 3MHHC 1NJIW 3ETEA 4J9ZB 1E1QG 2JK5C 1GM8A 2LP7A 5IDJA 1NVPD 5E1AC 1BMFG 3CC7V 1BHAA 4EKWA 4WFAV 4FK5C 2M7WA 2Y48A 4N21A 3ZCCA 2EILB 1VQMV 3TETA 4MVZA 3TK1A 2V1DA 2EINB 1W0KG 1IXMA 1QR9A 3ABKB 4I5SA 1F4NA 5KA5A 3E35A 2Q67A 2QEXV 4QJFB 1JOYA 4Q20A 3RVYA 1KECA 4PDRA 3OMIB 4BIZA 3E2EA 3QO8A 2ITDC 1K5SA 3ZMSA 4GX0A 1AJPA 2PI4A 3ZRVA 1OCZB 3CP1A 4P9OA 2W0FC 5LGUA 2WLIA 2X6CA 1QR8A 4PA4A 4RO2A 2A0LA 4N23A 1Q7YW 3QO5A 2QM7A 3ABLB 1I5YA 5LGTA 3W7XA 1KQSU 3KG2A 4ASUG 3BY6A 1GM7A 5B1OA 3CD6V 4MW3A 1WPXA 3ABKC 4FPPA 3T4DA 1PKXA 3E86A 2Y69B 1M56B 2ATKC 3CC4V 5FL7G 1CEZA 2DYRB 2C2AA 2WLLA 3ABMC 2P7TC 5CN0A 1EBOA 1MG1A 1QLNA 1CP9A 3MD0A 4G27B 1NR7A 1S3JA 2P67A 3JD0A 1OCOC 1G8MA 2XAJA 4JPRA 1YITV 2F43G 4H33A 3FYIB 3ZMZA 1YJ9V 1G4YB 2BOCC 5EK0A 4LBEC 2JJ1G 4CBCA 1Q82W 3ABTA 1L1FA 5IYCO 1DLBA 4R50A 3RW0A 4WFFA 2Y69C 5KUMA 1W2BU 1K73W 5J9PC 4MW8A 2DYRC 4PA3A 4MTOA 3EFFK 3STZC 2OTJV 4MVOA 2WLMA 1DTOA 2AHZA 3ZN0A 1GKFA 1MSWD 1VQLV 1UJWB 2UXXA 4PDMA 2QA4V 4JTAB 1S0VA 5C93A 1J95A 5L3FA 1K4CC 1BL8A 3UM7A 5IY5B 1TUEB 1JJ2U 4UUJC 4MSWC 5B1NA 4X88A 4G2KA 4MVQA 1GK9A 2EIKB 2ZXWC 4MTFA 3B8MA 5B3SB 5LHHA 5IYBO 1YI2V 2EIMC 4FIPC 3FB7C 3CCUV 2WPDG 3P30A 2IJHA 3SYQA 2QTOA 3FB5C 4FJCC 3AG1B 4R7CA 1PD3A 2X7RB 2UXNA 3UKMA 3K0GA 3CCJV 2PI5A 1NKDA 3K06A 2EJRA 4QE7A 3SPHA 1AJQA 1R6KA 4X8AA 3T1CA 5L3GA 4RUEA 1SZTA 1S72V 3JD2A 4P2ZA 1R73A 2IJKA 2W6IG 1SERA 4RQEA 2JEXA 3CXCU 5H6QA 1FXKC 2DW4A 2MK3A 3B77A 2BOBC 2XNDG 4R6ZA 1QLEB 3IC7A 1K34A 2IJIA 3SYCA 4ZBMA 3T2MA 5L3CA 1VQ5V 3CMAV 1THZA 1KP2A 2OTLV 2HLDG 3G6EV 1OCRB 3ML0A 1COWG 2HJFC 4YXWG 1SESA 1YTFB 3LSQA 4HZ3A 2CK3G 4LP8A 3E8FA 1CPYA 2XAHA 3E89A 1QVFU 1W0JG 4U7NA 4DXWA 1I5XA 3TCUA 4XBFA 3ZRWB 1VQ9V 1JX9A 1S77D 4U7OA 2DYSC 2Q6AA 3PJSK 4X89A 4LCUC 3WG7B 1NH2B 4XDKA 3W7TA 2ZDIA 2YSUB 3H01A 5CBHA 5B1AB 2ZDIC 4R8CA 4GX5A 5L3DA 1ENVA 4JYBA 1V55B 1V54C 3OMAB 5B3SC 4RQFA 2B1IA 3ZRWA 5DN6G 2LFRA 3K9AA 2EBOA 3DGEA 4WF9V 3ABMB 4BIUA 1K8AW 1P7BA 1F4MA 1YSCA 3A0RA 4OXSA 5CBGA 4PA7A 3LDDA 2EZOA 4L87A 3AG2B 3OFNG 1M1KW 2IH3C 2B5UA 3CCLV 5LBQA 4WFEA 2EIJC 3M99B 1VQKV 2A9HA 3CCSV 1XL6A 5B1AC 4XDJA 2R9RB 1RPOA 1K33A 3OMNB 2IU3A 4H37A 3ZRSA 2JJ2G 2ZQMA 4G28B 5DM6V 5EC2C 4QPJA 3K79A 2HR3A 1VQ6V 1FXVA 3CCMV 3IGAC 3ETGA 1DF5A 3OUSA 1AR1B 1E1RG 4DO2A 1VQ4V 2X0LA 1Q86W 1GMGA 3CCQV 4JF3A 4PA9A 4WFBV 1WLEA 2HVJC 2QE7G 4WFHA 1B6QA 4JASA 1R3JC 1LNQA 3DTUB 2R9IA 3SPCA 3CMEV 2WLIB 1OCRC 5CMUA 5B1BC 3W7SA 5IY5C 3GB7C 4QPKA 1H8EG 3X2QB 1EZJA 2QKSA 3F7YC 2EZPA 3OR7C 4TSFG 1FXKA 3SPGA 2AHYA 3LDCA 4UV8A 1PNKA 3F5WC 2IW5A 2WLJA 1H38A 3JD4A 2DQ0A 3K0DA 1YHQV 4XDLA 2WLLB 3E8HA 1K97A 1VQPV 2DWEC 5CA3A 3LSSA 1M9NA 3AG4C 3SJQC 3WG7C 5EBMC 5EBWC 3G4SV 3ASOC 2GSMB 1OCCC 4UXNA 1ZWIC 2Z5UA 1KP3A 2YEVA 2XAQA 4FMTA 4QIWF 3NXSA 1AI7A 2V7QG 2P90A 2YEVB 4GCZA 2GHYA 2B1GA 1JCHA 3G71V 3RBZA 4PA6A 3ZIAG 3ZN1A 4BAYA 3I55V 2JIZG 1RPRA 1BHBA 1MABG 3OM3B 3AG4B 1AI6A 3AG3C 3W7UA 4JAUA 3D3IA 1FFTB 5GW7A 4P30A 1FS0G 2KB1A 1E79G 3K3WA 2DWDC 1R3IC 2H8PC 2Q69A 3OGCC 3VOUA 1KKDA 1P4RA 2WWWA 2Q68A 2OCCB 4JTDB 1YJWV 1RM1B 2ZR3A 1JVMA 2ZR2A 4HYOA 4KUMA 1M56C 2X6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MW8 A;  2DYR C;  4PA3 A;  4MTO A;  3EFF K;  3STZ C;  1R3L C;  2IH1 C;  3ASN C;  3K04 A;  3OUF A;  4GX2 A;  3JYC A;  3SPI A;  4MVO A;  1P7B A;  3HPL C;  4OXS A;  2WLM A;  4RAI A;  3SYO A;  2HFE C;  4PA7 A;  1S5H C;  2AHZ A;  3AG1 C;  3LDD A;  3K03 A;  2WLK A;  4PDM A;  2IH3 C;  3BEH A;  3E83 A;  4JTA B;  4PDL A;  4WFE A;  2EIJ C;  2A9H A;  1XL6 A;  1J95 A;  5B1A C;  1K4C C;  4XDJ A;  1BL8 A;  1ORQ C;  2EIL C;  2R9R B;  3IFX A;  4H37 A;  3UM7 A;  3FB6 C;  3ZRS A;  4G28 B;  4UUJ C;  4MSW C;  5BZB A;  3E8G A;  2EIN C;  5EC2 C;  2ITC C;  4X88 A;  4MVQ A;  1V55 C;  4GX1 A;  2ZXW C;  4MTF A;  3IGA C;  3LDE A;  4J9Y B;  4P9P A;  3OUS A;  5KUK A;  2EIM C;  3FB7 C;  1R3K C;  4RUF A;  3FB8 C;  2X6A A;  3SYQ A;  2HVK C;  2QTO A;  3FB5 C;  1XL4 A;  4MVR A;  4PA9 A;  5J9P C;  2HVJ C;  4J9Z B;  2JK5 C;  4R7C A;  4WFH A;  3AG2 C;  3E8B A;  5E1A C;  3UKM A;  5CBG A;  4EKW A;  1R3J C;  1LNQ A;  3K0G A;  3K06 A;  4KFM A;  4QE7 A;  3SPC A;  3SPH A;  2WLI B;  1OCR C;  3R65 A;  4X8A A;  5B1B C;  3T1C A;  3GB7 C;  4MVM A;  4RUE A;  2HG5 C;  5IY5 C;  3TET A;  4MVZ A;  4P2Z A;  2QKS A;  3F7Y C;  3OR7 C;  4JTC B;  3SPG A;  2AHY A;  3LDC A;  3F5W C;  3RVZ A;  2WLJ A;  2BOB C;  3K0D A;  3SPJ A;  2Q67 A;  2WLL B;  4R6Z A;  4XDL A;  2K1E A;  3E8H A;  2DWE C;  3RVY A;  4MS2 A;  4PDR A;  3SYC A;  2A79 B;  4ZBM A;  2ITD C;  3SYP A;  3AG4 C;  4GX0 A;  3SJQ C;  3F7V C;  3T2M A;  4I9W A;  3WG7 C;  5EBM C;  5EBW C;  3T4Z A;  4P9O A;  5EC1 C;  3SYA A;  2W0F C;  3ASO C;  2WLI A;  2X6C A;  2WLH A;  4PA4 A;  4PDV A;  2A0L A;  4RO2 A;  1OCC C;  4F4L A;  2HJF C;  3ZJZ A;  1ZWI C;  3KG2 A;  4HZ3 A;  3X2Q C;  4MTG A;  4LP8 A;  2YEV A;  3E8F A;  2OCC C;  4MW3 A;  3ABK C;  3E89 A;  3LUT B;  3T4D A;  4MVU A;  4DXW A;  4TWK A;  3E86 A;  3LNM B;  2ATK C;  3TCU A;  5EBL C;  2WLL A;  3ABM C;  2P7T C;  1QLE C;  3RBZ A;  4PA6 A;  1K4D C;  2DYS C;  2Q6A A;  3PJS K;  4G27 B;  4X89 A;  4LCU C;  3AG3 C;  1OCZ C;  4XDK A;  3OR6 C;  1OCO C;  2NLJ C;  4WFG A;  4QNH B;  4P30 A;  1M57 C;  5CBF A;  2KB1 A;  4QE9 A;  4MVS A;  5CBH A;  4R8C A;  4GX5 A;  4H33 A;  3K08 A;  3STL C;  3ABL C;  2DWD C;  1R3I C;  4BW5 A;  1G4Y B;  2H8P C;  2BOC C;  2Q69 A;  3OGC C;  3VOU A;  1KKD A;  5EK0 A;  4LBE C;  4CBC A;  2Q68 A;  1V54 C;  4JTD B;  5B3S C;  2EIK C;  4R50 A;  4HYO A;  1JVM A;  3RW0 A;  4WFF A;  2Y69 C;  1M56 C;  5KUM A;  2X6B A;  2ZD9 A;  2WLN A; 
#chains in the Genus database with same CATH topology
 2GUZ A;  4TV8 A;  2HKO A;  1R3L C;  3K04 A;  4I4T A;  4CC6 A;  4X9Q A;  1ZAU A;  2OT5 A;  3SYO A;  3K03 A;  3FAV B;  5IJ0 A;  1XQ8 A;  2WLK A;  1VQO V;  3CRR A;  4EB6 B;  3K58 A;  3CYO A;  1ARO P;  3JAK A;  1FXH A;  1V54 B;  1V55 C;  1PL0 A;  5L3E A;  2LJ2 A;  2YUA A;  4AIL C;  1B04 A;  2YS8 A;  4UV9 A;  4ZHQ A;  2EUL A;  4NXN O;  1NTM H;  2ADQ B;  3JD1 A;  3OAA G;  4LF9 O;  5BR8 O;  2HG5 C;  1DF4 A;  5KA6 A;  5KX5 A;  1H2K A;  1ROP A;  4UCO A;  3CCV V;  4JTC B;  1NT2 B;  4DV5 O;  3OD4 A;  1H2L A;  3CSX A;  3MHS C;  4FFK A;  4K35 A;  3RVZ A;  5A2Q N;  1H8H G;  1LR1 A;  5KHI A;  4O4L A;  2HP8 A;  3ZMT A;  3F7V C;  2D3O W;  4TQD A;  4JI7 B;  4NYK A;  1SF9 A;  5LL6 Y;  1MOF A;  4LC1 A;  1NR1 A;  1YJN V;  1Q81 W;  1MA1 A;  1QBZ A;  1M93 A;  1WNS A;  3T1Y B;  3JAR B;  3OEH G;  4FLW A;  3F5T A;  4BWA A;  4Z1V A;  1GM9 A;  1NVP B;  2N04 A;  1PNL A;  4QNH B;  1KBH A;  5CBF A;  3RYH A;  2DJV A;  3BRC A;  3ZMU A;  1N36 B;  3FFQ A;  3ZHQ A;  2LFS A;  1EN6 A;  4U3J B;  1KD1 W;  2ZE5 A;  3B8N A;  2ZD9 A;  3SPJ A;  4J7J A;  3UT5 B;  5LGN A;  2BTQ A;  2Z0A A;  1JFF A;  4DR3 O;  3OUF A;  2JEU A;  3SPI A;  2Q5Z A;  3HPL C;  3BEH A;  3GWO A;  2ZCE A;  2E75 B;  2EIL C;  3FB6 C;  2XT9 A;  2WAM A;  3IC9 A;  3AEI A;  3H1K H;  5AG2 A;  3EXA A;  1S76 D;  1F51 A;  1EFR G;  1SQB H;  1ZL8 A;  1M90 W;  5LHI A;  3OW2 U;  2DOS A;  1R6T A;  3CC7 V;  4X1K A;  2Y48 A;  5KHK A;  1VQM V;  1XNR B;  3ZS8 C;  3TK1 A;  1EM1 A;  3ABK B;  4B08 A;  1G1X B;  2KG7 B;  5LA6 A;  3ZBH A;  2K9P A;  1JOY A;  4NTW A;  3ZMS A;  2PI4 A;  3CP1 A;  4NXM O;  1QR8 A;  2UUA B;  4X1Y B;  4N23 A;  1H2M A;  2YIA A;  4FFB B;  1I5Y A;  5LGT A;  1KQS U;  2PYL A;  2UXC O;  3BY6 A;  4X62 O;  1GM7 A;  5CA0 A;  2A06 H;  4YJ2 A;  1PKX A;  2Y69 B;  1M56 B;  1Z5V A;  5GTI Z;  2A7W A;  4CC5 A;  1QLN A;  2UXB B;  1CP9 A;  3MD0 A;  4B3T B;  3SDL A;  3K57 A;  4JPR A;  1GN4 A;  3FYI B;  3N27 A;  5H2F Z;  2RMK B;  1Q82 W;  3ABT A;  1L1F A;  5IYC O;  3RW0 A;  2Y69 C;  5KUM A;  1Y6X A;  2WA3 A;  3EFF K;  3HKE B;  2R72 A;  4KHP O;  1FFX A;  3HKE A;  3GVM A;  1GKF A;  1UJW B;  5C93 A;  4BIO A;  3S3X A;  1YDX A;  1QNM A;  5IY5 B;  1TUE B;  4UUJ C;  4LF4 O;  1X59 A;  4X88 A;  4G2K A;  5F2V O;  2KSD A;  4GUN A;  1GK9 A;  4MTF A;  4KL1 A;  5IYB O;  4DV1 B;  2QKA A;  1WP8 A;  3Q4H A;  1PD3 A;  3K0G A;  4UCR A;  2F95 B;  4O4H B;  1AJQ A;  3T1C A;  3G67 A;  2GV9 A;  5JCO C;  1AIL A;  2QM4 A;  3JCU Z;  2W6I G;  4LF6 B;  5IT9 N;  1DK1 A;  4DK1 A;  5H6Q A;  2MK3 A;  2XND G;  5FPR A;  2IJI A;  3ZHV A;  4FM0 A;  5L3C A;  3CMA V;  2HLD G;  1OCR B;  3A0B Z;  1I08 A;  4YXW G;  1SES A;  5LXT A;  1YTF B;  3LSQ A;  2Q8V A;  3I5D A;  4HZ3 A;  3E8F A;  1CPY A;  3E89 A;  1QVF U;  2Y4T A;  5EZY A;  4D7T A;  1US6 A;  4XBF A;  1S77 D;  4GLX A;  2CTP A;  3TXS A;  3N2K A;  2JS3 A;  3HKC B;  4CS2 A;  1VP7 A;  5B1A B;  2ZDI C;  4GX5 A;  4LF4 B;  3HKB A;  1HR0 B;  3ZHU A;  4RQF A;  2B1I A;  1ZSP A;  3DGE A;  1N34 B;  4J11 A;  2Y0P A;  4BIU A;  1N32 O;  4EFB A;  2P06 A;  1K8A W;  5CBG A;  4ZOL A;  3D36 C;  2EZO A;  2IH3 C;  2B5U A;  1Z2G A;  3CCL V;  4FLU A;  3M99 B;  5B1A C;  4U3F H;  3RT3 C;  4XDJ A;  5LP6 B;  2CE4 A;  4H37 A;  3ZRS A;  4YJ2 B;  1I7F A;  1YCI A;  5CB4 A;  4LFB O;  3DXR A;  3IGA C;  1DF5 A;  4FZ1 A;  1VQ4 V;  3FD9 A;  1SKV A;  4LH7 A;  3CCQ V;  1GN6 A;  4WFB V;  4X20 A;  1B6Q A;  4TV9 A;  4JAS A;  3BPZ A;  5J2U B;  1LUW A;  2R9I A;  5B5E Z;  1N4C A;  5IY5 C;  1H8E G;  3S3W A;  1MZE A;  4YIP A;  1MSD A;  1TAE A;  3E22 A;  3TXQ A;  4LF9 B;  3A0H Z;  1FKA O;  4YIO A;  1K97 A;  4NR1 A;  5CA3 A;  1HNX B;  1NTK H;  2D2C B;  3AG4 C;  3JAS A;  3RWR D;  3KZI Z;  3G4S V;  5D5P A;  2Q7E A;  1ZTE A;  2QKC A;  5CA0 B;  2R70 A;  4U3J A;  1S5L Z;  1KP3 A;  3K5N A;  2YEV A;  2FL4 A;  2F1M A;  2YIC A;  3BAA A;  2V7Q G;  2P90 A;  4GCZ A;  3OGI B;  4B3S B;  1BHB A;  1RPR A;  2YIB D;  3AG4 B;  2RNB A;  4FLZ A;  2CTW A;  4JAU A;  1NZ6 A;  1E79 G;  3K3W A;  2LW7 A;  2Q69 A;  3OGC C;  2Q68 A;  3RYC B;  1YJW V;  3DSQ A;  4HYO A;  4KUM A;  2EIM B;  1JA8 A;  1ZUQ A;  4NB5 A;  4I55 B;  1P7G A;  1U96 A;  3WFV A;  3QG5 A;  3W7W A;  2P22 C;  1YZB A;  4K8Z A;  1GTO A;  1WA8 B;  4DW0 A;  3B2E E;  2H94 A;  2FTK A;  2IJJ A;  5L3B A;  1VF6 A;  4J9Y B;  1QVG U;  3CPW U;  1SA0 A;  1WP7 A;  1HNX O;  3AG7 A;  1XL4 A;  2KKW A;  1VIB A;  4DR7 O;  3K9S A;  1KC8 W;  3K5O A;  3AK3 A;  1GH6 A;  4KFM A;  3JD3 A;  1OCC B;  3QNE A;  4K0K O;  2YDE A;  4KP4 A;  2XAS A;  3SJB C;  3VBB A;  1PP9 H;  3U10 A;  5LHG A;  1NH2 D;  2DYS B;  3SYP A;  3FX7 A;  4I9W A;  3VQY A;  3T4Z A;  3D3Q A;  2QM8 A;  5EC1 C;  3SYA A;  1BQ0 A;  4MTX A;  4F4L A;  3RYH B;  4JGS A;  1JPX A;  4MTG A;  5KMG B;  4AQY B;  2VQF O;  3LUT B;  4MVU A;  4TWK A;  3RN4 A;  4PI0 A;  1SS3 A;  4LFB B;  1FYJ A;  4CH4 A;  3ASN B;  1XHX A;  1QLE C;  1XI1 A;  3BA8 A;  1OJH A;  2NNU A;  1IDS A;  1K4D C;  4NTX A;  2RCV A;  1OCZ C;  3DC5 A;  2NLJ C;  3ASO B;  4WFG A;  1M57 C;  4QE9 A;  3JAW B;  3STL C;  2XOK G;  3ABL C;  4UCV A;  4AHC A;  5JH7 B;  4JAV A;  1QQC A;  2YID A;  4UB6 Z;  2ODM A;  4OX9 B;  1YIJ V;  4E4E A;  4UVC A;  4Z1M G;  4ZKI A;  1HWY A;  2ILM A;  1YTF D;  2ZT9 B;  3ASN C;  2P5O A;  1KMI Z;  4TQF A;  4X62 B;  5IWA O;  4F6R B;  3AG1 C;  1Q90 D;  4JI5 B;  4X66 B;  4J10 A;  3HB3 B;  3A2F A;  3FKS G;  2XAG A;  3DC6 A;  3IFX A;  1SRY A;  4DR2 B;  5CB4 B;  3CRC A;  4DR5 B;  4PEL A;  4ZIB A;  5JCO A;  4O2A B;  1S5J A;  2FML A;  4PV1 B;  1VQN V;  1KU9 A;  5HFL A;  2JDI G;  3J80 N;  3MHH C;  4X1I B;  4I9Q A;  1NVP D;  4X1I A;  3U11 A;  3BA9 A;  2M7W A;  2IBZ H;  2EIL B;  3TET A;  2QWR B;  4MVZ A;  2V1D A;  1EN4 A;  4YJ3 B;  4I5S A;  2QWP B;  4FVM A;  2ZIO A;  2VWJ A;  4X65 O;  1QU7 A;  2EJ7 A;  1BZK A;  1XMQ O;  3OMI B;  4BIZ A;  1N33 O;  2QSA A;  3QO8 A;  1K5S A;  1AJP A;  1Q6I A;  4F6R A;  1XNR O;  4P9O A;  2A0L A;  2YXY A;  4IYI A;  2QM7 A;  1IBL O;  3W7X A;  4OX9 O;  4O4I A;  4FFB A;  4MW3 A;  3ABK C;  4FPP A;  4JI6 B;  3T4D A;  2RJZ A;  4B3T O;  4LFC B;  3CC4 V;  5FL7 G;  1CEZ A;  2DYR B;  4GKJ B;  2C2A A;  1UPG A;  3N2G B;  4G27 B;  4GKJ O;  1NR7 A;  2P67 A;  5IJ9 B;  1KUQ A;  1R1B A;  2XAJ A;  3OTO O;  1YJ9 V;  4KHP B;  4CBC A;  2ZNJ A;  3C3T A;  4FLY A;  1RFY A;  4WFF A;  4PA3 A;  3STZ C;  2OTJ V;  4IYH A;  4H0L B;  2AHZ A;  2QA4 V;  3BVO A;  4JTA B;  5EIB D;  1XHZ A;  3APO A;  3HKC A;  5L3F A;  1BL8 A;  1EZV H;  3UM7 A;  2CDY A;  2UUB O;  4MSW C;  4LWS A;  4LF8 O;  2F4V O;  4BW9 A;  5BR8 B;  3B8M A;  2M6Y A;  4Z2W A;  2RN9 A;  3Q4H B;  3L74 H;  5KAF Z;  1YI2 V;  1SQQ H;  4O2B A;  2WPD G;  1IBK B;  2IJH A;  3SYQ A;  3FB5 C;  3RYI A;  4IT5 A;  1ZX3 A;  3AG1 B;  4GKK B;  2X7R B;  1OV9 A;  4BR6 A;  1V9P A;  4B3M O;  1Y76 B;  2GTS A;  3K06 A;  2EJR A;  4QE7 A;  1N34 O;  5L3G A;  2Y4U A;  3G6B A;  1S72 V;  1R73 A;  2L6L A;  2P4V A;  3RYI B;  1QLE B;  1BE3 H;  1K34 A;  2DN9 A;  4ZBM A;  5GON B;  1SC5 B;  3T2M A;  3CX5 F;  3TJT A;  4B3S O;  1XRE A;  1COW G;  5JJJ B;  4LF6 O;  2VQE B;  1G6U A;  3GWK C;  4LP8 A;  4X65 B;  4NKG B;  5LYJ B;  4J42 A;  3TCU A;  3ZRW B;  4U7O A;  3RYF B;  3AK1 A;  1SQX H;  3PJS K;  4X89 A;  4LCU C;  3WG7 B;  1NH2 B;  1IUR A;  5IWA B;  2ZDI A;  2YSU B;  3H01 A;  4R8C A;  2JS5 A;  1TVK A;  4YY3 B;  2XTA A;  1AR4 A;  5B3S C;  5DN6 G;  3CE2 A;  4PA7 A;  3LDD A;  1ZLZ A;  3OFN G;  4OPH A;  1L0N H;  4ZOL B;  3CJH A;  2EIJ C;  3O65 A;  1VQK V;  4LF7 B;  2ZM6 B;  3UO3 A;  2IU3 A;  2ZE7 A;  2JJ2 G;  2LQT A;  4O2A A;  4G28 B;  5TIS Z;  3K79 A;  2HR3 A;  1VQ6 V;  2JGD B;  3E22 B;  2YI8 A;  3JAR A;  5LYJ A;  1Q86 W;  3WB2 A;  4JF3 A;  4PA9 A;  5IJ9 A;  2HVJ C;  1RSO B;  3CEI A;  1O9H A;  5J2U A;  3CRA A;  2QE7 G;  4WFH A;  3H1L H;  4KXR A;  2L35 A;  2PTM A;  1R3J C;  1LNQ A;  2AGA A;  3W7S A;  1AP5 A;  4QPK A;  2UU9 B;  3X2Q B;  4JI0 B;  2QKS A;  3SPG A;  2AHY A;  4UV8 A;  2ZM6 O;  4H44 B;  2WLJ A;  1H38 A;  1BSM A;  3UO2 A;  5JVD B;  2DQ0 A;  3K0D A;  4EEQ A;  1BQZ A;  2WLL B;  2N05 A;  3E8H A;  1VQP V;  1RP3 B;  5EBM C;  3ASO C;  4FM1 A;  2CGO A;  1OCC C;  1XEQ A;  1ZWI C;  4JI4 B;  2Z5U A;  4IHJ B;  3KCX A;  5CA1 A;  1EN5 A;  2XAQ A;  5BXZ A;  4FMT A;  4JYY A;  1AI7 A;  4LFC O;  4DR6 B;  4ZI7 B;  2GHY A;  1JCH A;  4BAY A;  3I55 V;  1MAB G;  4J41 A;  1TUB B;  1AI6 A;  2ZE6 A;  3AG3 C;  3N2G A;  1FFT B;  5GW7 A;  4P30 A;  1FS0 G;  4TV9 B;  4EB6 A;  5EYP A;  4JYA O;  1R3I C;  5JQG B;  3CRM A;  2LGW A;  3VOU A;  5IE9 A;  1P4R A;  2WWW A;  4JTD B;  2BTO A;  2ZR2 A;  1BCC H;  2DQ3 A;  4X66 O;  1OZ0 A;  3EVK A;  2F66 C;  1N0N A;  1SET A;  2YXL A;  1S5H C;  3CCE V;  1IBK O;  3JCZ A;  4B7E A;  2DMX A;  2PYJ A;  1NQT A;  3L73 H;  2IU0 A;  2UU9 O;  2E3C A;  4IGG A;  1FD9 A;  1K3E A;  3E8G A;  2EIN C;  1Y4M A;  1HP8 A;  5J2T A;  3HR0 A;  4YHH O;  1VF6 C;  4DR2 O;  3FB8 C;  4DR5 O;  2HVK C;  2IM9 A;  1SA0 B;  3EHB B;  3JSL A;  3E8B A;  4O4J B;  4JYC A;  5H9C A;  2QR4 A;  3FYE B;  2E5L B;  5CA1 B;  1JQ0 A;  2EX3 A;  3VQV A;  5KMG A;  2Y0I A;  5EZY B;  4DRX A;  1AJN A;  4J80 A;  2XHB A;  1HNZ B;  1B06 A;  2QDO A;  1PV0 A;  2ZIN A;  4PDV A;  5B1B B;  3CWB H;  3X2Q C;  3ABU A;  3ETQ A;  3CXH F;  2OCC C;  3LNN A;  3OTO B;  3JSN A;  3OEE G;  4X64 B;  1FXK B;  3T1Y O;  5EBL C;  1I94 O;  1PNM A;  2W6J G;  3P3N A;  5J2T B;  5KAI Z;  3B09 A;  1QCE A;  4LF8 B;  2VWK A;  3SR2 C;  4CH3 A;  3ZX6 A;  3D36 A;  3AK2 A;  4MVS A;  1N8R W;  2LGQ A;  4MT8 A;  2V4D A;  1AP6 A;  3U0Z A;  1VQ7 V;  1OHH G;  2OYQ A;  3J81 N;  2PGG A;  1Y67 A;  1R6N A;  1HW7 A;  2ZXW B;  4E2L A;  1IZ3 A;  1O9G A;  4BW5 A;  2OIG A;  5KLV H;  1AI4 A;  3AG3 B;  3E83 A;  1VEW A;  1AI5 A;  1M4U A;  1M57 B;  4DV0 O;  2WSS G;  1F23 A;  1GN2 A;  4J7Z A;  3D8C A;  5BZB A;  1YXB A;  1FPO A;  2E74 B;  4GX1 A;  1RM1 C;  4LNU A;  5IYZ B;  1NTZ H;  4DV6 O;  3OE7 G;  4DR4 O;  1K9M W;  1NBM G;  2FB5 A;  2P6J A;  4MVR A;  4IL6 Z;  1NJI W;  4J9Z B;  2JK5 C;  2LP7 A;  1YEW A;  3RYF A;  1FAF A;  5E1A C;  4WFA V;  2BCC H;  2UUA O;  4OPA A;  2QWN B;  3RFR A;  1KKC A;  2EIN B;  5D5Q A;  4JI1 B;  1XMQ B;  4NXN B;  3MAQ A;  1WA8 A;  4JI2 B;  4J7K A;  5JVD A;  5KA5 A;  2QGN A;  4I4T B;  2Q67 A;  2QEX V;  4Q20 A;  4JI2 O;  3RVY A;  1SZX A;  4JI3 O;  4UCT A;  5K1P A;  4GX0 A;  3ZHR A;  2W0F C;  5LGU A;  2X6C A;  4PA4 A;  4QGP A;  1VAR A;  3UQ8 A;  3CJH B;  3QO5 A;  1Y74 A;  3L71 H;  4UFZ A;  3KG2 A;  1MMM A;  5LP6 A;  5B1O A;  1TA8 A;  1WPX A;  2ZE8 A;  2FKX A;  1XUQ A;  3E86 A;  2BSK A;  2ATK C;  1J5E O;  2P4K A;  2WLL A;  2UXD O;  2P7T C;  3QVN A;  1HNZ O;  5CN0 A;  3SGI A;  4AI8 A;  4JV5 O;  3SJA C;  1S3J A;  1OCO C;  1G8M A;  4LR3 A;  4DV3 O;  1L0L H;  1SQG A;  1YIT V;  4H33 A;  4WBN B;  3ZMZ A;  3H1J H;  2BOC C;  5EK0 A;  2E5L O;  2JJ1 G;  4DV4 O;  2G38 A;  1DLB A;  4R50 A;  3MDS A;  3VQX A;  1K73 W;  5J9P C;  4MW8 A;  2DYR C;  4TUY A;  1SQP H;  4MVO A;  4PI2 A;  4X20 B;  4JZ2 A;  3JAL A;  3ZN0 A;  4ZHQ B;  3C90 A;  1KYO F;  4FZ0 A;  4D6T H;  4PDM A;  5FLX N;  1S0V A;  1J5E B;  1BS3 A;  4O4J A;  4GYC B;  1J95 A;  2GBO A;  5BMV A;  2OCH A;  5B1N A;  3HKD A;  4HNA B;  3A8T A;  4I50 A;  2ZXW C;  2CTR A;  3FB7 C;  4FIP C;  3P30 A;  5FNV B;  2AZ0 A;  3N2K B;  4FJC C;  4R7C A;  5ITZ B;  3CCJ V;  5JH7 A;  2HJD A;  2FYU H;  3SPH A;  1R6K A;  1AR5 A;  2CUG A;  2NN4 A;  3JD2 A;  4DUY O;  2PZS A;  2IJK A;  1SER A;  2AZ2 A;  4L8J A;  3WU2 Z;  2JEX A;  4RQE A;  3CXC U;  3B77 A;  4K3A A;  1P84 F;  1N0J A;  2BOB C;  4PD4 F;  4DV5 B;  3IC7 A;  2Q0A A;  3SYC A;  5E79 Z;  1GN3 A;  1THZ A;  1TGO A;  2OTL V;  3G6E V;  3ML0 A;  2JGD A;  2CK3 G;  4I0X B;  4W4K A;  4LFA O;  1ZL8 B;  5H5N A;  1W0J G;  4U7N A;  3HKD B;  4DXW A;  1GRJ A;  2N74 A;  2B9Z A;  3ZHS A;  1JX9 A;  1VF5 B;  1SQV H;  5KHJ A;  2YIB A;  1H2S B;  3W7T A;  5CBH A;  3K5L A;  4JI8 O;  4JI5 O;  5L3D A;  4JYB A;  2ARH A;  5DEC A;  3OMA B;  4JI7 O;  3ZRW A;  2NR5 A;  4F6E A;  2UUC B;  3K9A A;  2EBO A;  4WF9 V;  4OGQ B;  3ABM B;  4B7K A;  1XDC A;  1P7B A;  1F4M A;  4OXS A;  3A0R A;  5C8Y A;  1WB8 A;  2MW2 B;  4LFA B;  3AG2 B;  1M1K W;  5LMN B;  5LBQ A;  2E76 B;  2A9H A;  1Q6H A;  3T1H O;  2RDC A;  2R9R B;  1K33 A;  3OMN B;  1B3Q A;  1D2D A;  1QHT A;  4UCS A;  2ZQM A;  3CHX A;  4DV4 B;  4FLV A;  3QTC A;  1XBL A;  4QPJ A;  5JWP A;  1FXV A;  3CCM V;  1JR9 A;  3ETG A;  1WN7 A;  1E1R G;  2Q0O C;  2X0L A;  1Q6U A;  5LOV A;  1WLE A;  5GTH Z;  3DTU B;  2CGN A;  5B1B C;  5CMU A;  2LO1 A;  2Q73 A;  2EZP A;  3WB1 A;  3BAB A;  2CH7 B;  3F5W C;  3JD4 A;  4JI3 B;  3BFR A;  3VQW A;  2DWE C;  3LSS A;  4I7Z B;  1M9N A;  4DUZ B;  4JZG A;  3SJQ C;  1D5N A;  5EBW C;  2PUS A;  4YHH B;  2GSM B;  1IXB A;  4UXN A;  1L8D A;  1YVW A;  5BY1 A;  3NXS A;  1XOU A;  3L75 H;  2UXC B;  3L70 H;  1X4T A;  2B1G A;  2VRZ A;  1Q3E A;  3RBZ A;  4PA6 A;  3ZIA G;  3ZN1 A;  2JIZ G;  4DRX B;  4O4L B;  4CS3 A;  2JVD A;  3W7U A;  3J7A U;  3ZED A;  3O9O A;  2KB1 A;  3L72 H;  3JAT B;  5JJE B;  2WA4 A;  4O4I B;  5BMV B;  2H8P C;  3BCC H;  1KKD A;  1P49 A;  2ADP A;  1CXZ B;  2OCC B;  3BHP A;  2GUZ B;  1RM1 B;  1I0H A;  1WPB A;  3JAL B;  2BE3 A;  2IH1 C;  3IJ4 A;  3JYC A;  4UVA A;  4RAI A;  4DR3 B;  4I55 A;  4PDL A;  1Y76 A;  1HNW O;  4NVP A;  4HBN A;  3ZRX A;  2Z3Y A;  2ZKO A;  3UCS C;  3CCR V;  4NXM B;  2ETN A;  4TOI A;  2XAF A;  2YXH A;  3LSU A;  4K8X A;  2ITC C;  3B40 A;  3JAK B;  1IX9 A;  3LDE A;  5FNV A;  4P9P A;  5KUK A;  4DV0 B;  1Q43 A;  1R3K C;  1BT8 A;  4RUF A;  3FAV A;  2OWO A;  3AG2 C;  1K5Q A;  3CC2 V;  3R65 A;  1DGS A;  4MVM A;  1D5A A;  5HFM A;  4CH5 A;  3ETD A;  2QJ1 A;  5JJN B;  5A9G A;  1AB3 A;  2GDS A;  5IYD O;  1K7D A;  2K1E A;  1VQ8 V;  4MS2 A;  4LF5 B;  2A79 B;  4C7U A;  4WCE V;  2UXD B;  3ZMV A;  3ICX A;  1OCO B;  2WLH A;  3JAT A;  1I94 B;  3ZJZ A;  4I0X A;  2QWQ B;  1GO3 F;  5KX5 B;  2F23 A;  3QO7 A;  2XUM A;  1PM9 A;  4D7S A;  3LNM B;  3KCY A;  2CH7 A;  1T5E A;  4TT3 G;  1U97 A;  3OT7 A;  1Q5O A;  4O2B B;  2UXB O;  4HAM A;  3JAW A;  2Q7H A;  1H2G A;  3JAS B;  2EIJ B;  3OR6 C;  4PJ0 Z;  1A32 A;  3K08 A;  5B66 Z;  4UVB A;  2OIE A;  1NU1 H;  1GAX A;  4IHJ A;  1AVM A;  2UUC O;  2EIK C;  1JJO A;  5LMU O;  4B3R O;  4CZZ A;  1K92 A;  2WLN A;  2PY5 A;  4GT1 A;  3WB0 A;  4GX2 A;  2HFE C;  5LOV B;  2A3Q A;  1HDJ A;  1Y66 A;  4NTY A;  3T1H B;  1SQF A;  2YI9 A;  2CAZ C;  1ORQ C;  1UFI A;  3C3S A;  2VS0 A;  1WB7 A;  2JRI A;  2Q4P A;  4JV5 B;  3P32 A;  5H6R A;  4FM2 A;  3I56 V;  4DV2 B;  1JFF B;  1IVS A;  2X6A A;  5EIB C;  5C8Y B;  4DV1 O;  3ETE A;  1E1Q G;  1GM8 A;  5IDJ A;  1BMF G;  1BHA A;  1XNQ B;  4EKW A;  4FK5 C;  1WJZ A;  4RWU A;  4N21 A;  3ZCC A;  3CRQ A;  3CB2 A;  1Y74 B;  1W0K G;  4CH6 A;  1IXM A;  4DR4 B;  1QR9 A;  1F4N A;  4I50 B;  2W0X A;  3E35 A;  4B3M B;  2PF4 E;  4QJF B;  1XMO B;  1KEC A;  2VQE O;  4PDR A;  3E2E A;  2ITD C;  1JMK C;  3ZRV A;  1OCZ B;  2R9A A;  2WLI A;  2QTS A;  4RO2 A;  1Q7Y W;  3ABL B;  1HNW B;  4DK0 A;  2CTQ A;  4ASU G;  1PPJ H;  3SJC C;  2UUB B;  3CD6 V;  2GTA A;  4PHZ A;  3KKY A;  4DYL A;  3ABM C;  1LUV A;  4JI4 O;  1EBO A;  4DV7 B;  1MG1 A;  5FPO A;  3TGU H;  3JD0 A;  5EYP B;  1IBM O;  2HEP A;  1H2N A;  4DR1 B;  2F43 G;  1Q8I A;  3H1H H;  1G4Y B;  1PL4 A;  1BGY H;  4LBE C;  4LH6 A;  2HHH O;  2ZIM A;  4DR1 O;  4ABM A;  4TV8 B;  1VMG A;  3RGB A;  4YJ3 A;  1W2B U;  4MTO A;  1N33 B;  3P3P A;  1RSO A;  2WLM A;  1Z5W A;  1DTO A;  1MSW D;  4ICG A;  4DV3 B;  1VQL V;  2UXX A;  4X1K B;  1K4C C;  4HNA A;  5JQG A;  4DV7 O;  1JJ2 U;  4X1Y A;  1YF2 A;  1FJG B;  4DUZ O;  4MVQ A;  5B3S B;  2EIK B;  5LHH A;  4CS4 A;  4JI8 B;  4FLX A;  2RQ6 A;  2EIM C;  3CCU V;  4UCU A;  3UT5 A;  4Q6G A;  4LF7 O;  2QTO A;  4K0K B;  2UXN A;  5GON A;  3UKM A;  2PI5 A;  1NKD A;  3HKB B;  2QWO B;  2H3O A;  4X8A A;  2O57 A;  3G80 A;  1SZT A;  1TVK B;  4RUE A;  4JI1 O;  4P2Z A;  4A5U B;  3IAY A;  1FXK C;  2JGU A;  2DW4 A;  3RYC A;  5KHG A;  4DW1 A;  3H1I H;  4R6Z A;  3ZHT A;  3M7M X;  1NS1 A;  2YC0 A;  1XNQ O;  4UB8 Z;  1FFX B;  1VQ5 V;  4O4H A;  1KP2 A;  5LXT B;  4WBN A;  2HJF C;  3DXR B;  4DR7 B;  3OTF A;  4DV6 B;  2XAH A;  4LWS B;  4TUY B;  1XMO O;  1I5X A;  1VQ9 V;  2Q9L A;  3H9V A;  3R66 A;  2ZNI A;  2DYS C;  2Q6A A;  4X64 O;  4XDK A;  3K59 A;  1W59 A;  4EFE A;  4AQY O;  5LP6 C;  4W4L A;  1ENV A;  3M8A A;  4DR6 O;  1F7Y A;  1FJG O;  1N36 O;  3K5M A;  1V55 B;  1V54 C;  4GZR B;  3B4S A;  2BTQ B;  2LFR A;  1M5I A;  4LNU B;  5IYZ A;  4H13 B;  3QF7 A;  1YSC A;  4IIJ B;  2KQX A;  4L87 A;  5K1X A;  4JYA B;  4WFE A;  3CCS V;  1XL6 A;  1RPO A;  3NR7 A;  1MZF A;  4JI0 O;  5DM6 V;  3CS5 A;  5EC2 C;  4FLT A;  1XIL A;  3OUS A;  2VQF B;  1AR1 B;  5LMU B;  4B3R B;  1URF A;  4DO2 A;  4JAA A;  1GMG A;  2F4V B;  3THO A;  3SPC A;  3CME V;  2WLI B;  1OCR C;  3GB7 C;  4YY3 O;  2LW1 A;  1EZJ A;  4GKK O;  4TSF G;  3F7Y C;  3OR7 C;  5KHH A;  5DED A;  1FXK A;  1VF7 A;  3LDC A;  1PNK A;  2HHH B;  2IW5 A;  2KG7 A;  5LA6 B;  1YHQ V;  4XDL A;  5IJ0 B;  1KB9 F;  3WG7 C;  1WAZ A;  3L9D A;  2DE0 X;  1MNG A;  2F93 B;  5LMN O;  1NI8 A;  2Q7G A;  1IBM B;  2AXT Z;  4LF5 O;  4QIW F;  1IBL B;  2YEV B;  3JAM N;  3G71 V;  4IIJ A;  2BSK B;  4JI6 O;  5ITZ A;  1HR0 O;  3OM3 B;  3APQ A;  3D3I A;  1TUB A;  4DV2 O;  2AW9 A;  2DWD C;  4DUY B;  4ZI7 A;  1N32 B;  3PN1 A;  2ZR3 A;  1JVM A;  1M56 C;  2X6B A; 
#chains in the Genus database with same CATH homology
 2DQ3 A;  2EIM B;  1OZ0 A;  2HKO A;  1R3L C;  2IH1 C;  3K04 A;  1SET A;  3JYC A;  4UVA A;  4RAI A;  2OT5 A;  3SYO A;  1S5H C;  3CCE V;  3K03 A;  3WFV A;  3JCZ A;  2WLK A;  1VQO V;  4PDL A;  3W7W A;  1NQT A;  3CYO A;  3ZRX A;  2Z3Y A;  2IU0 A;  3CCR V;  1ARO P;  1GTO A;  1K3E A;  2XAF A;  3E8G A;  2EIN C;  2ITC C;  1FXH A;  2H94 A;  1V54 B;  1V55 C;  1Y4M A;  1PL0 A;  2FTK A;  2IJJ A;  5L3E A;  5L3B A;  3LDE A;  4J9Y B;  4P9P A;  5KUK A;  1QVG U;  3CPW U;  1R3K C;  4RUF A;  3FB8 C;  2HVK C;  4UV9 A;  1XL4 A;  3EHB B;  3AG2 C;  3E8B A;  1K5Q A;  1KC8 W;  3JD1 A;  3OAA G;  4KFM A;  3CC2 V;  4JYC A;  3JD3 A;  1OCC B;  3R65 A;  3QNE A;  3FYE B;  5H9C A;  4MVM A;  2HG5 C;  5HFM A;  1DF4 A;  3ETD A;  1JQ0 A;  5KA6 A;  4KP4 A;  1ROP A;  2XAS A;  3CCV V;  4JTC B;  3VBB A;  3MHS C;  3RVZ A;  1H8H G;  5LHG A;  5IYD O;  1NH2 D;  1K7D A;  2K1E A;  1VQ8 V;  1AJN A;  4MS2 A;  2A79 B;  2DYS B;  3ZMT A;  3SYP A;  4WCE V;  3F7V C;  4I9W A;  3T4Z A;  3ZMV A;  2D3O W;  2QM8 A;  5EC1 C;  3SYA A;  1OCO B;  2WLH A;  4MTX A;  4PDV A;  5B1B B;  1MOF A;  4F4L A;  3ZJZ A;  4JGS A;  4LC1 A;  1GO3 F;  1NR1 A;  1JPX A;  3QO7 A;  3ABU A;  3X2Q C;  4MTG A;  1YJN V;  1Q81 W;  1QBZ A;  2OCC C;  3LUT B;  4MVU A;  4TWK A;  3OEE G;  3OEH G;  1FXK B;  3LNM B;  5EBL C;  1PNM A;  2W6J G;  4TT3 G;  3ASN B;  1QLE C;  2NNU A;  1GM9 A;  1K4D C;  1NVP B;  1QCE A;  4HAM A;  1OCZ C;  3D36 A;  1H2G A;  1PNL A;  2EIJ B;  3OR6 C;  2NLJ C;  3ASO B;  4WFG A;  4QNH B;  1M57 C;  5CBF A;  4QE9 A;  4MVS A;  3K08 A;  3STL C;  2XOK G;  3ABL C;  3ZMU A;  1N8R W;  4UVB A;  4JAV A;  4MT8 A;  1VQ7 V;  2LFS A;  1OHH G;  1KD1 W;  1YIJ V;  1R6N A;  4UVC A;  4Z1M G;  3B8N A;  4ZKI A;  2EIK C;  1HWY A;  2ZXW B;  1YTF D;  4CZZ A;  4E2L A;  2ZD9 A;  1K92 A;  2WLN A;  3SPJ A;  5LGN A;  4GT1 A;  3ASN C;  4GX2 A;  3OUF A;  2JEU A;  4BW5 A;  3SPI A;  3HPL C;  2HFE C;  3AG1 C;  1AI4 A;  3HB3 B;  1Y66 A;  3AG3 B;  3BEH A;  3E83 A;  1AI5 A;  3GWO A;  3FKS G;  1M57 B;  2XAG A;  1ORQ C;  2EIL C;  3IFX A;  1SRY A;  2WSS G;  3FB6 C;  1F23 A;  4PEL A;  5BZB A;  3P32 A;  5H6R A;  2WAM A;  3AEI A;  3I56 V;  4GX1 A;  1RM1 C;  1S76 D;  1F51 A;  1VQN V;  5HFL A;  1EFR G;  2JDI G;  3OE7 G;  1M90 W;  1K9M W;  1NBM G;  2P6J A;  2X6A A;  5LHI A;  3OW2 U;  4MVR A;  3MHH C;  1NJI W;  3ETE A;  4J9Z B;  1E1Q G;  2JK5 C;  1GM8 A;  2LP7 A;  5IDJ A;  1NVP D;  5E1A C;  1BMF G;  3CC7 V;  1BHA A;  4EKW A;  4WFA V;  4FK5 C;  2M7W A;  2Y48 A;  4N21 A;  3ZCC A;  2EIL B;  1VQM V;  3TET A;  4MVZ A;  3TK1 A;  2V1D A;  2EIN B;  1W0K G;  1IXM A;  1QR9 A;  3ABK B;  4I5S A;  1F4N A;  5KA5 A;  3E35 A;  2Q67 A;  2QEX V;  4QJF B;  1JOY A;  4Q20 A;  3RVY A;  1KEC A;  4PDR A;  3OMI B;  4BIZ A;  3E2E A;  3QO8 A;  2ITD C;  1K5S A;  3ZMS A;  4GX0 A;  1AJP A;  2PI4 A;  3ZRV A;  1OCZ B;  3CP1 A;  4P9O A;  2W0F C;  5LGU A;  2WLI A;  2X6C A;  1QR8 A;  4PA4 A;  4RO2 A;  2A0L A;  4N23 A;  1Q7Y W;  3QO5 A;  2QM7 A;  3ABL B;  1I5Y A;  5LGT A;  3W7X A;  1KQS U;  3KG2 A;  4ASU G;  3BY6 A;  1GM7 A;  5B1O A;  3CD6 V;  4MW3 A;  1WPX A;  3ABK C;  4FPP A;  3T4D A;  1PKX A;  3E86 A;  2Y69 B;  1M56 B;  2ATK C;  3CC4 V;  5FL7 G;  1CEZ A;  2DYR B;  2C2A A;  2WLL A;  3ABM C;  2P7T C;  5CN0 A;  1EBO A;  1MG1 A;  1QLN A;  1CP9 A;  3MD0 A;  4G27 B;  1NR7 A;  1S3J A;  2P67 A;  3JD0 A;  1OCO C;  1G8M A;  2XAJ A;  4JPR A;  1YIT V;  2F43 G;  4H33 A;  3FYI B;  3ZMZ A;  1YJ9 V;  1G4Y B;  2BOC C;  5EK0 A;  4LBE C;  2JJ1 G;  4CBC A;  1Q82 W;  3ABT A;  1L1F A;  5IYC O;  1DLB A;  4R50 A;  3RW0 A;  4WFF A;  2Y69 C;  5KUM A;  1W2B U;  1K73 W;  5J9P C;  4MW8 A;  2DYR C;  4PA3 A;  4MTO A;  3EFF K;  3STZ C;  2OTJ V;  4MVO A;  2WLM A;  1DTO A;  2AHZ A;  3ZN0 A;  1GKF A;  1MSW D;  1VQL V;  1UJW B;  2UXX A;  4PDM A;  2QA4 V;  4JTA B;  1S0V A;  5C93 A;  1J95 A;  5L3F A;  1K4C C;  1BL8 A;  3UM7 A;  5IY5 B;  1TUE B;  1JJ2 U;  4UUJ C;  4MSW C;  5B1N A;  4X88 A;  4G2K A;  4MVQ A;  1GK9 A;  2EIK B;  2ZXW C;  4MTF A;  3B8M A;  5B3S B;  5LHH A;  5IYB O;  1YI2 V;  2EIM C;  4FIP C;  3FB7 C;  3CCU V;  2WPD G;  3P30 A;  2IJH A;  3SYQ A;  2QTO A;  3FB5 C;  4FJC C;  3AG1 B;  4R7C A;  1PD3 A;  2X7R B;  2UXN A;  3UKM A;  3K0G A;  3CCJ V;  2PI5 A;  1NKD A;  3K06 A;  2EJR A;  4QE7 A;  3SPH A;  1AJQ A;  1R6K A;  4X8A A;  3T1C A;  5L3G A;  4RUE A;  1SZT A;  1S72 V;  3JD2 A;  4P2Z A;  1R73 A;  2IJK A;  2W6I G;  1SER A;  4RQE A;  2JEX A;  3CXC U;  5H6Q A;  1FXK C;  2DW4 A;  2MK3 A;  3B77 A;  2BOB C;  2XND G;  4R6Z A;  1QLE B;  3IC7 A;  1K34 A;  2IJI A;  3SYC A;  4ZBM A;  3T2M A;  5L3C A;  1VQ5 V;  3CMA V;  1THZ A;  1KP2 A;  2OTL V;  2HLD G;  3G6E V;  1OCR B;  3ML0 A;  1COW G;  2HJF C;  4YXW G;  1SES A;  1YTF B;  3LSQ A;  4HZ3 A;  2CK3 G;  4LP8 A;  3E8F A;  1CPY A;  2XAH A;  3E89 A;  1QVF U;  1W0J G;  4U7N A;  4DXW A;  1I5X A;  3TCU A;  4XBF A;  3ZRW B;  1VQ9 V;  1JX9 A;  1S77 D;  4U7O A;  2DYS C;  2Q6A A;  3PJS K;  4X89 A;  4LCU C;  3WG7 B;  1NH2 B;  4XDK A;  3W7T A;  2ZDI A;  2YSU B;  3H01 A;  5CBH A;  5B1A B;  2ZDI C;  4R8C A;  4GX5 A;  5L3D A;  1ENV A;  4JYB A;  1V55 B;  1V54 C;  3OMA B;  5B3S C;  4RQF A;  2B1I A;  3ZRW A;  5DN6 G;  2LFR A;  3K9A A;  2EBO A;  3DGE A;  4WF9 V;  3ABM B;  4BIU A;  1K8A W;  1P7B A;  1F4M A;  1YSC A;  3A0R A;  4OXS A;  5CBG A;  4PA7 A;  3LDD A;  2EZO A;  4L87 A;  3AG2 B;  3OFN G;  1M1K W;  2IH3 C;  2B5U A;  3CCL V;  5LBQ A;  4WFE A;  2EIJ C;  3M99 B;  1VQK V;  2A9H A;  3CCS V;  1XL6 A;  5B1A C;  4XDJ A;  2R9R B;  1RPO A;  1K33 A;  3OMN B;  2IU3 A;  4H37 A;  3ZRS A;  2JJ2 G;  2ZQM A;  4G28 B;  5DM6 V;  5EC2 C;  4QPJ A;  3K79 A;  2HR3 A;  1VQ6 V;  1FXV A;  3CCM V;  3IGA C;  3ETG A;  1DF5 A;  3OUS A;  1AR1 B;  1E1R G;  4DO2 A;  1VQ4 V;  2X0L A;  1Q86 W;  1GMG A;  3CCQ V;  4JF3 A;  4PA9 A;  4WFB V;  1WLE A;  2HVJ C;  2QE7 G;  4WFH A;  1B6Q A;  4JAS A;  1R3J C;  1LNQ A;  3DTU B;  2R9I A;  3SPC A;  3CME V;  2WLI B;  1OCR C;  5CMU A;  5B1B C;  3W7S A;  5IY5 C;  3GB7 C;  4QPK A;  1H8E G;  3X2Q B;  1EZJ A;  2QKS A;  3F7Y C;  2EZP A;  3OR7 C;  4TSF G;  1FXK A;  3SPG A;  2AHY A;  3LDC A;  4UV8 A;  1PNK A;  3F5W C;  2IW5 A;  2WLJ A;  1H38 A;  3JD4 A;  2DQ0 A;  3K0D A;  1YHQ V;  4XDL A;  2WLL B;  3E8H A;  1K97 A;  1VQP V;  2DWE C;  5CA3 A;  3LSS A;  1M9N A;  3AG4 C;  3SJQ C;  3WG7 C;  5EBM C;  5EBW C;  3G4S V;  3ASO C;  2GSM B;  1OCC C;  4UXN A;  1ZWI C;  2Z5U A;  1KP3 A;  2YEV A;  2XAQ A;  4FMT A;  4QIW F;  3NXS A;  1AI7 A;  2V7Q G;  2P90 A;  2YEV B;  4GCZ A;  2GHY A;  2B1G A;  1JCH A;  3G71 V;  3RBZ A;  4PA6 A;  3ZIA G;  3ZN1 A;  4BAY A;  3I55 V;  2JIZ G;  1RPR A;  1BHB A;  1MAB G;  3OM3 B;  3AG4 B;  1AI6 A;  3AG3 C;  3W7U A;  4JAU A;  3D3I A;  1FFT B;  5GW7 A;  4P30 A;  1FS0 G;  2KB1 A;  1E79 G;  3K3W A;  2DWD C;  1R3I C;  2H8P C;  2Q69 A;  3OGC C;  3VOU A;  1KKD A;  1P4R A;  2WWW A;  2Q68 A;  2OCC B;  4JTD B;  1YJW V;  1RM1 B;  2ZR3 A;  1JVM A;  2ZR2 A;  4HYO A;  4KUM A;  1M56 C;  2X6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...