3OGCC

Kcsa e71a variant in presence of na+
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVATATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for selectivity-inactivation coupling in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3ogcC00
4GX5A 4MVSA 3RVZA 4H33A 4G28B 2WLJA 1K4DC 2AHZA 2YEVA 4J9ZB 2A79B 5EBWC 4MW8A 2W0FC 3K08A 2ZD9A 3K06A 3T2MA 3JYCA 3AG4C 1R3KC 2WLLA 2EIMC 3F7VC 2A9HA 1M57C 3E8FA 3F5WC 3UKMA 3SJQC 2Q69A 4PA7A 2QKSA 2DWDC 3K0DA 4RUFA 4RAIA 5CBHA 4P30A 3OUFA 4WFGA 2HVJC 4MS2A 3X2QC 3GB7C 4EKWA 4LP8A 4QNHB 4R8CA 5KUKA 3E8HA 3HPLC 4P9OA 3UM7A 4PDRA 3SPIA 3WG7C 2Q68A 4PDMA 1V55C 2ITDC 1K4CC 3TETA 3AG1C 1LNQA 1M56C 1JVMA 2HFEC 2WLNA 1ZWIC 3K04A 5EBLC 2Y69C 4XDLA 3T4DA 3OUSA 4MVUA 1KKDA 2EINC 3AG2C 4WFFA 1R3JC 4R7CA 2QTOA 3FB6C 4XDJA 3SYAA 3IFXA 4JTDB 2DYSC 4PA4A 4P2ZA 2DYRC 4GX2A 2EIJC 2WLMA 4R50A 1OCCC 3E8GA 3OR6C 3ZJZA 2BOCC 4F4LA 4WFHA 4KFMA 2HJFC 2A0LA 4ZBMA 3STLC 2WLIB 4H37A 5KUMA 4RO2A 4PDLA 5B3SC 5J9PC 1BL8A 2EIKC 2X6BA 3SPGA 1QLEC 4CBCA 3T1CA 4J9YB 3FB8C 2WLKA 4OXSA 2NLJC 3VOUA 4QE7A 5BZBA 1G4YB 5CBGA 3SYQA 1OCZC 2ITCC 4TWKA 2Q67A 2WLLB 2Q6AA 2X6CA 4MTGA 1XL4A 3STZC 4JTAB 1V54C 3SPJA 4PA9A 2KB1A 4LCUC 4MVZA 2JK5C 4HZ3A 1ORQC 4WFEA 3E8BA 4X88A 2HG5C 4MVRA 3RVYA 1XL6A 3LUTB 3SYCA 3LDEA 1P7BA 3ABKC 5IY5C 3BEHA 3TCUA 1OCOC 4MSWC 5EC1C 3SYOA 5EC2C 3SPCA 3FB7C 4RUEA 5EK0A 1S5HC 4UUJC 3LNMB 3E83A 4QE9A 5CBFA 4GX0A 3OR7C 2IH3C 2ZXWC 2ATKC 4X89A 4XDKA 3FB5C 2AHYA 3LDDA 2H8PC 4HYOA 3K03A 3EFFK 3RBZA 4DXWA 5B1BC 2K1EA 3R65A 1R3IC 2WLHA 3PJSK 4MTOA 5B1AC 3E86A 5EBMC 2X6AA 5E1AC 2HVKC 3ASNC 4G27B 2P7TC 3KG2A 2IH1C 3ABLC 3LDCA 4R6ZA 4PA3A 2R9RB 3F7YC 3IGAC 4PDVA 2OCCC 3ZRSA 4MVQA 3OGCC 4I9WA 1J95A 4X8AA 4MVMA 2EILC 3SPHA 2DWEC 3RW0A 1OCRC 3ABMC 3SYPA 3K0GA 4MVOA 4BW5A 4LBEC 1R3LC 4GX1A 4MW3A 2BOBC 3AG3C 3E89A 3ASOC 2WLIA 3T4ZA 4JTCB 4MTFA 4P9PA 4PA6A
chains in the Genus database with same CATH superfamily
3ZMUA 1QR9A 1KECA 2V7QG 1ROPA 3JD4A 3P3NA 1JJOA 1PL4A 2W6JG 2EIMC 3F7VC 3K57A 3TGUH 3JAWA 1W0JG 3BHPA 1W0KG 5KAFZ 2QEXV 4QNHB 3B77A 1QVGU 4MTXA 4PDRA 4PDMA 3LSUA 4BAYA 3NXSA 4DV7B 1URFA 3K04A 1YHQV 4J80A 3RFRA 1M4UA 1S3JA 1Y66A 2C2AA 2D3OW 3QNEA 4Q20A 4IT5A 4NTWA 4FFKA 5KA6A 3E8GA 1M56B 1Z2GA 4LWSB 2IU0A 3ZRWB 4IL6Z 1EM1A 2F66C 4PDLA 4EB6A 3SPGA 3PN1A 4CBCA 3CRAA 1OCOB 3P3PA 5LMNO 5BZBA 3RN4A 4LC1A 4DUYB 4DV5O 4AQYO 2WLLB 2E75B 4MTGA 2UXBO 1V54C 2RN9A 1SKVA 4X66O 4MSWC 2VRZA 3WB1A 3UT5B 2YIAA 1Y76A 2OCCB 4O4LB 3OR7C 4ZHQA 4YHHO 1YCIA 4TQDA 2Q0AA 3LSQA 4MT8A 3R65A 3APOA 3UO2A 2QTSA 2UXBB 1EN6A 1IX9A 4JI3O 3G67A 3RYCB 2RNBA 1V55B 3CJHA 3QO7A 4JI2B 4FLYA 2YDEA 2ZNJA 1VF7A 4FLTA 2Q8VA 1K33A 1O9HA 1NH2D 2JJ1G 2L6LA 2BSKA 4D7SA 1XOUA 3A0HZ 4TUYB 2Q7EA 4LF8B 2L35A 2A9HA 5JJEB 4DR2B 3RYHB 3CD6V 5JVDA 3CE2A 1XMQB 1BE3H 1VEWA 2EINB 2A3QA 2UXNA 4C7UA 4DV4B 3E8HA 3G6BA 1J5EB 4KL1A 5BXZA 3SPIA 1KP2A 1Q90D 5FLXN 2ZE8A 2Z3YA 1R1BA 1NI8A 4WFBV 4JI4B 4O4HA 5GTHZ 1S0VA 1N8RW 3CRCA 2WLMA 5EYPA 1M1KW 2WSSG 1FD9A 2X6BA 2XNDG 1WLEA 4X62O 5IDJA 3FX7A 4FIPC 2E76B 1XL4A 5DECA 3UCSC 2JK5C 3HKDA 4B3TO 2ZT9B 3CCVV 1GAXA 1JPXA 3T1YB 4DR3B 5CBFA 1TVKA 3KCYA 4K0KO 4X62B 5IYZA 2FB5A 2QWNB 5ITZB 2K1EA 1SC5B 2ZDIA 3ASNC 2CTPA 1PKXA 1KKCA 3SR2C 3ZRSA 2GTSA 3L72H 1QQCA 3RGBA 2YC0A 1K9MW 1CEZA 1Q81W 4DRXA 4J42A 3ABMC 3B8NA 2N74A 2YIBA 3W7TA 1HNZO 5J2TB 1BZKA 4PA6A 3ETDA 4JYCA 2AHZA 4LF7O 1IBLO 5LYJA 1VQ6V 1LR1A 3OFNG 3QVNA 4DYLA 4JI7B 4X1YB 1VQOV 4YIPA 1VQ8V 2VWKA 2F95B 3L9DA 1MG1A 4OX9B 3UQ8A 2F43G 3CCRV 3T1YO 3UM7A 4DR1O 1JMKC 2R9AA 3M8AA 1LNQA 4YJ2B 2GUZA 1SS3A 4LF6B 1BHAA 3HKCA 1RFYA 4WFFA 1NVPD 4BIOA 3FB6C 2QM8A 1RM1B 1XMOB 4JI7O 2XAGA 2DYRC 4TV8A 5CA0A 2HHHO 4CH4A 4B3SB 3ZHSA 1AP6A 4ZBMA 2DOSA 4UXNA 1RPOA 3B09A 3ZX6A 2ZDIC 4G2KA 3JAKB 3W7SA 1JX9A 3TK1A 3Q4HB 2E74B 3R66A 3SYQA 3STZC 1AJNA 2KB1A 1UPGA 4JYBA 2HG5C 1BQ0A 1DLBA 2P06A 2JS3A 1FYJA 4I5SA 1XREA 2F4VB 2ZE7A 3HKBB 5JH7A 5KHJA 3BVOA 4I7ZB 3C3TA 2NNUA 1FAFA 2A06H 2YXLA 1QLNA 2JEUA 4B3RO 4JI8O 1YXBA 2FMLA 1JOYA 1QBZA 3CEIA 4B3TB 2UUCO 4DV3B 2JGDA 4LF4B 4X64O 2DWEC 4ABMA 1WA8A 4MW3A 4PELA 5LHIA 4MTFA 2E5LB 1YI2V 2NN4A 1I08A 1YTFD 3ABLB 1Q3EA 4Z1VA 1P4RA 3K3WA 2IW5A 4JI1B 2DN9A 5C8YA 2WLLA 3JCZA 1AR4A 2XAHA 2OIEA 3ZHUA 1JJ2U 4DV2O 4IGGA 3KKYA 4TSFG 3S3XA 1V9PA 4DK0A 3P30A 4FLZA 4FZ1A 4I55A 5EBLC 3ML0A 5CMUA 4BR6A 5LGNA 3ETQA 2VS0A 4GX2A 3RYCA 2H3OA 4GKJO 1LUWA 1YEWA 5HFLA 2P22C 1Q5OA 2WLIB 4QJFB 5DN6G 4DV6B 2WLKA 4TUYA 3ICXA 4OXSA 4DV6O 2JVDA 2Q67A 3OE7G 4UB6Z 4RQFA 4PA9A 4LCUC 3HKEB 2OT5A 4JPRA 1GN6A 2D2CB 2LP7A 1EN5A 1U96A 1FXKB 3U10A 5EK0A 3E83A 3WFVA 4I4TB 2VQEO 2CUGA 4LF5B 5KMGB 1SQVH 1IDSA 1OJHA 1R3IC 2CE4A 3E86A 3THOA 4O4IA 3O9OA 4CH5A 3T4ZA 4JTCB 3T1HO 1N33O 4B7KA 4NYKA 4QPKA 1GTOA 4G28B 5LXTB 5IYCO 1LUVA 5EBWC 2ZD9A 4J7JA 4JYYA 1M57C 3E8FA 5E79Z 3HKDB 3H1HH 2Q7GA 3RYIB 2ZIMA 3OUFA 4LF4O 3E22A 2Z0AA 1AI5A 3X2QC 5D5QA 2V4DA 1XNQB 1VQ4V 3D36C 4DW0A 2DYRB 1AR5A 4DV7O 2HFEC 3SJCC 1NU1H 3OUSA 1YSCA 4UCUA 4ZI7A 5J2UB 3E35A 5H2FZ 3ZHVA 4PA4A 2DYSC 2UXCO 4P2ZA 1GN3A 5EIBD 2OTJV 4FPPA 4JI1O 1DGSA 4DRXB 1FS0G 1SF9A 3CXHF 4K8ZA 3I56V 4RO2A 3SGIA 3J81N 5CB4A 5LA6B 1AJPA 2Y4TA 5KHIA 2ODMA 1XUQA 4TWKA 4DW1A 2Q6AA 4IYHA 1Q6UA 2PTMA 4JYAO 2ZKOA 3LDEA 1Y4MA 1N32O 4B7EA 1Q8IA 1VQMV 2ZXWC 2ZINA 1FKAO 2CGOA 1VF6C 4O2BB 1VF5B 1K8AW 2CTRA 1N34O 2PYJA 3KG2A 2YIDA 3I5DA 1J95A 4HNAA 3LSSA 4YJ3B 1L8DA 1AR1B 1NTZH 3DXRA 2F4VO 1IXMA 2XAQA 2YI8A 1RSOB 3JAKA 4BW9A 1VQLV 3JD1A 4D7TA 4I9QA 4MW8A 2W0FC 3K08A 1H2MA 4J7ZA 3N2GA 1MZFA 3O65A 2DWDC 2ZE5A 3B8MA 1EZVH 1T5EA 2Q5ZA 3W7UA 5KUKA 1YITV 4B3SO 5JH7B 3AK2A 2IU3A 2Q68A 5EZYB 1V55C 1K97A 1XMOO 2ZNIA 1S5JA 1WB7A 2ZR3A 2PGGA 4K0KB 1N0NA 4QPJA 1KKDA 2QWPB 2FL4A 4XDJA 3IFXA 3JD3A 2QWQB 3OEHG 2JGDB 3J80N 1AP5A 5B66Z 3CCJV 2LW7A 4NTXA 5B3SC 4JAUA 3FB8C 4BIUA 2N05A 1ZX3A 3U11A 2B9ZA 3JATA 4W4KA 3CXCU 3SPJA 4HZ3A 1TAEA 2Q9LA 4MVRA 4DR4O 3SYCA 4FZ0A 1YVWA 1JA8A 4GLXA 1L1FA 3CC2V 3SPCA 1S5LZ 3LNMB 4XDKA 2HKOA 4RQEA 1XMQO 4EEQA 4KXRA 4I50B 3WU2Z 5GTIZ 1Y67A 3LDCA 4PA3A 2R72A 1GM8A 4CC6A 4JI6B 4JI5B 3DC6A 4LWSA 1VQKV 3RT3C 1OCRC 4LFBO 4FJCC 2Y0PA 2BOBC 3JD2A 3EVKA 4LFCB 3BFRA 1SZTA 5CN0A 2ARHA 1DK1A 4JZGA 4K8XA 2QKSA 1BHBA 4ASUG 3GB7C 1B04A 4Q6GA 5KA5A 3UT5A 3B40A 3WG7C 1VMGA 1PP9H 5LGTA 4I4TA 1M56C 2FKXA 2Y69C 3T4DA 5KMGA 3J7AU 4X65O 4ZKIA 2ADPA 2M7WA 3E2EA 1KBHA 4LR3A 4O4IB 1YJ9V 5L3EA 4AI8A 3BCCH 4O4JB 1NQTA 4LF8O 1PL0A 2B5UA 1RP3B 4DUZB 3RWRD 2EIKC 2PYLA 4N21A 5B5EZ 1K5QA 5LXTA 4FFBA 3RYFA 2DE0X 5JVDB 3RYIA 4DO2A 1XL6A 2VWJA 3AG2B 2QSAA 3ABUA 1E1QG 3TCUA 5LOVB 2PF4E 1H38A 4FVMA 1JCHA 4UUJC 2EIJB 1FFTB 2YI9A 3BA8A 1PD3A 5B1BC 4O4HB 2WLHA 5J2UA 1QHTA 2EIKB 3JARB 4AILC 2IH1C 3K5LA 4D6TH 1PNKA 1JFFB 4MVQA 1KQSU 4X1IB 2O57A 1Q82W 3K0GA 1R3LC 3AG3C 1H2NA 1A32A 1B3QA 1SQFA 4GKKB 4PI2A 1I5YA 5CB4B 5L3BA 1BSMA 3L74H 4J10A 1Z5WA 2CTWA 1NKDA 1SA0B 1TGOA 1WP7A 2XOKG 2E5LO 4DR2O 2CAZC 2EJ7A 4P30A 4WFGA 5B1BB 3A0RA 1NH2B 2UUAO 4R8CA 5IYDO 4GZRB 5LHGA 2ITDC 2UXDO 1Q86W 5H6QA 3CRRA 1QU7A 2W6IG 2QJ1A 1E79G 5ITZA 1R3JC 2UUBB 1BT8A 4JI3B 1WNSA 3OAAG 1MSWD 3OR6C 2HEPA 1FXVA 1Z5VA 3DXRB 1RSOA 2YUAA 3AK1A 2LO1A 1R6TA 2F93B 4TV9A 1KP3A 4JASA 2X6CA 4JAVA 1P7GA 2HP8A 3ASOB 3MD0A 2GHYA 5KX5B 3K5MA 1QCEA 1G6UA 3CMEV 4B3MO 4UCRA 2EIMB 2KSDA 1CPYA 4X89A 5L3CA 2RQ6A 3KZIZ 1S76D 2AHYA 3MDSA 3HKCB 3L70H 1HNXB 1TUBB 3H1JH 2BE3A 3ZBHA 4JZ2A 3L71H 1L0LH 3H01A 4TV8B 5CA0B 1OV9A 1I94O 2ZR2A 4LH6A 4QIWF 1EBOA 5AG2A 1NT2B 4UVBA 5KLVH 4P9PA 1QR8A 2A7WA 4WFAV 2P6JA 2Z5UA 4JAAA 1R6NA 3JATB 3K9SA 1OCRB 5TISZ 4OGQB 1S72V 3UKMA 4EFBA 1XHZA 3S3WA 5CBHA 4EKWA 1YF2A 1M93A 3HKBA 4X9QA 1VP7A 1XQ8A 1E1RG 4NTYA 4U3JA 3ZN0A 3ZRVA 1SQQH 3VBBA 1MABG 1BCCH 4XDLA 4GYCB 4FM0A 4MVUA 3CC4V 4DV1B 2LGQA 4X64B 5IJ0B 4R7CA 2ZE6A 3CRQA 1NR7A 4UFZA 1K7DA 4LNUB 4DR3O 5JQGB 2BTOA 2UUCB 1H2SB 4LFAO 1IZ3A 2BOCC 4IHJA 1MMMA 3UO3A 2DW4A 5L3GA 3W7XA 1GM9A 5KHKA 3M99B 4FLWA 2EULA 4JI6O 1ZL8B 5LBQA 1VQ7V 5CA1A 1G1XB 2GV9A 4F6EA 4DV1O 2KKWA 2ITCC 2EZOA 3WB0A 1GO3F 2GTAA 5H6RA 1OZ0A 3DGEA 1XNRB 3ZMZA 3BRCA 1DTOA 1XILA 3QG5A 5EC2C 2GBOA 4KHPO 1AI4A 1NJIW 1B06A 1D2DA 3CCLV 2G38A 4I55B 2IH3C 1THZA 1AI7A 2AGAA 2F23A 4NXNB 3HB3B 2YSUB 3D36A 3IJ4A 3F7YC 4O4JA 3CB2A 1X59A 3L75H 4DV4O 3CWBH 3CC7V 3DSQA 1DF5A 3MAQA 3SYPA 4MVOA 1CXZB 1GMGA 4DR5B 2OCHA 2PY5A 2RJZA 2Y4UA 1OHHG 1K4DC 4Z2WA 1YZBA 3DTUB 4OX9O 2ETNA 1SQPH 4FFBB 2OYQA 2V1DA 3IAYA 1PM9A 1N33B 1WJZA 1FFXA 2ZXWB 3SJQC 4NXMO 4RAIA 5LP6C 5K1PA 4L8JA 2PUSA 1FXKA 3CSXA 1ZUQA 5KAIZ 4OPAA 3TETA 3CYOA 5B1OA 3AG1C 2JS5A 4UVCA 2ZM6O 1WB8A 3GWOA 4KHPB 1AI6A 3JARA 5JJNB 3JALB 3SYAA 4LF9B 3ZEDA 1JFFA 1Y6XA 4R50A 2Q0OC 5IYBO 1K73W 4X1IA 3BABA 1IBKO 1P84F 3JSLA 4X20B 3M7MX 3OTOB 1XBLA 2NLJC 3VOUA 2WA3A 2EBOA 1SA0A 1AB3A 3CMAV 4GUNA 3SJBC 1RPRA 1K92A 2IM9A 1SETA 4PJ0Z 3E22B 3QO8A 5EC1C 3SYOA 3AEIA 1NTKH 3FB7C 3AG4B 4B3MB 3I55V 1I5XA 2JRIA 3OMIB 3LDDA 3RBZA 4WBNA 5LP6A 3EFFK 4ZI7B 4YIOA 3QF7A 5E1AC 2VQFB 4PDVA 3SDLA 3H9VA 2XAFA 2F1MA 4CS3A 5H5NA 2EILC 4JI4O 3C3SA 1PNMA 2QKCA 2QM7A 1SZXA 4UB8Z 2VQFO 5BY1A 3DC5A 4DR7O 4H33A 1VARA 2BTQB 4UV8A 2OWOA 4LF5O 1YTFB 2ZCEA 3T2MA 4TV9B 3AG4C 1HW7A 5IJ9B 1K34A 4DV5B 1AVMA 2PI4A 2Q69A 1FPOA 3K0DA 4HAMA 4O2AA 5KX5A 2KG7B 4UVAA 2IJJA 3HR0A 5F2VO 3OD4A 3ZIAG 2DYSB 3EHBB 2YS8A 2CDYA 4RWUA 1M57B 2QA4V 2PZSA 1TUBA 3AG2C 4DR5O 1SRYA 2RDCA 1WPXA 3JCUZ 2B1GA 4JTDB 2AW9A 4JI5O 4KFMA 2A0LA 4HNAB 2LW1A 2Y48A 4H0LB 3STLC 4CC5A 1M9NA 4DR7B 2YIBD 1QLEC 3FKSG 1AJQA 2VQEB 3H1IH 5H9CA 4LH7A 5IT9N 4U7NA 4X66B 3N2KA 5CBGA 3K9AA 2Y0IA 5LGUA 3N2GB 2B1IA 2CH7B 3IC9A 3K58A 2LFRA 1ORQC 1AILA 1NZ6A 1OCOC 4CZZA 2QWRB 3A8TA 2UUBO 2XT9A 3FD9A 2QM4A 1WAZA 4ICGA 4J7KA 4GX0A 1V54B 5DEDA 2YXYA 2H8PC 4FLUA 3K03A 3ZHQA 1NTMH 5IJ0A 4L87A 3ZMSA 2N04A 4PD4F 1SQGA 1QLEB 3IC7A 4LNUA 1W2BU 2RMKB 1O9GA 2OCCC 5JQGA 1PPJH 4B3RB 3ZRWA 4DUZO 5B1AB 4EB6B 4IIJB 3K5NA 4MVSA 1JQ0A 3OMAB 5CA1B 4DV0O 3ZCCA 4F6RA 1R3KC 1VQ9V 1PV0A 1K5SA 4ZOLB 3CCQV 3QO5A 5JJJB 2ZM6B 4P9OA 1N36B 1K4CC 4HBNA 2JDIG 3ABTA 2UU9B 2ZIOA 2EINC 2R9IA 1F4MA 4I50A 1G8MA 5L3DA 5IY5B 5B3SB 4DR6O 3OTFA 3NR7A 1XI1A 4UCVA 1BGYH 3AG1B 2JIZG 4N23A 1HDJA 1D5AA 3TJTA 4LFCO 4F4LA 3G4SV 3W7WA 1BS3A 4FK5C 1MSDA 4LFBB 4YY3B 5J9PC 2CGNA 2XTAA 1IBMO 2BSKB 3T1CA 2YEVB 3CS5A 4WCEV 1OCCB 1OCZC 2EJRA 4JTAB 3RYHA 4DR1B 1JR9A 5IWAO 2QDOA 3GVMA 4TQFA 1P7BA 5IY5C 2CK3G 1HNZB 5FNVA 1U97A 4JI0O 2WWWA 4RUEA 2RCVA 3CRMA 2EILB 5LL6Y 2LJ2A 4DXWA 3X2QB 4JF3A 1H8EG 5FPRA 1N36O 4K3AA 2ILMA 1SQXH 4JGSA 4W4LA 1I0HA 5LMUO 3VQYA 3BA9A 1IXBA 4ZIBA 4UCSA 1VIBA 4X20A 1IBMB 4GX5A 1H2KA 4A5UB 1I94B 1IVSA 1N34B 3WG7B 5LHHA 1HNXO 1H8HG 3RYFB 1SESA 3F5WC 2EX3A 1QNMA 1BQZA 5LOVA 3CCSV 3A0BZ 2P5OA 3ZRXA 4X1KB 2MK3A 2FTKA 1TVKB 1JVMA 4AHCA 1F4NA 3B4SA 3MHHC 5IYZB 1M90W 4WBNB 3JAMN 1K3EA 2LQTA 3K5OA 5BR8O 1AROP 1UFIA 3CCEV 5KHHA 1NS1A 3ZJZA 1HR0B 5JWPA 2HJFC 1N4CA 1VF6A 1GN2A 4NR1A 4H37A 1B6QA 4EFEA 3APQA 2UXCB 4PHZA 3FYIB 1RM1C 4J9YB 3ZN1A 3TXSA 5BMVA 1DF4A 4FM1A 5LYJB 3D3IA 2H94A 4X1YA 4CH3A 1VQ5V 4UCTA 3RVYA 2KG7A 4H44B 5FPOA 4GCZA 3A2FA 5A9GA 3WB2A 1MNGA 4PI0A 4I0XA 5HFMA 1XEQA 1YDXA 2PI5A 3ZMVA 4FLXA 3T1HB 2DJVA 1KD1W 4MTOA 5B1AC 5GONB 2HVKC 3ABLC 2IJHA 2BCCH 1F7YA 1US6A 4MVMA 4X8AA 2IBZH 3RW0A 2X7RB 1FJGO 1GM7A 1KUQA 4LBEC 1ZTEA 2JJ2G 3G71V 1Y74B 2EZPA 3H1KH 2M6YA 3RVZA 2WLJA 3FAVA 4GT1A 3Q4HA 4J9ZB 1P49A 2R70A 4E2LA 2A79B 5FL7G 1VQNV 3N2KB 1QVFU 3C90A 2CH7A 3CP1A 1GK9A 2HLDG 1Q6HA 2IJKA 4FMTA 5LMNB 1KB9F 3EXAA 3D8CA 3JD0A 3VQXA 2P4KA 3OMNB 4CH6A 1MOFA 1ZWIC 3KCXA 1ZLZA 3ZS8C 3JASA 2UUAB 2X0LA 1HNWO 3OW2U 1HNWB 3K79A 2UXDB 3BY6A 5K1XA 1HWYA 1OCCC 4U7OA 4WFHA 1HP8A 1YIJV 2W0XA 1WA8B 2AZ0A 4IIJA 3ASNB 3GWKC 3ETGA 5C93A 4JI2O 1WN7A 1R73A 2WAMA 4QE7A 4F6RB 4TOIA 3CHXA 5C8YB 2P67A 3AK3A 4ZOLA 3B2EE 1Q43A 3JAWB 4GKKO 1HR0O 4DV2B 4QGPA 4DUYO 1KMIZ 2QGNA 2P90A 1S5HC 4U3JB 5BR8B 1MA1A 1KC8W 1D5NA 2ATKC 3FB5C 3OM3B 1NR1A 1SQBH 3ETEA 3ABKB 3ZHRA 1SERA 4G27B 2DQ3A 1FXKC 3CX5F 1EZJA 5B1NA 1L0NH 3OGCC 4I9WA 3OGIB 4IHJB 2Y69B 4KP4A 4GX1A 3E89A 2CTQA 2WLIA 1H2GA 2OTLV 1MZEA 4J11A 4DV3O 1XDCA 3BPZA 4GKJB 1F23A 1ZSPA 1ZL8A 1Q6IA 2YEVA 4OPHA 2GSMB 1IBKB 2OIGA 1NBMG 2DMXA 3JYCA 1Q7YW 2K9PA 4CS2A 4TT3G 3HKEA 1W59A 4LF9O 3OTOO 2HVJC 4Z1MG 4LP8A 1F51A 1X4TA 2IJIA 3AG7A 5LMUB 4JV5O 3OT7A 2GDSA 2LGWA 5FNVB 3G80A 1Y76B 2AZ2A 3F5TA 1WPBA 4O4LA 2JEXA 2WLNA 4ZHQB 4DR4B 2HR3A 4K35A 3ABMB 5JCOC 4X65B 1FJGB 2QTOA 4JI0B 3SJAC 3CJHB 2AXTZ 2EIJC 2JGUA 2ZQMA 1COWG 2ADQB 5KUMA 4NXMB 4U3FH 1ZAUA 4LF6O 2MW2B 1G4YB 1N0JA 2Q4PA 4CS4A 1FFXB 3FFQA 3E8BA 1ENVA 5IE9A 4X88A 4JI8B 3OEEG 4LF7B 4NXNO 1IURA 1PNLA 2QR4A 2KQXA 4X1KA 4QE9A 4B08A 5DM6V 1UJWB 3ZHTA 1GH6A 2XUMA 4HYOA 4J41A 5GW7A 1I7FA 2XHBA 3FYEB 1H2LA 3PJSK 1IBLB 1BMFG 5EBMC 4NB5A 3ZMTA 1VQPV 3JALA 4R6ZA 3QTCA 3IGAC 4KUMA 4NKGB 1XNRO 5EYPB 2YICA 3VQWA 3H1LH 4IYIA 4BW5A 5JCOA 2NR5A 4YXWG 3CCMV 2HHHB 2QWOB 5BMVB 4DV0B 5LA6A 1KYOF 4UV9A 3K06A 1J5EO 1NVPB 4PA7A 1WP8A 4RUFA 5D5PA 3CPWU 4MS2A 1CP9A 2P4VA 3HPLC 4LFAB 1S77D 3LNNA 2HJDA 2FYUH 4I0XB 1R6KA 1OCZB 4JYAB 3CCUV 5LP6B 4O2BA 3AG3B 2DQ0A 5GONA 5L3FA 2LFSA 2Q73A 4DR6B 1M5IA 4WF9V 4H13B 3G6EV 1GRJA 2E3CA 2UXXA 4NVPA 4FLVA 2WPDG 4YJ3A 3JSNA 1FXHA 1TA8A 4FM2A 1Y74A 2QE7G 5J2TA 1BL8A 1TUEB 2XAJA 3BAAA 4YHHB 3FAVB 1EFRG 3MHSC 4JV5B 1GN4A 2BTQA 4BWAA 4UCOA 5IJ9A 5KHGA 3N27A 3VQVA 4DK1A 4MVZA 1KU9A 4WFEA 5CA3A 4O2AB 5IWAB 3LUTB 2Q7HA 3ABKC 3BEHA 4PV1B 4BIZA 1EN4A 4AQYB 1XNQO 4XBFA 5EZYA 4YY3O 4YJ2A 2GUZB 2WA4A 3P32A 3K59A 1YJNV 3TXQA 3JASB 2XASA 2QKAA 2X6AA 2P7TC 1GKFA 3U0ZA 2R9RB 3L73H 5A2QN 5EIBC 1N32B 1XHXA 3SPHA 2UU9O 4E4EA 3D3QA 3ASOC 2YXHA 1YJWV
chains in the Genus database with same CATH topology
1QR8A 4GX5A 3ZMUA 1QR9A 1KECA 2V7QG 1ROPA 3JD4A 4QPKA 2P6JA 1GTOA 4WFAV 4G28B 2Z5UA 5IYCO 1R6NA 5EBWC 2W6JG 3WG7B 2ZD9A 5LHHA 2EIMC 1H8HG 1OCRB 1SESA 3F7VC 1S72V 1M57C 3E8FA 3F5WC 3UKMA 1W0JG 5CBHA 1W0KG 3OUFA 1AI5A 3X2QC 2QEXV 4EKWA 4QNHB 3B77A 1QVGU 1VQ4V 4MTXA 1E1RG 4PDRA 3CCSV 2DYRB 4PDMA 3ZRXA 2MK3A 3ZN0A 4BAYA 2FTKA 3ZRVA 3NXSA 1JVMA 2HFEC 3VBBA 1MABG 3K04A 1F4NA 1YHQV 3MHHC 4XDLA 3OUSA 1M90W 4MVUA 3CC4V 1YSCA 1S3JA 1Y66A 1K3EA 4R7CA 2C2AA 1NR7A 3E35A 2D3OW 1K7DA 3QNEA 4Q20A 1AROP 4PA4A 2DYSC 4P2ZA 3CCEV 5KA6A 2OTJV 3E8GA 1M56B 3ZJZA 4FPPA 2BOCC 2HJFC 1FS0G 2DW4A 2IU0A 3ZRWB 5L3GA 3W7XA 1GM9A 4H37A 3I56V 3M99B 4RO2A 4PDLA 1B6QA 3SPGA 4CBCA 3FYIB 1RM1C 4J9YB 3ZN1A 5LBQA 1OCOB 1VQ7V 1DF4A 5BZBA 1AJPA 3D3IA 2H94A 2EZOA 2ITCC 4LC1A 4TWKA 2WLLB 2Q6AA 1GO3F 4MTGA 5H6RA 1OZ0A 1V54C 3DGEA 1VQ5V 3ZMZA 3RVYA 3LDEA 1Y4MA 1DTOA 4GCZA 4MSWC 5EC2C 5HFMA 1AI4A 1NJIW 1VQMV 2PI5A 2OCCB 3ZMVA 3CCLV 3OR7C 2IH3C 1KD1W 1THZA 2ZXWC 1AI7A 3LSQA 4MT8A 3R65A 1K8AW 4MTOA 5B1AC 2HVKC 3HB3B 3KG2A 3ABLC 2YSUB 3D36A 3F7YC 3QO7A 1V55B 2IJHA 1J95A 4X8AA 4MVMA 3RW0A 3CC7V 2X7RB 1DF5A 1GM7A 3LSSA 3SYPA 4MVOA 4LBEC 1GMGA 1AR1B 1IXMA 2JJ2G 2XAQA 3G71V 2EZPA 1K33A 1NH2D 2JJ1G 3RVZA 1VQLV 2WLJA 4GT1A 1OHHG 1K4DC 4J9ZB 3DTUB 4E2LA 3JD1A 2A79B 4MW8A 2W0FC 3K08A 5FL7G 1VQNV 2V1DA 1QVFU 2A9HA 2ZXWB 3SJQC 3CD6V 3CP1A 1GK9A 2DWDC 2HLDG 4RAIA 3B8MA 2EINB 3W7UA 2UXNA 2IJKA 4FMTA 5KUKA 1YITV 3E8HA 1FXKA 2IU3A 3SPIA 2Q68A 3JD0A 1V55C 1KP2A 3TETA 3CYOA 1K97A 5B1OA 3AG1C 3OMNB 1MOFA 1ZWIC 2ZR3A 4UVCA 2Z3YA 4WFBV 4QPJA 1KKDA 2X0LA 3GWOA 3OW2U 1AI6A 1S0VA 4XDJA 3SYAA 3IFXA 3K79A 3BY6A 3JD3A 1N8RW 3OEHG 1HWYA 2WLMA 4R50A 5IYBO 1OCCC 4U7OA 1K73W 4WFHA 1M1KW 3CCJV 1YIJV 2WSSG 5B3SC 2X6BA 3ASNB 2XNDG 1WLEA 3ETGA 4JAUA 3FB8C 4BIUA 5C93A 5IDJA 1R73A 2WAMA 2NLJC 3VOUA 4QE7A 4FIPC 2EBOA 3CXCU 3CMAV 2P67A 1XL4A 3SPJA 2JK5C 4HZ3A 1RPRA 1K92A 4MVRA 3CCVV 1SETA 1JPXA 3SYCA 3QO8A 5EC1C 3SYOA 1L1FA 3CC2V 3SPCA 3AEIA 2P90A 3FB7C 1S5HC 3AG4B 3LNMB 5CBFA 3I55V 1KC8W 1I5XA 4XDKA 2ATKC 2HKOA 4RQEA 3OMIB 3FB5C 3OM3B 3LDDA 3RBZA 3EFFK 1NR1A 2K1EA 3ETEA 3ABKB 1SERA 2ZDIA 5E1AC 3ASNC 4G27B 2DQ3A 1PKXA 3LDCA 1FXKC 1EZJA 4PA3A 4PDVA 3ZRSA 1GM8A 5B1NA 3OGCC 2XAFA 4I9WA 2EILC 1K9MW 1CEZA 1VQKV 1Q81W 2Y69B 1OCRC 3ABMC 3B8NA 4FJCC 4KP4A 1PNMA 4GX1A 2BOBC 3W7TA 3E89A 2WLIA 3JD2A 1H2GA 2QM7A 2OTLV 4PA6A 3ETDA 1F23A 4JYCA 4H33A 2YEVA 2AHZA 2GSMB 4UV8A 1YTFB 3OFNG 1VQ6V 1NBMG 3T2MA 1SZTA 3JYCA 3AG4C 5CN0A 1Q7YW 1VQOV 1VQ8V 1K34A 4TT3G 2PI4A 2Q69A 2QKSA 3K0DA 1BHBA 4HAMA 2HVJC 4ASUG 3GB7C 4UVAA 4Z1MG 1MG1A 2IJJA 4LP8A 1F51A 2IJIA 2F43G 3CCRV 3ZIAG 2DYSB 3EHBB 3UM7A 5KA5A 3WG7C 5LGTA 2JEXA 1M56C 1LNQA 1M57B 2WLNA 2QA4V 2HR3A 2Y69C 3T4DA 3ABMB 1BHAA 3AG2C 4WFFA 1NVPD 4ZKIA 1SRYA 2M7WA 2QTOA 3FB6C 2QM8A 3E2EA 1WPXA 1RM1B 1YJ9V 2B1GA 4JTDB 2XAGA 5L3EA 2DYRC 2EIJC 2ZQMA 1NQTA 4KFMA 1COWG 2A0LA 4ZBMA 1PL0A 2Y48A 2B5UA 4UXNA 3STLC 1RPOA 5KUMA 1M9NA 2EIKC 2ZDIC 4G2KA 1QLEC 4N21A 3FKSG 3W7SA 1JX9A 1AJQA 3TK1A 5H9CA 1K5QA 4U7NA 1G4YB 3K9AA 3SYQA 5CBGA 5LGUA 2B1IA 1AJNA 3STZC 2KB1A 2LFRA 1ORQC 3E8BA 1ENVA 4JYBA 4X88A 2HG5C 4DO2A 1DLBA 1XL6A 3AG2B 3OEEG 3ABUA 4I5SA 1E1QG 3TCUA 1OCOC 4CZZA 1H38A 1PNLA 1JCHA 4UUJC 2EIJB 1FFTB 4QE9A 5DM6V 1UJWB 4GX0A 1V54B 2NNUA 1QLNA 2JEUA 2H8PC 4HYOA 3K03A 1PD3A 5GW7A 5B1BC 1JOYA 4L87A 3FYEB 2WLHA 3PJSK 1QBZA 3ZMSA 1BMFG 5EBMC 2EIKB 3ZMTA 1QLEB 1VQPV 2IH1C 3IC7A 1W2BU 4R6ZA 1PNKA 3IGAC 4KUMA 2OCCC 4MVQA 1KQSU 2DWEC 1Q82W 4BW5A 3K0GA 3ZRWA 1R3LC 4MW3A 3AG3C 4PELA 5LHIA 4MTFA 5B1AB 1YI2V 4MVSA 4YXWG 3CCMV 1I5YA 1JQ0A 1YTFD 3ABLB 5L3BA 3OMAB 1P4RA 3K3WA 2IW5A 4UV9A 3K06A 3ZCCA 1NKDA 1R3KC 1VQ9V 2WLLA 1NVPB 3JCZA 1K5SA 2XOKG 4PA7A 2XAHA 3CCQV 4RUFA 3QO5A 3CPWU 4P30A 4WFGA 4MS2A 1CP9A 5B1BB 3A0RA 1NH2B 1JJ2U 4R8CA 3HPLC 1S77D 5IYDO 4P9OA 5LHGA 1R6KA 4TSFG 1OCZB 1K4CC 2ITDC 1Q86W 2JDIG 5H6QA 3P30A 3CCUV 3ABTA 5EBLC 3ML0A 2W6IG 5CMUA 2EINC 3AG3B 1E79G 1F4MA 2R9IA 5LGNA 1R3JC 1G8MA 2DQ0A 5L3DA 5IY5B 5B3SB 5L3FA 2LFSA 4WF9V 3G6EV 2UXXA 4GX2A 3OAAG 3AG1B 2JIZG 4N23A 2WPDG 1MSWD 3OR6C 4F4LA 3G4SV 1FXVA 5HFLA 3W7WA 4FK5C 1FXHA 2WLIB 2QE7G 5J9PC 1BL8A 1TUEB 2XAJA 4QJFB 3T1CA 5DN6G 2WLKA 4OXSA 1EFRG 2YEVB 3MHSC 4WCEV 1OCCB 1OCZC 2EJRA 1KP3A 4JASA 2X6CA 2Q67A 3OE7G 4RQFA 4JTAB 4PA9A 4JAVA 4LCUC 4MVZA 2OT5A 3ASOB 4WFEA 3MD0A 5CA3A 2GHYA 3LUTB 4JPRA 1P7BA 3ABKC 5IY5C 3BEHA 4BIZA 2LP7A 1QCEA 2CK3G 3CMEV 1FXKB 4XBFA 2WWWA 4RUEA 5EK0A 3E83A 3WFVA 2EIMB 1CPYA 2EILB 3P32A 4X89A 5L3CA 1S76D 2AHYA 1YJNV 4DXWA 2XASA 3X2QB 1R3IC 4JF3A 1H8EG 3E86A 2X6AA 2P7TC 1GKFA 2R9RB 3H01A 4JGSA 2ZR2A 4QIWF 3SPHA 1EBOA 4UVBA 3ASOC 3T4ZA 4JTCB 4P9PA 1YJWV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GX5 A;  4MVS A;  3RVZ A;  4H33 A;  4G28 B;  2WLJ A;  1K4D C;  2AHZ A;  2YEV A;  4J9Z B;  2A79 B;  5EBW C;  4MW8 A;  2W0F C;  3K08 A;  2ZD9 A;  3K06 A;  3T2M A;  3JYC A;  3AG4 C;  1R3K C;  2WLL A;  2EIM C;  3F7V C;  2A9H A;  1M57 C;  3E8F A;  3F5W C;  3UKM A;  3SJQ C;  2Q69 A;  4PA7 A;  2QKS A;  2DWD C;  3K0D A;  4RUF A;  4RAI A;  5CBH A;  4P30 A;  3OUF A;  4WFG A;  2HVJ C;  4MS2 A;  3X2Q C;  3GB7 C;  4EKW A;  4LP8 A;  4QNH B;  4R8C A;  5KUK A;  3E8H A;  3HPL C;  4P9O A;  3UM7 A;  4PDR A;  3SPI A;  3WG7 C;  2Q68 A;  4PDM A;  1V55 C;  2ITD C;  1K4C C;  3TET A;  3AG1 C;  1LNQ A;  1M56 C;  1JVM A;  2HFE C;  2WLN A;  1ZWI C;  3K04 A;  5EBL C;  2Y69 C;  4XDL A;  3T4D A;  3OUS A;  4MVU A;  1KKD A;  2EIN C;  3AG2 C;  4WFF A;  1R3J C;  4R7C A;  2QTO A;  3FB6 C;  4XDJ A;  3SYA A;  3IFX A;  4JTD B;  2DYS C;  4PA4 A;  4P2Z A;  2DYR C;  4GX2 A;  2EIJ C;  2WLM A;  4R50 A;  1OCC C;  3E8G A;  3OR6 C;  3ZJZ A;  2BOC C;  4F4L A;  4WFH A;  4KFM A;  2HJF C;  2A0L A;  4ZBM A;  3STL C;  2WLI B;  4H37 A;  5KUM A;  4RO2 A;  4PDL A;  5B3S C;  5J9P C;  1BL8 A;  2EIK C;  2X6B A;  3SPG A;  1QLE C;  4CBC A;  3T1C A;  4J9Y B;  3FB8 C;  2WLK A;  4OXS A;  2NLJ C;  3VOU A;  4QE7 A;  5BZB A;  1G4Y B;  5CBG A;  3SYQ A;  1OCZ C;  2ITC C;  4TWK A;  2Q67 A;  2WLL B;  2Q6A A;  2X6C A;  4MTG A;  1XL4 A;  3STZ C;  4JTA B;  1V54 C;  3SPJ A;  4PA9 A;  2KB1 A;  4LCU C;  4MVZ A;  2JK5 C;  4HZ3 A;  1ORQ C;  4WFE A;  3E8B A;  4X88 A;  2HG5 C;  4MVR A;  3RVY A;  1XL6 A;  3LUT B;  3SYC A;  3LDE A;  1P7B A;  3ABK C;  5IY5 C;  3BEH A;  3TCU A;  1OCO C;  4MSW C;  5EC1 C;  3SYO A;  5EC2 C;  3SPC A;  3FB7 C;  4RUE A;  5EK0 A;  1S5H C;  4UUJ C;  3LNM B;  3E83 A;  4QE9 A;  5CBF A;  4GX0 A;  3OR7 C;  2IH3 C;  2ZXW C;  2ATK C;  4X89 A;  4XDK A;  3FB5 C;  2AHY A;  3LDD A;  2H8P C;  4HYO A;  3K03 A;  3EFF K;  3RBZ A;  4DXW A;  5B1B C;  2K1E A;  3R65 A;  1R3I C;  2WLH A;  3PJS K;  4MTO A;  5B1A C;  3E86 A;  5EBM C;  2X6A A;  5E1A C;  2HVK C;  3ASN C;  4G27 B;  2P7T C;  3KG2 A;  2IH1 C;  3ABL C;  3LDC A;  4R6Z A;  4PA3 A;  2R9R B;  3F7Y C;  3IGA C;  4PDV A;  2OCC C;  3ZRS A;  4MVQ A;  3OGC C;  4I9W A;  1J95 A;  4X8A A;  4MVM A;  2EIL C;  3SPH A;  2DWE C;  3RW0 A;  1OCR C;  3ABM C;  3SYP A;  3K0G A;  4MVO A;  4BW5 A;  4LBE C;  1R3L C;  4GX1 A;  4MW3 A;  2BOB C;  3AG3 C;  3E89 A;  3ASO C;  2WLI A;  3T4Z A;  4JTC B;  4MTF A;  4P9P A;  4PA6 A; 
#chains in the Genus database with same CATH topology
 3ZMU A;  1QR9 A;  1KEC A;  2V7Q G;  1ROP A;  3JD4 A;  3P3N A;  1JJO A;  1PL4 A;  2W6J G;  2EIM C;  3F7V C;  3K57 A;  3TGU H;  3JAW A;  1W0J G;  3BHP A;  1W0K G;  5KAF Z;  2QEX V;  4QNH B;  3B77 A;  1QVG U;  4MTX A;  4PDR A;  4PDM A;  3LSU A;  4BAY A;  3NXS A;  4DV7 B;  1URF A;  3K04 A;  1YHQ V;  4J80 A;  3RFR A;  1M4U A;  1S3J A;  1Y66 A;  2C2A A;  2D3O W;  3QNE A;  4Q20 A;  4IT5 A;  4NTW A;  4FFK A;  5KA6 A;  3E8G A;  1M56 B;  1Z2G A;  4LWS B;  2IU0 A;  3ZRW B;  4IL6 Z;  1EM1 A;  2F66 C;  4PDL A;  4EB6 A;  3SPG A;  3PN1 A;  4CBC A;  3CRA A;  1OCO B;  3P3P A;  5LMN O;  5BZB A;  3RN4 A;  4LC1 A;  4DUY B;  4DV5 O;  4AQY O;  2WLL B;  2E75 B;  4MTG A;  2UXB O;  1V54 C;  2RN9 A;  1SKV A;  4X66 O;  4MSW C;  2VRZ A;  3WB1 A;  3UT5 B;  2YIA A;  1Y76 A;  2OCC B;  4O4L B;  3OR7 C;  4ZHQ A;  4YHH O;  1YCI A;  4TQD A;  2Q0A A;  3LSQ A;  4MT8 A;  3R65 A;  3APO A;  3UO2 A;  2QTS A;  2UXB B;  1EN6 A;  1IX9 A;  4JI3 O;  3G67 A;  3RYC B;  2RNB A;  1V55 B;  3CJH A;  3QO7 A;  4JI2 B;  4FLY A;  2YDE A;  2ZNJ A;  1VF7 A;  4FLT A;  2Q8V A;  1K33 A;  1O9H A;  1NH2 D;  2JJ1 G;  2L6L A;  2BSK A;  4D7S A;  1XOU A;  3A0H Z;  4TUY B;  2Q7E A;  4LF8 B;  2L35 A;  2A9H A;  5JJE B;  4DR2 B;  3RYH B;  3CD6 V;  5JVD A;  3CE2 A;  1XMQ B;  1BE3 H;  1VEW A;  2EIN B;  2A3Q A;  2UXN A;  4C7U A;  4DV4 B;  3E8H A;  3G6B A;  1J5E B;  4KL1 A;  5BXZ A;  3SPI A;  1KP2 A;  1Q90 D;  5FLX N;  2ZE8 A;  2Z3Y A;  1R1B A;  1NI8 A;  4WFB V;  4JI4 B;  4O4H A;  5GTH Z;  1S0V A;  1N8R W;  3CRC A;  2WLM A;  5EYP A;  1M1K W;  2WSS G;  1FD9 A;  2X6B A;  2XND G;  1WLE A;  4X62 O;  5IDJ A;  3FX7 A;  4FIP C;  2E76 B;  1XL4 A;  5DEC A;  3UCS C;  2JK5 C;  3HKD A;  4B3T O;  2ZT9 B;  3CCV V;  1GAX A;  1JPX A;  3T1Y B;  4DR3 B;  5CBF A;  1TVK A;  3KCY A;  4K0K O;  4X62 B;  5IYZ A;  2FB5 A;  2QWN B;  5ITZ B;  2K1E A;  1SC5 B;  2ZDI A;  3ASN C;  2CTP A;  1PKX A;  1KKC A;  3SR2 C;  3ZRS A;  2GTS A;  3L72 H;  1QQC A;  3RGB A;  2YC0 A;  1K9M W;  1CEZ A;  1Q81 W;  4DRX A;  4J42 A;  3ABM C;  3B8N A;  2N74 A;  2YIB A;  3W7T A;  1HNZ O;  5J2T B;  1BZK A;  4PA6 A;  3ETD A;  4JYC A;  2AHZ A;  4LF7 O;  1IBL O;  5LYJ A;  1VQ6 V;  1LR1 A;  3OFN G;  3QVN A;  4DYL A;  4JI7 B;  4X1Y B;  1VQO V;  4YIP A;  1VQ8 V;  2VWK A;  2F95 B;  3L9D A;  1MG1 A;  4OX9 B;  3UQ8 A;  2F43 G;  3CCR V;  3T1Y O;  3UM7 A;  4DR1 O;  1JMK C;  2R9A A;  3M8A A;  1LNQ A;  4YJ2 B;  2GUZ A;  1SS3 A;  4LF6 B;  1BHA A;  3HKC A;  1RFY A;  4WFF A;  1NVP D;  4BIO A;  3FB6 C;  2QM8 A;  1RM1 B;  1XMO B;  4JI7 O;  2XAG A;  2DYR C;  4TV8 A;  5CA0 A;  2HHH O;  4CH4 A;  4B3S B;  3ZHS A;  1AP6 A;  4ZBM A;  2DOS A;  4UXN A;  1RPO A;  3B09 A;  3ZX6 A;  2ZDI C;  4G2K A;  3JAK B;  3W7S A;  1JX9 A;  3TK1 A;  3Q4H B;  2E74 B;  3R66 A;  3SYQ A;  3STZ C;  1AJN A;  2KB1 A;  1UPG A;  4JYB A;  2HG5 C;  1BQ0 A;  1DLB A;  2P06 A;  2JS3 A;  1FYJ A;  4I5S A;  1XRE A;  2F4V B;  2ZE7 A;  3HKB B;  5JH7 A;  5KHJ A;  3BVO A;  4I7Z B;  3C3T A;  2NNU A;  1FAF A;  2A06 H;  2YXL A;  1QLN A;  2JEU A;  4B3R O;  4JI8 O;  1YXB A;  2FML A;  1JOY A;  1QBZ A;  3CEI A;  4B3T B;  2UUC O;  4DV3 B;  2JGD A;  4LF4 B;  4X64 O;  2DWE C;  4ABM A;  1WA8 A;  4MW3 A;  4PEL A;  5LHI A;  4MTF A;  2E5L B;  1YI2 V;  2NN4 A;  1I08 A;  1YTF D;  3ABL B;  1Q3E A;  4Z1V A;  1P4R A;  3K3W A;  2IW5 A;  4JI1 B;  2DN9 A;  5C8Y A;  2WLL A;  3JCZ A;  1AR4 A;  2XAH A;  2OIE A;  3ZHU A;  1JJ2 U;  4DV2 O;  4IGG A;  3KKY A;  4TSF G;  3S3X A;  1V9P A;  4DK0 A;  3P30 A;  4FLZ A;  4FZ1 A;  4I55 A;  5EBL C;  3ML0 A;  5CMU A;  4BR6 A;  5LGN A;  3ETQ A;  2VS0 A;  4GX2 A;  3RYC A;  2H3O A;  4GKJ O;  1LUW A;  1YEW A;  5HFL A;  2P22 C;  1Q5O A;  2WLI B;  4QJF B;  5DN6 G;  4DV6 B;  2WLK A;  4TUY A;  3ICX A;  4OXS A;  4DV6 O;  2JVD A;  2Q67 A;  3OE7 G;  4UB6 Z;  4RQF A;  4PA9 A;  4LCU C;  3HKE B;  2OT5 A;  4JPR A;  1GN6 A;  2D2C B;  2LP7 A;  1EN5 A;  1U96 A;  1FXK B;  3U10 A;  5EK0 A;  3E83 A;  3WFV A;  4I4T B;  2VQE O;  2CUG A;  4LF5 B;  5KMG B;  1SQV H;  1IDS A;  1OJH A;  1R3I C;  2CE4 A;  3E86 A;  3THO A;  4O4I A;  3O9O A;  4CH5 A;  3T4Z A;  4JTC B;  3T1H O;  1N33 O;  4B7K A;  4NYK A;  4QPK A;  1GTO A;  4G28 B;  5LXT B;  5IYC O;  1LUV A;  5EBW C;  2ZD9 A;  4J7J A;  4JYY A;  1M57 C;  3E8F A;  5E79 Z;  3HKD B;  3H1H H;  2Q7G A;  3RYI B;  2ZIM A;  3OUF A;  4LF4 O;  3E22 A;  2Z0A A;  1AI5 A;  3X2Q C;  5D5Q A;  2V4D A;  1XNQ B;  1VQ4 V;  3D36 C;  4DW0 A;  2DYR B;  1AR5 A;  4DV7 O;  2HFE C;  3SJC C;  1NU1 H;  3OUS A;  1YSC A;  4UCU A;  4ZI7 A;  5J2U B;  3E35 A;  5H2F Z;  3ZHV A;  4PA4 A;  2DYS C;  2UXC O;  4P2Z A;  1GN3 A;  5EIB D;  2OTJ V;  4FPP A;  4JI1 O;  1DGS A;  4DRX B;  1FS0 G;  1SF9 A;  3CXH F;  4K8Z A;  3I56 V;  4RO2 A;  3SGI A;  3J81 N;  5CB4 A;  5LA6 B;  1AJP A;  2Y4T A;  5KHI A;  2ODM A;  1XUQ A;  4TWK A;  4DW1 A;  2Q6A A;  4IYH A;  1Q6U A;  2PTM A;  4JYA O;  2ZKO A;  3LDE A;  1Y4M A;  1N32 O;  4B7E A;  1Q8I A;  1VQM V;  2ZXW C;  2ZIN A;  1FKA O;  2CGO A;  1VF6 C;  4O2B B;  1VF5 B;  1K8A W;  2CTR A;  1N34 O;  2PYJ A;  3KG2 A;  2YID A;  3I5D A;  1J95 A;  4HNA A;  3LSS A;  4YJ3 B;  1L8D A;  1AR1 B;  1NTZ H;  3DXR A;  2F4V O;  1IXM A;  2XAQ A;  2YI8 A;  1RSO B;  3JAK A;  4BW9 A;  1VQL V;  3JD1 A;  4D7T A;  4I9Q A;  4MW8 A;  2W0F C;  3K08 A;  1H2M A;  4J7Z A;  3N2G A;  1MZF A;  3O65 A;  2DWD C;  2ZE5 A;  3B8M A;  1EZV H;  1T5E A;  2Q5Z A;  3W7U A;  5KUK A;  1YIT V;  4B3S O;  5JH7 B;  3AK2 A;  2IU3 A;  2Q68 A;  5EZY B;  1V55 C;  1K97 A;  1XMO O;  2ZNI A;  1S5J A;  1WB7 A;  2ZR3 A;  2PGG A;  4K0K B;  1N0N A;  4QPJ A;  1KKD A;  2QWP B;  2FL4 A;  4XDJ A;  3IFX A;  3JD3 A;  2QWQ B;  3OEH G;  2JGD B;  3J80 N;  1AP5 A;  5B66 Z;  3CCJ V;  2LW7 A;  4NTX A;  5B3S C;  4JAU A;  3FB8 C;  4BIU A;  2N05 A;  1ZX3 A;  3U11 A;  2B9Z A;  3JAT A;  4W4K A;  3CXC U;  3SPJ A;  4HZ3 A;  1TAE A;  2Q9L A;  4MVR A;  4DR4 O;  3SYC A;  4FZ0 A;  1YVW A;  1JA8 A;  4GLX A;  1L1F A;  3CC2 V;  3SPC A;  1S5L Z;  3LNM B;  4XDK A;  2HKO A;  4RQE A;  1XMQ O;  4EEQ A;  4KXR A;  4I50 B;  3WU2 Z;  5GTI Z;  1Y67 A;  3LDC A;  4PA3 A;  2R72 A;  1GM8 A;  4CC6 A;  4JI6 B;  4JI5 B;  3DC6 A;  4LWS A;  1VQK V;  3RT3 C;  1OCR C;  4LFB O;  4FJC C;  2Y0P A;  2BOB C;  3JD2 A;  3EVK A;  4LFC B;  3BFR A;  1SZT A;  5CN0 A;  2ARH A;  1DK1 A;  4JZG A;  4K8X A;  2QKS A;  1BHB A;  4ASU G;  3GB7 C;  1B04 A;  4Q6G A;  5KA5 A;  3UT5 A;  3B40 A;  3WG7 C;  1VMG A;  1PP9 H;  5LGT A;  4I4T A;  1M56 C;  2FKX A;  2Y69 C;  3T4D A;  5KMG A;  3J7A U;  4X65 O;  4ZKI A;  2ADP A;  2M7W A;  3E2E A;  1KBH A;  4LR3 A;  4O4I B;  1YJ9 V;  5L3E A;  4AI8 A;  3BCC H;  4O4J B;  1NQT A;  4LF8 O;  1PL0 A;  2B5U A;  1RP3 B;  4DUZ B;  3RWR D;  2EIK C;  2PYL A;  4N21 A;  5B5E Z;  1K5Q A;  5LXT A;  4FFB A;  3RYF A;  2DE0 X;  5JVD B;  3RYI A;  4DO2 A;  1XL6 A;  2VWJ A;  3AG2 B;  2QSA A;  3ABU A;  1E1Q G;  3TCU A;  5LOV B;  2PF4 E;  1H38 A;  4FVM A;  1JCH A;  4UUJ C;  2EIJ B;  1FFT B;  2YI9 A;  3BA8 A;  1PD3 A;  5B1B C;  4O4H B;  2WLH A;  5J2U A;  1QHT A;  2EIK B;  3JAR B;  4AIL C;  2IH1 C;  3K5L A;  4D6T H;  1PNK A;  1JFF B;  4MVQ A;  1KQS U;  4X1I B;  2O57 A;  1Q82 W;  3K0G A;  1R3L C;  3AG3 C;  1H2N A;  1A32 A;  1B3Q A;  1SQF A;  4GKK B;  4PI2 A;  1I5Y A;  5CB4 B;  5L3B A;  1BSM A;  3L74 H;  4J10 A;  1Z5W A;  2CTW A;  1NKD A;  1SA0 B;  1TGO A;  1WP7 A;  2XOK G;  2E5L O;  4DR2 O;  2CAZ C;  2EJ7 A;  4P30 A;  4WFG A;  5B1B B;  3A0R A;  1NH2 B;  2UUA O;  4R8C A;  5IYD O;  4GZR B;  5LHG A;  2ITD C;  2UXD O;  1Q86 W;  5H6Q A;  3CRR A;  1QU7 A;  2W6I G;  2QJ1 A;  1E79 G;  5ITZ A;  1R3J C;  2UUB B;  1BT8 A;  4JI3 B;  1WNS A;  3OAA G;  1MSW D;  3OR6 C;  2HEP A;  1FXV A;  1Z5V A;  3DXR B;  1RSO A;  2YUA A;  3AK1 A;  2LO1 A;  1R6T A;  2F93 B;  4TV9 A;  1KP3 A;  4JAS A;  2X6C A;  4JAV A;  1P7G A;  2HP8 A;  3ASO B;  3MD0 A;  2GHY A;  5KX5 B;  3K5M A;  1QCE A;  1G6U A;  3CME V;  4B3M O;  4UCR A;  2EIM B;  2KSD A;  1CPY A;  4X89 A;  5L3C A;  2RQ6 A;  3KZI Z;  1S76 D;  2AHY A;  3MDS A;  3HKC B;  3L70 H;  1HNX B;  1TUB B;  3H1J H;  2BE3 A;  3ZBH A;  4JZ2 A;  3L71 H;  1L0L H;  3H01 A;  4TV8 B;  5CA0 B;  1OV9 A;  1I94 O;  2ZR2 A;  4LH6 A;  4QIW F;  1EBO A;  5AG2 A;  1NT2 B;  4UVB A;  5KLV H;  4P9P A;  1QR8 A;  2A7W A;  4WFA V;  2P6J A;  2Z5U A;  4JAA A;  1R6N A;  3JAT B;  3K9S A;  1OCR B;  5TIS Z;  4OGQ B;  1S72 V;  3UKM A;  4EFB A;  1XHZ A;  3S3W A;  5CBH A;  4EKW A;  1YF2 A;  1M93 A;  3HKB A;  4X9Q A;  1VP7 A;  1XQ8 A;  1E1R G;  4NTY A;  4U3J A;  3ZN0 A;  3ZRV A;  1SQQ H;  3VBB A;  1MAB G;  1BCC H;  4XDL A;  4GYC B;  4FM0 A;  4MVU A;  3CC4 V;  4DV1 B;  2LGQ A;  4X64 B;  5IJ0 B;  4R7C A;  2ZE6 A;  3CRQ A;  1NR7 A;  4UFZ A;  1K7D A;  4LNU B;  4DR3 O;  5JQG B;  2BTO A;  2UUC B;  1H2S B;  4LFA O;  1IZ3 A;  2BOC C;  4IHJ A;  1MMM A;  3UO3 A;  2DW4 A;  5L3G A;  3W7X A;  1GM9 A;  5KHK A;  3M99 B;  4FLW A;  2EUL A;  4JI6 O;  1ZL8 B;  5LBQ A;  1VQ7 V;  5CA1 A;  1G1X B;  2GV9 A;  4F6E A;  4DV1 O;  2KKW A;  2ITC C;  2EZO A;  3WB0 A;  1GO3 F;  2GTA A;  5H6R A;  1OZ0 A;  3DGE A;  1XNR B;  3ZMZ A;  3BRC A;  1DTO A;  1XIL A;  3QG5 A;  5EC2 C;  2GBO A;  4KHP O;  1AI4 A;  1NJI W;  1B06 A;  1D2D A;  3CCL V;  2G38 A;  4I55 B;  2IH3 C;  1THZ A;  1AI7 A;  2AGA A;  2F23 A;  4NXN B;  3HB3 B;  2YSU B;  3D36 A;  3IJ4 A;  3F7Y C;  4O4J A;  3CB2 A;  1X59 A;  3L75 H;  4DV4 O;  3CWB H;  3CC7 V;  3DSQ A;  1DF5 A;  3MAQ A;  3SYP A;  4MVO A;  1CXZ B;  1GMG A;  4DR5 B;  2OCH A;  2PY5 A;  2RJZ A;  2Y4U A;  1OHH G;  1K4D C;  4Z2W A;  1YZB A;  3DTU B;  4OX9 O;  2ETN A;  1SQP H;  4FFB B;  2OYQ A;  2V1D A;  3IAY A;  1PM9 A;  1N33 B;  1WJZ A;  1FFX A;  2ZXW B;  3SJQ C;  4NXM O;  4RAI A;  5LP6 C;  5K1P A;  4L8J A;  2PUS A;  1FXK A;  3CSX A;  1ZUQ A;  5KAI Z;  4OPA A;  3TET A;  3CYO A;  5B1O A;  3AG1 C;  2JS5 A;  4UVC A;  2ZM6 O;  1WB8 A;  3GWO A;  4KHP B;  1AI6 A;  3JAR A;  5JJN B;  3JAL B;  3SYA A;  4LF9 B;  3ZED A;  1JFF A;  1Y6X A;  4R50 A;  2Q0O C;  5IYB O;  1K73 W;  4X1I A;  3BAB A;  1IBK O;  1P84 F;  3JSL A;  4X20 B;  3M7M X;  3OTO B;  1XBL A;  2NLJ C;  3VOU A;  2WA3 A;  2EBO A;  1SA0 A;  1AB3 A;  3CMA V;  4GUN A;  3SJB C;  1RPR A;  1K92 A;  2IM9 A;  1SET A;  4PJ0 Z;  3E22 B;  3QO8 A;  5EC1 C;  3SYO A;  3AEI A;  1NTK H;  3FB7 C;  3AG4 B;  4B3M B;  3I55 V;  1I5X A;  2JRI A;  3OMI B;  3LDD A;  3RBZ A;  4WBN A;  5LP6 A;  3EFF K;  4ZI7 B;  4YIO A;  3QF7 A;  5E1A C;  2VQF B;  4PDV A;  3SDL A;  3H9V A;  2XAF A;  2F1M A;  4CS3 A;  5H5N A;  2EIL C;  4JI4 O;  3C3S A;  1PNM A;  2QKC A;  2QM7 A;  1SZX A;  4UB8 Z;  2VQF O;  5BY1 A;  3DC5 A;  4DR7 O;  4H33 A;  1VAR A;  2BTQ B;  4UV8 A;  2OWO A;  4LF5 O;  1YTF B;  2ZCE A;  3T2M A;  4TV9 B;  3AG4 C;  1HW7 A;  5IJ9 B;  1K34 A;  4DV5 B;  1AVM A;  2PI4 A;  2Q69 A;  1FPO A;  3K0D A;  4HAM A;  4O2A A;  5KX5 A;  2KG7 B;  4UVA A;  2IJJ A;  3HR0 A;  5F2V O;  3OD4 A;  3ZIA G;  2DYS B;  3EHB B;  2YS8 A;  2CDY A;  4RWU A;  1M57 B;  2QA4 V;  2PZS A;  1TUB A;  3AG2 C;  4DR5 O;  1SRY A;  2RDC A;  1WPX A;  3JCU Z;  2B1G A;  4JTD B;  2AW9 A;  4JI5 O;  4KFM A;  2A0L A;  4HNA B;  2LW1 A;  2Y48 A;  4H0L B;  3STL C;  4CC5 A;  1M9N A;  4DR7 B;  2YIB D;  1QLE C;  3FKS G;  1AJQ A;  2VQE B;  3H1I H;  5H9C A;  4LH7 A;  5IT9 N;  4U7N A;  4X66 B;  3N2K A;  5CBG A;  3K9A A;  2Y0I A;  5LGU A;  3N2G B;  2B1I A;  2CH7 B;  3IC9 A;  3K58 A;  2LFR A;  1ORQ C;  1AIL A;  1NZ6 A;  1OCO C;  4CZZ A;  2QWR B;  3A8T A;  2UUB O;  2XT9 A;  3FD9 A;  2QM4 A;  1WAZ A;  4ICG A;  4J7K A;  4GX0 A;  1V54 B;  5DED A;  2YXY A;  2H8P C;  4FLU A;  3K03 A;  3ZHQ A;  1NTM H;  5IJ0 A;  4L87 A;  3ZMS A;  2N04 A;  4PD4 F;  1SQG A;  1QLE B;  3IC7 A;  4LNU A;  1W2B U;  2RMK B;  1O9G A;  2OCC C;  5JQG A;  1PPJ H;  4B3R B;  3ZRW A;  4DUZ O;  5B1A B;  4EB6 B;  4IIJ B;  3K5N A;  4MVS A;  1JQ0 A;  3OMA B;  5CA1 B;  4DV0 O;  3ZCC A;  4F6R A;  1R3K C;  1VQ9 V;  1PV0 A;  1K5S A;  4ZOL B;  3CCQ V;  3QO5 A;  5JJJ B;  2ZM6 B;  4P9O A;  1N36 B;  1K4C C;  4HBN A;  2JDI G;  3ABT A;  2UU9 B;  2ZIO A;  2EIN C;  2R9I A;  1F4M A;  4I50 A;  1G8M A;  5L3D A;  5IY5 B;  5B3S B;  4DR6 O;  3OTF A;  3NR7 A;  1XI1 A;  4UCV A;  1BGY H;  3AG1 B;  2JIZ G;  4N23 A;  1HDJ A;  1D5A A;  3TJT A;  4LFC O;  4F4L A;  3G4S V;  3W7W A;  1BS3 A;  4FK5 C;  1MSD A;  4LFB B;  4YY3 B;  5J9P C;  2CGN A;  2XTA A;  1IBM O;  2BSK B;  3T1C A;  2YEV B;  3CS5 A;  4WCE V;  1OCC B;  1OCZ C;  2EJR A;  4JTA B;  3RYH A;  4DR1 B;  1JR9 A;  5IWA O;  2QDO A;  3GVM A;  4TQF A;  1P7B A;  5IY5 C;  2CK3 G;  1HNZ B;  5FNV A;  1U97 A;  4JI0 O;  2WWW A;  4RUE A;  2RCV A;  3CRM A;  2EIL B;  5LL6 Y;  2LJ2 A;  4DXW A;  3X2Q B;  4JF3 A;  1H8E G;  5FPR A;  1N36 O;  4K3A A;  2ILM A;  1SQX H;  4JGS A;  4W4L A;  1I0H A;  5LMU O;  3VQY A;  3BA9 A;  1IXB A;  4ZIB A;  4UCS A;  1VIB A;  4X20 A;  1IBM B;  4GX5 A;  1H2K A;  4A5U B;  1I94 B;  1IVS A;  1N34 B;  3WG7 B;  5LHH A;  1HNX O;  1H8H G;  3RYF B;  1SES A;  3F5W C;  2EX3 A;  1QNM A;  1BQZ A;  5LOV A;  3CCS V;  3A0B Z;  2P5O A;  3ZRX A;  4X1K B;  2MK3 A;  2FTK A;  1TVK B;  1JVM A;  4AHC A;  1F4N A;  3B4S A;  3MHH C;  5IYZ B;  1M90 W;  4WBN B;  3JAM N;  1K3E A;  2LQT A;  3K5O A;  5BR8 O;  1ARO P;  1UFI A;  3CCE V;  5KHH A;  1NS1 A;  3ZJZ A;  1HR0 B;  5JWP A;  2HJF C;  1N4C A;  1VF6 A;  1GN2 A;  4NR1 A;  4H37 A;  1B6Q A;  4EFE A;  3APQ A;  2UXC B;  4PHZ A;  3FYI B;  1RM1 C;  4J9Y B;  3ZN1 A;  3TXS A;  5BMV A;  1DF4 A;  4FM1 A;  5LYJ B;  3D3I A;  2H94 A;  4X1Y A;  4CH3 A;  1VQ5 V;  4UCT A;  3RVY A;  2KG7 A;  4H44 B;  5FPO A;  4GCZ A;  3A2F A;  5A9G A;  3WB2 A;  1MNG A;  4PI0 A;  4I0X A;  5HFM A;  1XEQ A;  1YDX A;  2PI5 A;  3ZMV A;  4FLX A;  3T1H B;  2DJV A;  1KD1 W;  4MTO A;  5B1A C;  5GON B;  2HVK C;  3ABL C;  2IJH A;  2BCC H;  1F7Y A;  1US6 A;  4MVM A;  4X8A A;  2IBZ H;  3RW0 A;  2X7R B;  1FJG O;  1GM7 A;  1KUQ A;  4LBE C;  1ZTE A;  2JJ2 G;  3G71 V;  1Y74 B;  2EZP A;  3H1K H;  2M6Y A;  3RVZ A;  2WLJ A;  3FAV A;  4GT1 A;  3Q4H A;  4J9Z B;  1P49 A;  2R70 A;  4E2L A;  2A79 B;  5FL7 G;  1VQN V;  3N2K B;  1QVF U;  3C90 A;  2CH7 A;  3CP1 A;  1GK9 A;  2HLD G;  1Q6H A;  2IJK A;  4FMT A;  5LMN B;  1KB9 F;  3EXA A;  3D8C A;  3JD0 A;  3VQX A;  2P4K A;  3OMN B;  4CH6 A;  1MOF A;  1ZWI C;  3KCX A;  1ZLZ A;  3ZS8 C;  3JAS A;  2UUA B;  2X0L A;  1HNW O;  3OW2 U;  1HNW B;  3K79 A;  2UXD B;  3BY6 A;  5K1X A;  1HWY A;  1OCC C;  4U7O A;  4WFH A;  1HP8 A;  1YIJ V;  2W0X A;  1WA8 B;  2AZ0 A;  4IIJ A;  3ASN B;  3GWK C;  3ETG A;  5C93 A;  4JI2 O;  1WN7 A;  1R73 A;  2WAM A;  4QE7 A;  4F6R B;  4TOI A;  3CHX A;  5C8Y B;  2P67 A;  3AK3 A;  4ZOL A;  3B2E E;  1Q43 A;  3JAW B;  4GKK O;  1HR0 O;  4DV2 B;  4QGP A;  4DUY O;  1KMI Z;  2QGN A;  2P90 A;  1S5H C;  4U3J B;  5BR8 B;  1MA1 A;  1KC8 W;  1D5N A;  2ATK C;  3FB5 C;  3OM3 B;  1NR1 A;  1SQB H;  3ETE A;  3ABK B;  3ZHR A;  1SER A;  4G27 B;  2DQ3 A;  1FXK C;  3CX5 F;  1EZJ A;  5B1N A;  1L0N H;  3OGC C;  4I9W A;  3OGI B;  4IHJ B;  2Y69 B;  4KP4 A;  4GX1 A;  3E89 A;  2CTQ A;  2WLI A;  1H2G A;  2OTL V;  1MZE A;  4J11 A;  4DV3 O;  1XDC A;  3BPZ A;  4GKJ B;  1F23 A;  1ZSP A;  1ZL8 A;  1Q6I A;  2YEV A;  4OPH A;  2GSM B;  1IBK B;  2OIG A;  1NBM G;  2DMX A;  3JYC A;  1Q7Y W;  2K9P A;  4CS2 A;  4TT3 G;  3HKE A;  1W59 A;  4LF9 O;  3OTO O;  2HVJ C;  4Z1M G;  4LP8 A;  1F51 A;  1X4T A;  2IJI A;  3AG7 A;  5LMU B;  4JV5 O;  3OT7 A;  2GDS A;  2LGW A;  5FNV B;  3G80 A;  1Y76 B;  2AZ2 A;  3F5T A;  1WPB A;  4O4L A;  2JEX A;  2WLN A;  4ZHQ B;  4DR4 B;  2HR3 A;  4K35 A;  3ABM B;  5JCO C;  4X65 B;  1FJG B;  2QTO A;  4JI0 B;  3SJA C;  3CJH B;  2AXT Z;  2EIJ C;  2JGU A;  2ZQM A;  1COW G;  2ADQ B;  5KUM A;  4NXM B;  4U3F H;  1ZAU A;  4LF6 O;  2MW2 B;  1G4Y B;  1N0J A;  2Q4P A;  4CS4 A;  1FFX B;  3FFQ A;  3E8B A;  1ENV A;  5IE9 A;  4X88 A;  4JI8 B;  3OEE G;  4LF7 B;  4NXN O;  1IUR A;  1PNL A;  2QR4 A;  2KQX A;  4X1K A;  4QE9 A;  4B08 A;  5DM6 V;  1UJW B;  3ZHT A;  1GH6 A;  2XUM A;  4HYO A;  4J41 A;  5GW7 A;  1I7F A;  2XHB A;  3FYE B;  1H2L A;  3PJS K;  1IBL B;  1BMF G;  5EBM C;  4NB5 A;  3ZMT A;  1VQP V;  3JAL A;  4R6Z A;  3QTC A;  3IGA C;  4KUM A;  4NKG B;  1XNR O;  5EYP B;  2YIC A;  3VQW A;  3H1L H;  4IYI A;  4BW5 A;  5JCO A;  2NR5 A;  4YXW G;  3CCM V;  2HHH B;  2QWO B;  5BMV B;  4DV0 B;  5LA6 A;  1KYO F;  4UV9 A;  3K06 A;  1J5E O;  1NVP B;  4PA7 A;  1WP8 A;  4RUF A;  5D5P A;  3CPW U;  4MS2 A;  1CP9 A;  2P4V A;  3HPL C;  4LFA B;  1S77 D;  3LNN A;  2HJD A;  2FYU H;  4I0X B;  1R6K A;  1OCZ B;  4JYA B;  3CCU V;  5LP6 B;  4O2B A;  3AG3 B;  2DQ0 A;  5GON A;  5L3F A;  2LFS A;  2Q73 A;  4DR6 B;  1M5I A;  4WF9 V;  4H13 B;  3G6E V;  1GRJ A;  2E3C A;  2UXX A;  4NVP A;  4FLV A;  2WPD G;  4YJ3 A;  3JSN A;  1FXH A;  1TA8 A;  4FM2 A;  1Y74 A;  2QE7 G;  5J2T A;  1BL8 A;  1TUE B;  2XAJ A;  3BAA A;  4YHH B;  3FAV B;  1EFR G;  3MHS C;  4JV5 B;  1GN4 A;  2BTQ A;  4BWA A;  4UCO A;  5IJ9 A;  5KHG A;  3N27 A;  3VQV A;  4DK1 A;  4MVZ A;  1KU9 A;  4WFE A;  5CA3 A;  4O2A B;  5IWA B;  3LUT B;  2Q7H A;  3ABK C;  3BEH A;  4PV1 B;  4BIZ A;  1EN4 A;  4AQY B;  1XNQ O;  4XBF A;  5EZY A;  4YY3 O;  4YJ2 A;  2GUZ B;  2WA4 A;  3P32 A;  3K59 A;  1YJN V;  3TXQ A;  3JAS B;  2XAS A;  2QKA A;  2X6A A;  2P7T C;  1GKF A;  3U0Z A;  2R9R B;  3L73 H;  5A2Q N;  5EIB C;  1N32 B;  1XHX A;  3SPH A;  2UU9 O;  4E4E A;  3D3Q A;  3ASO C;  2YXH A;  1YJW V; 
#chains in the Genus database with same CATH homology
 1QR8 A;  4GX5 A;  3ZMU A;  1QR9 A;  1KEC A;  2V7Q G;  1ROP A;  3JD4 A;  4QPK A;  2P6J A;  1GTO A;  4WFA V;  4G28 B;  2Z5U A;  5IYC O;  1R6N A;  5EBW C;  2W6J G;  3WG7 B;  2ZD9 A;  5LHH A;  2EIM C;  1H8H G;  1OCR B;  1SES A;  3F7V C;  1S72 V;  1M57 C;  3E8F A;  3F5W C;  3UKM A;  1W0J G;  5CBH A;  1W0K G;  3OUF A;  1AI5 A;  3X2Q C;  2QEX V;  4EKW A;  4QNH B;  3B77 A;  1QVG U;  1VQ4 V;  4MTX A;  1E1R G;  4PDR A;  3CCS V;  2DYR B;  4PDM A;  3ZRX A;  2MK3 A;  3ZN0 A;  4BAY A;  2FTK A;  3ZRV A;  3NXS A;  1JVM A;  2HFE C;  3VBB A;  1MAB G;  3K04 A;  1F4N A;  1YHQ V;  3MHH C;  4XDL A;  3OUS A;  1M90 W;  4MVU A;  3CC4 V;  1YSC A;  1S3J A;  1Y66 A;  1K3E A;  4R7C A;  2C2A A;  1NR7 A;  3E35 A;  2D3O W;  1K7D A;  3QNE A;  4Q20 A;  1ARO P;  4PA4 A;  2DYS C;  4P2Z A;  3CCE V;  5KA6 A;  2OTJ V;  3E8G A;  1M56 B;  3ZJZ A;  4FPP A;  2BOC C;  2HJF C;  1FS0 G;  2DW4 A;  2IU0 A;  3ZRW B;  5L3G A;  3W7X A;  1GM9 A;  4H37 A;  3I56 V;  3M99 B;  4RO2 A;  4PDL A;  1B6Q A;  3SPG A;  4CBC A;  3FYI B;  1RM1 C;  4J9Y B;  3ZN1 A;  5LBQ A;  1OCO B;  1VQ7 V;  1DF4 A;  5BZB A;  1AJP A;  3D3I A;  2H94 A;  2EZO A;  2ITC C;  4LC1 A;  4TWK A;  2WLL B;  2Q6A A;  1GO3 F;  4MTG A;  5H6R A;  1OZ0 A;  1V54 C;  3DGE A;  1VQ5 V;  3ZMZ A;  3RVY A;  3LDE A;  1Y4M A;  1DTO A;  4GCZ A;  4MSW C;  5EC2 C;  5HFM A;  1AI4 A;  1NJI W;  1VQM V;  2PI5 A;  2OCC B;  3ZMV A;  3CCL V;  3OR7 C;  2IH3 C;  1KD1 W;  1THZ A;  2ZXW C;  1AI7 A;  3LSQ A;  4MT8 A;  3R65 A;  1K8A W;  4MTO A;  5B1A C;  2HVK C;  3HB3 B;  3KG2 A;  3ABL C;  2YSU B;  3D36 A;  3F7Y C;  3QO7 A;  1V55 B;  2IJH A;  1J95 A;  4X8A A;  4MVM A;  3RW0 A;  3CC7 V;  2X7R B;  1DF5 A;  1GM7 A;  3LSS A;  3SYP A;  4MVO A;  4LBE C;  1GMG A;  1AR1 B;  1IXM A;  2JJ2 G;  2XAQ A;  3G71 V;  2EZP A;  1K33 A;  1NH2 D;  2JJ1 G;  3RVZ A;  1VQL V;  2WLJ A;  4GT1 A;  1OHH G;  1K4D C;  4J9Z B;  3DTU B;  4E2L A;  3JD1 A;  2A79 B;  4MW8 A;  2W0F C;  3K08 A;  5FL7 G;  1VQN V;  2V1D A;  1QVF U;  2A9H A;  2ZXW B;  3SJQ C;  3CD6 V;  3CP1 A;  1GK9 A;  2DWD C;  2HLD G;  4RAI A;  3B8M A;  2EIN B;  3W7U A;  2UXN A;  2IJK A;  4FMT A;  5KUK A;  1YIT V;  3E8H A;  1FXK A;  2IU3 A;  3SPI A;  2Q68 A;  3JD0 A;  1V55 C;  1KP2 A;  3TET A;  3CYO A;  1K97 A;  5B1O A;  3AG1 C;  3OMN B;  1MOF A;  1ZWI C;  2ZR3 A;  4UVC A;  2Z3Y A;  4WFB V;  4QPJ A;  1KKD A;  2X0L A;  3GWO A;  3OW2 U;  1AI6 A;  1S0V A;  4XDJ A;  3SYA A;  3IFX A;  3K79 A;  3BY6 A;  3JD3 A;  1N8R W;  3OEH G;  1HWY A;  2WLM A;  4R50 A;  5IYB O;  1OCC C;  4U7O A;  1K73 W;  4WFH A;  1M1K W;  3CCJ V;  1YIJ V;  2WSS G;  5B3S C;  2X6B A;  3ASN B;  2XND G;  1WLE A;  3ETG A;  4JAU A;  3FB8 C;  4BIU A;  5C93 A;  5IDJ A;  1R73 A;  2WAM A;  2NLJ C;  3VOU A;  4QE7 A;  4FIP C;  2EBO A;  3CXC U;  3CMA V;  2P67 A;  1XL4 A;  3SPJ A;  2JK5 C;  4HZ3 A;  1RPR A;  1K92 A;  4MVR A;  3CCV V;  1SET A;  1JPX A;  3SYC A;  3QO8 A;  5EC1 C;  3SYO A;  1L1F A;  3CC2 V;  3SPC A;  3AEI A;  2P90 A;  3FB7 C;  1S5H C;  3AG4 B;  3LNM B;  5CBF A;  3I55 V;  1KC8 W;  1I5X A;  4XDK A;  2ATK C;  2HKO A;  4RQE A;  3OMI B;  3FB5 C;  3OM3 B;  3LDD A;  3RBZ A;  3EFF K;  1NR1 A;  2K1E A;  3ETE A;  3ABK B;  1SER A;  2ZDI A;  5E1A C;  3ASN C;  4G27 B;  2DQ3 A;  1PKX A;  3LDC A;  1FXK C;  1EZJ A;  4PA3 A;  4PDV A;  3ZRS A;  1GM8 A;  5B1N A;  3OGC C;  2XAF A;  4I9W A;  2EIL C;  1K9M W;  1CEZ A;  1VQK V;  1Q81 W;  2Y69 B;  1OCR C;  3ABM C;  3B8N A;  4FJC C;  4KP4 A;  1PNM A;  4GX1 A;  2BOB C;  3W7T A;  3E89 A;  2WLI A;  3JD2 A;  1H2G A;  2QM7 A;  2OTL V;  4PA6 A;  3ETD A;  1F23 A;  4JYC A;  4H33 A;  2YEV A;  2AHZ A;  2GSM B;  4UV8 A;  1YTF B;  3OFN G;  1VQ6 V;  1NBM G;  3T2M A;  1SZT A;  3JYC A;  3AG4 C;  5CN0 A;  1Q7Y W;  1VQO V;  1VQ8 V;  1K34 A;  4TT3 G;  2PI4 A;  2Q69 A;  2QKS A;  3K0D A;  1BHB A;  4HAM A;  2HVJ C;  4ASU G;  3GB7 C;  4UVA A;  4Z1M G;  1MG1 A;  2IJJ A;  4LP8 A;  1F51 A;  2IJI A;  2F43 G;  3CCR V;  3ZIA G;  2DYS B;  3EHB B;  3UM7 A;  5KA5 A;  3WG7 C;  5LGT A;  2JEX A;  1M56 C;  1LNQ A;  1M57 B;  2WLN A;  2QA4 V;  2HR3 A;  2Y69 C;  3T4D A;  3ABM B;  1BHA A;  3AG2 C;  4WFF A;  1NVP D;  4ZKI A;  1SRY A;  2M7W A;  2QTO A;  3FB6 C;  2QM8 A;  3E2E A;  1WPX A;  1RM1 B;  1YJ9 V;  2B1G A;  4JTD B;  2XAG A;  5L3E A;  2DYR C;  2EIJ C;  2ZQM A;  1NQT A;  4KFM A;  1COW G;  2A0L A;  4ZBM A;  1PL0 A;  2Y48 A;  2B5U A;  4UXN A;  3STL C;  1RPO A;  5KUM A;  1M9N A;  2EIK C;  2ZDI C;  4G2K A;  1QLE C;  4N21 A;  3FKS G;  3W7S A;  1JX9 A;  1AJQ A;  3TK1 A;  5H9C A;  1K5Q A;  4U7N A;  1G4Y B;  3K9A A;  3SYQ A;  5CBG A;  5LGU A;  2B1I A;  1AJN A;  3STZ C;  2KB1 A;  2LFR A;  1ORQ C;  3E8B A;  1ENV A;  4JYB A;  4X88 A;  2HG5 C;  4DO2 A;  1DLB A;  1XL6 A;  3AG2 B;  3OEE G;  3ABU A;  4I5S A;  1E1Q G;  3TCU A;  1OCO C;  4CZZ A;  1H38 A;  1PNL A;  1JCH A;  4UUJ C;  2EIJ B;  1FFT B;  4QE9 A;  5DM6 V;  1UJW B;  4GX0 A;  1V54 B;  2NNU A;  1QLN A;  2JEU A;  2H8P C;  4HYO A;  3K03 A;  1PD3 A;  5GW7 A;  5B1B C;  1JOY A;  4L87 A;  3FYE B;  2WLH A;  3PJS K;  1QBZ A;  3ZMS A;  1BMF G;  5EBM C;  2EIK B;  3ZMT A;  1QLE B;  1VQP V;  2IH1 C;  3IC7 A;  1W2B U;  4R6Z A;  1PNK A;  3IGA C;  4KUM A;  2OCC C;  4MVQ A;  1KQS U;  2DWE C;  1Q82 W;  4BW5 A;  3K0G A;  3ZRW A;  1R3L C;  4MW3 A;  3AG3 C;  4PEL A;  5LHI A;  4MTF A;  5B1A B;  1YI2 V;  4MVS A;  4YXW G;  3CCM V;  1I5Y A;  1JQ0 A;  1YTF D;  3ABL B;  5L3B A;  3OMA B;  1P4R A;  3K3W A;  2IW5 A;  4UV9 A;  3K06 A;  3ZCC A;  1NKD A;  1R3K C;  1VQ9 V;  2WLL A;  1NVP B;  3JCZ A;  1K5S A;  2XOK G;  4PA7 A;  2XAH A;  3CCQ V;  4RUF A;  3QO5 A;  3CPW U;  4P30 A;  4WFG A;  4MS2 A;  1CP9 A;  5B1B B;  3A0R A;  1NH2 B;  1JJ2 U;  4R8C A;  3HPL C;  1S77 D;  5IYD O;  4P9O A;  5LHG A;  1R6K A;  4TSF G;  1OCZ B;  1K4C C;  2ITD C;  1Q86 W;  2JDI G;  5H6Q A;  3P30 A;  3CCU V;  3ABT A;  5EBL C;  3ML0 A;  2W6I G;  5CMU A;  2EIN C;  3AG3 B;  1E79 G;  1F4M A;  2R9I A;  5LGN A;  1R3J C;  1G8M A;  2DQ0 A;  5L3D A;  5IY5 B;  5B3S B;  5L3F A;  2LFS A;  4WF9 V;  3G6E V;  2UXX A;  4GX2 A;  3OAA G;  3AG1 B;  2JIZ G;  4N23 A;  2WPD G;  1MSW D;  3OR6 C;  4F4L A;  3G4S V;  1FXV A;  5HFL A;  3W7W A;  4FK5 C;  1FXH A;  2WLI B;  2QE7 G;  5J9P C;  1BL8 A;  1TUE B;  2XAJ A;  4QJF B;  3T1C A;  5DN6 G;  2WLK A;  4OXS A;  1EFR G;  2YEV B;  3MHS C;  4WCE V;  1OCC B;  1OCZ C;  2EJR A;  1KP3 A;  4JAS A;  2X6C A;  2Q67 A;  3OE7 G;  4RQF A;  4JTA B;  4PA9 A;  4JAV A;  4LCU C;  4MVZ A;  2OT5 A;  3ASO B;  4WFE A;  3MD0 A;  5CA3 A;  2GHY A;  3LUT B;  4JPR A;  1P7B A;  3ABK C;  5IY5 C;  3BEH A;  4BIZ A;  2LP7 A;  1QCE A;  2CK3 G;  3CME V;  1FXK B;  4XBF A;  2WWW A;  4RUE A;  5EK0 A;  3E83 A;  3WFV A;  2EIM B;  1CPY A;  2EIL B;  3P32 A;  4X89 A;  5L3C A;  1S76 D;  2AHY A;  1YJN V;  4DXW A;  2XAS A;  3X2Q B;  1R3I C;  4JF3 A;  1H8E G;  3E86 A;  2X6A A;  2P7T C;  1GKF A;  2R9R B;  3H01 A;  4JGS A;  2ZR2 A;  4QIW F;  3SPH A;  1EBO A;  4UVB A;  3ASO C;  3T4Z A;  4JTC B;  4P9P A;  1YJW V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...