3OGFA

Crystal structure of difoil-4p homo-trimer: de novo designed dimeric trefoil-fold sub-domain which forms homo-trimer assembly
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
81
structure length
81
Chain Sequence
PVLLKSTETGQYLRINPDGTVDGTRDRSDPHIQFQISPEGNGEVLLKSTETGQYLRINPDGTVDGTRDRSDPHIQFQISPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental support for the evolution of symmetric protein architecture from a simple peptide motif.
pubmed doi rcsb
molecule keywords de novo designed dimeric trefoil-fold sub-domain which forms
molecule tags De novo protein
source organism Synthetic construct
total genus 14
structure length 81
sequence length 81
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3ogfA00
1T4QA 2D24A 1E0OA 3K1XA 4DCKC 4LO0C 3BA7A 2DREA 2VSAA 3BA4A 3UJ0A 2GO2A 1QXMA 2DRYA 1XZZA 4IZXA 4KC3A 1ISWA 1G9AA 1MD6A 1Z2VA 3IIRA 3HMYA 4XFSA 3WMVA 3RTIB 2I1BA 5FZUA 3AKFA 2KI4A 3HBWA 3CQAA 4I4SA 3LTQA 4I96A 2BEBA 4I4PA 1FWUA 1FGAA 41BIA 1PC8B 3HALA 5BP5C 2XOAA 1V6XA 4R6UB 2D1ZA 3WO2A 1G9BA 1ISZA 1DIWA 1JY0A 3O44A 1BFGA 2D20A 4I4RA 3A07A 1RZOB 3CA5A 3RMXA 5FZYA 4IONA 1DFQA 4JKQA 4QALA 3HOMA 3IM6A 1AVXB 1JT4A 4FVVA 3E8LC 1EVTA 4LO1A 1OQLB 1XG6A 2ET2A 4ZOTA 3PUBA 4XKIA 2F8XC 4G6JA 3FJJA 1UPSA 3FJIA 1VCLA 3BRDA 3VT1A 5BVPI 2M49A 4HR6C 1GGPB 3R4SA 3FUQA 2FFUA 1TWEA 3H6QA 1WD3A 1WBCA 3FJBA 2MIBA 8I1BA 3VT0A 3BAOA 5BQUC 1Q04A 2RG9B 3O4AA 3A21A 4Q9PA 5EC5A 1PZZA 3BAGA 4I8MA 4LO1C 3UDAA 2UUSA 1ISXA 1IHKA 3WO4A 3BA5A 4ZFYB 1W3AA 4XFTA 3H6SE 3FJHA 2KI6B 4Z9WB 2Q3NB 2FDBM 1R8NA 3O4CA 1Q03A 4X39A 1PUMB 1I1EA 3RTJB 1JLYA 4QD2C 3ZX7A 4I1BA 3Q7YA 3FJCA 4GP3A 3A22A 3OJMA 4QC4A 4IY9A 4JP0A 3FJAA 4KEIA 1Z0HA 4II0A 4KEKA 5D61A 4P6AA 3VWCA 4J2YA 4GAIA 3VSZA 2AAIB 3PMEA 3BRGC 1S0EA 3BAVA 4I0YA 4EB2B 3V79C 4IHZA 3R4UA 1IJTA 1AF9A 5FZZA 4I7IA 3I2AA 1DJSB 4LO2A 2DS0A 1AVWB 4P0LA 1I1BA 4DEPA 4OEGA 3AH4A 4QKRA 3LLPA 2WRYA 3NBEA 1NZKA 2P39A 3B9UA 1SR4A 1A8DA 4I4XA 1Q1UA 2K43A 3AZVA 3F1RA 3QYDA 3BRFA 1TOOA 3AJ6A 2BFHA 4ISQA 4Z8SB 1JT5A 2HWMA 1DQOA 1FV3A 1DLLA 2Z48A 3CRGA 3IAGC 4D8HA 3FGMA 4LO2C 4J2XA 3H6RB 4EFRA 4I4UA 2RQ9A 1NUNA 4LO7B 21BIA 1S0LA 1M16A 2QYIB 4ZFUB 3FUOA 4H9WA 4LO3A 3SNVA 3UD9A 3O3QA 3I2XA 3CA6A 3O4DA 4ZLBB 1DQGA 3BAHA 3CA3A 4J2SA 3S8KA 3JRRA 3T8SA 3JUTA 1PUUB 1HCEA 2HZ9A 3BAUA 3VEQA 4I2SA 3FJDA 5EHAA 2VU9A 1G9DA 5HPZA 1CE7B 1TP0A 2L5XA 3IM5A 1L2HA 3O4OA 2ZR1B 4H04A 2LIQA 3POKA 1IRAX 3ZXGA 3Q7WA 4X3AA 2K4AB 2HWAA 1JT3A 4ZFWB 3ZC8A 1ISVA 4LO3C 1G82A 3OJVA 2Y9FA 3AH1A 3V0BA 3KMVA 3VSFA 4Q9GA 1AXMA 1FQ9A 2D23A 4ZBVB 7I1BA 4OWKA 1HKNA 1S0BA 4IQPA 4I37A 3P6JA 31BIA 4J23B 1BFBA 2E4MA 1AVUA 2F2FA 3WA1A 1JTCA 4P0JA 3WINA 3OBTA 5BXSA 2MLLB 3H6RA 3UD8A 1J0SA 4P0KA 1WBAA 2NVHA 2ZQNA 1QQLA 3MPPG 3EF2A 2D43A 1WD4A 3RSJA 2P23A 3CA0A 3NJ5A 3N7LA 1IT0A 2Z49A 1CVSA 1W3GA 2R9KB 4LO8B 3CRIA 1FWVA 1YF8B 1TFMB 2E4MC 1BA7A 1HCDA 3WINC 3D7WB 2NZ9A 4OWJA 1IRPA 4IYBA 3HN1A 1FV2A 2QN4A 3AKIA 1RG8A 4X37A 4QBCA 1YXWA 5B2HA 4A7YA 5FNXA 1XHBA 2FO1A 3V0AB 3O5WB 4GOYA 6I1BA 4JQ0A 2KLLA 3OGGA 1BLAA 1BARA 2FFVA 3FJKA 4JPZA 4OEEA 5JLVA 4LO0A 3ZC9A 1Z4SA 1BLDA 4OUJA 3QR5A 2RSTA 3O4BA 3C9ZA 3WO3A 5F8YA 4AN6A 2YUGA 3IM7A 4JAWA 1JQZA 1JLXA 5DVHA 1V6UA 3BAQA 4D0ZA 4PC4A 1QQKA 4I4VA 4IY8A 1S0CA 4F83A 5E24E 4I4OA 1ONKB 5EG6C 4OWLA 1V6WA 1AVAC 3ZXDA 3S8JA 1V6VA 1N4KA 1II4A 1KNMA 4HA2A 3OBRA 3HSMA 4F34A 1DFCA 5BP5A 5BOWA 1SR4C 3AKHA 4QD2B 2NM1A 3CA4A 4JKXB 1FMMS 3FJ9A 2D44A 3N0KA 4L4HA 4DENA 3AZWA 3MALA 2D7IA 5F90A 1RY7A 4ZGRB 2X2SA 4A7KA 3AJ5A 5I1BA 2VLCA 3NBCA 3OJ2A 3BX1C 3TC2A 4FGFA 4J2KA 1S0GA 1YYNA 1PWAA 4I4YA 3V0AA 4AN7B 4KBBA 1ITBA 4USOA 3CA1A 4OW4A 4GOVA 1AFCA 1S0DA 1FMZA 2KKIA 3CU1B 3FJFA 3N7KA 1DZDA 2D22A 3NBNA 5JMCA 2Y9GA 4G9NA 1BFFA 4ZA3B 3NBDA 1T9FA 5BQUA 1W3FA 1HWMB 4ENDA 5F8SA 3VUOA 3ILAA 1HWPB 2VXTI 4YOLA 2GZBA 5BXTA 3BADA 4OEFA 3BB2A 2WBCA 3UD7A 5D63A 4ISRA 4I3NA 4Q91A 4G1RA 4QO3A 2FGFA 2NTDA 1BFCA 1D0HA 3AH2A 4IZEA 3VT2A 3PG0A 1HWNB 2VXRA 2MC2A 1RMLA 1K5VA 1K5UA 4WBCA 1P63A 1EV2A 2AFGA 2DRZA 4G9MA 4G6MA 3FJEA 4QKSA 4GAFA 4USPA 5DZUA 5FNWA 2BEAA 1IILA 3F62B 4L4IA 2ZQOA 1SZ6B 3UJ4A 3WMUA 4EEEB 4ZKTB 2F2FC 4A7ZA 2ERMA 4KEJA 5DSSB 3N7JA 3W9TA 1TTUA 1YTOA 1HWOB 1IOBA 2NP0A 1ILR1 4LO7C 4HJJA 2IHOA 5BXRA 3CRHA 1HIBA 1EYLA 1XYFA 3OGFA 1TWMA 3O49A 3Q7XA 4I4QA 3A23A 5DUYA 2ESUA 1G9CA 2AQZA 2IWTB 3FJ8A 1EPWA 4GP0A 4I1EA 2KH2A 2Q9XA 3CAHA 3N7MA 2K8RA 1TIEA 3PHZA 2VSEA 4D0TA 2AXMA 1MC9A 4CJMA 4EFPA 4JRAA 1F31A 2NYYA 4QBVA 2VUAA 3I29B 2D7RA 5G00A 3AKGA 9ILBA 1FN0A 2J3PA 1R8OA 5D62A 1DZCA 2HW9A 2X2TA 3FFZA 5F8WA 4XFUA 4EFQA 2LIEA 4TLPA 5GAQA 1JT7A 3V0BB 2Y9WC 1BASA 1YBIA 2Y9XE 3RMYA 5BXPA 3BTAA 4EKXB 1M2TB 1S0FA 1ABRB 3P6IA 4I6IA 4X38A 3P53A 1ISYA
chains in the Genus database with same CATH superfamily
1T4QA 2D24A 1E0OA 3K1XA 4DCKC 4LO0C 3BA7A 2DREA 2VSAA 3BA4A 3UJ0A 2GO2A 1QXMA 2DRYA 1XZZA 4IZXA 4KC3A 1ISWA 1G9AA 1MD6A 1Z2VA 3IIRA 3HMYA 4XFSA 4MZFB 3WMVA 3RTIB 2I1BA 5FZUA 3AKFA 2KI4A 3HBWA 3CQAA 4I4SA 3LTQA 4I96A 2BEBA 4I4PA 1FWUA 1FGAA 41BIA 1PC8B 3HALA 5BP5C 2XOAA 1V6XA 4R6UB 2D1ZA 3WO2A 1G9BA 1ISZA 1DIWA 1JY0A 3O44A 1BFGA 2D20A 4I4RA 3A07A 1RZOB 3CA5A 3RMXA 5FZYA 4IONA 1DFQA 4JKQA 4QALA 3HOMA 3IM6A 1AVXB 1JT4A 4FVVA 3E8LC 1EVTA 4LO1A 1OQLB 1XG6A 2ET2A 4ZOTA 3PUBA 4XKIA 2F8XC 4G6JA 3FJJA 1UPSA 3FJIA 1VCLA 3BRDA 3VT1A 5BVPI 2M49A 4HR6C 1GGPB 3R4SA 3FUQA 2FFUA 1TWEA 3H6QA 1WD3A 1WBCA 3FJBA 2MIBA 8I1BA 3VT0A 3BAOA 5BQUC 1Q04A 2RG9B 3O4AA 3A21A 4Q9PA 5EC5A 1PZZA 3BAGA 4I8MA 4LO1C 3UDAA 2UUSA 1ISXA 1IHKA 3WO4A 3BA5A 4ZFYB 1W3AA 4UY4A 4XFTA 3H6SE 3FJHA 2KI6B 4Z9WB 2Q3NB 2FDBM 1R8NA 3O4CA 1Q03A 4X39A 1PUMB 1I1EA 3RTJB 1JLYA 4QD2C 3ZX7A 4I1BA 3Q7YA 3FJCA 4GP3A 3A22A 3OJMA 4QC4A 4IY9A 4JP0A 3FJAA 4KEIA 1Z0HA 4II0A 4KEKA 5D61A 4P6AA 3VWCA 4J2YA 4GAIA 3VSZA 2AAIB 3PMEA 3BRGC 1S0EA 3BAVA 4I0YA 4EB2B 3V79C 4IHZA 3R4UA 1IJTA 1AF9A 5FZZA 4I7IA 3I2AA 1DJSB 4LO2A 2DS0A 1AVWB 4P0LA 1I1BA 4DEPA 4OEGA 3AH4A 4QKRA 3LLPA 2WRYA 3NBEA 1NZKA 2P39A 3B9UA 1SR4A 1A8DA 4I4XA 1Q1UA 2K43A 3AZVA 3F1RA 3QYDA 3BRFA 1TOOA 3AJ6A 2BFHA 4ISQA 4Z8SB 1JT5A 2HWMA 1DQOA 1FV3A 1DLLA 2Z48A 3CRGA 3IAGC 4D8HA 3FGMA 4LO2C 4J2XA 3H6RB 4EFRA 4I4UA 2RQ9A 1NUNA 4LO7B 21BIA 1S0LA 1M16A 2QYIB 4ZFUB 3FUOA 4H9WA 4LO3A 3SNVA 3UD9A 3O3QA 3I2XA 3CA6A 3O4DA 4ZLBB 1DQGA 3BAHA 3CA3A 4J2SA 3S8KA 3JRRA 3T8SA 3JUTA 1PUUB 1HCEA 2HZ9A 3BAUA 3VEQA 4I2SA 3FJDA 5EHAA 2VU9A 1G9DA 5HPZA 1CE7B 1TP0A 2L5XA 3IM5A 1L2HA 3O4OA 2ZR1B 4H04A 2LIQA 3POKA 1IRAX 3ZXGA 3Q7WA 4X3AA 2K4AB 2HWAA 1JT3A 4ZFWB 3ZC8A 1ISVA 4LO3C 1G82A 3OJVA 2Y9FA 3AH1A 3V0BA 3KMVA 3VSFA 4Q9GA 1AXMA 1FQ9A 2D23A 4ZBVB 7I1BA 4OWKA 1HKNA 1S0BA 4IQPA 4I37A 3P6JA 31BIA 4J23B 1BFBA 2E4MA 1AVUA 2F2FA 3WA1A 1JTCA 4P0JA 3WINA 3OBTA 5BXSA 2MLLB 3H6RA 3UD8A 1J0SA 4P0KA 1WBAA 2NVHA 2ZQNA 1QQLA 3MPPG 3EF2A 2D43A 1WD4A 3RSJA 2P23A 3CA0A 3NJ5A 3N7LA 1IT0A 2Z49A 1CVSA 1W3GA 2R9KB 4LO8B 3CRIA 1FWVA 1YF8B 1TFMB 2E4MC 1BA7A 1HCDA 3WINC 3D7WB 2NZ9A 4OWJA 1IRPA 4IYBA 3HN1A 1FV2A 2QN4A 3AKIA 1RG8A 4X37A 4QBCA 1YXWA 5B2HA 4A7YA 5FNXA 1XHBA 2FO1A 3V0AB 3O5WB 4GOYA 6I1BA 4JQ0A 2KLLA 3OGGA 1BLAA 1BARA 2FFVA 3FJKA 4JPZA 4OEEA 5JLVA 4LO0A 3ZC9A 1Z4SA 1BLDA 4OUJA 3QR5A 2RSTA 3O4BA 3C9ZA 3WO3A 5F8YA 4AN6A 2YUGA 3IM7A 4JAWA 1JQZA 1JLXA 5DVHA 1V6UA 3BAQA 4D0ZA 4PC4A 1QQKA 4I4VA 4IY8A 1S0CA 4F83A 4H75A 5E24E 4I4OA 1ONKB 5EG6C 4OWLA 1V6WA 1AVAC 3ZXDA 3S8JA 1V6VA 1N4KA 1II4A 1KNMA 4HA2A 3OBRA 3HSMA 4F34A 1DFCA 5BP5A 5BOWA 1SR4C 3AKHA 4QD2B 2NM1A 3CA4A 4JKXB 1FMMS 3FJ9A 2D44A 3N0KA 4L4HA 4DENA 3AZWA 3MALA 2D7IA 5F90A 1RY7A 4ZGRB 2X2SA 4A7KA 3AJ5A 5I1BA 2VLCA 3NBCA 3OJ2A 3BX1C 3TC2A 4FGFA 4J2KA 1S0GA 1YYNA 1PWAA 4I4YA 3V0AA 4AN7B 4KBBA 1ITBA 4USOA 3CA1A 4OW4A 4GOVA 1AFCA 1S0DA 1FMZA 2KKIA 3CU1B 3FJFA 3N7KA 1DZDA 2D22A 3NBNA 5JMCA 2Y9GA 4G9NA 1BFFA 4ZA3B 3NBDA 1T9FA 2NS2A 1W3FA 5BQUA 1HWMB 4ENDA 5F8SA 3VUOA 3ILAA 1HWPB 2VXTI 4YOLA 2GZBA 5BXTA 3BADA 4OEFA 3BB2A 2WBCA 3UD7A 5D63A 4ISRA 4I3NA 4Q91A 4G1RA 4QO3A 2FGFA 2NTDA 1BFCA 1D0HA 3AH2A 4IZEA 3VT2A 3PG0A 1HWNB 2VXRA 2MC2A 1RMLA 1K5VA 1K5UA 4WBCA 1P63A 1EV2A 2AFGA 2DRZA 4G9MA 4G6MA 3FJEA 4QKSA 4GAFA 4USPA 5DZUA 5FNWA 2BEAA 1IILA 4MZHA 3F62B 4L4IA 2ZQOA 1SZ6B 3UJ4A 3WMUA 4EEEB 4ZKTB 2F2FC 4A7ZA 2ERMA 4KEJA 5DSSB 3N7JA 3W9TA 1TTUA 1YTOA 1HWOB 1IOBA 2NP0A 1ILR1 4LO7C 4HJJA 2IHOA 5BXRA 3CRHA 1HIBA 1EYLA 1XYFA 3OGFA 1TWMA 3O49A 3Q7XA 4I4QA 3A23A 5DUYA 2ESUA 1G9CA 2AQZA 2IWTB 3FJ8A 1EPWA 4GP0A 4I1EA 2KH2A 2Q9XA 3CAHA 3N7MA 2K8RA 1TIEA 3PHZA 2VSEA 4D0TA 2AXMA 1MC9A 4CJMA 4EFPA 4JRAA 1F31A 2NYYA 4QBVA 2VUAA 3I29B 2D7RA 5G00A 3AKGA 9ILBA 1FN0A 2J3PA 1R8OA 4MZGB 5D62A 2HW9A 1DZCA 2X2TA 3FFZA 5F8WA 4XFUA 4EFQA 2LIEA 4TLPA 5GAQA 1JT7A 3V0BB 2Y9WC 1BASA 1YBIA 2Y9XE 3RMYA 5BXPA 3BTAA 4EKXB 1M2TB 1S0FA 1ABRB 3P6IA 4I6IA 4X38A 3P53A 1ISYA
chains in the Genus database with same CATH topology
1T4QA 2D24A 1E0OA 3K1XA 4DCKC 4LO0C 3BA7A 2DREA 2VSAA 3BA4A 3UJ0A 2GO2A 1QXMA 2DRYA 1XZZA 4IZXA 4KC3A 1ISWA 1G9AA 1MD6A 1Z2VA 3IIRA 3HMYA 4XFSA 4MZFB 3WMVA 3RTIB 2I1BA 5FZUA 3AKFA 2KI4A 3HBWA 3CQAA 4I4SA 3LTQA 4I96A 2BEBA 4I4PA 1FWUA 1FGAA 41BIA 1PC8B 3HALA 5BP5C 2XOAA 1V6XA 4R6UB 2D1ZA 3WO2A 1G9BA 1ISZA 1DIWA 1JY0A 3O44A 1BFGA 2D20A 4I4RA 3A07A 1RZOB 3CA5A 3RMXA 5FZYA 4IONA 1DFQA 4JKQA 4QALA 3HOMA 3IM6A 1AVXB 1JT4A 4FVVA 3E8LC 1EVTA 4LO1A 1OQLB 1XG6A 2ET2A 4ZOTA 3PUBA 4XKIA 2F8XC 4G6JA 3FJJA 1UPSA 3FJIA 1VCLA 3BRDA 3VT1A 5BVPI 2M49A 4HR6C 1GGPB 3R4SA 3FUQA 2FFUA 1TWEA 3H6QA 1WD3A 1WBCA 3FJBA 2MIBA 8I1BA 3VT0A 3BAOA 5BQUC 1Q04A 2RG9B 3O4AA 3A21A 4Q9PA 5EC5A 1PZZA 3BAGA 4I8MA 4LO1C 3UDAA 2UUSA 1ISXA 1IHKA 3WO4A 3BA5A 4ZFYB 1W3AA 4UY4A 4XFTA 3H6SE 3FJHA 2KI6B 4Z9WB 2Q3NB 2FDBM 1R8NA 3O4CA 1Q03A 4X39A 1PUMB 1I1EA 3RTJB 1JLYA 4QD2C 3ZX7A 4I1BA 3Q7YA 3FJCA 4GP3A 3A22A 3OJMA 4QC4A 4IY9A 4JP0A 3FJAA 4KEIA 1Z0HA 4II0A 4KEKA 5D61A 4P6AA 3VWCA 4J2YA 4GAIA 3VSZA 2AAIB 3PMEA 3BRGC 1S0EA 3BAVA 4I0YA 4EB2B 3V79C 4IHZA 3R4UA 1IJTA 1AF9A 5FZZA 4I7IA 3I2AA 1DJSB 4LO2A 2DS0A 1AVWB 4P0LA 1I1BA 4DEPA 4OEGA 3AH4A 4QKRA 3LLPA 2WRYA 3NBEA 1NZKA 2P39A 3B9UA 1SR4A 1A8DA 4I4XA 1Q1UA 2K43A 3AZVA 3F1RA 3QYDA 3BRFA 1TOOA 3AJ6A 2BFHA 4ISQA 4Z8SB 1JT5A 2HWMA 1DQOA 1FV3A 1DLLA 2Z48A 3CRGA 3IAGC 4D8HA 3FGMA 4LO2C 4J2XA 3H6RB 4EFRA 4I4UA 2RQ9A 1NUNA 4LO7B 21BIA 1S0LA 1M16A 2QYIB 4ZFUB 3FUOA 4H9WA 4LO3A 3SNVA 3UD9A 3O3QA 3I2XA 3CA6A 3O4DA 4ZLBB 1DQGA 3BAHA 3CA3A 4J2SA 3S8KA 3JRRA 3T8SA 3JUTA 1PUUB 1HCEA 2HZ9A 3BAUA 3VEQA 4I2SA 3FJDA 5EHAA 2VU9A 1G9DA 5HPZA 1CE7B 1TP0A 2L5XA 3IM5A 1L2HA 3O4OA 2ZR1B 4H04A 2LIQA 3POKA 1IRAX 3ZXGA 3Q7WA 4X3AA 2K4AB 2HWAA 1JT3A 4ZFWB 3ZC8A 1ISVA 4LO3C 1G82A 3OJVA 2Y9FA 3AH1A 3V0BA 3KMVA 3VSFA 4Q9GA 1AXMA 1FQ9A 2D23A 4ZBVB 7I1BA 4OWKA 1HKNA 1S0BA 4IQPA 4I37A 3P6JA 31BIA 4J23B 1BFBA 2E4MA 1AVUA 2F2FA 3WA1A 1JTCA 4P0JA 3WINA 3OBTA 5BXSA 2MLLB 3H6RA 3UD8A 1J0SA 4P0KA 1WBAA 2NVHA 2ZQNA 1QQLA 3MPPG 3EF2A 2D43A 1WD4A 3RSJA 2P23A 3CA0A 3NJ5A 3N7LA 1IT0A 2Z49A 1CVSA 1W3GA 2R9KB 4LO8B 3CRIA 1FWVA 1YF8B 1TFMB 2E4MC 1BA7A 1HCDA 3WINC 3D7WB 2NZ9A 4OWJA 1IRPA 4IYBA 3HN1A 1FV2A 2QN4A 3AKIA 1RG8A 4X37A 4QBCA 1YXWA 5B2HA 4A7YA 5FNXA 1XHBA 2FO1A 3V0AB 3O5WB 4GOYA 6I1BA 4JQ0A 2KLLA 3OGGA 1BLAA 1BARA 2FFVA 3FJKA 4JPZA 4OEEA 5JLVA 4LO0A 3ZC9A 1Z4SA 1BLDA 4OUJA 3QR5A 2RSTA 3O4BA 3C9ZA 3WO3A 5F8YA 4AN6A 2YUGA 3IM7A 4JAWA 1JQZA 1JLXA 5DVHA 1V6UA 3BAQA 4D0ZA 4PC4A 1QQKA 4I4VA 4IY8A 1S0CA 4F83A 4H75A 5E24E 4I4OA 1ONKB 5EG6C 4OWLA 1V6WA 1AVAC 3ZXDA 3S8JA 1V6VA 1N4KA 1II4A 1KNMA 4HA2A 3OBRA 3HSMA 4F34A 1DFCA 5BP5A 5BOWA 1SR4C 3AKHA 4QD2B 2NM1A 3CA4A 4JKXB 1FMMS 3FJ9A 2D44A 3N0KA 4L4HA 4DENA 3AZWA 3MALA 2D7IA 5F90A 1RY7A 4ZGRB 2X2SA 4A7KA 3AJ5A 5I1BA 2VLCA 3NBCA 3OJ2A 3BX1C 3TC2A 4FGFA 4J2KA 1S0GA 1YYNA 1PWAA 4I4YA 3V0AA 4AN7B 4KBBA 1ITBA 4USOA 3CA1A 4OW4A 4GOVA 1AFCA 1S0DA 1FMZA 2KKIA 3CU1B 3FJFA 3N7KA 1DZDA 2D22A 3NBNA 5JMCA 2Y9GA 4G9NA 1BFFA 4ZA3B 3NBDA 1T9FA 2NS2A 1W3FA 5BQUA 1HWMB 4ENDA 5F8SA 3VUOA 3ILAA 1HWPB 2VXTI 4YOLA 2GZBA 5BXTA 3BADA 4OEFA 3BB2A 2WBCA 3UD7A 5D63A 4ISRA 4I3NA 4Q91A 4G1RA 4QO3A 2FGFA 2NTDA 1BFCA 1D0HA 3AH2A 4IZEA 3VT2A 3PG0A 1HWNB 2VXRA 2MC2A 1RMLA 1K5VA 1K5UA 4WBCA 1P63A 1EV2A 2AFGA 2DRZA 4G9MA 4G6MA 3FJEA 4QKSA 4GAFA 4USPA 5DZUA 5FNWA 2BEAA 1IILA 4MZHA 3F62B 4L4IA 2ZQOA 1SZ6B 3UJ4A 3WMUA 4EEEB 4ZKTB 2F2FC 4A7ZA 2ERMA 4KEJA 5DSSB 3N7JA 3W9TA 1TTUA 1YTOA 1HWOB 1IOBA 2NP0A 1ILR1 4LO7C 4HJJA 2IHOA 5BXRA 3CRHA 1HIBA 1EYLA 1XYFA 3OGFA 1TWMA 3O49A 3Q7XA 4I4QA 3A23A 5DUYA 2ESUA 1G9CA 2AQZA 2IWTB 3FJ8A 1EPWA 4GP0A 4I1EA 2KH2A 2Q9XA 3CAHA 3N7MA 2K8RA 1TIEA 3PHZA 2VSEA 4D0TA 2AXMA 1MC9A 4CJMA 4EFPA 4JRAA 1F31A 2NYYA 4QBVA 2VUAA 3I29B 2D7RA 5G00A 3AKGA 9ILBA 1FN0A 2J3PA 1R8OA 4MZGB 5D62A 2HW9A 1DZCA 2X2TA 3FFZA 5F8WA 4XFUA 4EFQA 2LIEA 4TLPA 5GAQA 1JT7A 3V0BB 2Y9WC 1BASA 1YBIA 2Y9XE 3RMYA 5BXPA 3BTAA 4EKXB 1M2TB 1S0FA 1ABRB 3P6IA 4I6IA 4X38A 3P53A 1ISYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T4Q A;  2D24 A;  1E0O A;  3K1X A;  4DCK C;  4LO0 C;  3BA7 A;  2DRE A;  2VSA A;  3BA4 A;  3UJ0 A;  2GO2 A;  1QXM A;  2DRY A;  1XZZ A;  4IZX A;  4KC3 A;  1ISW A;  1G9A A;  1MD6 A;  1Z2V A;  3IIR A;  3HMY A;  4XFS A;  3WMV A;  3RTI B;  2I1B A;  5FZU A;  3AKF A;  2KI4 A;  3HBW A;  3CQA A;  4I4S A;  3LTQ A;  4I96 A;  2BEB A;  4I4P A;  1FWU A;  1FGA A;  41BI A;  1PC8 B;  3HAL A;  5BP5 C;  2XOA A;  1V6X A;  4R6U B;  2D1Z A;  3WO2 A;  1G9B A;  1ISZ A;  1DIW A;  1JY0 A;  3O44 A;  1BFG A;  2D20 A;  4I4R A;  3A07 A;  1RZO B;  3CA5 A;  3RMX A;  5FZY A;  4ION A;  1DFQ A;  4JKQ A;  4QAL A;  3HOM A;  3IM6 A;  1AVX B;  1JT4 A;  4FVV A;  3E8L C;  1EVT A;  4LO1 A;  1OQL B;  1XG6 A;  2ET2 A;  4ZOT A;  3PUB A;  4XKI A;  2F8X C;  4G6J A;  3FJJ A;  1UPS A;  3FJI A;  1VCL A;  3BRD A;  3VT1 A;  5BVP I;  2M49 A;  4HR6 C;  1GGP B;  3R4S A;  3FUQ A;  2FFU A;  1TWE A;  3H6Q A;  1WD3 A;  1WBC A;  3FJB A;  2MIB A;  8I1B A;  3VT0 A;  3BAO A;  5BQU C;  1Q04 A;  2RG9 B;  3O4A A;  3A21 A;  4Q9P A;  5EC5 A;  1PZZ A;  3BAG A;  4I8M A;  4LO1 C;  3UDA A;  2UUS A;  1ISX A;  1IHK A;  3WO4 A;  3BA5 A;  4ZFY B;  1W3A A;  4XFT A;  3H6S E;  3FJH A;  2KI6 B;  4Z9W B;  2Q3N B;  2FDB M;  1R8N A;  3O4C A;  1Q03 A;  4X39 A;  1PUM B;  1I1E A;  3RTJ B;  1JLY A;  4QD2 C;  3ZX7 A;  4I1B A;  3Q7Y A;  3FJC A;  4GP3 A;  3A22 A;  3OJM A;  4QC4 A;  4IY9 A;  4JP0 A;  3FJA A;  4KEI A;  1Z0H A;  4II0 A;  4KEK A;  5D61 A;  4P6A A;  3VWC A;  4J2Y A;  4GAI A;  3VSZ A;  2AAI B;  3PME A;  3BRG C;  1S0E A;  3BAV A;  4I0Y A;  4EB2 B;  3V79 C;  4IHZ A;  3R4U A;  1IJT A;  1AF9 A;  5FZZ A;  4I7I A;  3I2A A;  1DJS B;  4LO2 A;  2DS0 A;  1AVW B;  4P0L A;  1I1B A;  4DEP A;  4OEG A;  3AH4 A;  4QKR A;  3LLP A;  2WRY A;  3NBE A;  1NZK A;  2P39 A;  3B9U A;  1SR4 A;  1A8D A;  4I4X A;  1Q1U A;  2K43 A;  3AZV A;  3F1R A;  3QYD A;  3BRF A;  1TOO A;  3AJ6 A;  2BFH A;  4ISQ A;  4Z8S B;  1JT5 A;  2HWM A;  1DQO A;  1FV3 A;  1DLL A;  2Z48 A;  3CRG A;  3IAG C;  4D8H A;  3FGM A;  4LO2 C;  4J2X A;  3H6R B;  4EFR A;  4I4U A;  2RQ9 A;  1NUN A;  4LO7 B;  21BI A;  1S0L A;  1M16 A;  2QYI B;  4ZFU B;  3FUO A;  4H9W A;  4LO3 A;  3SNV A;  3UD9 A;  3O3Q A;  3I2X A;  3CA6 A;  3O4D A;  4ZLB B;  1DQG A;  3BAH A;  3CA3 A;  4J2S A;  3S8K A;  3JRR A;  3T8S A;  3JUT A;  1PUU B;  1HCE A;  2HZ9 A;  3BAU A;  3VEQ A;  4I2S A;  3FJD A;  5EHA A;  2VU9 A;  1G9D A;  5HPZ A;  1CE7 B;  1TP0 A;  2L5X A;  3IM5 A;  1L2H A;  3O4O A;  2ZR1 B;  4H04 A;  2LIQ A;  3POK A;  1IRA X;  3ZXG A;  3Q7W A;  4X3A A;  2K4A B;  2HWA A;  1JT3 A;  4ZFW B;  3ZC8 A;  1ISV A;  4LO3 C;  1G82 A;  3OJV A;  2Y9F A;  3AH1 A;  3V0B A;  3KMV A;  3VSF A;  4Q9G A;  1AXM A;  1FQ9 A;  2D23 A;  4ZBV B;  7I1B A;  4OWK A;  1HKN A;  1S0B A;  4IQP A;  4I37 A;  3P6J A;  31BI A;  4J23 B;  1BFB A;  2E4M A;  1AVU A;  2F2F A;  3WA1 A;  1JTC A;  4P0J A;  3WIN A;  3OBT A;  5BXS A;  2MLL B;  3H6R A;  3UD8 A;  1J0S A;  4P0K A;  1WBA A;  2NVH A;  2ZQN A;  1QQL A;  3MPP G;  3EF2 A;  2D43 A;  1WD4 A;  3RSJ A;  2P23 A;  3CA0 A;  3NJ5 A;  3N7L A;  1IT0 A;  2Z49 A;  1CVS A;  1W3G A;  2R9K B;  4LO8 B;  3CRI A;  1FWV A;  1YF8 B;  1TFM B;  2E4M C;  1BA7 A;  1HCD A;  3WIN C;  3D7W B;  2NZ9 A;  4OWJ A;  1IRP A;  4IYB A;  3HN1 A;  1FV2 A;  2QN4 A;  3AKI A;  1RG8 A;  4X37 A;  4QBC A;  1YXW A;  5B2H A;  4A7Y A;  5FNX A;  1XHB A;  2FO1 A;  3V0A B;  3O5W B;  4GOY A;  6I1B A;  4JQ0 A;  2KLL A;  3OGG A;  1BLA A;  1BAR A;  2FFV A;  3FJK A;  4JPZ A;  4OEE A;  5JLV A;  4LO0 A;  3ZC9 A;  1Z4S A;  1BLD A;  4OUJ A;  3QR5 A;  2RST A;  3O4B A;  3C9Z A;  3WO3 A;  5F8Y A;  4AN6 A;  2YUG A;  3IM7 A;  4JAW A;  1JQZ A;  1JLX A;  5DVH A;  1V6U A;  3BAQ A;  4D0Z A;  4PC4 A;  1QQK A;  4I4V A;  4IY8 A;  1S0C A;  4F83 A;  5E24 E;  4I4O A;  1ONK B;  5EG6 C;  4OWL A;  1V6W A;  1AVA C;  3ZXD A;  3S8J A;  1V6V A;  1N4K A;  1II4 A;  1KNM A;  4HA2 A;  3OBR A;  3HSM A;  4F34 A;  1DFC A;  5BP5 A;  5BOW A;  1SR4 C;  3AKH A;  4QD2 B;  2NM1 A;  3CA4 A;  4JKX B;  1FMM S;  3FJ9 A;  2D44 A;  3N0K A;  4L4H A;  4DEN A;  3AZW A;  3MAL A;  2D7I A;  5F90 A;  1RY7 A;  4ZGR B;  2X2S A;  4A7K A;  3AJ5 A;  5I1B A;  2VLC A;  3NBC A;  3OJ2 A;  3BX1 C;  3TC2 A;  4FGF A;  4J2K A;  1S0G A;  1YYN A;  1PWA A;  4I4Y A;  3V0A A;  4AN7 B;  4KBB A;  1ITB A;  4USO A;  3CA1 A;  4OW4 A;  4GOV A;  1AFC A;  1S0D A;  1FMZ A;  2KKI A;  3CU1 B;  3FJF A;  3N7K A;  1DZD A;  2D22 A;  3NBN A;  5JMC A;  2Y9G A;  4G9N A;  1BFF A;  4ZA3 B;  3NBD A;  1T9F A;  5BQU A;  1W3F A;  1HWM B;  4END A;  5F8S A;  3VUO A;  3ILA A;  1HWP B;  2VXT I;  4YOL A;  2GZB A;  5BXT A;  3BAD A;  4OEF A;  3BB2 A;  2WBC A;  3UD7 A;  5D63 A;  4ISR A;  4I3N A;  4Q91 A;  4G1R A;  4QO3 A;  2FGF A;  2NTD A;  1BFC A;  1D0H A;  3AH2 A;  4IZE A;  3VT2 A;  3PG0 A;  1HWN B;  2VXR A;  2MC2 A;  1RML A;  1K5V A;  1K5U A;  4WBC A;  1P63 A;  1EV2 A;  2AFG A;  2DRZ A;  4G9M A;  4G6M A;  3FJE A;  4QKS A;  4GAF A;  4USP A;  5DZU A;  5FNW A;  2BEA A;  1IIL A;  3F62 B;  4L4I A;  2ZQO A;  1SZ6 B;  3UJ4 A;  3WMU A;  4EEE B;  4ZKT B;  2F2F C;  4A7Z A;  2ERM A;  4KEJ A;  5DSS B;  3N7J A;  3W9T A;  1TTU A;  1YTO A;  1HWO B;  1IOB A;  2NP0 A;  1ILR 1;  4LO7 C;  4HJJ A;  2IHO A;  5BXR A;  3CRH A;  1HIB A;  1EYL A;  1XYF A;  3OGF A;  1TWM A;  3O49 A;  3Q7X A;  4I4Q A;  3A23 A;  5DUY A;  2ESU A;  1G9C A;  2AQZ A;  2IWT B;  3FJ8 A;  1EPW A;  4GP0 A;  4I1E A;  2KH2 A;  2Q9X A;  3CAH A;  3N7M A;  2K8R A;  1TIE A;  3PHZ A;  2VSE A;  4D0T A;  2AXM A;  1MC9 A;  4CJM A;  4EFP A;  4JRA A;  1F31 A;  2NYY A;  4QBV A;  2VUA A;  3I29 B;  2D7R A;  5G00 A;  3AKG A;  9ILB A;  1FN0 A;  2J3P A;  1R8O A;  5D62 A;  1DZC A;  2HW9 A;  2X2T A;  3FFZ A;  5F8W A;  4XFU A;  4EFQ A;  2LIE A;  4TLP A;  5GAQ A;  1JT7 A;  3V0B B;  2Y9W C;  1BAS A;  1YBI A;  2Y9X E;  3RMY A;  5BXP A;  3BTA A;  4EKX B;  1M2T B;  1S0F A;  1ABR B;  3P6I A;  4I6I A;  4X38 A;  3P53 A;  1ISY A; 
#chains in the Genus database with same CATH topology
 1T4Q A;  2D24 A;  1E0O A;  3K1X A;  4DCK C;  4LO0 C;  3BA7 A;  2DRE A;  2VSA A;  3BA4 A;  3UJ0 A;  2GO2 A;  1QXM A;  2DRY A;  1XZZ A;  4IZX A;  4KC3 A;  1ISW A;  1G9A A;  1MD6 A;  1Z2V A;  3IIR A;  3HMY A;  4XFS A;  4MZF B;  3WMV A;  3RTI B;  2I1B A;  5FZU A;  3AKF A;  2KI4 A;  3HBW A;  3CQA A;  4I4S A;  3LTQ A;  4I96 A;  2BEB A;  4I4P A;  1FWU A;  1FGA A;  41BI A;  1PC8 B;  3HAL A;  5BP5 C;  2XOA A;  1V6X A;  4R6U B;  2D1Z A;  3WO2 A;  1G9B A;  1ISZ A;  1DIW A;  1JY0 A;  3O44 A;  1BFG A;  2D20 A;  4I4R A;  3A07 A;  1RZO B;  3CA5 A;  3RMX A;  5FZY A;  4ION A;  1DFQ A;  4JKQ A;  4QAL A;  3HOM A;  3IM6 A;  1AVX B;  1JT4 A;  4FVV A;  3E8L C;  1EVT A;  4LO1 A;  1OQL B;  1XG6 A;  2ET2 A;  4ZOT A;  3PUB A;  4XKI A;  2F8X C;  4G6J A;  3FJJ A;  1UPS A;  3FJI A;  1VCL A;  3BRD A;  3VT1 A;  5BVP I;  2M49 A;  4HR6 C;  1GGP B;  3R4S A;  3FUQ A;  2FFU A;  1TWE A;  3H6Q A;  1WD3 A;  1WBC A;  3FJB A;  2MIB A;  8I1B A;  3VT0 A;  3BAO A;  5BQU C;  1Q04 A;  2RG9 B;  3O4A A;  3A21 A;  4Q9P A;  5EC5 A;  1PZZ A;  3BAG A;  4I8M A;  4LO1 C;  3UDA A;  2UUS A;  1ISX A;  1IHK A;  3WO4 A;  3BA5 A;  4ZFY B;  1W3A A;  4UY4 A;  4XFT A;  3H6S E;  3FJH A;  2KI6 B;  4Z9W B;  2Q3N B;  2FDB M;  1R8N A;  3O4C A;  1Q03 A;  4X39 A;  1PUM B;  1I1E A;  3RTJ B;  1JLY A;  4QD2 C;  3ZX7 A;  4I1B A;  3Q7Y A;  3FJC A;  4GP3 A;  3A22 A;  3OJM A;  4QC4 A;  4IY9 A;  4JP0 A;  3FJA A;  4KEI A;  1Z0H A;  4II0 A;  4KEK A;  5D61 A;  4P6A A;  3VWC A;  4J2Y A;  4GAI A;  3VSZ A;  2AAI B;  3PME A;  3BRG C;  1S0E A;  3BAV A;  4I0Y A;  4EB2 B;  3V79 C;  4IHZ A;  3R4U A;  1IJT A;  1AF9 A;  5FZZ A;  4I7I A;  3I2A A;  1DJS B;  4LO2 A;  2DS0 A;  1AVW B;  4P0L A;  1I1B A;  4DEP A;  4OEG A;  3AH4 A;  4QKR A;  3LLP A;  2WRY A;  3NBE A;  1NZK A;  2P39 A;  3B9U A;  1SR4 A;  1A8D A;  4I4X A;  1Q1U A;  2K43 A;  3AZV A;  3F1R A;  3QYD A;  3BRF A;  1TOO A;  3AJ6 A;  2BFH A;  4ISQ A;  4Z8S B;  1JT5 A;  2HWM A;  1DQO A;  1FV3 A;  1DLL A;  2Z48 A;  3CRG A;  3IAG C;  4D8H A;  3FGM A;  4LO2 C;  4J2X A;  3H6R B;  4EFR A;  4I4U A;  2RQ9 A;  1NUN A;  4LO7 B;  21BI A;  1S0L A;  1M16 A;  2QYI B;  4ZFU B;  3FUO A;  4H9W A;  4LO3 A;  3SNV A;  3UD9 A;  3O3Q A;  3I2X A;  3CA6 A;  3O4D A;  4ZLB B;  1DQG A;  3BAH A;  3CA3 A;  4J2S A;  3S8K A;  3JRR A;  3T8S A;  3JUT A;  1PUU B;  1HCE A;  2HZ9 A;  3BAU A;  3VEQ A;  4I2S A;  3FJD A;  5EHA A;  2VU9 A;  1G9D A;  5HPZ A;  1CE7 B;  1TP0 A;  2L5X A;  3IM5 A;  1L2H A;  3O4O A;  2ZR1 B;  4H04 A;  2LIQ A;  3POK A;  1IRA X;  3ZXG A;  3Q7W A;  4X3A A;  2K4A B;  2HWA A;  1JT3 A;  4ZFW B;  3ZC8 A;  1ISV A;  4LO3 C;  1G82 A;  3OJV A;  2Y9F A;  3AH1 A;  3V0B A;  3KMV A;  3VSF A;  4Q9G A;  1AXM A;  1FQ9 A;  2D23 A;  4ZBV B;  7I1B A;  4OWK A;  1HKN A;  1S0B A;  4IQP A;  4I37 A;  3P6J A;  31BI A;  4J23 B;  1BFB A;  2E4M A;  1AVU A;  2F2F A;  3WA1 A;  1JTC A;  4P0J A;  3WIN A;  3OBT A;  5BXS A;  2MLL B;  3H6R A;  3UD8 A;  1J0S A;  4P0K A;  1WBA A;  2NVH A;  2ZQN A;  1QQL A;  3MPP G;  3EF2 A;  2D43 A;  1WD4 A;  3RSJ A;  2P23 A;  3CA0 A;  3NJ5 A;  3N7L A;  1IT0 A;  2Z49 A;  1CVS A;  1W3G A;  2R9K B;  4LO8 B;  3CRI A;  1FWV A;  1YF8 B;  1TFM B;  2E4M C;  1BA7 A;  1HCD A;  3WIN C;  3D7W B;  2NZ9 A;  4OWJ A;  1IRP A;  4IYB A;  3HN1 A;  1FV2 A;  2QN4 A;  3AKI A;  1RG8 A;  4X37 A;  4QBC A;  1YXW A;  5B2H A;  4A7Y A;  5FNX A;  1XHB A;  2FO1 A;  3V0A B;  3O5W B;  4GOY A;  6I1B A;  4JQ0 A;  2KLL A;  3OGG A;  1BLA A;  1BAR A;  2FFV A;  3FJK A;  4JPZ A;  4OEE A;  5JLV A;  4LO0 A;  3ZC9 A;  1Z4S A;  1BLD A;  4OUJ A;  3QR5 A;  2RST A;  3O4B A;  3C9Z A;  3WO3 A;  5F8Y A;  4AN6 A;  2YUG A;  3IM7 A;  4JAW A;  1JQZ A;  1JLX A;  5DVH A;  1V6U A;  3BAQ A;  4D0Z A;  4PC4 A;  1QQK A;  4I4V A;  4IY8 A;  1S0C A;  4F83 A;  4H75 A;  5E24 E;  4I4O A;  1ONK B;  5EG6 C;  4OWL A;  1V6W A;  1AVA C;  3ZXD A;  3S8J A;  1V6V A;  1N4K A;  1II4 A;  1KNM A;  4HA2 A;  3OBR A;  3HSM A;  4F34 A;  1DFC A;  5BP5 A;  5BOW A;  1SR4 C;  3AKH A;  4QD2 B;  2NM1 A;  3CA4 A;  4JKX B;  1FMM S;  3FJ9 A;  2D44 A;  3N0K A;  4L4H A;  4DEN A;  3AZW A;  3MAL A;  2D7I A;  5F90 A;  1RY7 A;  4ZGR B;  2X2S A;  4A7K A;  3AJ5 A;  5I1B A;  2VLC A;  3NBC A;  3OJ2 A;  3BX1 C;  3TC2 A;  4FGF A;  4J2K A;  1S0G A;  1YYN A;  1PWA A;  4I4Y A;  3V0A A;  4AN7 B;  4KBB A;  1ITB A;  4USO A;  3CA1 A;  4OW4 A;  4GOV A;  1AFC A;  1S0D A;  1FMZ A;  2KKI A;  3CU1 B;  3FJF A;  3N7K A;  1DZD A;  2D22 A;  3NBN A;  5JMC A;  2Y9G A;  4G9N A;  1BFF A;  4ZA3 B;  3NBD A;  1T9F A;  2NS2 A;  1W3F A;  5BQU A;  1HWM B;  4END A;  5F8S A;  3VUO A;  3ILA A;  1HWP B;  2VXT I;  4YOL A;  2GZB A;  5BXT A;  3BAD A;  4OEF A;  3BB2 A;  2WBC A;  3UD7 A;  5D63 A;  4ISR A;  4I3N A;  4Q91 A;  4G1R A;  4QO3 A;  2FGF A;  2NTD A;  1BFC A;  1D0H A;  3AH2 A;  4IZE A;  3VT2 A;  3PG0 A;  1HWN B;  2VXR A;  2MC2 A;  1RML A;  1K5V A;  1K5U A;  4WBC A;  1P63 A;  1EV2 A;  2AFG A;  2DRZ A;  4G9M A;  4G6M A;  3FJE A;  4QKS A;  4GAF A;  4USP A;  5DZU A;  5FNW A;  2BEA A;  1IIL A;  4MZH A;  3F62 B;  4L4I A;  2ZQO A;  1SZ6 B;  3UJ4 A;  3WMU A;  4EEE B;  4ZKT B;  2F2F C;  4A7Z A;  2ERM A;  4KEJ A;  5DSS B;  3N7J A;  3W9T A;  1TTU A;  1YTO A;  1HWO B;  1IOB A;  2NP0 A;  1ILR 1;  4LO7 C;  4HJJ A;  2IHO A;  5BXR A;  3CRH A;  1HIB A;  1EYL A;  1XYF A;  3OGF A;  1TWM A;  3O49 A;  3Q7X A;  4I4Q A;  3A23 A;  5DUY A;  2ESU A;  1G9C A;  2AQZ A;  2IWT B;  3FJ8 A;  1EPW A;  4GP0 A;  4I1E A;  2KH2 A;  2Q9X A;  3CAH A;  3N7M A;  2K8R A;  1TIE A;  3PHZ A;  2VSE A;  4D0T A;  2AXM A;  1MC9 A;  4CJM A;  4EFP A;  4JRA A;  1F31 A;  2NYY A;  4QBV A;  2VUA A;  3I29 B;  2D7R A;  5G00 A;  3AKG A;  9ILB A;  1FN0 A;  2J3P A;  1R8O A;  4MZG B;  5D62 A;  2HW9 A;  1DZC A;  2X2T A;  3FFZ A;  5F8W A;  4XFU A;  4EFQ A;  2LIE A;  4TLP A;  5GAQ A;  1JT7 A;  3V0B B;  2Y9W C;  1BAS A;  1YBI A;  2Y9X E;  3RMY A;  5BXP A;  3BTA A;  4EKX B;  1M2T B;  1S0F A;  1ABR B;  3P6I A;  4I6I A;  4X38 A;  3P53 A;  1ISY A; 
#chains in the Genus database with same CATH homology
 1T4Q A;  2D24 A;  1E0O A;  3K1X A;  4DCK C;  4LO0 C;  3BA7 A;  2DRE A;  2VSA A;  3BA4 A;  3UJ0 A;  2GO2 A;  1QXM A;  2DRY A;  1XZZ A;  4IZX A;  4KC3 A;  1ISW A;  1G9A A;  1MD6 A;  1Z2V A;  3IIR A;  3HMY A;  4XFS A;  4MZF B;  3WMV A;  3RTI B;  2I1B A;  5FZU A;  3AKF A;  2KI4 A;  3HBW A;  3CQA A;  4I4S A;  3LTQ A;  4I96 A;  2BEB A;  4I4P A;  1FWU A;  1FGA A;  41BI A;  1PC8 B;  3HAL A;  5BP5 C;  2XOA A;  1V6X A;  4R6U B;  2D1Z A;  3WO2 A;  1G9B A;  1ISZ A;  1DIW A;  1JY0 A;  3O44 A;  1BFG A;  2D20 A;  4I4R A;  3A07 A;  1RZO B;  3CA5 A;  3RMX A;  5FZY A;  4ION A;  1DFQ A;  4JKQ A;  4QAL A;  3HOM A;  3IM6 A;  1AVX B;  1JT4 A;  4FVV A;  3E8L C;  1EVT A;  4LO1 A;  1OQL B;  1XG6 A;  2ET2 A;  4ZOT A;  3PUB A;  4XKI A;  2F8X C;  4G6J A;  3FJJ A;  1UPS A;  3FJI A;  1VCL A;  3BRD A;  3VT1 A;  5BVP I;  2M49 A;  4HR6 C;  1GGP B;  3R4S A;  3FUQ A;  2FFU A;  1TWE A;  3H6Q A;  1WD3 A;  1WBC A;  3FJB A;  2MIB A;  8I1B A;  3VT0 A;  3BAO A;  5BQU C;  1Q04 A;  2RG9 B;  3O4A A;  3A21 A;  4Q9P A;  5EC5 A;  1PZZ A;  3BAG A;  4I8M A;  4LO1 C;  3UDA A;  2UUS A;  1ISX A;  1IHK A;  3WO4 A;  3BA5 A;  4ZFY B;  1W3A A;  4UY4 A;  4XFT A;  3H6S E;  3FJH A;  2KI6 B;  4Z9W B;  2Q3N B;  2FDB M;  1R8N A;  3O4C A;  1Q03 A;  4X39 A;  1PUM B;  1I1E A;  3RTJ B;  1JLY A;  4QD2 C;  3ZX7 A;  4I1B A;  3Q7Y A;  3FJC A;  4GP3 A;  3A22 A;  3OJM A;  4QC4 A;  4IY9 A;  4JP0 A;  3FJA A;  4KEI A;  1Z0H A;  4II0 A;  4KEK A;  5D61 A;  4P6A A;  3VWC A;  4J2Y A;  4GAI A;  3VSZ A;  2AAI B;  3PME A;  3BRG C;  1S0E A;  3BAV A;  4I0Y A;  4EB2 B;  3V79 C;  4IHZ A;  3R4U A;  1IJT A;  1AF9 A;  5FZZ A;  4I7I A;  3I2A A;  1DJS B;  4LO2 A;  2DS0 A;  1AVW B;  4P0L A;  1I1B A;  4DEP A;  4OEG A;  3AH4 A;  4QKR A;  3LLP A;  2WRY A;  3NBE A;  1NZK A;  2P39 A;  3B9U A;  1SR4 A;  1A8D A;  4I4X A;  1Q1U A;  2K43 A;  3AZV A;  3F1R A;  3QYD A;  3BRF A;  1TOO A;  3AJ6 A;  2BFH A;  4ISQ A;  4Z8S B;  1JT5 A;  2HWM A;  1DQO A;  1FV3 A;  1DLL A;  2Z48 A;  3CRG A;  3IAG C;  4D8H A;  3FGM A;  4LO2 C;  4J2X A;  3H6R B;  4EFR A;  4I4U A;  2RQ9 A;  1NUN A;  4LO7 B;  21BI A;  1S0L A;  1M16 A;  2QYI B;  4ZFU B;  3FUO A;  4H9W A;  4LO3 A;  3SNV A;  3UD9 A;  3O3Q A;  3I2X A;  3CA6 A;  3O4D A;  4ZLB B;  1DQG A;  3BAH A;  3CA3 A;  4J2S A;  3S8K A;  3JRR A;  3T8S A;  3JUT A;  1PUU B;  1HCE A;  2HZ9 A;  3BAU A;  3VEQ A;  4I2S A;  3FJD A;  5EHA A;  2VU9 A;  1G9D A;  5HPZ A;  1CE7 B;  1TP0 A;  2L5X A;  3IM5 A;  1L2H A;  3O4O A;  2ZR1 B;  4H04 A;  2LIQ A;  3POK A;  1IRA X;  3ZXG A;  3Q7W A;  4X3A A;  2K4A B;  2HWA A;  1JT3 A;  4ZFW B;  3ZC8 A;  1ISV A;  4LO3 C;  1G82 A;  3OJV A;  2Y9F A;  3AH1 A;  3V0B A;  3KMV A;  3VSF A;  4Q9G A;  1AXM A;  1FQ9 A;  2D23 A;  4ZBV B;  7I1B A;  4OWK A;  1HKN A;  1S0B A;  4IQP A;  4I37 A;  3P6J A;  31BI A;  4J23 B;  1BFB A;  2E4M A;  1AVU A;  2F2F A;  3WA1 A;  1JTC A;  4P0J A;  3WIN A;  3OBT A;  5BXS A;  2MLL B;  3H6R A;  3UD8 A;  1J0S A;  4P0K A;  1WBA A;  2NVH A;  2ZQN A;  1QQL A;  3MPP G;  3EF2 A;  2D43 A;  1WD4 A;  3RSJ A;  2P23 A;  3CA0 A;  3NJ5 A;  3N7L A;  1IT0 A;  2Z49 A;  1CVS A;  1W3G A;  2R9K B;  4LO8 B;  3CRI A;  1FWV A;  1YF8 B;  1TFM B;  2E4M C;  1BA7 A;  1HCD A;  3WIN C;  3D7W B;  2NZ9 A;  4OWJ A;  1IRP A;  4IYB A;  3HN1 A;  1FV2 A;  2QN4 A;  3AKI A;  1RG8 A;  4X37 A;  4QBC A;  1YXW A;  5B2H A;  4A7Y A;  5FNX A;  1XHB A;  2FO1 A;  3V0A B;  3O5W B;  4GOY A;  6I1B A;  4JQ0 A;  2KLL A;  3OGG A;  1BLA A;  1BAR A;  2FFV A;  3FJK A;  4JPZ A;  4OEE A;  5JLV A;  4LO0 A;  3ZC9 A;  1Z4S A;  1BLD A;  4OUJ A;  3QR5 A;  2RST A;  3O4B A;  3C9Z A;  3WO3 A;  5F8Y A;  4AN6 A;  2YUG A;  3IM7 A;  4JAW A;  1JQZ A;  1JLX A;  5DVH A;  1V6U A;  3BAQ A;  4D0Z A;  4PC4 A;  1QQK A;  4I4V A;  4IY8 A;  1S0C A;  4F83 A;  4H75 A;  5E24 E;  4I4O A;  1ONK B;  5EG6 C;  4OWL A;  1V6W A;  1AVA C;  3ZXD A;  3S8J A;  1V6V A;  1N4K A;  1II4 A;  1KNM A;  4HA2 A;  3OBR A;  3HSM A;  4F34 A;  1DFC A;  5BP5 A;  5BOW A;  1SR4 C;  3AKH A;  4QD2 B;  2NM1 A;  3CA4 A;  4JKX B;  1FMM S;  3FJ9 A;  2D44 A;  3N0K A;  4L4H A;  4DEN A;  3AZW A;  3MAL A;  2D7I A;  5F90 A;  1RY7 A;  4ZGR B;  2X2S A;  4A7K A;  3AJ5 A;  5I1B A;  2VLC A;  3NBC A;  3OJ2 A;  3BX1 C;  3TC2 A;  4FGF A;  4J2K A;  1S0G A;  1YYN A;  1PWA A;  4I4Y A;  3V0A A;  4AN7 B;  4KBB A;  1ITB A;  4USO A;  3CA1 A;  4OW4 A;  4GOV A;  1AFC A;  1S0D A;  1FMZ A;  2KKI A;  3CU1 B;  3FJF A;  3N7K A;  1DZD A;  2D22 A;  3NBN A;  5JMC A;  2Y9G A;  4G9N A;  1BFF A;  4ZA3 B;  3NBD A;  1T9F A;  2NS2 A;  1W3F A;  5BQU A;  1HWM B;  4END A;  5F8S A;  3VUO A;  3ILA A;  1HWP B;  2VXT I;  4YOL A;  2GZB A;  5BXT A;  3BAD A;  4OEF A;  3BB2 A;  2WBC A;  3UD7 A;  5D63 A;  4ISR A;  4I3N A;  4Q91 A;  4G1R A;  4QO3 A;  2FGF A;  2NTD A;  1BFC A;  1D0H A;  3AH2 A;  4IZE A;  3VT2 A;  3PG0 A;  1HWN B;  2VXR A;  2MC2 A;  1RML A;  1K5V A;  1K5U A;  4WBC A;  1P63 A;  1EV2 A;  2AFG A;  2DRZ A;  4G9M A;  4G6M A;  3FJE A;  4QKS A;  4GAF A;  4USP A;  5DZU A;  5FNW A;  2BEA A;  1IIL A;  4MZH A;  3F62 B;  4L4I A;  2ZQO A;  1SZ6 B;  3UJ4 A;  3WMU A;  4EEE B;  4ZKT B;  2F2F C;  4A7Z A;  2ERM A;  4KEJ A;  5DSS B;  3N7J A;  3W9T A;  1TTU A;  1YTO A;  1HWO B;  1IOB A;  2NP0 A;  1ILR 1;  4LO7 C;  4HJJ A;  2IHO A;  5BXR A;  3CRH A;  1HIB A;  1EYL A;  1XYF A;  3OGF A;  1TWM A;  3O49 A;  3Q7X A;  4I4Q A;  3A23 A;  5DUY A;  2ESU A;  1G9C A;  2AQZ A;  2IWT B;  3FJ8 A;  1EPW A;  4GP0 A;  4I1E A;  2KH2 A;  2Q9X A;  3CAH A;  3N7M A;  2K8R A;  1TIE A;  3PHZ A;  2VSE A;  4D0T A;  2AXM A;  1MC9 A;  4CJM A;  4EFP A;  4JRA A;  1F31 A;  2NYY A;  4QBV A;  2VUA A;  3I29 B;  2D7R A;  5G00 A;  3AKG A;  9ILB A;  1FN0 A;  2J3P A;  1R8O A;  4MZG B;  5D62 A;  2HW9 A;  1DZC A;  2X2T A;  3FFZ A;  5F8W A;  4XFU A;  4EFQ A;  2LIE A;  4TLP A;  5GAQ A;  1JT7 A;  3V0B B;  2Y9W C;  1BAS A;  1YBI A;  2Y9X E;  3RMY A;  5BXP A;  3BTA A;  4EKX B;  1M2T B;  1S0F A;  1ABR B;  3P6I A;  4I6I A;  4X38 A;  3P53 A;  1ISY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...