3OGJA

Crystal structure of partial apo (92-227) of cgmp-dependent protein kinase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
SHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PRKG1 protein
publication title Co-Crystal Structures of PKG Ibeta (92-227) with cGMP and cAMP Reveal the Molecular Details of Cyclic-Nucleotide Binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 30
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.12: cGMP-dependent protein kinase.
pdb deposition date 2010-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ogjA00
3ES4A 2ET1A 3E6DA 2V09A 4LA3A 4IEYA 3RYKA 3E97A 4YNIA 4MX3A 1O4TA 1I6XA 3CEWA 5LEJA 3CLPA 3D82A 1OMIA 2GU9A 3MDPA 2XL7A 4KWKA 3QACA 1O3SA 1HW5A 3U11A 1DZRA 3I7DA 4XF0A 3TNQA 2GC2A 4IESA 2OZJA 2PAKA 4I09A 5BPXA 1ZZ9A 3DN7A 5LEKA 1QXRA 4Q0PA 3EBRA 3E5QA 3DV8A 2UY8A 2H0VA 1O5LA 3TNPB 2IC1A 5KHGA 3UKVA 4HMZA 3LOIA 2XL9A 3E6BA 2C0ZA 1J3RA 2QNKA 4BYYA 2XKOA 2B8MA 4FBFA 3GBFA 1EYBA 4HSJA 4MUVA 4I0BA 3OGJA 1XE7A 4HN1A 4JTOA 3IBMA 1U12A 5CADA 3MYXA 5EFUA 1LRHA 1FI2A 4QXKA 4YRDA 4IEUA 4LUMA 3ELNA 3M3IA 3KGLA 4I02A 1RUOA 1YFYA 5BXXA 3H1WA 1CAVB 3D0JA 4J1XA 2XLFA 4YARA 3WW1A 1LB2A 4FT8A 4Q0UA 3NKTA 2IXKA 2Q30A 2IXIA 1GQGA 1WLTA 1RL3A 1ZZ7A 5I8TA 3PNAA 4WZCA 2IXJA 3CJXA 1CGPA 2OA2A 4MGZE 1H1IA 3H8UA 1ZRCA 4P9GA 1X7NA 4BHPA 3EQEA 4BIFA 5J7MA 5FPXA 1NE6A 3E5XA 2OPKA 4EWAA 2CAUA 5K8SA 2Q0AA 4WVZA 4K8FA 5I0TA 3U10A 1ZVFA 4PJYA 3FHIB 1X8EA 4L11A 2OYZA 3LA3A 1Q5OA 1PMIA 4J1WA 4NVPA 5FLHA 3RYRA 4Q0VA 5KHIA 4QM8A 5HI0A 1VR3A 1ZREA 4EWDA 1NXMA 2GAUA 3I59A 1RUNA 4IEXA 1YHFA 2IXLA 5I8SA 2F4PA 3H1MA 1Q43A 3WW4A 4XF3A 1FXZA 4XF1A 4IEOA 3KCCA 3C3VA 3UKNA 4PIYA 1NZCA 4PIXA 3ES1A 2FMYA 4QMAA 1UIJA 3D0SA 4Q0SA 3HT2A 1CAWA 3BPZA 4LLOA 1Y9QA 2ZCWA 3M70A 1TQ5A 5FDBA 4ONUA 3BB6A 1ZZCA 1J3QA 1ZNPA 5C6CA 4D7TA 3KGZA 5BY5A 4META 3N4MA 2BYVE 2PHDA 4XFHA 2IXHA 2VQAA 1DGRA 2IXCA 5FCCA 1CAXA 1O3TA 3ETQA 3FFQA 4HVOA 3KMHA 1QWRA 2Q4SA 1YUDA 4XF9A 3HQXA 3S7IA 3PVBB 2EAAA 4FAGA 4LA2A 4HVQA 1H1MA 4E2SA 3H3ZA 1XE8A 4L2NA 1YFWA 4Q29A 1RGSA 1J1LA 1IPKA 2Y0OA 2Q1ZB 4IEQA 5FQ0B 5CU1A 4OLLA 1CAUB 2BGCA 2K9ZA 4HVRA 3ST7A 2HKXA 2ZKLA 3LAGA 3SCHA 1ZZ8A 4MGKE 3LA2A 1FT9A 4E2GA 4QX5A 4I2OA 4CYDA 3NW4A 5I91A 5E16A 4KWJA 2FQPA 3RNSA 3H3UA 2B5HA 4AVCA 3IIAA 2D5HA 4H7LA 1CX4A 3S7EA 4MV2A 3OCPA 4R52A 3SHRA 4TLFA 3ZDSA 4KU7A 1UW8A 2CAVA 4QGMA 4ZU5A 1RC6A 2PA7A 1UIKA 4R8HA 2MNGA 2H6BA 1Q3EA 1WGPA 3UKTA 3B02A 2PAMA 2WC2A 1X82A 2GC3A 3NL1A 1O7FA 3RYPA 2P17A 3HT1A 4MH0E 4UBGA 3BALA 4AQ6A 1X8MA 2VECA 3EHKA 4XFCA 2PYTA 3OD0A 1RTVA 2DCTA 2UYAA 4Z82A 1SQ4A 2XLGA 3SCGA 1JUHA 2PQQA 4JV4A 5F1RA 4Q0QA 2GC1A 4X6QB 3BCWA 2PAEA 3L2HA 2XKPA 4N9IA 4IERA 4XETA 1ZZ6A 3IWZA 2QJVA 5KBFA 4AVAA 4XFBA 4ORFA 5JCTA 3I54A 1CAVA 3IDCB 3MPBA 4KL1A 2PHLA 1EY2A 1GQHA 5JSPA 1O3QA 1VP6A 4LTAA 2QVSB 2D93A 4X6RB 1ZRDA 1UD1A 4IEPA 4IEZA 5T3NA 4LUKA 4AVBA 1LKNA 1Y3TA 4HBNA 5LRSA 3LZZA 2GH2A 5JAXA 5KHJA 4XFAA 4BH9A 1OD5A 4E2QA 4MGIE 3FX3A 5BUVA 1L3JA 3RDIA 2HJIA 3GYDA 3R6SA 1G6NA 1DZTA 3SMHA 1NE4A 3G7DA 1ZRRA 4O9GA 1QXJA 3FJSA 4N9HA 5I0RA 3JZVA 3SXWA 3EO6A 2ET7A 5FLIA 2VPVA 1J58A 5I8YA 1SEFA 4FAHA 4HN0A 3IDBB 5FPZA 1YLLA 3SCFA 4D7SA 5JSOA 3NVCA 4UXAA 3CO2A 4ZU7A 5KHKA 3OTFA 2KXLA 4AQ2A 4KU8A 2QCSB 3DKWA 3U0ZA 4A2UA 4GULA 3E5UA 2H6CA 2ATFA 1V70A 1ZZBA 3VHRA 3MZHA 2EA7A 3E6CC 1YFXA 4DINB 3H7JA 4LULA 3H9AA 1I5ZA 4B29A 2XHKA 2O8QA 5KHHA 4QGLA 3RPQA 2Z2SB 4XFFA 4JVAA 3PLQA 4HLTA 2ETEA 3O14A 3RZZA 5BV6A 1LR5A 1EP0A 4QGNA 3HIFA 5FLJA 2CGPA 4O9EA 4F7ZA 4AXOA 4EWEA 4EV0A 4OFGA 3FWEA 1YFUA 4UBHA 2EVXA 2PFWA 3LA7A 4MZUA 3CL1A 4YSFA 4XF4A 3WW3A 2BNOA 3USSA 4PIZA 3I59B 5E1RA 3WW2A 5I93A 5D1IA 2BNNA 3KSCA 4LEJA 3FE5A 3DL3A 2Z69A 2UY9A 1J59A 2WFPA 3NSTA 4I3PA 1O3RA 2K0GA 2MHFA 4ZU4A 3OF1A 5JSRA 5EZWA 1CAWB 5I0UA 4IETA 2E9QA 5JR7B 5AVPA 1DGWA 1QY4A 4XFIA 4MGYE 5LRRA 2N7GA 3ROUA 1J3PA 3EJKA 1WA4A 3S0MA 5J3UA 1YWKA 1CAXB 2D5FA 2GC0A 2BNMA 2GZWA 2O1QA 2QDRA 1VJ2A 2XGXA 4QM9A 5FQ0A 1O5UA 3QOPA 4XFGA 1CAUA 3FZ3A 4JTNA 2I45A 4XEZA 1UCXA 1XRUA 1PM7A 3H7YA 3ACLA 1EPZA 3CF6E 3BU7A 3H1YA 4HSLA 4I0AA 4Z07A 5I0SA 3H50A 3LWCA 5J48A 1ZX5A 2XLAA 4RD7A 4F8AA 3NJZA 1UPIA 2MPFA 4EROA 4IEWA 2OZ6A 4IEVA 1OI6A 5CVRA 1ZRFA 4YYOA 1OFNA 1NYWA 4KWLA 1SFNA 2BEOA 4I01A 1IPJA 2CV6A 2UYBA 5C8WA 2B9UA 4HZFA 2PTMA 2D40A 4WBBA
chains in the Genus database with same CATH superfamily
2JIGA 2ET1A 2VMHA 3Q9OA 4ZXEA 4LHSA 4RS5B 1K12A 4Q4V1 2V09A 5A6ZA 4IEYA 2JB8A 5FYBA 1O4TA 1CN1A 1PNGA 1V6MA 5F2SA 1E5RA 3VD4A 1OMIA 3Q8FA 2GU9A 1IGOA 3GJBA 3WF0A 3GBWA 3ZXDA 1E5HA 4NHMA 4QPGB 3ZYPA 3I7DA 2VTFA 2VOKA 3VHPA 2GC2A 1K5MA 1W3XA 5IVBA 5LA0A 3M7AA 3U4SA 3I2JA 4IV3A 4XACA 3DN7A 4Q0PA 2GP3A 5LBCA 3EBRA 3IIIA 1VAVA 3IMNA 5FP4A 4DZGA 5EPAA 1IG3A 3D3AA 2K46A 2UY8A 3POEA 1FPN2 5FYSA 3O12A 5FZMA 2C6SA 3TNPB 3T0DA 1K42A 1TMF2 1UY0A 2LS6A 3C7OA 3UKVA 1PO21 2Y6GA 3MW4A 1VBE3 5BNNC 5ACA2 4JAAA 1COV1 2XL9A 4XUNA 3UT0A 4COVA 3RZLA 4NIGA 2XR4A 1DQ0A 2QNKA 5FZOB 5C71A 3CDZB 1NY72 1GZ9A 2R071 3U14A 3VBOB 4R4XA 4DNYA 2MEV3 4LO8A 5HXMA 1L7RA 4NRMA 5DPNA 5EHDA 1SBDA 4M3CB 3OGJA 4V2VA 4UAPA 1POV1 4LO7A 4JGZC 2CTVA 2P37A 4D0QA 4IEUA 5FFOC 1YXWA 5FZLA 1K5JA 4HETA 3KGLA 4BXSV 1LAJA 3AKQA 3PIJA 2ADDA 4Q4Y2 4EN7B 1NOVA 1YFYA 2PQSA 4S2HA 3N7KA 1LHWA 5BXXA 5FZKA 4OI1A 2DCKA 4M3CA 3H1WA 1EAH1 1CAVB 3E1F1 5TSWA 5JOYA 3D0JA 2HEWF 2NM1A 4YZ3A 1RIRA 4FOVA 2D44A 3FC0A 4UI9L 4X8PA 1ULDA 1W9WA 3PTYA 5F37A 3WW1A 3VZMA 3I3QA 5DZFA 5FO9B 4IE6A 1HQNA 1AR71 3VBFC 3ETPA 4CA9A 2X5IA 2B45X 1LESA 2DTWA 2HWD1 2XUEA 3POIA 5J96B 4JGYC 2RJLA 4AEKA 4N7UA 5I8TA 2A6ZA 3MO4A 3B93A 4K20A 4WVVA 3RRDA 1MZ5A 2DUPA 3CJXA 1W03A 1CGPA 3OEBA 4R9BA 4FFHA 4MGZE 1H1IA 3WDWA 3K51A 1JU3A 2JE9A 4PBOA 3ZXJA 3WV6A 4QQ2A 1X7NA 4LK7A 2QQOA 4XZPA 3ZN5A 5C5TA 3D6EA 3AP6A 1NE6A 4NPRA 2DVAA 4RQPB 1S0CA 1MS4A 4CCCA 5K8SA 4K7JA 4D8MA 1LOGA 3J8F3 4D7YA 2X29A 2DU0A 2Y60A 3WHUA 2VL4A 1KFUL 2ZHNA 1DGWX 2JG9B 2D6OX 4BQ2A 1RUG1 3NNFA 5JVVA 5LBEA 3CQOA 5CZKA 2G19A 3FHIB 5GLWA 4QHBA 1V6OA 3IZOA 4ZS2A 3ZLIA 1PX4A 1X8EA 4L11A 5F6LB 4ZHNA 3VBOA 3MW3A 2XMLA 3AP4A 2JXAA 2WS92 3LSDA 4W50A 3ZFGB 3UYJA 4C1WA 2XQXA 5A70A 4J1WA 1KFXL 2K2SA 5FLHA 3LDBA 1KITA 1FOD3 3TEXA 1UY3A 5A7QA 3LDKA 4DO0A 4Q0VA 4DY5A 4J6GA 4B1MA 4EZHA 1S0FA 2HLEA 3POWA 3BTYA 5AFEA 1TME3 1V6JA 2VZUA 2WZR2 3A0KA 1SLAA 1VR3A 2Y34A 4QX8A 4UFIA 3ZSMA 4EWDA 1HV0A 3ZR5A 5JI9A 1NXMA 5IATA 1OOPB 5J36A 2WFF3 2F4PA 1AX0A 4YM0A 3EMRA 1GWKA 2Q1MA 1Q43A 3WW4A 2RE9A 4NWWA 3OGGA 1FXZA 2XDVA 4U2AA 4B1LA 2E63A 2ZAAA 3KCCA 1C1LA 1AR81 2G9GA 4L9BA 4FPEA 1RUJ1 4XW3A 5T5PA 4P14A 4BQ4A 4HPKA 2P3YA 1AX1A 4AI1A 3AMMA 3WCSA 1GU3A 1PK6C 3HQUA 5A3TA 3A0NA 4CP9A 1PO22 2P6CA 3HT2A 2D6KA 1CAWA 5GZEA 3ZYBA 1GLHA 5FYVA 2ZAHA 2ARCA 1POQA 2Q5TA 3O0WA 3RQ0A 3WUCA 2V73A 2WO3A 2DU1A 5A1FA 5IVEA 2AENA 2PLV1 4CCOA 1J3QA 1ZNPA 5CB7A 4D7TA 1JOPA 2BYVE 2GP5A 4L92A 5DAWA 1HRV2 2PHDA 3SKVA 2IXHA 1G9CA 1DGRA 1ENQA 1VB2A 4XQ4A 1QOTA 2GSYA 3DGTA 1W8OA 2RDSA 3ETQA 5GLZA 5KXDA 4GH4A 2RHPA 4K40A 2Q4SA 3VBHB 4QDQA 5T54A 4EQVA 4K9SA 4HONA 4WVMA 4P9YA 3ACFA 2E7TA 4FAGA 4LA2A 1IKPA 3I3EA 1ZM1A 5FKCA 4W8JA 4E2SA 4OYUA 3BTZA 1H2NA 2BRTA 3POSA 4ATEA 3IB3A 4L2NA 4CUCA 2GMPA 4Y5SA 1EAH2 1YFWA 2J42A 4Q29A 4YVWA 4NR1A 1J1LA 1UZVA 2B9VA 4A3XA 2CGNA 4LE4A 4TWTA 4G9SB 1HN0A 1A78A 1MS0A 4D3WA 2R6QA 2W3JA 1ZYBA 3AFKA 2K9ZA 3CHXA 1VBE1 4FPKA 3ST7A 1JI6A 2TUNA 1PGL2 1ODNA 1Q8PA 3KV5A 2P3JA 2HKXA 2ZGLA 4FQ4A 2ZKLA 2FCTA 4KBBA 1U5YA 5J37A 4MGKE 1D0GA 5IVCA 1V6KA 3LA2A 1FT9A 3NQHA 5A33A 4MXWB 4AL9A 4E2GA 2MEV1 2W39A 3B00A 4I2OA 4RHV3 3OGRA 1S1AA 2FQPA 3J4UH 5IW0A 3RNSA 2W47A 3WDVA 5A3MA 4I0WB 1JBCA 4OHWA 3IIAA 5C9AA 1JZ4A 5F3GA 5LA2A 3H8OA 4MV2A 3K4AA 2CYFA 3SHRA 4TLFA 3WG1A 3H42B 4XUPA 3WNOA 1H8VA 5C3SA 2W46A 2Y0IA 4BMBA 4ES8A 3VBRB 1GWMA 1J1TA 2HBUA 1ULEA 2WNOA 1NA1B 1POV0 4ZU5A 1RC6A 1RUG2 1RXFA 4FOYA 2BQPA 2W9XA 3TWIA 1VMFA 1AVBA 4R8HA 5BNNB 2MNGA 3FBYA 1U0AA 4DRVA 3UKTA 3PDQA 3GJAA 3OB8A 3QLQA 1QKQA 2A71A 2ZGUA 3ALQA 2OX0A 2BOIA 3LE0A 1JYVA 1O7FA 1KDKA 2P3IA 3NV1A 1OVPA 2P17A 2CNAA 4UBGA 1XU2A 3BALA 2NMOA 3N3HA 3EHKA 3WD5A 5A6YA 5FP8A 5EJ1B 4JGZB 3GBGA 1R1ZA 3JD73 3NJYA 3KQ4B 5FZIA 5JOXA 3PL0A 1GP5A 1V00A 2W92A 4WV8A 4AAXA 4GQ7A 5FZ8A 2OUJA 5EQUA 2J1VA 4WZFA 1JYXA 4CDQA 2WT1A 3VV1A 4QU1A 5FP3A 4A45A 2ZEWA 3W20A 1AR82 1WWYA 4MLOA 1RUJ2 3BCWA 3J8F1 1BBT3 2PAEA 2XKPA 4CDXC 3HAGA 4Y33A 1RUI3 2V4AA 1JZ6A 3UGGA 4IERA 4XUQA 4BZ4A 4AVAA 4JC1A 4FP2A 4YW6A 3WG3A 3VZLA 1UN1A 3I54A 4UW4A 4JGYB 4MXWA 2E31A 1W6QB 2VTXA 3JB8A 1AXZA 3WHTA 1Q56A 5GZGA 3TRSB 2DVGA 2R49A 1J83A 4BCUA 2PLV2 4KL1A 5CAZA 3W5NA 2ID4A 3N9OA 2D97A 1EY2A 2VQUA 4B8EA 2PXJA 2XPJA 1FOD1 4YM3A 1N3OA 2RJ2A 5CG8A 2WNEA 1ZRDA 2VW0A 3HN3A 4BOWA 3WDYA 2A3WA 3ILNA 5LK7B 1TME1 4CU6A 1DG6A 1VBD3 1XPWA 4HBNA 5JMCA 5LRSA 2CGOA 2E33A 1V9U3 3MF6A 3DUIA 1W8UA 2WFF1 1SPPA 5BNNA 2WQ8A 2TEPA 1UYZA 4XFAA 4BH9A 1OD5A 3MI8A 1W2OA 2CY6A 5DAXA 2VCBA 4J25A 5FYYA 3WF3A 3RDIA 1GFF2 1AHSA 1RUH3 4YFZA 2ORZA 5EIYB 1SLIA 1ONAA 3QH7A 1LJ7A 1RVF3 2ZGOA 3RMYA 3PU8A 1SCRA 5IVFA 2YB7A 3R6SA 3SMHA 1MS3A 1G9DA 4PLOA 4M4PA 3ZSLA 3RMXA 3VBSC 4BLJA 2ZGTA 3M3QA 1QXJA 4O9GA 2D3RA 2D98A 2WSUA 3JZVA 3CMGA 1GZWB 3EO6A 2ET7A 3AVSA 5D8AA 2XJRA 1VBE2 2VPVA 5F3CA 4JGZA 2GMEA 3AL5A 3CU7A 4V2WA 3IDBB 5FPZA 2XVLA 2CU5A 2BUKA 2VMCA 3O0VA 4GXLA 1KGYA 2W95A 5FZ4A 3T1MA 1UKRA 3J7MA 3JUUA 4AVSA 3WNNA 4AQ2A 4OULA 1RUD2 3IPVA 4UFHA 2QCSB 3DKWA 4XXAA 3WVJA 3U0ZA 2MEV2 3MLLA 1WW6A 1ALYA 2ATFA 3E5UA 1LGNA 4PQQA 2Y8KA 3DEMA 2V5DA 1ZZBA 3AZWA 3C7GA 1UU5A 4GALA 3PU3A 3E6CC 3RSJA 1W6NB 4RFT0 1O6UA 3WR0A 4QD2A 3ZR6A 5HCHA 2ZBJA 2FBEA 2O8QA 5KHHA 1W3VA 1UOFA 4XDOA 3WF2A 2ZABA 3MBWA 3VBFA 5KWRA 1W0PA 2HWB3 4XFFA 3ZPYA 4JVAA 1LHUA 4XVHA 5C8CC 1JODA 2R30A 4JGYA 3LOBA 1IPSA 3PURA 3OUHA 4NPLA 2A75A 4W65A 4SLIA 4W6XA 1W6MB 2WA3A 4L0PA 1U5XA 4XQDA 5JZGC 3K4ZA 4NN0A 3MUY1 1MZFA 4BDVB 5DG2A 4UFMA 3PJQA 1OD3A 5L7OC 1PVC3 4UBHA 4BWOA 4XOGA 1KD7A 3AM2A 4Z8BA 2I74A 3THCA 3M3CA 1QQP2 3ZDVA 4AAPA 3POFA 3O1TA 4QQHA 3USSA 3GNEA 4YM2A 3LIGA 2CHHA 1WZXA 4PIZA 3WW2A 1AXYA 1UZYA 5DUUA 2VCCA 1C8NA 2Q8CA 2QDNA 3DL3A 3AMQA 4CU8A 3IDEA 4RHV1 5FYUA 1JN2P 2UY9A 3I8TA 4H7MA 5IVVA 5A6XA 1J59A 4XJWA 2WFPA 4E4DX 3U4XA 2W5FA 3RI8A 5FMBA 3OD4A 3OYWA 3MW2A 2WA4A 1FYUA 2MHFA 4IE4A 3T30A 3ZYJB 5JSRA 5EZWA 2FZ2A 4RS5C 4BISA 4DEVA 1AYM3 1AL22 3M3OA 3U78A 4ZY9A 4IETA 3THPA 4Y20B 1S2KA 1DIWA 3W58A 1QY4A 3CIHA 2PHUA 4XFIA 2L9LA 3J7HA 3L9JT 4ET7A 5JIAA 4GA9A 1OC1A 4MGYE 5ANNA 1U5IA 3CNAA 5A7PA 4CCDA 3ROUA 4QXHA 1WA4A 3AC0A 1WBFA 2D5FA 2GC0A 2BNMA 1UNBA 2QDRA 1FOD2 2VMGA 2WWSA 2XGXA 4CP0A 1MS8A 1W6NA 5FQ0A 1S0BA 2WNVB 2VNRA 4I30A 3BUCA 3USUB 2ZHMA 4AI2A 3VDAA 3HNYM 2HWC3 4AI9A 1PM7A 5A3PA 1C5HA 4EJRA 4I0AA 4Z07A 2C4XA 3ECQA 3JD71 1QNWA 4FVVA 5LATA 5CFDB 3H50A 1W6PB 1PK6A 3MPPG 2VVFA 5FJKA 1JHNA 1EV13 2QQNA 4QXBA 2DFBA 1JOJA 1SLTA 1KS4A 5DABA 1ZRFA 5E88A 2E32A 4PLMA 3J7NA 1BEV2 4W6WA 4QQPA 2RR13 1CIWA 4JZRA 1BBT1 2VGDA 1CESA 4MHUA 1ND2B 3BTAA 1RUI1 2CV6A 2JDNA 1SFYA 4GWIA 4XCAA 1URXA 1WCKA 1RUF1 2J1SA 3PHMA 4WM8B 2P3KA 5A3LA 5A1AA 5C8WA 1WLCA 3KT4A 3FL7A 2R062 4QU2A 2ZMLA 5T5LA 2D40A 4RA0A 3SH4A 3SITA 4QB1A 1R093 3E6DA 4WVWA 2QQIA 3RYKA 1NQJA 2GN3A 3E97A 4QT6A 1F35A 1RUC3 5EJZB 4DIQA 3CLPA 3D82A 5F39A 2OKXA 5L19A 3PVEA 3WDXA 3RVHA 4KWKA 3QACA 1CJPA 1YEWA 1DZRA 1QJY3 2RVAA 4XF0A 1VBD1 4COUA 2XONA 3I2IA 1H9PA 3LCPA 1GV9A 1OF4A 1UF2C 3QBQA 4QKFA 5G04L 1V9U1 3T4HB 2PAKA 4I09A 5BPXA 1W8WA 2XJUA 3OUJA 1CJDA 4PDWC 3OY8A 2VNVA 4URAA 2VZ1A 4KWUA 4R9AA 3H8XA 2HWE3 1GICA 1RUH1 1XSQA 2AEZA 5FY1A 2H0VA 3MFCA 1RVF1 4ISQA 3AK0A 4CUBA 1IQDC 1O59A 2VZPA 2VNOA 3LOIA 4M00A 3UL2A 2RS13 3V0AB 2VC9A 2BVVA 1YQ2A 2WZEA 1C57A 3E6BA 4E8CA 3O1VA 3NNLA 4N43B 4CDUC 2XKOA 4RQPC 2B8MA 4AHWA 3T4VA 5JUVA 4QQLA 3GBFA 3SISA 2AUYA 3LEIA 3R05A 4H2AA 4HSJA 4IGQA 4I0BA 5LB6A 5F3EA 1AYN2 2ARXA 2ZGMA 1C8M3 1HIXA 2JG9C 3PUQA 4RHV2 5G05L 2VZSA 5C3PA 3ZFFB 1U12A 2Y6LA 1YYNA 5JXJA 3R4SA 2ZTNA 1R083 2EIBA 5EFUA 2VM9A 1CZSA 1W9FA 2WLQA 5FPUA 3T09A 4YRDA 4LUMA 5L73A 2Z5WA 1X50A 1QH7A 3ZFGC 4LBJA 4CEYC 2IVJA 3BI3A 2YGMA 2RS33 1EUUA 1RUOA 4QAWA 3ILFA 2HWB1 1GP6A 3VBSB 2LW8A 2WZ8A 4AR2A 3O7OA 2A6XA 2EIDA 4Z2AA 1KS5A 5CNAA 4CCEA 3VLBB 5ABJB 1GOFA 3PUIA 1CX1A 3VN4A 1NCRA 4QB6A 1C5IA 1OF3A 3UK9A 2IXKA 4K8RB 3RWNA 5LY1A 2YU1A 3SKJE 2YZ4A 2B39A 3WNPA 1CQ9A 1OOPC 2ZGRA 1PVC1 2GNTA 2O0OA 1WLTA 1RL3A 4Q4X1 3POGA 4NAMA 4E4ZA 2BVBA 5FMOS 1G9FA 2LUWA 2OA2A 4CDXA 4CUGA 1LCLA 4Z1VA 3C7FA 4IQPA 1OFSA 3VHNA 1ENSA 1KEXA 2DF7A 4LIUA 4OZXA 1OQDA 1UZ0A 1WCDJ 3BGAA 4LHLA 4P9GA 1MACA 4XUTA 3V65A 3VDDC 4BIFA 5J7MA 4CDWB 1BYHA 5C8CB 2Y38A 2ZJCA 5A7SA 2Q0AA 3DYMA 5CYYA 2NP0A 4Q1RA 1DP0A 3AP9A 1GANA 3S6PA 4CUAA 3ZKYA 2RG4A 4NHXA 2Y6KA 3LFMA 4PJYA 1AYM1 2B46X 1RUI2 1UMIA 4ISRA 2VO5A 4A7ZA 5DN2A 2D6LX 3S5AA 2UWAA 2GN7A 4LMFA 5FYTA 3WOGA 2WRAA 2KD7A 4PBPA 2O14A 4PHZA 3UJQA 5DUXA 4BK4A 1VBB3 3LA3A 3A23A 1PMIA 1UO9A 2KA3A 2VUCA 2ZX0A 3LFIA 3VBHC 5HV0A 3MV11 4MXVA 4O65A 1K3IA 2JG8A 4CSWA 1AR93 1OLME 2XQRA 3B01A 4XQWA 2Q1FA 4C0HA 4ZKTB 3T0AA 1VE0A 1JUIA 2ADEA 5A7WA 1LU2A 2VZOA 1LULA 4QM8A 1W8ZA 2HWC1 4A4AA 5CA6A 1FX5A 2G9ZA 2GAUA 1UMHA 3K3OA 4Y22A 4CXXA 1RUNA 4XBNA 2VCMA 2IXLA 3VBSA 3WP3A 2BDRA 2X53S 5JDBA 1V9U2 1YO8A 2J1RA 2V4VA 1EV11 1I1EA 1AF9A 4RR3A 1MS9A 3C3VA 4HANA 4P9WA 4N53A 2D6PA 1RMU3 3WLUA 4PIXA 5F5AA 4DB5A 1MQTC 4AGGA 1PO12 1W8FA 5DAVA 4FFFA 1RVF2 1UIJA 4CCJA 2RR11 1IS6A 1MPXA 1OQ1A 1RXGA 4AHZA 3RG0A 2XOMA 1SBFA 3DYPA 4UW6A 1ULGA 1S55A 3O1RA 3FUQA 4LLOA 2J1AA 2GNMA 4P02B 4YW2A 4Z2WA 1A6CA 1Y43B 4ASLA 2UWCA 4GZ9A 1R091 4WM7C 5HPOA 3VBRC 3IAQA 1RUC1 2BBAA 4XFHA 2PHXA 2SLIA 2VQAA 4HK9A 5FCCA 5C8CA 1NA1C 2AH2A 3P5BA 1CAXA 3ZKUA 5DDJ2 4EN6B 1KXGA 5JWPA 3KMHA 5FIXA 5IK5A 3GCXA 3RJRA 3HQXA 5FO7B 5JZGA 3S7IA 3PVBB 1QJY1 2EAAA 5IK7A 4Q2FA 3J7LA 5L7OA 1Y9MA 5JLVA 1GNYA 1L7LA 3H3ZA 2Y26A 3SH5A 2QQLA 5CKMA 3LKJA 1XE8A 5DG1A 2B4KA 3AL6A 3I3MA 3SEEA 3TEZA 2HWE1 3U37A 4DXTA 5A1LA 1UL9A 5FY7A 3GCWA 1W9YA 1LOBA 3KV6A 2Q8OA 5DMYA 3FHQA 4AGRA 2NZ9A 1CAUB 2BGCA 4IUGA 4TLGA 4CEWB 4HT1T 2RS11 4RGGA 1OSGA 4QQOA 3N9NA 1MEC2 2VUAA 4JX0A 1ZZ8A 3SCHA 1ZRIA 3B7MA 5EXOA 1PMJX 1VRH2 4CYDA 4RS5A 3FBMA 3LIHA 5I91A 2VD7A 1F9KA 4KWJA 3ZIWA 2R043 2YC4A 1C8M1 2XJPA 4EN0A 4AVCA 4BPZA 1IHMA 3ZYRA 4H7LA 1R081 3S7EA 3GHMA 2OW4A 4PDWB 4XCBA 5A80A 1WMDA 5FK8A 1ENXA 1JXNA 4P9JA 4QPGA 4AEMA 5C33A 1LENA 4QGMA 1OLRA 2HYKA 2RS31 1PGW2 4JQTA 1X33A 1DZQA 1YQ8A 2OIIA 3N9QA 3MFAA 3KZ4C 1S4CA 5LZ6A 3B02A 2WC2A 3KM5A 1UWWA 1XE0A 4YW7A 4CDUB 3NL1A 3RYPA 2ZX1A 3HT1A 1RHI2 2PMWB 3ITQA 1E57A 2J1TA 3WCRA 1HB4A 2VECA 4IW3A 5IUQA 4Y26A 3OD0A 2RMU3 2FDKA 3LQCA 2DCTA 2ZGSA 4ASMB 2QZ2A 4Q4W2 2HWC2 1OA2A 1QJX3 5FZOA 3AJYA 1Q8SA 2D3PA 2ZZQA 1H1AA 4K6BA 4M0HA 1ZA4A 5CKQA 4LBQB 2VUDA 2XLGA 4FOWA 1N3PA 1XJAA 4XHXA 1ZBE3 1O4YA 4B4RA 3SCGA 4CEYB 3B9IA 3MIHA 5K0UC 2AEYA 4Q8LA 2W0XA 4K3UA 2VQTA 1EV12 4JV4A 4Q4V2 3WG4A 3KD4A 2ZA9A 4Q0QA 4NMIA 1J84A 2DV9A 2EICA 1QJU3 5A32B 1SDWA 1R1A3 2XVKA 2P34A 2OQ7A 1X9TA 4Q26A 4XJ9A 1LNSA 2LM3A 1B09A 2DCZA 5KBFA 4XFBA 4ZPIA 2FDHA 2F6BA 3ZM8A 4M01A 2YBKA 1CAVA 3GZUC 3OOXA 4DY3A 3ACHA 2HWF3 3IDCB 4COYA 1VBB1 1PX3A 1Y9GA 3SLIA 3JB4C 1WMEA 2VG9A 3GGLA 3LPGA 1AR91 1UOJA 5JSPA 3K2OA 1RUC2 1VP6A 4X6RB 2DBNA 4XJZA 1WD4A 3VDDB 2ARBA 2VR4A 1HJGA 3OPTA 4BIOA 1Y3TA 3VGIA 2ZHKA 4CVUA 1WCQA 3LZZA 1COV2 2GH2A 1GR3A 5AC93 4AI8A 5JAXA 3ZOIA 5A6QA 3ORJA 1XNBA 2R072 4JKMA 3FX3A 3VKLA 4CXYA 4AQTA 3B9CA 4BQYA 2BP6A 2HEVF 2A7AA 3JQXA 3WG2A 1F8VA 1W04A 1BVP1 4RQPA 3ASIA 3GYDA 3BIWE 1RMU1 3FLTA 1OHFA 5FZ1A 2NYYA 3ZN6B 1ULCA 3RGBA 4S2DA 1UU4A 2JG9A 3SXWA 5FLIA 1BK0A 3V0BB 1VMHA 1ZA7A 3OG2A 1NCQC 3QH6A 4FSJA 2JICA 1YIPA 2RS12 3MLKA 4HN0A 5T50A 4OUMA 3KT7A 3CO2A 1DF0A 5GALA 4ZU7A 5DAPA 1NKGA 3OTFA 2KXLA 3K77A 3ZFGA 4CEYA 3C8XA 2XJTA 3HWJA 4B4QA 1OLMA 2DVBA 1YCIA 4A2UA 5KC5A 2A6VA 4GULA 1TZOA 1IS3A 1Q8OA 5L9RA 4LNVA 5LBBA 5DQ0A 2PHRA 3MZHA 3NV3A 1LGBA 1AR72 3LGRA 4GIQA 3N9PA 4LIVA 2RM23 5A32A 3H7JA 2WLPA 4LULA 1M06G 2HWD2 2WSVA 3T0BA 3PMSA 2VVEA 5FV3A 2HBTA 4AHYA 5IFTA 2VQ0A 2XXZA 5C4WB 3VD9A 1MQTB 2EAKA 1FMD3 2Z2SB 4MO3M 5IWFA 1PZ8A 3PLQA 1OOPA 2JE7A 3J26N 3O14A 1M4WA 3RZZA 4NOTA 2YMZA 1EP0A 4QGNA 5FLJA 3O1UA 3I2OA 1W6OB 2CGPA 1HKDA 2WNVC 2YY1A 5BNOB 3BKZA 4O9EA 4F7ZA 3KV4A 2CWSA 2QQMA 4TYSA 1YFUA 5CFDC 5GZFA 2TBVA 2IUWA 1BCXA 3GDBA 4IV1B 1UOGA 2R1BA 4MZUA 3VDDA 4WM7B 4H55A 1RYYA 4O7XA 3O1OA 1DGRN 3I59B 3AYDA 5I93A 3EB7A 1D4M3 5FZDA 3FE5A 2VZQA 2BWCA 1JU4A 2AACA 1W0OA 1ND2C 3P3NA 3TN93 2R041 1AR63 3MLJA 4I3PA 4WM8C 4W4ZA 2ZXQA 4R9DA 5FZCA 2K0GA 4OHYA 3PUAA 1PVXA 3JQWA 3V56A 4E27A 4ZXKA 3VBHA 2X05A 4XJUA 2XJSA 4DXZA 3BOPA 1Y4WA 1BLZA 4GMP1 4QKNA 4XE9A 3MF9A 2A5ZA 2D3SA 2VULA 1DGWA 4DUWA 3WQ7A 4QPWA 2X8KA 4KGGA 1DQ4A 5CISA 5FPVA 1SZBA 5IJRA 3HNBM 4OHVA 1W9SA 5LRRA 4D94A 4S2FA 2WWUA 1HX6A 4TSVA 5J3UA 3ZFEC 2GZWA 4QM9A 1PM4A 4FQZA 1VJ2A 4YG6A 4UYBA 2BFUL 4XFGA 5JI7A 1HXS3 4EE2A 3FZ3A 3R4DB 1JYTA 3VL9A 2YUEA 3H7YA 1W8HA 2IVIB 1AL0G 1EPZA 1RUF3 2RMU1 2X09A 3ACLA 1QEXA 3CF6E 3DPRC 2AREA 1LOFC 3KQRA 4JCKA 4JDNA 3WNMA 5I0SA 1QJX1 5IK4A 5L36A 4FTEA 3LPFA 5H9RA 2YFZA 4RD7A 3LSEA 2Q8EA 4XJ8A 4K1YA 3VBUB 1ZBE1 5BYNA 4MSVA 2MPFA 1AJKA 3I2KA 2OZ6A 1KJLA 4YYOA 5CFCB 1OFNA 4YW4A 3RWKX 1CIYA 4N43C 5E6HA 1ND3B 4NE9A 2A6WA 1W05A 1QJU1 2WAAA 2DURA 2YYOA 1MVEA 4WM7A 1R1A1 3VBRA 4XABA 1IPJA 1DQ6A 1NA1A 1DHKB 5FMDA 1W39A 3ZFFC 4DEQA 4Q1PA 2XVGA 3VZKA 2HWF1 3VL8A 4LA3A 1RB8G 4B7EA 1BHGA 3K75B 2VXRA 3TB0A 3CEWA 1JZ5A 1P8JA 1QDOA 1GBGA 1HRI3 2RDQA 4AEDC 2J1EA 4AFCA 5FP9A 1QHDA 3MDPA 4HFSA 5IVYA 2XL7A 5K0UB 4XUOA 3FFZA 3NV4A 5ABJC 1HW5A 3TNQA 1GNZA 2ENRA 5FXWA 2E6VA 2OZJA 1ULOA 4FPLA 5AC91 2BJSA 3I2FA 2YV8A 3KVBA 1D2SA 4OUEA 5FOBB 2VMFA 5FZGA 5LEKA 3BN6A 4BU2A 1VAKA 2VOXA 4OI0A 3E5QA 1BZWA 3DV8A 2ZMNA 1EUTA 2Y33A 1IS5A 3T2TA 2BU9A 4YZ4A 1NXD1 1O5LA 1UYYA 3NAPB 4C90A 4XTMA 1WA6X 1UY4A 2WNUC 2HH9A 4DOUA 2IC1A 3LEGA 3VHOA 3NWKA 4G4FA 2ZX2A 4HMZA 2E51A 3MHZA 5HBAA 4NIAA 3SEPA 2V5YA 1TE1B 1W9TA 3LF7A 3DXUA 4XILA 4GB31 1J3RA 1US3A 3CZJA 3MICA 4CDWC 4BYYA 3AXEA 3O0XA 5JIUA 2WQ4A 1W6QA 4Q8KA 1EYBA 1PIV3 5EWSA 4LKFA 4DXSA 1XE7A 5JXHA 5B4NA 1IS4A 2EIGA 3FUOA 3NNJA 5CADA 1TMF3 3MYXA 1K5MC 2VUJA 4AGVA 3B3QE 2JWPA 5JOZA 1LRHA 1WUVA 4JQRA 4LR4A 4BQWA 4Q4X3 2RM21 5CKNA 3MV01 2R1DA 1SACA 4LJHA 2XHNA 4YVSB 4HXCA 2P1BA 1CONA 4I02A 5JMOA 1LOAA 2ZPXA 3KLSA 1FMD1 2W2IA 2VH9A 5KXCA 2FDJA 4PCRA 4AOCA 4J1XA 4QHZA 1PMHX 1K45A 5J98B 3OGVA 1F2NA 3OUIA 1NCQB 3ZXKA 4YARA 1X9PA 3RZJA 2VMIA 2E53A 2VOWA 2DVFA 3NKTA 1PHMA 3QD6A 1XSRA 4V1PA 1H8TB 1T2XA 2Q30A 5FZAA 4ZZ5A 1W8NA 4Q4Y3 3DXTA 3J8F2 4WZCA 1QOSA 1GZWA 4OHXA 3LB9A 4BK5A 5T55A 1AX2A 5FYIA 4Y24A 3IMMA 4UFJA 5FPLA 2RMU2 1YQCA 2W87A 1V6LA 1D4M1 3O1MA 2JEMA 2XB6C 1REEA 3Q8EA 5A3OA 1G9AA 4MGSA 4GKXA 1ZRCA 5AFBA 4BHPA 3EQEA 2VOTA 2JECA 5FPXA 4OQ8A 3E5XA 2QZ3A 3RZGA 4DPNA 3TN91 4EWAA 2Y6JA 1QNYA 1AR61 2CAUA 3GZAA 4WVZA 4FTSA 2WWJA 3LD8A 4PI0A 4BXFA 4XBLA 1MZ6A 5SV8A 5I0TA 4MGQA 1ST8A 4YGEA 3U1XA 3U10A 4EN9B 1ZVFA 2IFWA 5EV7A 1TME2 4FTBA 3TEYA 3SC7X 2BZDA 1RJ8A 3AXDA 1UXXX 4XMIA 2OYZA 5FYHA 4K1ZA 1MZEA 4NUBA 5CIRA 1Q5OA 4YZ5A 1TVGA 2WFF2 1W6MA 1UY1A 4BLIA 1T6BX 2HWF2 3ABZA 4NVPA 2W91A 3RYRA 3I49A 1D2QA 3WUDA 4NAOA 2HEYF 3WQBA 2IWGB 3P1IA 3N7LA 1D0HA 2A3XA 2LALA 3IDAA 1JOBA 5KHIA 1HXS1 1H2KA 1ZREA 1DLLA 2UU8A 1Y7BA 1GUIA 2XWBB 1VPHA 4IEXA 2WS93 1YHFA 2YFUA 4RFRB 3J9SA 4E8DA 5I8SA 2QUOA 1GZTA 1DLCA 4NRQA 5LW9A 4LOTA 5FMCA 1YC61 2QQVA 4XF1A 3WNLA 3PVNA 3RZMA 4LHNA 3NKGA 2Z42A 4CEWC 4PIYA 1W06A 1F5JA 1NZCA 2CDPA 5ANQA 4AWDA 1BKZA 3W59A 3VD3A 2FMYA 5LBFA 4QMAA 1US2A 2WZR3 2EXHA 3UJOA 5A7OA 3CJIB 4ZS3A 1H6YA 4FCAA 2GNBA 4Q0SA 5JXGA 3PJYA 2VMDA 4JDOA 1BMV1 3NO8A 3ZFEB 3BPZA 4CU7A 4BQ5A 1UKGA 1Y9QA 2LTNA 4QPIB 4Y4YA 2ZCWA 5LA9A 4P5HA 1Z7S3 4Y20A 5FDBA 4FPFA 1MS5A 4JKKA 4ONUA 4DXRA 1YQ5A 2C1FA 5D21A 5FPAA 5FAXA 1S0DA 5C6CA 3QCWA 4BE3A 3DPRB 3N4MA 4JHTA 4P00B 5GZCA 1DQ2A 2VZVA 3GM8A 4OVEA 3WZ1A 3VD7A 2IXCA 3H0OA 3HD8B 5FP7A 2B7YA 1O3TA 2A73B 1HRI1 2FCUA 3FFQA 4XAAA 4CXWA 3M4FA 2WNVA 1UPSA 4LKEA 1N47A 3USUA 3BYWA 2RM22 2WYFA 4AFDA 4ASKA 1H0BA 5IHRA 3ENRA 1JZ2A 4GWMA 3IM0A 1W8TA 5J09A 5CFDA 1H1MA 1F31A 1W6PA 1ZBA3 1FMD2 4LXLA 1S0JA 5E89A 1HRV3 3AZZA 5HXVA 1JZ7A 3AZVA 2C9AA 2BGPA 2Y0OA 4CPBD 5FZFA 4IXLA 4TZDA 4A44A 5FBJA 4IEQA 4LT5A 4OCTA 4N7IA 3AKTA 4Y1XA 3AYCA 4HVRA 4LLFA 1ND2A 4URTA 4UOJA 2Y6HA 2ZEYA 4AVVA 4YGCA 3R4UA 4WM8A 4AEDB 2JDHA 5A7NA 3AYEA 3L2YA 1C3HA 2BOJA 1UYPA 2EXJA 2OUHA 2RDRA 3KCYA 4QX5A 4QXCA 2C24A 1PIV1 3N9LA 4OZOA 4O61A 5T52A 5E16A 1QJZA 3D4KA 4GD4A 2ZZJA 1N3QA 3MIGA 4COWA 3H3UA 2AGSA 2FCVA 4QHOA 1Q8QA 3RFRA 1TMF1 2JDZA 4BM8A 2D5HA 1CX4A 1AR62 1F15A 5FZ3A 1HB1A 3W9AA 3ZDSA 4KU7A 1UW8A 4UWDA 1N1VA 3FHAA 4LBMA 1SHWB 3AP7A 1TEIA 4LPLA 1NY71 3ZFEA 2WNUB 5T5JA 2PA7A 4IE5A 1UIKA 3POBA 4NIHA 3PVOA 3JD72 1Q3EA 2V72A 1YIFA 2ZX3A 2JKXA 5K9YA 3FLPA 3I2GA 3DPRA 4FPGA 2QTWB 2D43A 3N7MA 1LOFA 2VJXA 4JRAA 1S2EA 4C91A 1XNDA 4YG0A 4MH0E 4FXKB 5F9TA 4CPBA 1GOHA 3ZXAC 4Q4Y1 4XFCA 4RGAA 1BBT2 3V0AA 2PYTA 2QKDA 3GF6A 1N1SA 1RTVA 3UESA 2VZTA 3ZPOA 2E7AA 2UYAA 1K5MB 5FZ9A 2JIJA 4N8MA 4TN7A 3ZVXA 4N43A 2C5DA 1GKBA 1RUF2 3A4UA 4IV3B 3LDRA 3F2ZA 1JUHA 2PQQA 3K4DA 4HKWA 5E8AA 5H9SA 5F1RA 2QE3A 5FO8B 3VUOA 3MIDA 4GJZA 3ZFFA 4XHBA 2GC1A 3HVDA 4LQRA 1DDLA 1WW5A 2WR9A 3KHCA 2JDAA 4N9IA 3ATGA 4NRPA 2DTYA 4XETA 2QJVA 4MOAA 4XIKA 5K4LA 1ULFA 2VU9A 2XJQA 1VBD2 3CKHA 3MUZ1 5I0DA 3TBDA 5ABJA 1KDMA 1MVQA 2PHWA 4QDRA 3ZXGA 2PHLA 3U07A 1H2MA 1H9WA 1XU1A 3T08A 1O3QA 2UURA 4AFAA 4YM1A 4KG0A 2VBBA 4K21A 1RUH2 3URFA 4DMIA 4LTAA 5C5UA 2QVSB 2WBKA 2CSGA 4XC9A 1UD1A 3UETA 4Y1ZA 1LU1A 4FOQA 3AB0A 4LUKA 4AVBA 1LKNA 1W28A 1DYOA 2VBPA 4DFSA 5BNOC 4MVTA 2BERA 3OBTA 3VZNA 2BTVC 2WS91 2VY0A 2RV9A 5FY9A 3VKNA 1OXCA 5EYXA 4E2QA 4AQSA 1FV3A 5ISLA 3HR9A 4IV1C 1XYNA 4C1XA 2E26A 3JXSA 5A3UA 2HJIA 4CDWA 1LHOA 3M2MA 1F4HA 2EXIA 4FFGA 4KNCA 2QQJA 1SDDB 1G6NA 1HV1A 2X5IB 4Q5OA 1NE4A 3W5MA 3R0RA 3G7DA 1ZRRA 2WZR1 3KF5A 3FJSA 1CR7A 5FTTC 5I0RA 2JDMA 2BWAA 4BQ1A 2YPDA 4RN5A 4NHLA 1RITA 1N1YA 4GWJA 1IQAA 5I8YA 4JRLA 1N1TA 4ITCA 5AVAA 3OPZA 1YLLA 3WY6A 3SCFA 2VBDA 2BBVA 4D7SA 5JSOA 1Z7S1 3NVCA 2QBXA 4UXAA 4MG2A 2HWB2 3WF1A 2R7EB 5FPBA 5KHKA 5FY4A 3AKSA 1LHNA 1UXZA 2IFRA 3AFGA 3PTRB 1PIV2 3ZMNA 1C4RA 2H6CA 5B2GB 1V70A 2AZ5A 3AJZA 1YNAA 2CL2A 4XZUG 3PMEA 4NHYA 5FYCA 1LHVA 1LTEA 1SLCA 4DINB 3H9AA 1NZIA 1PVC2 4Q4X2 3SNMA 4HG6B 4TTGA 4LO5B 3RPQA 1I9RA 3F95A 4CCMA 3VB9A 1RUD3 2ETEA 2UWBA 1G9BA 1ZBA1 4CZSA 4UFLA 5F5CA 2NN8A 4Y3OA 4FXGB 4DUXA 1HRV1 4ZZ8A 5ERLA 2YDEA 4NO4A 4AXOA 5D8AC 4EWEA 2WZPP 2ZX4A 2ZGNA 4EV0A 4I3GA 3S5QA 4FPCA 4XXPA 1OQEA 2PFWA 3LA7A 1OBNA 5F7UA 2NQYA 3CL1A 2YPJA 4QWNA 2GDFA 3VBUC 3OJBA 4GMP3 2ZACA 2BNOA 2P5BA 4M4RA 1AYM2 4XDQA 4BQ3A 5CFCC 1R64A 3BIEA 4AG4A 3DECA 3P3PA 2P2KA 4AEJA 1UZWA 4IGOA 1ND3C 1WW4A 4NROA 1OVSA 4FPYA 1XYOA 2ORXA 3A21A 3NSTA 3AP5A 2A6YA 4LE3A 2BPA2 3P6BA 4HPKB 2W08A 1O8PA 1QQP3 1QU0A 1PGL1 2ES3A 4ZU4A 4CP9B 1KQRA 3OF1A 4LBKA 2A1XA 2G4IA 1CAWB 4F3JA 5I0UA 4YLZA 2EXKA 5FY8A 2E9QA 4M0NA 4SBVA 4KG8A 1QXPA 1LODA 3MIFA 3WXPA 2RDNA 2VTXJ 4JDMA 3LEMA 1GQPA 3RJ2X 4RGKA 3O1PA 2JB4A 1RUE3 5SV5A 4UW5A 1ENRA 3EJKA 3NJVA 3AMHA 3KWVA 1STMA 2O1QA 2AC1A 2I07B 1HN1A 2PN5A 3ZYGA 4CRQA 1SCSA 4QX3A 4GH4B 1O5UA 2ZEZA 3QOPA 4CE8A 5FJHA 1AL23 1CAUA 1OH4A 3CZUA 3DCQA 4E4SA 3B94A 3WQ1A 2RR12 1UCXA 1XRUA 2VMEA 4KQ7A 4CEWA 4WVMB 4LBQD 1XQNA 3BU7A 3H8RA 3H1YA 1S2BA 4HSLA 1FATA 4BJ0A 2F17A 3NAPC 3N7JA 5FZ6A 5J48A 2XLAA 2EALA 1UU6A 5T5OA 3OEAA 4F8AA 3BTXA 1JH5A 1OPMA 1SBEA 1NAEA 2CDOA 5DUWA 5GLTA 3WSOA 4YVWB 3NMBA 4IEWA 1R092 1RINA 3FMGA 1VBA3 3Q8CA 4S2GA 3K46A 3NJXA 2Y6FA 2A70A 3SQOA 1QIQA 4PDWA 4CTEA 1JYCA 1QF3A 4COZA 1OKQA 1X36A 2BEOA 1QDCA 2BV4A 2VZRA 2WN3A 4Q27A 4UW3A 4A6SA 1JZ8A 1HB3A 2ZEXA 4CCKA 3Q8BA 3TEWA 1OUSA 4AK3A 3ACGA 1A3KA 1D4VB 2B9UA 2ZMKA 3AKPA 3IN9A 1VAMA 1OA4A 1QJY2 4HZFA 1C28A 3M1HA 1F4AA 3WDTA 5A33B 2PTMA 3THTA 4WBBA 3ES4A 2YU2A 3HOBA 1MS1A 1Z7S2 5CG9A 1BEV3 1JS9A 2JKBA 4MX3A 4YNIA 4CDUA 1WKYA 4YVSC 5IT6A 4MGTA 5C9AB 1I6XA 2R32A 5LEJA 2HWE2 2D7FA 5F5QA 5FXXA 3JBG3 3GHNA 1Q8VA 1DQ5A 1T6GC 5KXEA 1S0GA 2CWMA 1O3SA 3OPWA 3U11A 1GNHA 2R063 4GB33 3A22A 3HBZA 4IESA 3UGFA 1XYPA 4LKDA 2PHTA 4OI2A 2XBO3 2F4LA 1H8TC 1ZZ9A 4LBQA 5EJ3A 1QJFA 1QXRA 2WYSA 1ZBA2 3HBKA 3K3NA 4RL7A 2LROA 1PNFA 3OGSA 4LBNA 3DF0A 1E5SA 1SMVA 1C8M2 2BGOA 2JE8A 3RZHA 5KHGA 4EZ4A 1CD3G 1R082 3M8LA 5BNPC 2IZWA 3I97A 4PF5A 4FPJA 5FUIA 5F8PA 5L9BA 2C0ZA 3ON7A 1QGLA 2WQZC 3V64A 4B7KA 5FYMA 2RS32 4QX0A 4FBFA 1VBC3 1GYKA 1IOAA 5APAA 5A3WA 2AYHA 4XIOA 3BU0A 4MUVA 4YW1A 3NRUA 3UGHA 5F5IA 4OMDA 4HN1A 1WMFA 4CDQB 2JDYA 4JTOA 4XBQA 5H9PA 4CCNA 3IBMA 1I3HA 5GKAC 1BQPA 1YJLA 4KI5M 3TYJA 1FI2A 1LEMA 4QXKA 1YQ6A 3RS6A 3WDUA 3WP4A 2XUMA 3ELNA 1H6XA 1WW7A 4DUVA 2WO2A 3K48A 3M3IA 1ASJ3 1NLRA 2ARAA 2PELA 5BNQA 1DYPA 2ZHLA 3BPSA 3ME2A 1TG7A 5FK7A 1RUD1 4MYEA 2RS53 1WBLA 1UZZA 3HNMA 4IE0A 1AYN3 2DCYA 4RYDA 3ZXEA 1GWLA 2XLFA 1NLSA 3DYOA 2DFCA 2XH6A 3ZIXA 1LB2A 4FT8A 4Q0UA 3NNMA 3HEIA 4P08A 1OURA 3BODA 1ACCA 3X29B 3ZSKA 5HCBA 1UYXA 2IXIA 1GQGA 3ZN6A 5EYYA 1IG0A 4F83A 1EPWA 2JJ6A 4QKDA 1ZZ7A 5FKBA 4QKBA 3PNAA 2VOVA 2ERFA 4W6YA 4NJ4A 3BVCA 4Y5TA 3SH3A 3V0BA 2IXJA 4LO6B 1BXHA 5IAXA 1NUKA 4KH9A 4LBLA 1SPPB 5C4WC 1F5FA 3H8UA 1DQ1A 5CEHA 1W99A 4OHZA 1H4HA 4UFKA 5F3IA 3TAYA 3ZMOA 3CJIC 2SBAA 2GALA 1DFQA 3MEPA 5KXBA 1VBB2 2OPKA 3MIBA 5FZEA 2WL1A 3VZOA 4AVTA 4OI4A 2O8OA 2J1UA 2VZ3A 4K8FA 2FDGA 4QPIC 1V6NA 1AR92 1REFA 1QQP1 1TNFA 1IKQA 2VVDA 3WP6A 4AYUA 5GLUA 2Y64A 3INAA 2WABA 5D8AB 1NCRC 3HPNA 5D2AA 5C4WA 1MQTA 3ACIA 1SG3A 2BW8A 2R16A 5DUVA 2W68A 4YZ1A 4D6SA 5J1XA 2DCJA 4BMEA 3U75A 5FZBA 4YG3A 1JZ3A 3IT8A 3IPVB 1W6OA 1L7QA 3ZYFA 4H3WA 1RUE1 1Z0HA 2B42B 5BNOA 3PIGA 4PF1A 1NX9A 3C7HA 2NPIA 4PQ9A 5DZGA 5IVJA 1OA3A 5F2WA 2WT0A 2VCAA 1RMU2 4XDPA 1LOEA 4IV1A 2FZ1A 4C0BA 1B35C 3D8CA 5GM0A 1AL21 1BK1A 1UX7A 1YJKA 4DRRA 1W90A 5HI0A 1NT0A 3VBFB 1CZTA 4LK6A 3I59A 3N36A 3KT1A 3JU9A 3HMYA 4LHKA 1LECA 3H1MA 2WN2A 4X8NA 1VIWB 3H3LA 2J22A 1XNAA 2EF6A 4XF3A 4D6RA 1W2NA 1QOOA 4IEOA 4PT6A 5JPNB 2JDPA 2X10A 3AZXA 4A42A 4L8QA 3T2PA 3UKNA 5FRAA 1VBA1 2NMNA 3POYA 1VALA 3ES1A 5HCFA 1ODMA 4NIIA 5FWJA 1JYWA 1H2LA 2RJKA 1OUXA 3D0SA 1OKOA 4MHRA 3AZYA 1QH6A 4P9IA 4DS0A 1OPOA 1DYKA 1JHJA 2W1UA 3OSDA 2JG8C 3M70A 5DAQA 1TQ5A 3WEZA 1C1FA 1MR5A 4TXWA 3BB6A 4QPYA 1ZZCA 3WNKA 1O8SA 1DCSA 3KGZA 5BY5A 4META 4ES9A 3ZYHA 1O91A 1BEV1 2J7MA 2ILMA 1PO13 2W94A 2ZOEB 5FY0A 3ZO0B 4E4HA 1D7PM 5LA1A 4FO9A 4GKYA 3OYWB 2YBSA 3C2UA 4YGDA 5FREA 2QFEA 4HVOA 3JBG1 3UNPA 1QWRA 3ZSJA 1YUDA 4AFBA 4XF9A 2GNDA 1QJEA 1XXNA 5EP9A 3JCIA 2G9FA 3KCXA 2R061 4A41A 1DBNA 4RR3C 5K7PA 4N53C 4HVQA 1WLDA 4IGPA 4LOSA 3ZXLA 5LASA 2XBO1 1AJOA 3O5SA 3AYAA 4R9CA 5B4XA 2VE1A 4M3CF 3VBUA 2D6MA 2XG3A 3VKFC 1RGSA 1FPN3 5DXDA 2DBIA 2AR6A 1IPKA 1G86A 4XPVA 4CP1A 1WD3A 5DDJ3 5CFCA 2JD9A 2Q1ZB 1WCSA 2QQWA 3THDA 2R042 2WJSA 5FMOL 4AI0A 5ACA3 5FQ0B 1ND3A 3BOWA 5CU1A 4OLLA 4IV3C 5FBZA 4D69A 4LORA 4AHXA 1REDA 1Z78A 2WDBA 5F32A 5FUPA 2VNGA 2WKKA 3VDCA 3LAGA 1LOCA 1PK6B 5FY5A 1VBC1 4Y4RA 4C8DA 4QX2A 3NW4A 4MADA 4NWVA 5FXVA 2YG0A 1G7YA 3N35A 3NNGA 4IE7A 1H4GA 3NV2A 3ZX7A 4R4ZA 5A3NA 2B5HA 4YFWA 1NG0A 4LBOA 2Z4FA 5FZ0A 3OCPA 5C3QA 3I4IA 1XOYA 4R52A 2WUHA 5K0UA 2Z79A 3AVRA 4RSUA 3VKOA 5FR3A 1AUYA 1MEC3 3I2DA 4PI2A 5FXZA 3S30A 5IYYA 1ASJ1 2CAVA 2DUQA 4Y1VA 4IDZA 1VRH3 3RI9A 4A6OA 5M0TA 2TNFA 1BVVA 2H6BA 2P4EA 2RS51 1NLQA 1QJX2 1WGPA 2YC0A 1AYN1 1G8WA 3KS7A 1APNA 2PAMA 3KV9A 4FP3A 5BNPB 5C7GA 2WO7A 1X82A 2VXJA 2GC3A 1ZBE2 2JDUA 2R0HA 4B3NA 1RUE2 5FZHA 3UV9A 4E9KA 3NAPA 4B4PA 2JENA 4PLNA 4BQXA 3I3DA 2OXBA 4LO4B 4D6QA 4AQ6A 4UF0B 1JYNA 1X8MA 4GWNA 3VZJA 1QJU2 4HKOA 1HB2A 4KGQA 1UAIA 4N90A 4NHKA 3T2OA 5L9VA 1R1A2 3I3BA 1XNKA 4Z82A 2PHFA 3I2HA 1SQ4A 2WAOA 3Q8AA 3CBNA 1S0EA 4YGBA 2X5IC 5JPMB 1U5ZA 5LWBA 1WMXA 3OY8B 4IL7A 5JXIA 4Z92B 1WLWA 4OMCA 1A34A 2ZKNA 2JDKA 1AXKA 4GMP0 4QPGC 5HCAA 1UX6A 2ZGQA 4CU9A 1RHI3 3M3EA 4A7YA 4YZ2A 3MGUA 4X6QB 4GAZA 5C70A 1VBA2 3L2HA 4FPOB 2WINB 3WT3A 4Q4W3 1FAYA 4QB2A 2HYXA 3MIEA 3T3YA 2YHJA 4YVSA 4BA6A 1ZZ6A 3IWZA 5F6KA 3IKWA 4ORFA 3TOJA 5JCTA 5LY2A 1UOBA 4AFMA 2OPWA 4Q4V3 5AC92 1FNZA 2LRPA 3MPBA 2WIIB 4KBZA 5FYZA 3O1SA 4JKLA 1NCQA 1E5IA 2D6NA 1DGLA 1GQHA 5DZEA 3G6JB 2WO1A 4NPMA 4U36A 4A7KA 2YGLA 3VD5A 1H8TA 2D93A 2OVUA 1VB4A 4GJYA 1LEDA 3VBOC 1YI9A 4IEPA 4IEZA 4HOOA 3B69A 2Q8DA 3W21A 4AZZA 5JR2A 5T3NA 3EXUA 3JBG2 4A3ZA 4INDA 2VAUA 1UY2A 4BB3A 1JMUB 2ZS6B 2BFUS 5KHJA 4GB32 3AMNA 1AZDA 1HDKA 2XWJB 1GOGA 3FLRA 3T2QA 4MGIE 4XJAA 5BNPA 5BUVA 2XBO2 1NCRB 4M3CE 1L3JA 2ZGKA 2FDFA 2W52A 1A8MA 1GMMA 1VLNA 5CBLA 2OQ6A 5IFPA 4QX7A 1SLBA 1DU3D 1DZTA 5IK8A 4XAEA 5IAVA 4FPHA 3C7EA 3GZTB 1PO23 4OQ9A 5C3OA 1OH3A 4AF9A 5FOJB 4N9HA 4UF0A 4ARYA 1COV3 1FV2A 4AI3A 1J58A 4Y5Z0 1SEFA 1HQLA 4FAHA 3GALA 4YW5A 3IAPA 4L99A 3WQ0A 1S0IA 2R073 4CDXB 3S57A 1CWPA 1B35B 3ILRA 1XNCA 1I5PA 3HN1A 3EYPA 4KU8A 4HL0A 4CCLA 1V6IA 3KVAA 5JOWA 1WCUA 1VBC2 2R0FA 2DUOA 1POV3 1PO11 3LEKA 4H14A 5FUNA 1CVNA 3VHRA 3ZYIB 2EA7A 1YFXA 4YPJA 2ZGPA 2EIEA 1I5ZA 3PUHA 4EN8B 1BJQA 4B29A 2XHKA 3AMPA 4QGLA 1XNTA 4LKSA 3VKMA 4P9LA 3ZXFA 1ASJ2 4HLTA 2W1SA 1EAH3 5BV6A 1LR5A 3AKRA 3HIFA 1W2TA 1D4M2 3B5LB 4YW3A 4GH4C 5C3RA 2RS52 3FN9A 1FPN1 3WF4A 1HQWA 2YXSA 2JG8B 1AR73 1OLQA 2FMDA 4P5YA 5DDJ1 3RZKA 4OFGA 4UT5A 3FWEA 1SLLA 2HWD3 4HK8A 3TN92 5ACA1 4OUSA 2EVXA 5A7WB 1CPNA 2QQKA 1V0AA 2G1MA 2WT2A 3CJIA 4G3YC 4YSFA 2GH8A 2I2SA 2C9KA 4XF4A 1XC6A 3WW3A 5FZ7A 1KRIA 3AX4A 3GZEA 4YVWC 5E1RA 5KR7A 4Y22B 4FFIA 4QPIA 4L97A 2BNNA 5D1IA 3KF3A 3KSCA 2QQUA 3OBRA 4LEJA 1YI7A 1W2UA 1RJ7A 2Z69A 5FWEA 1CZVA 4JHZA 1CPMA 1FNYA 5GLVA 5LCWL 2XJVA 4RR3B 1XBFA 3WP5A 4N53B 4ZONA 5LK5A 1GP4A 1NQDA 4HKLA 3A7QA 2VW1A 4DQAA 2H0BA 1O3RA 4QDSA 5GJ6A 2YROA 4ATFA 1JTZX 4LITA 3D5OA 5H9QA 3WX5A 1MEC1 1RUG3 2C26A 1HXS2 4XYXA 4AE2A 1TNRA 2A3YA 1VRH1 4Y1UA 1GZCA 3WNXA 5C9AC 2FDIA 5JR7B 1B35A 1QMJA 2VW2A 4XTPA 5AVPA 3POJA 3N9MA 2JX9A 2P6HA 2KR2A 2QQPA 3KHBA 4KMQA 2FHRA 2DWRA 2E7QA 2N7GA 1J3PA 1ULPA 1PZ7A 1W2AX 3S0MA 1O4ZA 1CAXB 1YWKA 2DYCA 3KB5A 2YC2A 4XURA 1LGCA 1A8DA 1UMZA 1HJFA 3DKQA 4P9XA 4JTNA 1W0NA 1XB9A 2I45A 4XEZA 5JZGB 1VRBA 1PGW1 1KJRA 1OT5A 3T1LA 2W1WA 4AEDA 1YRZA 1IZ3A 1GSLA 5L7OB 1BMV2 4EYUA 4XMAA 2NLRA 5GZDA 3LWCA 3WINE 1ZX5A 1PGSA 4FI9A 1VMJA 2OS2A 3NJZA 1PZ9A 1UPIA 3HQRA 4ARXA 1SFPA 2DVDA 3VDBA 1AR83 4EROA 3ZN4A 4IEVA 1OI6A 1JW6A 1RUJ3 5CVRA 1RHI1 2YBPA 4AW7A 1HLCA 4YWAA 2FD8A 1NYWA 4KWLA 1UQXA 3OBAA 1HRI2 1SFNA 4I01A 5KC6A 2W1QA 4CP2A 3APBA 3HJRA 2JD4A 4Q4W1 2UYBA 2GMMA 5HV4A 3GXUA 3OBZA 4QX1A 3ZSEA 2WNUA 2DDUA 4CDQC 1JYIA 3PUSA 2OT7A 4NIDA 2KM2A 1H30A 2PLV3 4Y1YA
chains in the Genus database with same CATH topology
2ET1A 2VMHA 3Q9OA 4RS5B 4Q4V1 2V09A 4IEYA 1O4TA 1CN1A 1PNGA 1V6MA 1OMIA 2GU9A 1IGOA 3GBWA 3ZXDA 4NHMA 4QPGB 3ZYPA 3I7DA 2VOKA 3VHPA 2GC2A 1K5MA 3M7AA 4IV3A 3DN7A 4Q0PA 3EBRA 1VAVA 3IMNA 4DZGA 2UY8A 1FPN2 3O12A 3TNPB 1TMF2 3UKVA 1PO21 3MW4A 5BNNC 1VBE3 5ACA2 4JAAA 1COV1 2XL9A 4COVA 1DQ0A 2QNKA 1NY72 1GZ9A 2R071 3VBOB 4R4XA 4DNYA 2MEV3 4LO8A 1SBDA 4M3CB 3OGJA 1POV1 4LO7A 4JGZC 2CTVA 2P37A 4IEUA 5FFOC 1YXWA 4HETA 3KGLA 3AKQA 4Q4Y2 4EN7B 1NOVA 1YFYA 4S2HA 5BXXA 3N7KA 1LHWA 4OI1A 2DCKA 4M3CA 3H1WA 1EAH1 1CAVB 5TSWA 5JOYA 3D0JA 2HEWF 2NM1A 4YZ3A 1RIRA 4FOVA 2D44A 3FC0A 4X8PA 1ULDA 3PTYA 5FO9B 3WW1A 3VZMA 5DZFA 1HQNA 1AR71 3VBFC 2X5IA 2B45X 1LESA 2DTWA 2HWD1 5J96B 4JGYC 2RJLA 4AEKA 4N7UA 5I8TA 2A6ZA 3B93A 4K20A 4WVVA 3RRDA 1MZ5A 2DUPA 3CJXA 1CGPA 4R9BA 4MGZE 1H1IA 3WDWA 3K51A 2JE9A 4PBOA 3ZXJA 3WV6A 4QQ2A 1X7NA 3ZN5A 4XZPA 3D6EA 3AP6A 1NE6A 4NPRA 2DVAA 4RQPB 1S0CA 1MS4A 5K8SA 4K7JA 1LOGA 3J8F3 4D7YA 2X29A 2DU0A 3WHUA 1KFUL 2ZHNA 1DGWX 2JG9B 2D6OX 1RUG1 5JVVA 3FHIB 5GLWA 4QHBA 1V6OA 5F6LB 1X8EA 4L11A 3VBOA 3MW3A 3AP4A 2JXAA 2WS92 3LSDA 3ZFGB 4C1WA 4J1WA 1KFXL 2K2SA 5FLHA 1KITA 1FOD3 4Q0VA 4DY5A 4J6GA 1S0FA 3POWA 5AFEA 1TME3 1V6JA 2WZR2 3A0KA 1SLAA 1VR3A 5JI9A 3ZSMA 4EWDA 1HV0A 1NXMA 1OOPB 5J36A 2WFF3 2F4PA 1AX0A 4YM0A 2Q1MA 1Q43A 3WW4A 2RE9A 4NWWA 3OGGA 1FXZA 4U2AA 2E63A 2ZAAA 3KCCA 1C1LA 1AR81 2G9GA 4L9BA 4FPEA 1RUJ1 4XW3A 5T5PA 4P14A 4HPKA 1AX1A 4AI1A 3AMMA 3WCSA 1PK6C 3A0NA 1PO22 3HT2A 2D6KA 1CAWA 5GZEA 1GLHA 2ZAHA 3O0WA 3RQ0A 2Q5TA 3WUCA 2V73A 2DU1A 2AENA 2PLV1 1J3QA 1ZNPA 5CB7A 4D7TA 2BYVE 4L92A 1HRV2 2PHDA 2IXHA 1G9CA 1DGRA 1ENQA 1VB2A 4XQ4A 1QOTA 2GSYA 3DGTA 5GLZA 3ETQA 5KXDA 4GH4A 2RHPA 4K40A 2Q4SA 3VBHB 5T54A 4K9SA 4WVMA 4P9YA 2E7TA 4FAGA 4LA2A 1IKPA 1ZM1A 4E2SA 1H2NA 3POSA 4ATEA 4L2NA 2GMPA 1EAH2 1YFWA 4Q29A 4YVWA 4NR1A 1J1LA 4A3XA 2CGNA 4LE4A 4TWTA 4G9SB 1A78A 1MS0A 4D3WA 2R6QA 3AFKA 1ZYBA 4FPKA 2K9ZA 1VBE1 3ST7A 2TUNA 1PGL2 1Q8PA 2P3JA 2HKXA 2ZGLA 4FQ4A 2ZKLA 5J37A 4KBBA 1U5YA 4MGKE 1D0GA 1V6KA 3LA2A 1FT9A 5A33A 4E2GA 4MXWB 2MEV1 2W39A 3B00A 4I2OA 4RHV3 1S1AA 2FQPA 3J4UH 3RNSA 3WDVA 5A3MA 4I0WB 1JBCA 4OHWA 3IIAA 5C9AA 4MV2A 2CYFA 3SHRA 4TLFA 3WG1A 1H8VA 4BMBA 2Y0IA 4ES8A 3VBRB 1J1TA 1ULEA 1NA1B 1POV0 4ZU5A 1RC6A 1RUG2 4FOYA 2BQPA 3TWIA 4R8HA 1AVBA 5BNNB 2MNGA 3FBYA 1U0AA 4DRVA 3UKTA 3QLQA 1QKQA 2A71A 2ZGUA 3ALQA 1O7FA 1KDKA 2P3IA 3NV1A 2P17A 2CNAA 4UBGA 1XU2A 3BALA 2NMOA 3N3HA 3EHKA 3WD5A 4JGZB 3GBGA 1R1ZA 3JD73 5JOXA 1V00A 4WV8A 4GQ7A 2OUJA 4WZFA 4CDQA 2WT1A 3VV1A 1AR82 4MLOA 1RUJ2 3BCWA 3J8F1 1BBT3 2PAEA 2XKPA 4CDXC 3HAGA 1RUI3 4IERA 4BZ4A 4AVAA 4JC1A 4FP2A 3WG3A 3VZLA 1UN1A 3I54A 4UW4A 4JGYB 4MXWA 1W6QB 3JB8A 1AXZA 3WHTA 1Q56A 5GZGA 3TRSB 2DVGA 2R49A 5CAZA 4BCUA 2PLV2 4KL1A 2D97A 1EY2A 4B8EA 2XPJA 1FOD1 4YM3A 1N3OA 5CG8A 2WNEA 1ZRDA 2VW0A 4BOWA 3WDYA 2A3WA 3ILNA 5LK7B 1TME1 1DG6A 1VBD3 4HBNA 5JMCA 5LRSA 2CGOA 1V9U3 3MF6A 3DUIA 2WFF1 5BNNA 4XFAA 2TEPA 4BH9A 1OD5A 3MI8A 2CY6A 3RDIA 1GFF2 1AHSA 1RUH3 4YFZA 1SLIA 1ONAA 3QH7A 1LJ7A 1RVF3 2ZGOA 3RMYA 1SCRA 3R6SA 3SMHA 1MS3A 1G9DA 4PLOA 3ZSLA 3RMXA 3VBSC 4BLJA 2ZGTA 3M3QA 1QXJA 4O9GA 2D3RA 2D98A 2WSUA 3JZVA 1GZWB 3EO6A 2ET7A 5D8AA 2XJRA 2VPVA 1VBE2 4JGZA 2GMEA 3CU7A 3IDBB 5FPZA 2XVLA 4GXLA 2BUKA 3O0VA 3T1MA 1UKRA 3JUUA 4AVSA 4AQ2A 4OULA 1RUD2 3IPVA 4XXAA 2QCSB 3DKWA 3WVJA 3U0ZA 2MEV2 3MLLA 1WW6A 1ALYA 2ATFA 3E5UA 1LGNA 1ZZBA 3AZWA 1UU5A 4GALA 3E6CC 3RSJA 1W6NB 4RFT0 3WR0A 4QD2A 2ZBJA 2FBEA 2O8QA 5KHHA 5KWRA 2ZABA 3VBFA 1W0PA 2HWB3 4XFFA 3ZPYA 4JVAA 1LHUA 5C8CC 2R30A 4JGYA 3LOBA 4W65A 2A75A 4W6XA 4SLIA 1W6MB 2WA3A 1U5XA 4XQDA 5JZGC 4NN0A 1MZFA 5DG2A 3PJQA 5L7OC 1PVC3 4UBHA 4BWOA 4XOGA 1KD7A 3AM2A 4Z8BA 2I74A 3M3CA 1QQP2 4QQHA 3USSA 3GNEA 4YM2A 4PIZA 3WW2A 1AXYA 1UZYA 5DUUA 1C8NA 2QDNA 3DL3A 3AMQA 3IDEA 4RHV1 1JN2P 2UY9A 3I8TA 4H7MA 1J59A 4XJWA 2WFPA 4E4DX 3U4XA 3RI8A 3OD4A 3OYWA 3MW2A 2WA4A 1FYUA 2MHFA 3ZYJB 5JSRA 5EZWA 2FZ2A 4RS5C 1AYM3 1AL22 3M3OA 4IETA 3THPA 4Y20B 1S2KA 1DIWA 3W58A 1QY4A 4XFIA 2PHUA 3L9JT 5JIAA 4GA9A 4MGYE 1U5IA 3CNAA 3ROUA 1WA4A 1WBFA 2D5FA 2GC0A 2WWSA 2QDRA 2XGXA 2VMGA 2BNMA 1FOD2 4CP0A 5FQ0A 1MS8A 1W6NA 1S0BA 2WNVB 2VNRA 4I30A 3USUB 2ZHMA 4AI2A 2HWC3 1PM7A 1C5HA 4EJRA 4I0AA 4Z07A 3ECQA 3JD71 1QNWA 4FVVA 5CFDB 3H50A 1W6PB 1PK6A 3MPPG 2VVFA 1JHNA 1EV13 2DFBA 1JOJA 1SLTA 1KS4A 1ZRFA 5E88A 4PLMA 1BEV2 4W6WA 4QQPA 2RR13 1CIWA 1BBT1 2VGDA 1CESA 1ND2B 3BTAA 1RUI1 2CV6A 1SFYA 1URXA 1WCKA 1RUF1 3PHMA 4WM8B 5A3LA 2P3KA 5C8WA 1WLCA 3KT4A 2R062 4QU2A 2ZMLA 5T5LA 2D40A 4RA0A 3SH4A 3SITA 1R093 3E6DA 4WVWA 3RYKA 1NQJA 2GN3A 3E97A 4QT6A 1RUC3 3CLPA 3D82A 5L19A 3PVEA 3WDXA 4KWKA 3QACA 1CJPA 1DZRA 1QJY3 4XF0A 4COUA 1VBD1 3LCPA 1H9PA 1GV9A 3QBQA 1UF2C 1V9U1 2PAKA 4I09A 5BPXA 2XJUA 1CJDA 4PDWC 3OY8A 4R9AA 2HWE3 1GICA 1RUH1 2H0VA 3MFCA 1RVF1 4ISQA 3AK0A 2VNOA 3LOIA 4M00A 3UL2A 2RS13 3V0AB 2BVVA 3E6BA 1C57A 4N43B 4CDUC 2XKOA 4RQPC 2B8MA 4AHWA 4QQLA 3GBFA 3SISA 2AUYA 4HSJA 3R05A 4I0BA 1AYN2 2ARXA 2ZGMA 1C8M3 1HIXA 2JG9C 4RHV2 3ZFFB 1U12A 1YYNA 3R4SA 2ZTNA 1R083 5EFUA 2WLQA 4YRDA 4LUMA 5L73A 2Z5WA 1X50A 1QH7A 3ZFGC 4LBJA 4CEYC 2YGMA 2RS33 1RUOA 3ILFA 2HWB1 3VBSB 3O7OA 2A6XA 1KS5A 5CNAA 5ABJB 3VLBB 3VN4A 1NCRA 1C5IA 3UK9A 2IXKA 3RWNA 2YZ4A 2B39A 1CQ9A 1OOPC 2ZGRA 1PVC1 2GNTA 2O0OA 1WLTA 1RL3A 4Q4X1 4E4ZA 2BVBA 5FMOS 1G9FA 2LUWA 2OA2A 4CDXA 1LCLA 4Z1VA 3VHNA 4IQPA 1OFSA 1ENSA 2DF7A 4OZXA 4P9GA 1OQDA 3V65A 1WCDJ 4LHLA 3VDDC 4BIFA 1MACA 5J7MA 4CDWB 1BYHA 5C8CB 2Y38A 2ZJCA 2Q0AA 2NP0A 4Q1RA 3AP9A 1GANA 3S6PA 4PJYA 1AYM1 2B46X 1RUI2 4A7ZA 4ISRA 2D6LX 2UWAA 2GN7A 3WOGA 4PBPA 3UJQA 5DUXA 1VBB3 3LA3A 1PMIA 2KA3A 2ZX0A 3VBHC 4MXVA 2JG8A 1AR93 3B01A 4XQWA 4C0HA 4ZKTB 1JUIA 1LU2A 1LULA 4QM8A 2HWC1 5CA6A 1FX5A 2GAUA 1RUNA 4Y22A 4XBNA 2IXLA 3VBSA 3WP3A 2X53S 5JDBA 1V9U2 1YO8A 1EV11 1I1EA 1AF9A 4RR3A 1MS9A 3C3VA 4HANA 4P9WA 4N53A 2D6PA 1RMU3 3WLUA 4PIXA 4DB5A 1MQTC 4AGGA 1PO12 1RVF2 1UIJA 2RR11 1IS6A 1OQ1A 4AHZA 3RG0A 1SBFA 4UW6A 1ULGA 1S55A 3FUQA 4LLOA 4YW2A 2GNMA 4Z2WA 1A6CA 1Y43B 4ASLA 2UWCA 1R091 4WM7C 3VBRC 1RUC1 4XFHA 2PHXA 2SLIA 2VQAA 4HK9A 5FCCA 5C8CA 1NA1C 2AH2A 1CAXA 5DDJ2 4EN6B 1KXGA 5JWPA 3KMHA 5IK5A 3RJRA 3HQXA 5FO7B 5JZGA 3S7IA 3PVBB 1QJY1 2EAAA 5IK7A 4Q2FA 5L7OA 5JLVA 3H3ZA 2Y26A 3SH5A 3LKJA 1XE8A 5DG1A 2HWE1 1UL9A 1LOBA 2Q8OA 4AGRA 2NZ9A 1CAUB 2BGCA 4CEWB 4HT1T 2RS11 4RGGA 1OSGA 4QQOA 1MEC2 2VUAA 3SCHA 1ZZ8A 3B7MA 5EXOA 1VRH2 4CYDA 4RS5A 3FBMA 5I91A 1F9KA 4KWJA 3ZIWA 2R043 1C8M1 2XJPA 4EN0A 4AVCA 4BPZA 1IHMA 3ZYRA 4H7LA 1R081 3S7EA 3GHMA 2OW4A 4PDWB 1WMDA 1ENXA 1JXNA 4P9JA 4QPGA 4AEMA 5C33A 1LENA 4QGMA 1OLRA 2HYKA 2RS31 1PGW2 1X33A 1DZQA 2OIIA 3MFAA 3KZ4C 3B02A 2WC2A 3KM5A 4CDUB 3NL1A 3RYPA 2ZX1A 3HT1A 1RHI2 1E57A 3WCRA 2VECA 5IUQA 4Y26A 3OD0A 2RMU3 4ASMB 2DCTA 2ZGSA 2QZ2A 4Q4W2 2HWC2 1OA2A 1QJX3 3AJYA 1Q8SA 2D3PA 2ZZQA 1H1AA 4K6BA 4M0HA 1ZA4A 4LBQB 4XHXA 2XLGA 4FOWA 1N3PA 4B4RA 1ZBE3 1O4YA 4CEYB 3SCGA 5K0UC 3B9IA 3MIHA 4Q8LA 2W0XA 4K3UA 4JV4A 1EV12 4Q4V2 3WG4A 3KD4A 2ZA9A 4Q0QA 2DV9A 5A32B 1QJU3 1SDWA 1R1A3 2XVKA 2P34A 4Q26A 4XJ9A 2LM3A 1B09A 2DCZA 5KBFA 4XFBA 2F6BA 4M01A 4DY3A 1CAVA 3GZUC 2HWF3 3IDCB 4COYA 1VBB1 3SLIA 3JB4C 1WMEA 2VG9A 5JSPA 1AR91 1RUC2 1VP6A 4X6RB 4XJZA 1WD4A 3VDDB 2ARBA 4BIOA 1Y3TA 3VGIA 2ZHKA 3LZZA 1COV2 2GH2A 1GR3A 5AC93 4AI8A 5JAXA 1XNBA 2R072 3FX3A 3VKLA 4AQTA 3B9CA 2A7AA 2HEVF 3JQXA 3WG2A 1F8VA 1BVP1 4RQPA 3ASIA 3GYDA 3BIWE 1RMU1 3FLTA 1OHFA 2NYYA 3ZN6B 1ULCA 4S2DA 1UU4A 2JG9A 3SXWA 5FLIA 3V0BB 1NCQC 3QH6A 4FSJA 2JICA 1YIPA 2RS12 3MLKA 4HN0A 5T50A 4OUMA 3KT7A 3CO2A 1DF0A 5GALA 4ZU7A 3OTFA 2KXLA 3ZFGA 4CEYA 3HWJA 2XJTA 4B4QA 2DVBA 1YCIA 4A2UA 5KC5A 2A6VA 4GULA 1IS3A 1Q8OA 4LNVA 2PHRA 3MZHA 3NV3A 1LGBA 1AR72 3LGRA 4GIQA 5A32A 2RM23 3H7JA 2WLPA 4LULA 1M06G 2HWD2 2WSVA 3PMSA 2VVEA 4AHYA 2VQ0A 5C4WB 1MQTB 2EAKA 1FMD3 2Z2SB 1PZ8A 3PLQA 1OOPA 2JE7A 3J26N 3O14A 1M4WA 3RZZA 4NOTA 2YMZA 1EP0A 4QGNA 5FLJA 2CGPA 1W6OB 1HKDA 2WNVC 2YY1A 5BNOB 4O9EA 4F7ZA 2CWSA 4TYSA 1YFUA 5CFDC 5GZFA 2TBVA 1BCXA 4IV1B 3VDDA 2R1BA 4MZUA 4WM7B 4H55A 1DGRN 3I59B 3AYDA 5I93A 1D4M3 3FE5A 2BWCA 1W0OA 1ND2C 3P3NA 3TN93 2R041 1AR63 3MLJA 4I3PA 4WM8C 4R9DA 2K0GA 4OHYA 1PVXA 3JQWA 3V56A 4E27A 4ZXKA 3VBHA 4XJUA 2XJSA 4DXZA 3BOPA 4GMP1 4XE9A 3MF9A 2A5ZA 2D3SA 2VULA 1DGWA 3WQ7A 2X8KA 4KGGA 1DQ4A 4OHVA 4D94A 5LRRA 4S2FA 1HX6A 4TSVA 5J3UA 3ZFEC 2GZWA 4QM9A 4FQZA 1VJ2A 4YG6A 2BFUL 4XFGA 5JI7A 1HXS3 3FZ3A 3R4DB 3VL9A 2YUEA 3H7YA 3ACLA 3DPRC 1AL0G 1EPZA 1RUF3 2RMU1 3CF6E 4JCKA 2AREA 1LOFC 3KQRA 5IK4A 4JDNA 5I0SA 5L36A 1QJX1 4FTEA 5H9RA 4RD7A 3LSEA 4XJ8A 4K1YA 3VBUB 1ZBE1 5BYNA 4MSVA 2MPFA 1AJKA 2OZ6A 1KJLA 4YYOA 5CFCB 1OFNA 4YW4A 4N43C 1ND3B 2A6WA 1QJU1 2DURA 2YYOA 1MVEA 4WM7A 1R1A1 3VBRA 1IPJA 1DQ6A 1NA1A 1DHKB 1W39A 3ZFFC 4Q1PA 2XVGA 3VZKA 2HWF1 3VL8A 4LA3A 1RB8G 4B7EA 2VXRA 3TB0A 3CEWA 1QDOA 1GBGA 1HRI3 4AEDC 4AFCA 1QHDA 3MDPA 4HFSA 5K0UB 2XL7A 3FFZA 3NV4A 5ABJC 1HW5A 3TNQA 1GNZA 2ENRA 2E6VA 2OZJA 4FPLA 5AC91 2YV8A 1D2SA 5FOBB 5LEKA 1VAKA 2VOXA 4OI0A 3E5QA 1BZWA 3DV8A 2ZMNA 1IS5A 3T2TA 4YZ4A 1NXD1 1O5LA 3NAPB 4C90A 4XTMA 2WNUC 4DOUA 2IC1A 3VHOA 3NWKA 4G4FA 2ZX2A 4HMZA 2E51A 5HBAA 2V5YA 1TE1B 4XILA 4GB31 1J3RA 3MICA 4CDWC 4BYYA 3AXEA 3O0XA 5JIUA 2WQ4A 1W6QA 4Q8KA 1EYBA 1PIV3 5EWSA 1XE7A 1IS4A 2EIGA 3FUOA 5CADA 1TMF3 3MYXA 1K5MC 2VUJA 4AGVA 3B3QE 5JOZA 1LRHA 1WUVA 4JQRA 4LR4A 4Q4X3 2RM21 2R1DA 1SACA 4YVSB 4I02A 1CONA 1LOAA 2ZPXA 3KLSA 1FMD1 2VH9A 5KXCA 4PCRA 4J1XA 5J98B 3ZXKA 1F2NA 4YARA 1NCQB 2VMIA 2E53A 2VOWA 2DVFA 3NKTA 1PHMA 3QD6A 4V1PA 1H8TB 2Q30A 4Q4Y3 3J8F2 4WZCA 1QOSA 1GZWA 4OHXA 3LB9A 5T55A 1AX2A 4Y24A 2RMU2 1V6LA 1D4M1 2JEMA 2XB6C 1REEA 1G9AA 4GKXA 1ZRCA 5AFBA 4BHPA 3EQEA 2JECA 5FPXA 3E5XA 2QZ3A 4DPNA 3TN91 4EWAA 1QNYA 1AR61 2CAUA 3GZAA 4WVZA 4FTSA 4XBLA 1MZ6A 5SV8A 5I0TA 4YGEA 3U10A 4EN9B 1ZVFA 2IFWA 5EV7A 1TME2 1RJ8A 3AXDA 4XMIA 2OYZA 4K1ZA 1MZEA 5CIRA 4YZ5A 1Q5OA 2WFF2 1W6MA 4BLIA 2HWF2 4NVPA 3RYRA 1D2QA 3WUDA 2HEYF 2IWGB 3N7LA 1D0HA 2A3XA 2LALA 5KHIA 1HXS1 1H2KA 1ZREA 1DLLA 2UU8A 1Y7BA 2XWBB 4IEXA 2WS93 1YHFA 3J9SA 5I8SA 2QUOA 4XF1A 3PVNA 4LHNA <