3OHWA

X-ray structure of phycobilisome lcm core-membrane linker polypeptide (fragment 721-860) from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr209e
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
127
Chain Sequence
DKVAVKNAIRAAYRQVFERDLEPYIINSEFTALESKLSNNEINVKEFIEGLGTSELYMKEFYAPYPNTKVIEMGTKHFLGRAPLNQKEIQQYNQILASQGLKAFIGAMVNGMEYLQTFGEDTVPYRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phycobilisome LCM core-membrane linker polypeptide
publication title Northeast Structural Genomics Consortium Target SgR209E
rcsb
source organism Synechocystis sp.
molecule tags Protein binding
total genus 36
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00427 PBS_linker_poly Phycobilisome Linker polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3130.20 Mainly Alpha Orthogonal Bundle serine acetyltransferase, domain 1 serine acetyltransferase, domain 1 3ohwA00
2L8VA 3OHWA 2L3WA 2KY4A 2L06A 3OSJA 3NPHB 3PRUA
chains in the Genus database with same CATH superfamily
1S80A 4HZCA 4N6BA 4N6AA 2L06A 3P47A 1SSTA 3Q1XA 3NPHB 4H7OA 3F1XA 2L3WA 3GVDA 3OSJA 3P1BA 1SSQA 3MC4A 3PRUA 3OHWA 2KY4A 4HZDA 2L8VA 1T3DA 1SSMA 4N69A
chains in the Genus database with same CATH topology
1S80A 4HZCA 4N6BA 4N6AA 2L06A 3P47A 1SSTA 3Q1XA 3NPHB 4H7OA 3F1XA 2L3WA 3GVDA 3OSJA 3P1BA 1SSQA 3MC4A 3PRUA 3OHWA 2KY4A 4HZDA 2L8VA 1T3DA 1SSMA 4N69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L8V A;  3OHW A;  2L3W A;  2KY4 A;  2L06 A;  3OSJ A;  3NPH B;  3PRU A; 
#chains in the Genus database with same CATH topology
 1S80 A;  4HZC A;  4N6B A;  4N6A A;  2L06 A;  3P47 A;  1SST A;  3Q1X A;  3NPH B;  4H7O A;  3F1X A;  2L3W A;  3GVD A;  3OSJ A;  3P1B A;  1SSQ A;  3MC4 A;  3PRU A;  3OHW A;  2KY4 A;  4HZD A;  2L8V A;  1T3D A;  1SSM A;  4N69 A; 
#chains in the Genus database with same CATH homology
 1S80 A;  4HZC A;  4N6B A;  4N6A A;  2L06 A;  3P47 A;  1SST A;  3Q1X A;  3NPH B;  4H7O A;  3F1X A;  2L3W A;  3GVD A;  3OSJ A;  3P1B A;  1SSQ A;  3MC4 A;  3PRU A;  3OHW A;  2KY4 A;  4HZD A;  2L8V A;  1T3D A;  1SSM A;  4N69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...