3OHXM

Molecular basis for complement recognition and inhibition determined by crystallographic studies of the staphylococcal complement inhibitor (scin) bound to c3c and c3b
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
84
structure length
84
Chain Sequence
TSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGQKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3
publication title Molecular Basis for Complement Recognition and Inhibition Determined by Crystallographic Studies of the Staphylococcal Complement Inhibitor (SCIN) Bound to C3c and C3b.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 35
structure length 84
sequence length 84
chains with identical sequence P
ec nomenclature
pdb deposition date 2010-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3ohxM00
4JWIA 5E84A 4EZQA 4JWDA 2QFFA 4JNFA 4R5KA 4EZSA 1DKZA 4JN4A 3OHXM 4EZZA 4H6IA 4F01A 2QXLA 3T48A 3T46A 3L3OM 4R5LA 4EZVA 4B9QA 4F00A 4EZRA 4EZTA 1U00A 4H6HA 4E81A 4EZWA 3C7NA 3DPPA 3DPQA 4HY9A 3QNJA 3T4AG 4R5GA 1DKXA 3T47A 4JNEA 3T49A 2WINM 2KHOA 4JWCA 4EZPA 4JWEA 4EZOA 1DKYA 3D2EA 4PO2A 3D2FA 4EZNA 4EZUA 4HYBA 4R5IA 3DPOA 5TKYA 4R5JA 4EZXA 4EZYA
chains in the Genus database with same CATH superfamily
1OAOA 4AVMA 3ER9B 3I2WA 2F18A 2X3WA 1I4LA 3BUBA 3BVTA 4B9QA 2YIAA 4EZRA 3CZNA 3HAHA 4IWOA 4AKVA 3UITA 2EWFA 1WDZA 1TQWA 1DKYA 2JNKA 3DPOA 4WPCA 4EZQA 1DKZA 4JN4A 2Z0VA 2C08A 3D4ZA 2ND1A 3BVVA 3DPQA 1OA0A 1JQKA 3ERCC 1SU7A 2RAIA 2FICA 3CZSA 3EJRA 5FLEX 3QNIA 5C5BB 3A98A 2RAKA 1O7DB 2PY6A 4NPHA 3T49A 1OA1A 3CAZA 3VKHA 2QKWA 5E84A 1ZYLA 3KAVA 4BNEA 2YLLA 4EZVA 2LXYA 1E9VA 1R33A 3SYVA 4IM3A 4HY9A 3ACOA 3QNJA 3I01A 4I1QA 1X04A 1URUA 2Z0NA 4EZOA 3BUDA 2X3VA 3LMFA 4JWIA 3ZEDA 4EZSA 1GN9A 3T46A 4KIKA 3BUIA 1U00A 4H6HA 4E81A 3QWEA 4EZWA 3T4AG 3BVWA 4R5GA 4D8JA 2RT6A 4EZPA 4JWEA 2EX3B 5TKYA 2YL6A 3ER8C 2N3KA 3EJQA 2YLAA 4HR1B 3SOGA 5KBPA 1YWMA 3PLTA 2OW6A 2F7RA 3T47A 2GF4A 3F7WA 3B51X 3O3NB 1MJGA 2F7PA 2X5CA 4AZ7A 4IM0A 4EZUA 4WPEA 3ABHA 2F7OA 1SUFA 3M3WA 3OHXM 4FZOA 1TQUA 2OW7A 4NSWA 1TQTA 3VEBA 2OBLA 5FIGA 1E2UA 4AZHA 4E3CA 3EJPA 4AZCA 4FZPA 4F00A 4EZTA 4IWPA 4AZBA 4UDYX 2F1AA 4JLCA 3KDRA 2YL8A 3VEAA 2Z8YA 1LQ7A 2GA9D 4EZYA 1E1DA 3RPMA 3HAJA 4AZ5A 3OWGA 4F01A 3B52X 2O0I1 3D52A 4FM3A 2ZXQA 1PS3A 4DYLA 4FZSA 2ND0A 2EFKA 4JWDA 3I04A 3KAWA 3O3MB 3L3OM 3D50A 1ZWWA 3Q0KA 2WYHA 2YL9A 1R5EA 4JWCA 3CVRA 4G6QA 3BUPA 2Z0OA 4R5KA 3DX4A 4EZZA 1SU8A 2RAJA 2YI9A 3RV1A 3LVTA 1I4TA 2F1BA 2F7QA 4JNEA 2Q13A 4JL9A 3DYTA 1TQSA 3D4YA 4PO2A 4HYBA 2YIVX 2OZNB 4EZXA 2QFFA 4AZCB 1GNTA 3T48A 4M0MA 1QWNA 4R5IA 2GAFD 1I49A 1QWUA 3L3PA 3G9GA 4UDXX 4H6IA 2QXLA 3QE6A 4HR1A 1HTYA 2YL5A 2ELBA 4ATMA 3DPPA 1DKXA 1I4DA 1HXKA 3BLBA 3I39X 2EFLA 4AZGA 3BVXA 3DX1A 3D2FA 4EZNA 4IW0A 1O7DC 2OO2A 1QX1A 4JNFA 4NQIA 3RV0A 3CKDA 4H8SA 1HWWA 2X3XA 3LLLA 4KIKB 3D51A 3CV5A 3BUQA 3DDFA 4AZIA 3EJTA 3EJSA 3DX3A 1Y2OA 2MI7A 2D1LA 1X03A 4AZ6A 4R5JA 2WYIA 3DDGA 3DX0A 4DCNC 2LM0A 3B53X 1SU6A 3Q84A 2FYVA 5C5BA 3C7NA 2YI8A 2D4CA 1R34A 2WINM 2KHOA 3HAIA 3EJUA 3D2EA 1GNLA 2JNSA 2YIBA 2V0OA 2PMRA 1TQVA 3BVUA 3FD9A 3DX2A 4R5LA 4IWQA 2YKTA 4IM2A 3QA8A 2OBMA 1UPXA 3GI7A 2NCZA 2Q12A 3O3OB 3OK8A 2ALWA 1W9MA
chains in the Genus database with same CATH topology
4JWIA 1E1DA 3ZEDA 1OAOA 4EZSA 3ER9B 3OWGA 4UDXX 4F01A 4H6IA 2QXLA 1GN9A 3T46A 4HR1A 4KIKA 4B9QA 2YIAA 4EZRA 4IWOA 1U00A 3B52X 4H6HA 4E81A 4EZWA 3DPPA 3T4AG 4R5GA 1DKXA 3I39X 3UITA 2RT6A 4D8JA 2EWFA 4EZPA 4JWEA 4FM3A 1DKYA 3D2FA 2ND0A 2EX3B 4EZNA 4IW0A 5TKYA 3DPOA 4EZQA 4JWDA 4JNFA 3I04A 3ER8C 1DKZA 3KAWA 3RV0A 2N3KA 4JN4A 3O3MB 4HR1B 3L3OM 4KIKB 2ND1A 3DPQA 1OA0A 1JQKA 3T47A 3ERCC 1SU7A 4JWCA 3F7WA 3B51X 3O3NB 1MJGA 2X5CA 4IM0A 4EZUA 4G6QA 4R5JA 5FLEX 1SUFA 4R5KA 2LM0A 3B53X 3OHXM 4EZZA 1SU8A 1SU6A 2YI9A 3RV1A 3A98A 2PY6A 3VEBA 3C7NA 2YI8A 4NPHA 1OA1A 4JNEA 2WINM 3T49A 2KHOA 4JL9A 2OBLA 3D2EA 1GNLA 4PO2A 2JNSA 5FIGA 4HYBA 1E2UA 2YIBA 2YIVX 3VKHA 4EZXA 4E3CA 5E84A 1ZYLA 2QFFA 1GNTA 3FD9A 3KAVA 3T48A 4R5LA 4M0MA 4EZVA 1E9VA 4F00A 4EZTA 4IWPA 4IWQA 4UDYX 4IM3A 4HY9A 3QNJA 4JLCA 3I01A 4IM2A 3KDRA 3QA8A 2OBMA 4EZOA 3VEAA 1UPXA 3GI7A 2Z8YA 2NCZA 3LMFA 3O3OB 4R5IA 2GA9D 2GAFD 1W9MA 4EZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWI A;  5E84 A;  4EZQ A;  4JWD A;  2QFF A;  4JNF A;  4R5K A;  4EZS A;  1DKZ A;  4JN4 A;  3OHX M;  4EZZ A;  4H6I A;  4F01 A;  2QXL A;  3T48 A;  3T46 A;  3L3O M;  4R5L A;  4EZV A;  4B9Q A;  4F00 A;  4EZR A;  4EZT A;  1U00 A;  4H6H A;  4E81 A;  4EZW A;  3C7N A;  3DPP A;  3DPQ A;  4HY9 A;  3QNJ A;  3T4A G;  4R5G A;  1DKX A;  3T47 A;  4JNE A;  3T49 A;  2WIN M;  2KHO A;  4JWC A;  4EZP A;  4JWE A;  4EZO A;  1DKY A;  3D2E A;  4PO2 A;  3D2F A;  4EZN A;  4EZU A;  4HYB A;  4R5I A;  3DPO A;  5TKY A;  4R5J A;  4EZX A;  4EZY A; 
#chains in the Genus database with same CATH topology
 1OAO A;  4AVM A;  3ER9 B;  3I2W A;  2F18 A;  2X3W A;  1I4L A;  3BUB A;  3BVT A;  4B9Q A;  2YIA A;  4EZR A;  3CZN A;  3HAH A;  4IWO A;  4AKV A;  3UIT A;  2EWF A;  1WDZ A;  1TQW A;  1DKY A;  2JNK A;  3DPO A;  4WPC A;  4EZQ A;  1DKZ A;  4JN4 A;  2Z0V A;  2C08 A;  3D4Z A;  2ND1 A;  3BVV A;  3DPQ A;  1OA0 A;  1JQK A;  3ERC C;  1SU7 A;  2RAI A;  2FIC A;  3CZS A;  3EJR A;  5FLE X;  3QNI A;  5C5B B;  3A98 A;  2RAK A;  1O7D B;  2PY6 A;  4NPH A;  3T49 A;  1OA1 A;  3CAZ A;  3VKH A;  2QKW A;  5E84 A;  1ZYL A;  3KAV A;  4BNE A;  2YLL A;  4EZV A;  2LXY A;  1E9V A;  1R33 A;  3SYV A;  4IM3 A;  4HY9 A;  3ACO A;  3QNJ A;  3I01 A;  4I1Q A;  1X04 A;  1URU A;  2Z0N A;  4EZO A;  3BUD A;  2X3V A;  3LMF A;  4JWI A;  3ZED A;  4EZS A;  1GN9 A;  3T46 A;  4KIK A;  3BUI A;  1U00 A;  4H6H A;  4E81 A;  3QWE A;  4EZW A;  3T4A G;  3BVW A;  4R5G A;  4D8J A;  2RT6 A;  4EZP A;  4JWE A;  2EX3 B;  5TKY A;  2YL6 A;  3ER8 C;  2N3K A;  3EJQ A;  2YLA A;  4HR1 B;  3SOG A;  5KBP A;  1YWM A;  3PLT A;  2OW6 A;  2F7R A;  3T47 A;  2GF4 A;  3F7W A;  3B51 X;  3O3N B;  1MJG A;  2F7P A;  2X5C A;  4AZ7 A;  4IM0 A;  4EZU A;  4WPE A;  3ABH A;  2F7O A;  1SUF A;  3M3W A;  3OHX M;  4FZO A;  1TQU A;  2OW7 A;  4NSW A;  1TQT A;  3VEB A;  2OBL A;  5FIG A;  1E2U A;  4AZH A;  4E3C A;  3EJP A;  4AZC A;  4FZP A;  4F00 A;  4EZT A;  4IWP A;  4AZB A;  4UDY X;  2F1A A;  4JLC A;  3KDR A;  2YL8 A;  3VEA A;  2Z8Y A;  1LQ7 A;  2GA9 D;  4EZY A;  1E1D A;  3RPM A;  3HAJ A;  4AZ5 A;  3OWG A;  4F01 A;  3B52 X;  2O0I 1;  3D52 A;  4FM3 A;  2ZXQ A;  1PS3 A;  4DYL A;  4FZS A;  2ND0 A;  2EFK A;  4JWD A;  3I04 A;  3KAW A;  3O3M B;  3L3O M;  3D50 A;  1ZWW A;  3Q0K A;  2WYH A;  2YL9 A;  1R5E A;  4JWC A;  3CVR A;  4G6Q A;  3BUP A;  2Z0O A;  4R5K A;  3DX4 A;  4EZZ A;  1SU8 A;  2RAJ A;  2YI9 A;  3RV1 A;  3LVT A;  1I4T A;  2F1B A;  2F7Q A;  4JNE A;  2Q13 A;  4JL9 A;  3DYT A;  1TQS A;  3D4Y A;  4PO2 A;  4HYB A;  2YIV X;  2OZN B;  4EZX A;  2QFF A;  4AZC B;  1GNT A;  3T48 A;  4M0M A;  1QWN A;  4R5I A;  2GAF D;  1I49 A;  1QWU A;  3L3P A;  3G9G A;  4UDX X;  4H6I A;  2QXL A;  3QE6 A;  4HR1 A;  1HTY A;  2YL5 A;  2ELB A;  4ATM A;  3DPP A;  1DKX A;  1I4D A;  1HXK A;  3BLB A;  3I39 X;  2EFL A;  4AZG A;  3BVX A;  3DX1 A;  3D2F A;  4EZN A;  4IW0 A;  1O7D C;  2OO2 A;  1QX1 A;  4JNF A;  4NQI A;  3RV0 A;  3CKD A;  4H8S A;  1HWW A;  2X3X A;  3LLL A;  4KIK B;  3D51 A;  3CV5 A;  3BUQ A;  3DDF A;  4AZI A;  3EJT A;  3EJS A;  3DX3 A;  1Y2O A;  2MI7 A;  2D1L A;  1X03 A;  4AZ6 A;  4R5J A;  2WYI A;  3DDG A;  3DX0 A;  4DCN C;  2LM0 A;  3B53 X;  1SU6 A;  3Q84 A;  2FYV A;  5C5B A;  3C7N A;  2YI8 A;  2D4C A;  1R34 A;  2WIN M;  2KHO A;  3HAI A;  3EJU A;  3D2E A;  1GNL A;  2JNS A;  2YIB A;  2V0O A;  2PMR A;  1TQV A;  3BVU A;  3FD9 A;  3DX2 A;  4R5L A;  4IWQ A;  2YKT A;  4IM2 A;  3QA8 A;  2OBM A;  1UPX A;  3GI7 A;  2NCZ A;  2Q12 A;  3O3O B;  3OK8 A;  2ALW A;  1W9M A; 
#chains in the Genus database with same CATH homology
 4JWI A;  1E1D A;  3ZED A;  1OAO A;  4EZS A;  3ER9 B;  3OWG A;  4UDX X;  4F01 A;  4H6I A;  2QXL A;  1GN9 A;  3T46 A;  4HR1 A;  4KIK A;  4B9Q A;  2YIA A;  4EZR A;  4IWO A;  1U00 A;  3B52 X;  4H6H A;  4E81 A;  4EZW A;  3DPP A;  3T4A G;  4R5G A;  1DKX A;  3I39 X;  3UIT A;  2RT6 A;  4D8J A;  2EWF A;  4EZP A;  4JWE A;  4FM3 A;  1DKY A;  3D2F A;  2ND0 A;  2EX3 B;  4EZN A;  4IW0 A;  5TKY A;  3DPO A;  4EZQ A;  4JWD A;  4JNF A;  3I04 A;  3ER8 C;  1DKZ A;  3KAW A;  3RV0 A;  2N3K A;  4JN4 A;  3O3M B;  4HR1 B;  3L3O M;  4KIK B;  2ND1 A;  3DPQ A;  1OA0 A;  1JQK A;  3T47 A;  3ERC C;  1SU7 A;  4JWC A;  3F7W A;  3B51 X;  3O3N B;  1MJG A;  2X5C A;  4IM0 A;  4EZU A;  4G6Q A;  4R5J A;  5FLE X;  1SUF A;  4R5K A;  2LM0 A;  3B53 X;  3OHX M;  4EZZ A;  1SU8 A;  1SU6 A;  2YI9 A;  3RV1 A;  3A98 A;  2PY6 A;  3VEB A;  3C7N A;  2YI8 A;  4NPH A;  1OA1 A;  4JNE A;  2WIN M;  3T49 A;  2KHO A;  4JL9 A;  2OBL A;  3D2E A;  1GNL A;  4PO2 A;  2JNS A;  5FIG A;  4HYB A;  1E2U A;  2YIB A;  2YIV X;  3VKH A;  4EZX A;  4E3C A;  5E84 A;  1ZYL A;  2QFF A;  1GNT A;  3FD9 A;  3KAV A;  3T48 A;  4R5L A;  4M0M A;  4EZV A;  1E9V A;  4F00 A;  4EZT A;  4IWP A;  4IWQ A;  4UDY X;  4IM3 A;  4HY9 A;  3QNJ A;  4JLC A;  3I01 A;  4IM2 A;  3KDR A;  3QA8 A;  2OBM A;  4EZO A;  3VEA A;  1UPX A;  3GI7 A;  2Z8Y A;  2NCZ A;  3LMF A;  3O3O B;  4R5I A;  2GA9 D;  2GAF D;  1W9M A;  4EZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...