3OI7A

Structure of the structure of the h13a mutant of ykr043c in complex with sedoheptulose-1,7-bisphosphate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
260
structure length
260
Chain Sequence
LTPRCIIVRAGQTEWSKSGQYTGLTDLPLTPYGEGQMLRTGESVFRNNQFLNPDNITYIFTSPRLRARQTVDLVLKPLSDEQRAKIRVVVDDDLREWEYGDYEGMLTREIIELRKSRGLDKERPWNIWRDGCENGETTQQIGLRLSRAIARIQNLHRKHQSEGRASDIMVFAHGHALRYFAAIWFGLGVQKKCETIEEIQNVKSYDDDTVPYVKLESYRHLVDNPCFLLDAGGIGVLSYAHHNIDEPALELAGPFVSPPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Riboneogenesis in yeast.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Uncharacterized protein YKR043C
total genus 88
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.37: Sedoheptulose-bisphosphatase.
pdb deposition date 2010-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3oi7A01
1SKAA 3EOZA 4ARUA 2I1VB 3FJYA 1FBTA 2P79A 2QNIA 4AROA 2ENWA 2P9FA 3K4PA 4JODA 3E9EA 3MXOA 2H52A 1EBBA 2H4XA 5AJYA 1RPTA 1QWOA 1BQ3A 2IKQA 4ARSA 1DKQA 3DB1A 3QPVA 5PGMA 1CVIA 4QIHA 3PGMA 3FDZA 2OWEA 3DCYA 1TIPA 1C80A 1H2FA 3GP5A 1SKBA 1T8PA 1UJBA 3LG2A 4PZ9A 1RPAA 2P6OA 2P2ZA 1QHFA 3EZNA 4GPZA 1DKOA 3NFYA 4ARVA 3IT0A 2AXNA 4D4KA 2A6PA 2HIAA 3KKKA 3BIFA 1C81A 5AJZA 4D4MA 1FZTA 4EO9A 3E9CA 5CDHA 5CU7A 5AJWA 1DKLA 3MBKA 2P9YA 1H2EA 3LL4A 3QPUA 4EMBA 5AJXA 3GP3A 1SK8A 3QPWA 4JOCA 1K6MA 3D6AA 3OI7A 3IT2A 1NT4A 1YJXA 2HHJA 5HTKA 4IJ6A 1BQ4A 2P77A 2ENUA 2P2YA 3FDZB 3ZHCA 1QFXA 4HBZA 3D8HA 1V7QA 3IT1A 3F3KA 2P75A 5HR5A 4FDTA 2H0QA 2WNHA 1C7ZA 4IJ5A 2HPAA 4PGMA 3IT3A 3GW8A 3C7TA 1V37A 1BIFA 2OWDA 2EOAA 2H4ZA 2DWPA 2PA0A 2YN2A 1E59A 1IHPA 1ND5A 1YFKA 2YN0A 1UJCA 2P30A 2EKBA 4D4JA 2WNIA 3O0TA 4JOBA 1XQ9A 2P6MA 3HJGA 2P9ZA 3E9DA 2EKZA 4PZAA 2A9JA 3F2IA 5CX4A 3R7AA 5AK0A 1ND6A 2BIFA 2RFLA 4D4LA 1DKPA 4E3WA 3K4QA 4MA4A 3LNTA 1E58A 2F90A 3D4IA 2GFIA 1DKMA 1DKNA 4FDUA 4GPIB 2P78A 4ODIA 1SK9A 4TSRA 2DWOA 3NTLA 2WU0A 1RIIA 5AJVB
chains in the Genus database with same CATH superfamily
1C3JA 2JI8A 4QBGB 4UEJA 5CPBA 1P2DA 3FJYA 2W2LD 3Q7PA 4MW5A 4NV1A 3UMCA 3PPWA 3PQ3A 1RYFA 3E2MA 1QHSA 1Q77A 1SXHA 1NYRA 2OO3A 4M1OA 1ISFA 2FZCA 1J1IA 2QRQA 3EGWA 3K0BA 1PF7E 2W00A 4CF4A 4QUJA 1IB6A 1B1AA 1Y3FE 3GEPA 4ZHQF 1G0NA 4GMHA 3MELA 3RYHA 3MILA 3V7WA 3MC1A 4Z9YA 4O3FA 2ZJ8A 3WIUA 3REFA 4KQIA 4EM6A 3Q1LA 2C04A 2R11A 3C3AA 3QF4A 3AUAA 1TGYA 5T41A 4EJSA 4PZ9A 3SX4A 4R2LA 4U0JA 3Q3HA 1YJ8A 1SVMA 3I0ZA 1IG0A 2OBYA 2YIJA 3EA4A 1E9VA 1QAQA 1GIAA 1YL7A 2QM0A 1OXTA 2D0DA 3PGVA 1X9HA 4X9XA 2PT7A 3LY7A 1WCIB 3SGLA 2PKQO 4UHKA 2OAQ1 1FMCA 1MR3F 2JB9A 3HB0A 1Y3DE 1Z74A 5ITSA 3AHDA 3LOQA 2BBWA 1T2AA 3TZKA 3AKZA 5CVCA 2EC5A 1GCOA 1K8YB 1WZCA 4REQA 1E0AA 1NUHA 2ORYA 3I5YA 4F56A 1RJDA 4LF9B 1T6NA 2D7CA 3HCOA 5LQSA 2DPXA 2I2DA 4II2A 3VU3A 5CFOA 2GCEA 4RHEA 4CDRA 1QIGA 4MQ5A 2RHDA 1KY3A 1MH9A 1PYOA 4R1SA 1E4EB 1XEAA 2AUTA 3R5JA 2RHOA 1YJBA 3QU4A 4OFZA 5HIMA 4L72A 4BPRA 4X95A 2TECE 1LWNA 4RKQA 2XTMA 3T7IA 2WVJA 3LXRA 2W2PA 4MTLA 3TQIA 2A35A 2GETA 1DL5A 2FUEA 1SEPA 2QAGB 4LXUA 1J7JA 1Q6ZA 2JKYA 3K1YA 3LAWA 2LVBA 2YX1A 1EM8A 3ASVA 4WZ6A 4CQMB 1JJBA 4B6OA 4E5YA 4ER5A 2ZBRA 5TQ0A 2FQQA 3MD0A 4FWIB 2X22A 1ECJA 2PNJA 3U48A 4E33A 1NXVA 1IXRC 1L7MA 3AT1A 3C7TA 3OLZA 4Y9TA 3I73A 1EVZA 4MCHA 3U4CA 3V1TC 3C0KA 4AZ3A 5C1DA 3RTDA 1LFAA 4CEIA 1LDGA 1NP7A 1GFZA 2R79A 2CXHA 2XCSB 3LBYA 1XQXA 2ZVDA 2NPFA 4JQYA 2PGIA 3L18A 3K0SA 1DOAA 4Q24A 1IN4A 1JJVA 4K9NA 3A2LA 2E4YA 4EGCB 4Q7MB 3QBVA 3LWDA 3DTVB 5DP2A 1LJLA 3BK7A 3EQ9A 1VCHA 3OQIB 4R2IA 5BSTA 3VPGA 2I9KA 3PIRA 1RJ9B 3D2AA 1XQ9A 3AUFA 3RAGA 2FFJA 2J9YB 4KUEA 1WZIA 2GRAA 3OHSX 4QGAA 4ESHA 3U7QA 4FLMA 4RJKA 5EWLA 2YVUA 2GJKA 9ABPA 2XMZA 2CLCX 4R8VA 2DZDA 4QX6A 4AZ0B 1ZSYA 3QXJA 5HZKA 4RPGA 3PT5A 2QRNA 3AIKA 3EGEA 1R66A 1TKBA 5L7WA 3RHFA 4E4TA 1NF2A 3LA6A 5KTRA 3DA8A 2VAWA 2UKDA 2X77A 4OHFA 3ZGLA 3B8HA 3NB0A 4EUHA 1RM3A 3LYAA 4ZEVA 3MWFA 3K70B 1E4VA 1YAHA 2YS7A 3LUJA 2HWYA 3W6PA 4CYMA 4UU0A 4JP8A 1EHCA 3G68A 3IV7A 3PNLA 4MHSA 4DLXA 4C0LA 4EO4A 4OJQA 2NV2B 3A9SA 3G5TA 1NX6A 5E7MA 5EJ9A 2GKGA 3KOWA 2QNIA 3AHFA 1NN0A 1O8BA 3VDRA 4YY3B 2QZSA 4MVCA 4UULA 1SCDA 1AQYA 1RHMA 1TKCA 2VJMA 1CJKC 4NENB 2Q6IA 3AY0A 1Q0QA 2VYVA 4FGKA 2ZR0A 3GJZA 3MRVA 4OLJA 3AEXA 2DPHA 4LYGA 2HJGA 5GIOE 1NL3A 4MYTA 3KOZA 4M87A 5T3UA 3RIGA 3TPFA 4IV5A 4EB6A 4AF7A 2Q1YA 3L8ZA 2II6A 1MF7A 4Y2RA 3CNEA 4O2RA 3KJFA 4F0JA 4YR9A 4V1CA 4G0UA 1E3MA 1I32A 1L7DA 5I5EA 4IDGA 4W1SA 4JYZA 2AXPA 1Y34E 4ZQCB 3ZDFA 4HK4A 1FYDA 1CZHA 1F4LA 1VPTA 3O5AA 1PNRA 4NP6A 3ONDA 2F62A 3GGCA 2TMDA 4RLFA 3EWSA 4NECA 5IARA 4L0CA 4XQGA 3TUIC 1QHYA 3WFJA 3K71B 4Y2PA 3V32A 3IS3A 1VZ2A 4BO3A 4E2FA 4A36A 4JXZA 4HLUC 1AUVA 1YJQA 3C8HA 4OHRA 5EJAA 4QGFA 3E9CA 1E89A 3HV0A 3SQNA 5C3MA 1VE7A 4HDMB 3EEQA 4MV7A 1CS0A 2JI4A 3I05A 4EHLA 3T7EA 3OJCA 4B5KA 1RYYA 3D6MA 3OBBA 1YKGA 3OQJA 3URMA 1KA9H 1OAOA 4P0TA 2CDCA 4KWIA 4GC5A 1JDSA 1O6FA 2RDMA 2PH3A 3NJRA 3RGWS 3L7IA 3SJ7A 2J9FA 3TRIA 2VH5R 1H2WA 2IYAA 4IJKA 1WJGA 5G0WA 2YNMA 2J85A 1KL7A 3CG0A 4B2YA 2UVPB 2OAP1 3KD2A 3LS2A 3Q1KA 3SNHA 5KOJB 2IGBA 3AK4A 4V03A 2C5EA 4BBZA 5HR5A 1NWCA 5EE9A 3S2FA 3VHXB 3A4VA 2AL7A 3DWIA 4TXHA 4RHTA 3FYUA 4TPKA 5JAQA 4NAVA 3A1WA 4DCCA 2W2KA 2I78A 1O94C 1WUHS 2IV7A 2QMZA 4O4IB 2APJA 3VGJA 3FE2A 1XJWA 4J94A 2VPYA 2FZKA 4NAUA 2O2HA 1ETUA 3FUTA 1XVTA 3ASUA 4OEHA 4XWGA 4EARA 2OECA 5F33A 5B6PA 2FXVA 2GM5A 3EIOA 1CQPA 2EIHA 3G9XA 4W99A 5EPUA 1G21E 4QPNA 4YRJA 3U26A 3YASA 4B2LA 4EYOA 4UDNA 3VPFA 3ZVLA 1JZQA 2WA2A 1C3VA 2GSDA 1KO7A 3H2GA 3HFSA 4MJLA 2DUNA 3ITNA 4AS3A 5B1YA 2D62A 1DPFA 2BEWB 2ZBPA 1NVVQ 3BL8A 4J76A 3CR8A 4S0ZA 1E8MA 1O95C 1WPQA 1YA6A 4DQUA 3CRZA 4ARCA 4TM7A 2CHUA 1S2IA 2BR4A 4TTAA 4MUXA 1VLZA 3UWSA 3EZLA 4I14A 1TM2A 1P2BA 1VI2A 1ADYA 2DHRA 2F8LA 2J5BA 1NSFA 1H4VB 4IH1A 2PSEA 3UZUA 1V96A 1AKYA 3P5BA 3DMFA 2XCOA 4MLDA 3ZBTA 4L6IA 3R6WA 2B21A 4U8GA 3A1NA 3BGWA 1DAPA 3NTLA 2YMPA 4HH4A 5D51S 3ZK7A 4AN0A 5IXJA 1QP0A 1P2FA 3BTOA 3NHYA 3K9CA 1TLFA 3EXIA 2CJWB 13PKA 2Z8YA 1BYUA 4URHA 5C5EA 4ZANA 2BUAA 1QJ4A 1PJAA 1E1QA 3N87A 4Q1VA 5KTOA 4FJ1A 1TUBA 2NSLA 3F78A 5LA6F 3UT5B 2JCVA 5AW7A 3IKJA 3H87A 3UH0A 1DI0A 4YRKA 3VR3A 1JEQA 2B8NA 4YJ3A 3QUBA 4B7ZA 1OFTA 1DTSA 2VDPB 3R3HA 1M2WA 2COKA 3A26A 4K88A 5JSFA 5HOQA 1KMHB 5F12A 3STXA 4CDNA 1B23P 1QGAA 4IVRA 1C50A 1O97D 3C39A 4ZDWA 2NW6A 3GRCA 3HQ4O 3PS9A 5HP4A 4BKUA 1OKKD 4LZOA 2OMEA 4E3ZA 1KJ9A 3EVNA 3ICCA 3KR9A 3ISVA 4FDAA 4PTYA 1KY5A 4EW1A 2ZTVA 3MT7A 5DRTA 4ZC8A 1N7GA 2Q3FA 2YH2A 3DOEA 2VYCA 1OA0A 3U49A 2IXEA 3AVWA 1JAIA 3A4MA 3KEGA 3AW8A 3RNLA 1CULC 1QLWA 4JP5A 4PX3A 3G02A 1R4ZA 4F2GA 2B8WA 4JLBA 3BIJA 3ET5A 2EP7A 5CB6A 1E7MA 2O59A 1DX6A 1ST3A 1U7OA 1R0WA 2HU5A 2O3SA 2V7TA 3IO5A 1PQYA 4KO3S 4YBRA 5KTPA 3FNRA 1YB7A 5JCJD 1E1LA 3EF0A 2XWPA 3OPQA 4I9HA 1VL5A 1EFPB 2ARKA 2QU7A 221PA 1FFXB 2RG7A 1MIOB 3GVXA 3O8NA 3LQQA 4QYXA 4BO5A 3PEWA 3QSYA 2GN9A 3DQQA 3FH0A 4GRIA 1GXSB 3RBZA 5I9NA 2ZUBA 2XLCA 2NQTA 2P77A 2X6QA 2E7ZA 4PNZA 5BRNA 3IQHX 1DO0A 2G06A 1RTTA 3TD2A 5C8YB 4YRNA 5J2TA 1DJLA 1SD5A 3I4CA 4Q34A 3KUKA 1IRIA 1LPNA 4I1VA 5CG2A 5I8PA 1A1VA 3FYHA 5TEWA 1HY3A 2Q21A 1K3TA 3N2EA 3F3SA 2GNOA 3PGXA 4QUKA 4WA8A 1OAOC 5EZYA 1ZD8A 5FKJA 1S96A 4EY6A 4TWRA 5JVDF 1RAIA 1V71A 3ND5A 3AEQA 1CS4C 2WHPA 2OHOA 2ZUWA 3M81A 3D7MA 4QYTA 5KDLA 4L5IA 5EIHA 4H77A 2B5OA 2A33A 2E4ZA 4R2MA 2L2QA 4XCXA 1KS9A 4JLVA 1KVQA 3RS8A 3SKXA 3VMFA 1FTGA 3EVEA 1ZOIA 4H15A 4HD8A 3TE7A 1O1YA 1QTNA 1YDHA 4LY3A 4QYMA 5ITWA 3LT5A 1J0EA 1W34A 4GZMA 2CL7X 2ZUDA 3ADKA 1N9ZA 1NHWA 4LTMA 5H82A 3W05A 2Y1FA 4L5YA 3PQ8A 1X3LA 2CL0X 4KOAA 2XNDA 4OQ4A 5F9MA 4IXMA 2BIFA 3TEJA 4CR8A 1ODKA 2LE0A 3E22B 4HDKA 3O1LA 1M67A 1O2DA 2DPGA 3QOXA 1NUUA 1WCIA 2ZBQA 1U0OC 5G1NA 1W87A 4CUJA 5DNUA 2FEOA 2OCPA 4UEQA 1KC3A 1CUZA 4GX2A 1H65A 3HCRA 2HBYA 4K3UA 3G2NA 3RK1A 4KGXA 4W8OA 3HKEB 1NW9B 4HWPA 5J5VA 1VKHA 5L40A 1JYSA 1ORIA 2W2QA 1CR6A 3I2HA 5FBVB 3W8EA 3CUYA 3ZC3A 4PX5A 2NAPA 4JLNA 4GEKA 2GTHA 4OQDA 3JQAA 2GFHA 4BB0A 1E4EA 3TR0A 2VJLA 3MW8A 2OV6A 4C2AA 3SICE 2JPDA 3BTUA 2R00A 4US0R 5A4JA 1ABBA 2RGEA 3H1BA 4YRAA 4JD5A 1OFHA 2AFIB 3KXIA 3NASA 1C4KA 1BVHA 5KMGA 5LQNA 4LMBA 5JXGA 1J9ZA 2FRVA 1X1RA 5CYOA 3GJ3A 2L69A 5F98A 1RZRA 3EHDA 4U00A 5JSYA 1HT2E 3CRVA 5GVRA 1GTG1 1NE2A 1JR6A 4KNYA 1RDFA 2WZQA 4UD6A 3L6OO 3ZXXA 4AVYA 2AW3A 3KKZA 3G5LA 4HFMA 3CVWA 2FZ4A 2KSQA 4LJ8A 1II8A 3QSGA 3GA5A 2Y6UA 1MO2A 3ELBA 2VXBA 2X0DA 4B3BA 2LIVA 3G2OA 1PE0A 3RYIA 2CY0A 4G65A 1ZIYA 5DEIA 1A95A 4DUGA 2O0HA 3CPHA 1NBME 2BGGA 3CJTA 3GJ6A 4POAA 3P9NA 1CUEA 3JWEA 3IBFA 1E2UA 4G67A 1UP4A 1FS6A 4LY0A 4BFXA 3IDOA 3NR2A 3ABOB 3KQPA 1SCBA 4P53A 1X38A 4XARA 3S2EA 5ER9A 5F1KA 3G9TA 4ZV7A 4AZVA 2MYTA 1G9SA 5CP8A 2QVGA 3HJHA 5DGTA 5F5NA 4B3IA 2Q5JA 4BO8A 1HURA 1V43A 3SIWA 3AP2A 3NWJA 5BRJA 3L6RA 1E20A 1TW3A 2PZKA 4NH4A 3OJ0A 5M2QA 5FBRB 1NXQA 1I6MA 2FOIA 4QRHA 4LPSA 3ZGOA 1CQJA 4AP5A 2J41A 3UANA 2F1OA 2XVMA 3WLPA 4EG0A 2Q2QA 2VTKA 2ZRAA 4J75A 4DLWA 3GFTA 4NKRA 2Q0XA 5DBIA 5M3BA 1KRWA 2O0MA 4IGIA 2J0SA 2WUDA 4B40A 4PLFA 4RZ3A 2Q0QA 1RBQA 4EQ6B 3EMKA 2OWDA 2RGGA 2CKMA 5C5CA 2LV8A 3BD8A 2PA0A 2IXGA 4K28A 1E59A 3W1EA 4CHGA 1XMJA 3JALB 1XBTA 1Z63A 2EYUA 2O8CB 4FUTA 4LE0A 1DG3A 1AF4A 3T15A 3KDSE 3OICA 2ZYIA 5TX7A 3RVJA 2W4QA 3TTYA 4CPDA 1EAYA 1JLLB 4PSAA 1XT6A 3RIMA 3W3AD 4LVNA 1CIJA 1QO9A 4PZAA 1RC8A 2J5QA 1JLSA 4B73A 1XD9A 2DFPA 1JZTA 3NIWA 5J3JA 4AKIA 4LSZA 5FA6A 4XDYA 3ACCA 1N4DA 3ZV3A 4FMCF 3LJKA 1AK9A 4MKXA 1P18A 4OBEA 2XNCA 3LPDA 3LWNA 1ONBA 1G3MA 4TV8A 1VKRA 1MDBA 4Z2YA 1C14A 1Z2DA 4WJZA 4RTOA 1DKMA 1QX4A 2R8ZA 5GY7A 5I8ZA 3AFMA 4DLRA 2DX7A 5TLSA 3DTYA 5LIPA 2G6TA 2HIGA 4I9FA 3KT0A 2HCJB 1M8KA 3D5TA 5ALPA 3UENA 4BCDA 3BM5A 1YRBA 2W83A 4WEQA 5FI0B 5HKLA 2R3SA 1J5PA 4H9GA 4NCJA 4CKWB 4CTMA 3BOSA 1EFUA 3ELDA 5HQ3B 3K4PA 2Y8EA 2C42A 3FMPB 1EYZA 2FK7A 5JCOC 2Q6KA 4X97A 2NTJA 3T35A 5L3SB 2AD1A 3FG9A 1LEHA 1DSSG 3H99A 5FOWA 3W78A 1R18A 1VE6A 5EWLB 3BG5A 5CEEA 5BN3A 1G8HA 2JH8A 3UMVA 3PXXA 2PRZA 4AZ0A 3O8RA 5TS3A 1PHRA 3N39C 1YZQA 5E3IA 2VEOA 1T10A 2YV1A 4QEDA 3F9IA 3FYUB 4QUEA 3NHLA 1M0WA 5B4UA 4MDEA 2J7PA 1LSSA 1JUDA 2HO4A 3G1WA 4ON9A 1E66A 1UC9A 2DEUA 4Z53A 2BTEA 1I9GA 4C0JA 2YVLA 2YNMC 2J59A 4CU2A 4AMBA 4C0KA 1ODSA 1SNYA 4ND5A 5C1OA 3IE0A 2KI5A 3WOVA 3EZ7A 4ZOBA 3JYNA 1U99A 2QRHA 3ENQA 3ZDYB 3NHFA 2X42A 4GUAA 4L8GA 2ZIEA 1JKJB 4MRPA 2WBLC 2PZJA 3WR5A 4B7AA 4HXGA 4Q4JB 5KO2A 1LTHR 2BHNA 3IMKA 5F9FA 1E69A 3OCUA 2JLCA 1X1TA 2EBWA 4N12A 1INLA 5AHKA 3T1NA 5ITVA 4LF7B 2NTYC 5JG7A 2QL9A 3KB8A 4F06A 1U1GA 3G79A 2WF8A 4G3XA 3D6UA 4JOCA 4DQVA 2DUJA 3IPXA 3GRPA 1T0PA 3PPIA 4V0LA 3TQRA 1TJ5A 2NO0A 3WL7A 3N0XA 4F1KA 4FB5A 2GASA 2D4AA 1CEQA 4HJXA 1IZ7A 4JVNA 4AJOA 3RG2A 1V7QA 4NTZA 4RNCA 1WMDA 1G3QA 2FN3A 3PJRA 2QT1A 2EZ9A 2H8KA 4HWGA 2H17A 3IQEA 4HPXB 4XQCA 3T7SA 3UB2A 4YIHA 3FA2A 5DMXA 5K99A 2QBYB 1ZJZA 3NEPX 3OOJA 2YV5A 5CK4A 5FBKA 4YQYA 1ZU5A 1ZW6A 1JHPA 2H4ZA 3EG5A 2OCKA 1DJPA 3QVSA 3T52A 4OK3A 3FCOA 5IJ0B 3W79A 2KWIA 3MQ4A 1VL6A 2DE0X 3RNOA 1SXQA 2EHDA 3SHOA 1GCAA 1OSNA 2FFBA 3G1UA 2N1BA 3PUKA 3TG2A 3IUMA 4MQBA 4UOQA 3THWB 2I7CA 2P9ZA 4HXEB 3KZVA 1GZUA 2X1HA 1U7ZA 3NYRA 4QPZA 5CX4A 1JFFA 2F43A 3G8BA 1Y3BE 4YUWA 5A0VA 1OH6A 3ZZUA 3EMDA 1RW4A 1EFVB 3WXMA 1Q16A 1JQBA 5DK4A 2FMIA 3FY4A 2OYRA 3SK0A 1XIVA 1NVKA 4WE3A 121PA 4U6QA 3T0FA 5AW3A 3N58A 3A28A 1TB4A 3AU9A 4LBZA 2NVUA 1YQWA 1SVNA 2X19A 5ESRA 2B69A 1XAGA 4XGQA 4KQEA 5JS7A 1RAHA 3FVVA 3IXLA 2R8PA 2A59A 4W6ZA 2R8RA 3QEKA 3U3KA 2GCOA 4EPVA 1E1KA 2PJUA 4RAQA 3LH5A 4BFYA 1W2HA 3NC0C 1H6BA 4TS4A 1GZ4A 4OJNA 1UBCA 4OPMA 2C8VA 3NS7A 3QJYA 4K87A 1T4DA 3RTGA 3S5JA 4R68A 3ZHTA 3UJHA 3VC1A 5EIWA 4HNUA 3R6LA 1JIJA 4G1FA 5DBOA 3VPXA 1M33A 2FSIA 2ZE6A 2OBLA 1A8QA 2Z2ZA 1VLLA 2RH4A 4QYSA 5L7TA 1JA0A 3SHFA 5LL6P 5J2TB 1QONA 4KUGA 1Y63A 3HXLA 3AI1A 3QEOA 1EGHA 1RJEA 4ZALA 5FFFA 2ZIAA 1IU9A 3WV5A 4HBGA 5C8YF 1N0HA 1SUBA 1Z73A 2GKSA 4OYLA 2Q6LA 1EP1B 5I9SA 1DRKA 3MN1A 1E0DA 3NFYA 3QBEA 1Z6AA 3SZMA 5BVHA 4TWBA 4DADA 1NF9A 5JADA 1KVUA 2QJFA 3GD5A 5DJ5A 1OV4A 3VO9A 2QK4A 4HADA 4GP9A 4PINA 2GBLA 4Y7DA 1DBSA 2Z58A 1GRNA 2PMDA 2XE6A 3FBWA 1E18A 3JWJA 4KHZA 4LJ6A 4AO8A 4CL0A 1ZGBA 2MTBA 1SQ5A 3PUHA 3U9SA 2PYDA 1ADCA 1OXSC 3V2UA 1KE2A 2QAIA 3EXIB 2CJWA 3EBLA 2BW0A 2OVFA 4OVKA 1I01A 4R1UA 5D5HA 1G55A 5L53A 1VMIA 1PTJC 3NBZC 4JU8A 4DRXA 2KMLA 3ISJA 3MCTA 2C7OA 4ONEA 1QGUA 4QPJC 4FZRA 4RS3A 3ILYA 1XJQA 2G77B 3IT2A 1JEQB 4F5DA 4NK4A 1NBOA 2Z04A 4GBMA 4LMPA 3O94A 3GFSA 3DLBA 1N0UA 2BGUA 1JA1A 3G8DA 1QE5A 2EWMA 2ONCA 2WMNB 2H00A 3CX7A 3VOTA 3U4QA 2PJZA 3QFHA 4L78A 3BKXA 1WW8A 2V7BA 1G20B 1U65A 3WL5A 5B7NA 2IYRA 2YVAA 3ABRB 3FHOA 4UFOA 1VCIA 1PK8A 2AYZA 4HLCA 3AB8A 2P9EA 5G3ZA 2OK7A 2ZTMA 3MCZA 1BDHA 1RHRA 3PLNA 3KHUA 1PS0A 3F4KA 1SWVA 3E03A 4BCBA 4D6XA 1IYZA 2UVQA 2PCLA 5C80A 1E60A 1JJFA 1FNDA 3FCUB 5IAGA 3MBIA 4YPVA 5LWHA 1RI5A 2E0IA 2YZMA 3NAQA 2EKZA 5EMHA 5CFPA 5BSMA 4FNOA 1ZGAA 1YZGA 2PT9A 4FOPA 1EFPA 1F48A 1PZHA 4UBIA 3FX2A 5E6UA 2XCIA 4Q7QA 1JMKC 2QYTA 4S2EA 1PJBA 2ZB4A 2JFBA 3AM3A 5EUMA 1GCUA 1PG5A 4KYVA 4WKBA 1XXHA 2WF6A 3FB1A 4KAFA 3RK0A 3ZDRA 5IABA 1ZL2A 3CUEF 4UVDA 5EPOA 3N8DA 3F6PA 1K8ZB 2YIDA 4IWXA 4P4TA 4OXIA 5IN4A 3EAQA 4LYHA 5IM5A 5TRTA 4Y9SA 2GJ4A 2X0JA 4UM7A 1TMKA 4ZEXA 3KUDA 2REQB 1ZC4A 2XODA 1FLAA 1NVEA 1DDGA 1KPIA 3E61A 4YCAA 3TTUA 5CJPA 3ZN2A 2HJVA 2CBXA 3GFQA 2VP9A 4UOEA 5JYDA 1Q14A 1SKYE 1WVGA 3TQFA 4FEAA 1QIIA 1OBOA 3NKFA 4GPD1 3AEQB 5K2MA 3TTSA 3S1SA 1BDJA 2D0OB 4DKJA 4FYIA 3TPCA 2F1HA 4H6VA 3DPSA 4RK7A 1WMEA 1TPZA 2H07A 2JCBA 3IULA 1Q5PA 4DJ5X 2H4XA 1BMFD 1N8KA 4GUDA 4YRMA 1YC2A 3EQ2A 4F4CA 1K7CA 2G9RA 3K73O 1HI9A 3OP1A 5ALEA 1J09A 3SCZA 1DCMA 5BWLA 1DELA 1BNCA 1HE3A 2FF7A 1E3TA 1UODA 3KZNA 4YJKA 4YLYA 4UJ3A 3HUFA 3FPSA 2O8DB 1UJMA 2GK3A 1BG6A 4WLUA 5C5IA 4CG1A 2YVQA 2RC5A 4H4EA 3WGZA 1J8YF 2VHWA 3SX2A 3T1VA 3EZNA 4GPZA 3GMDA 4QYIA 1JIKA 3CZMA 4KITB 4WCFC 4BBAA 1HQKA 1WHTA 1OGIA 3QK7A 4I4TF 4JB0A 2HIHA 1NTOA 4OMFG 2ZKLA 5IT9A 1NBWB 4ZARA 3TRHA 3LRXA 2PXHA 4BNGA 1L1QA 4UZEA 2C07A 1AS2A 1RIFA 3LY8A 3HKEA 5AJZA 3RSGA 1G9TA 3L0DA 3M5DA 3MTJA 2CXOA 4MW4A 4QWMA 4CNQA 2G1JA 4N8SA 3EXHA 3UKOA 4EG4A 5AVYA 4QU0A 3DAFA 3ZKWA 5CU7A 3OZIA 3ZIUA 3V1NA 1JDNA 3AY7A 5AJWA 2CLIB 5EQFA 4M6WA 3WWYA 4AJEA 1G7CA 4CTNA 5BW4A 4K6OA 3ST7A 1AN9A 1P60A 2Q6TA 4FB4A 2GHIA 3P4XA 4Y98A 3IAFA 4PZZA 2A4KA 2INGX 2QVXX 4URFA 2WOOA 1A4UA 1FBNA 3AUTA 1WTAA 3G82C 4JKYA 1Q0UA 4EVSA 2EV9A 4NWIA 4J0CA 4ZYVA 4EKEA 2FSUA 4IOJA 1OFIA 4Z9XA 3TK1A 1YJXA 4UU8A 3NM6B 4TROA 4FDLA 1H94A 2EERA 1Q20A 1KH1A 2JAOA 2VAMA 5DGCA 3TGWA 4LDNA 3H9BA 3CLVA 3SZOA 1OBHA 2ZJFA 4RMHA 3FNIA 2B4AA 3A1FA 3CH4B 3VKFA 1UOEA 5K6AA 5T64A 3KNZA 1NDQA 4KQXA 4JT8A 4EKYA 3F7OA 1K4KA 4TMWA 4A27A 4BAGA 2TMYA 4K0RA 2BGNA 3RS7A 1ISIA 1VDZA 3MOIA 4FYMA 4CKWA 2OC4A 5U4QA 3WSTA 4ALJA 4B6SA 1JEEA 2HCRA 2PBFA 2ASVA 1AF7A 1TF5A 2IUYA 4QLAA 3WA7A 1RXCA 4C43A 1Q7BA 2ZJ4A 5KVVA 3CGGA 2J3KA 3D6TB 2DBYA 3PUZA 3OIWA 4G37A 2Q7DA 1ONOA 1QPZA 3Q7RA 5DB4A 4EWLA 1C9JA 3ND8A 3IEKA 1P29A 2QZ9A 4ND2A 3H5OA 2DCMA 1L2TA 3NHUA 1I3CA 3MTAA 4JP1A 4NABA 5TVKA 1RHQA 2XT9A 1V0JA 2UZ4A 4CODB 5CA1F 3VU9B 2IUTA 1SB8A 1YDWA 3HXPA 4QL3A 4KVGA 5FYQA 1E1RA 3RHZA 1ZVVA 2JA2A 4DCPA 4CTJA 4UOZA 1KZ4A 2X8AA 1S1MA 1Y5IA 1NVMB 1U8XX 5EIBD 4RV4A 4H7KA 3OLWA 4Q48A 3IUQA 2P6PA 3NZEA 2EU8A 1OZGA 1KYZA 1CE8B 4YMHA 4X6XA 4O4LF 4HWOA 1ENZA 3C87A 3TSYA 4E7OA 2B35A 4I50A 3R5XA 1E2JA 4L95C 2C0CA 3JAMA 3PQEA 3CY6A 2PZ8A 2R7KA 1GGKA 2IODA 3MMPA 3HKCB 4A8JA 4EZIA 3HJRA 2CN1A 2C3MA 1M6EX 4O0LA 1UBJS 1C9KA 1NW6A 3GUYA 2X1VA 3OE7A 1UMKA 4GP6A 4F7WA 1KMCA 2WUFA 5JD4A 2HPVA 8ATCA 1UPFA 1C7FA 3HL4A 4WJLA 5MF6A 2IKSA 4R6WA 1G5FA 1PNVA 1VBKA 3TG8A 1TTTA 2C92A 4J9VA 3RUIA 1V3TA 2TMGA 2A57A 3T9EA 3QZUA 3V34A 3ZLVA 1PS9A 1UR5A 3KE8A 4K2HA 4RPKA 4Q9LA 5DASA 3WKDA 1P19A 2AZ4A 4X93A 2IS1A 1Q0HA 5IBRA 1S7GA 1KAQA 1A7JA 3DE6X 1KQ3A 4ZQEA 3TCKA 3WP0A 3KM0A 3JCZA 2X3YA 5GONA 3D4OA 3S1AA 1JBKA 2VDJA 3VR3D 1IZ8A 4R71A 1RQPA 1K6IA 2DUWA 1U9CA 2MSEB 3LW7A 4JQOA 3RC3A 1W0JA 3FDXA 3HCCA 3VV2A 1R50A 4N40A 1QFSA 1KBOA 3PEEA 4WQMA 1P4AA 1GGEA 2GB4A 4P7FA 1SCIA 3COJA 2ID8A 2AFHE 3AVPA 1O89A 5BN4A 3GJ0A 3THWA 1FY2A 1W30A 4Q7KA 4QFCA 3ANTA 3KQKA 3BK1A 3PQ5A 4TTQA 1PSDA 3RKUA 2B99A 4MTCA 4YJFA 1EFVA 1LK7A 5DBGA 1DTEA 1Y7HA 1OT5A 2KLBA 2M9MA 4Z3KA 3GT4A 4UAJA 3U81A 4KQCA 4JFAA 3DH0A 3Q3JB 3VSAA 4BZQA 4JGBA 2Q7OE 1Y6JA 3OU2A 5JCJA 1KI3A 1MMFB 2CCKA 5J40A 3L8YA 4ZMRA 9MHTA 1QQTA 5C1BA 1WXGA 1ONNA 2XNKA 5FADA 3ZGVA 3IOCA 4GX1A 2WP0A 1HDOA 3IPYA 1NXSA 5A2GA 5J4KA 3TBKA 2EOAA 3RFFA 1Y6RA 2IC5A 2XUJA 1XMQB 3DMRA 4UHEA 5GADl 3CNQS 2X0KA 2PX5A 4ZVLA 3VU1A 1VLVA 3QNWA 1EP2B 2PLRA 4KQGA 2H08A 3SQLA 3ZHXA 4E13A 4UUPA 1XEWX 2F3QA 4TSFD 1KK2A 3DBIA 2KBFA 3E3MA 1RBZA 2JHPA 4AFNA 3CR3C 4HAXA 4QXQA 4GM4A 1MC4A 4NPCA 1X7WB 4BNZA 3C1OA 3PNSA 1DAIA 1GQ2A 4FCVA 1A9QA 1TZBA 2I91A 1OBCA 1M9NA 1R4MA 4HWSA 3MIZA 3WBKA 1NMEA 4Q66C 3CVVA 1K89A 3H3FA 2QSZA 2PD3A 1QG2A 4LXYA 3T3OA 3CLSC 4IJQA 4R0VA 3CA8A 4LPKA 3RT9A 3BGOS 5I9IA 2P7HA 3JQFC 2QY9A 4QODA 3AG5A 2QUZA 3BKWA 3M1AA 5JY6A 3A9TA 3K2IA 3SC4A 5AJVB 1N0VC 1CY4A 2GDJA 3LK7A 3QH4A 4TKVB 3LUDA 4N6OA 2E2WA 4P3KA 4PHHA 4Q12A 4QDOA 1DG1G 1T5TA 2FX3A 1LA2A 5TF0A 3NIDB 3T38A 4MV3A 4PCLA 2GR9A 4DRXB 1U7TA 3N2ZB 5JQWA 2PKXA 3MT8A 1M0TA 2PGDA 2PUVA 5LZ5A 4JQZA 1QGUB 2XWSA 4KPYA 2HXYA 4PO1A 4CT0A 3B20A 2OOKA 3O26A 4RK5A 2WUEA 1DU4A 1QNFA 1BSVA 1E2IA 1OLOA 4B2PA 2FN9A 3BXPA 3DEKA 2RB5A 3TB4A 1G8GA 2FN8A 4GQIA 4D4GA 4XEUA 4H16A 4CRWB 2H29A 1RXSA 5FB3A 1NF8A 4OKSA 4E2YA 1V3QE 3CJQA 3PIDA 5FFMA 4ZVTA 4NZNA 3HDVA 5ALYA 2A1IA 3SYKA 1LSUA 5F5XA 4CMHA 5HZMA 5ALTA 5EL0A 3U0BA 3ZE7A 3TFOA 1ZXXA 3M5WA 5F2EA 3DMYA 3JZIA 4UBMA 3KTOA 2IX9A 2CZGA 1C9NA 2I71A 1QIKA 2QROA 3PHLA 1Y42X 3RV4A 5IDXA 1J9GA 5LLTA 1WABA 1ODCA 1DC7A 1LTQA 2Y1WA 4XUDA 3RVKA 3HCFA 3H1FA 4A82A 1GQSA 1W2GA 4MQUA 2B1QA 4ZRNA 1QORA 2AC2A 4IFBA 3EXEA 4GECA 4J6FA 2JLRA 2QN3A 1J8VA 4U02A 1XU4A 3GLFA 1N5JA 2FHSA 1ORVA 1QRDA 1YH3A 4QARA 5HPYB 4L75A 3JS5A 2DR3A 3RLIA 1C0PA 1NZDA 5DLPA 3BMCA 3WMRA 2JZOA 3UPUA 2JDID 1PWEA 2Z6VA 5BUSA 3EPHA 1L4LA 3GYGA 2ZUFA 2JIZD 1MUUA 5A7GA 1YZKA 3KXDA 2QZPA 1MABA 2GPWA 3U09A 2GTIA 3FCYA 3TDNA 1N4AA 3Q87B 4AL4A 1AK1A 3A8TA 3CF4G 4IO1A 3NVDA 1F6WA 3WGHA 2YRFA 4RTQA 2QN9A 3I9JA 4TXNA 2GQ0A 1GQOA 3ZWMA 3N0RA 5HF5A 5IWAB 1ZSNA 1M2NA 2B5WA 3V6MA 2REQA 3AFHA 3AZPA 5E4YA 1H1TA 1RZVA 1E5LA 2V6IA 3UJ9A 3V2HA 1HT1E 2PWBA 4Q3AA 2DWPA 3AUUA 4E11A 3QUTA 2XD9A 3QXSA 3TKAA 3W6OA 4R84A 4RPIA 4L2IA 2BUBA 3THSA 2EARA 3D54D 1Y6FA 1F14A 2PS9A 1EUZA 3LFHA 1OX5A 1F8YA 3IUNA 4F1WA 1WCV1 2BLNA 1P1IA 4M89A 3HLTA 3N2KA 3GLSA 2A3RA 3EARA 4OI0A 1FUIA 3DFMA 4KRYA 1TYEB 1ES9A 3IP5A 2WJVA 4MPRA 5KYVA 3FW1A 4XRRA 1CJBA 5EHIA 2KHZA 3NVAA 3OFND 4WN3A 1JHDA 5I9LA 2JBWA 3M6LA 2QRPA 3KPVA 1JVSA 1TQ4A 4WXHA 5LZ2A 4S2UA 2D7DA 2EQAA 3HZZA 3P9IA 5IJZA 4C08A 3JZFA 2YOFA 1Y3AA 1EUDA 4Q01A 3IYLW 3S55A 2DWOA 2GXAA 3E5RA 3MYRA 3L77A 3T7RA 4CMIA 2HLHA 3HP4A 3O84A 5IVDA 4EF4A 1E2BA 2G83A 4R2KA 2OBFA 3GLHE 1MRNA 4AUKA 2M1XA 5DBEX 4I7EA 3CVUA 3G5MA 3A4YA 4W9NA 4AKSA 3EVCA 3ODPA 2QSUA 5GZ6A 1XK6A 3DHNA 1QQ7A 1GRQA 4LDZA 1QU3A 3OG9A 1CUJA 2OGTA 2W48A 5ECGC 4RE5A 2DETA 4XE5A 4HLDA 3HBFA 1PWHA 2B1JA 3I6BA 1U0GA 2L19A 3ZU2A 1ZI9A 5HTOA 4CM9A 1W4CA 4X64B 2QJWA 3QYAA 1Q0ZA 3R8FA 2EG5A 1US8B 5AIAA 3F8SA 3H4MA 1ZJ5A 3FPLA 3KYIB 2CVOA 4D9MA 5LQCA 4MRNA 2XIJA 3B6MA 1FU8A 3EY9A 4FCWA 1YR9A 2VWHA 1GEEA 2PWYA 4DLKA 5JW6A 1CJUC 3CF6R 2Z8YM 3CISA 4HV4A 1NE7A 4M99A 4Y9RA 1ESCA 3A1CA 8MHTA 1W4LA 1OFGA 3MLAA 3MOGA 4F3NA 3TRDA 3FI9A 1JG3A 1XZEA 4L76A 2YJ6A 1ZR4A 3LECA 4XGRA 1M6VB 3THYB 5C4MA 1A0OA 2XTJA 4W1QA 2ST1A 4CMJA 5KU1A 1A9RA 2CFSA 3EMVA 3GP8A 2QTLA 3JQBC 5JBIA 4IIGA 1FSZA 5EAIA 2NZXA 4LKRA 5LMUB 5F2NA 2EJCA 2V5VA 1NQOA 2VHUA 3FPKA 4HMPA 5I9MA 3H6KA 2GLTA 3CONA 5AJXA 1ULAA 2E4UA 1SK8A 2J7KA 2ECKA 1K6MA 3E7DA 3K53A 3HU5A 4M88A 5SZKB 1E5DA 1VRCA 3UMJA 4AYXA 3GPCA 3O4GA 4DY4A 2G88A 2VP2A 2OXCA 3C3WA 3E82A 3CWZA 4XM1A 4MUNA 2Y99A 4E1VA 1UXIA 2PFKA 4D0GA 3L7DA 5DTRA 4Q93A 4X6LA 1RVDA 1NF3A 3E58A 4HG2A 2HOQA 4PYOA 1FUYB 1MJ5A 2V7EA 3FYTA 3OU6A 3PSHA 4I50B 1FTSA 4XDZA 5JCZA 1EFHA 3KT8A 2XHEA 5DN9A 3DXXA 4EHJA 4HN2A 1ZU4A 1TVKA 3Q4GA 1G7SA 4WCFB 1OXVA 4IICA 2VF2A 5DM60 4R7TA 1OX4B 1ZI6A 2ZTLA 3HA2A 3MTEA 3KQLA 2ZGVA 1FA9A 3U44B 1ZK2A 4W1RA 2J9GA 4RQTA 4GIBA 1UBEA 1BD4A 1CRWG 2PL5A 2XMRA 1YE5A 3EXHB 3BSSA 3IH5A 1RADA 2VNJA 3P0FA 4OJKA 2BZ1A 2PFGA 3IBCA 2GT1A 1UEJA 3E9DA 3S44A 3PXBA 4ZHSA 1NBMD 3H2IA 2GD6A 1DVRA 3MEQA 2Z4TA 3DDUA 3T9CA 1XU9A 1GTL1 1X1QA 1XTIA 4TLBA 1UDRA 1IXKA 1NVDA 4DE5A 3SDZA 4XWOA 3MFYA 3FWYA 3DHWC 3R09A 4WPGA 1R6VA 1C1XB 5AVOA 4P80A 2Q4BA 2NPOA 1YBVA 1QE0A 2A5LA 4IQGA 4MDHA 1BH2A 4X85A 1KOLA 3TIXB 3WKBA 1H4QA 1OFUA 2VCYA 5FOVA 1FF9A 1ZBDA 3CVXA 1L9KA 5DTQA 1JF8A 4M9SA 3UYLA 1KBQA 4YP5A 4KOEC 1XXLA 2PPVA 3P2YA 2P4QA 1B0ZA 3VU0A 5JZOA 5KKNB 1UOOA 1P7YA 3FKSA 1AV7A 4PAOA 3RSZA 3QU5A 4ECEA 5LM3A 3TF5A 4W7HA 4H3HB 3KCQA 5H80A 2LZ0A 3PGLA 3ORSA 3HBLA 1U1EA 2FP3A 1YRHA 3UJ6A 2Y9PB 4HTAA 3R7BA 1M2OB 2AJ8A 4KNWA 5JBNA 5L95A 4J1TA 5BOVA 8LDHA 1U2EA 3UG6A 1L9XA 1GPMA 3BXZA 5I47A 1IY2A 3GCWA 5TEVA 5JH7B 2M1ZA 1XN1A 2PD4A 2XQIA 4IDBA 4LGMA 4N7RA 4LGYA 3QLVC 3GFPA 1WKCA 1XZCA 1FNCA 8OHMA 1IPEA 1DHRA 1GZ5A 1N5MA 3WQQA 1R37A 1ZIDA 3KETA 1OAAA 2RH8A 1Z38A 3ZNPA 4KHPB 1POXA 1ZMXA 3CEMA 2BDEA 4YONB 3W5JA 4C3UA 4UTVA 1ICIA 3IB3A 3ND6A 1G16A 5AKZA 3ANMA 4KRFA 1LLUA 1FE8A 2B0JA 1B15A 1XD2B 3BPSA 3KBBA 2W6ID 1XRSB 1MPXA 3EQ8A 3CLUD 1GZSA 4BFUA 4TMVA 4YQZA 5LB4A 2Q2VA 1I4OA 1MP0A 3NTVA 1QK5A 3CHYA 3UAWA 1EUQA 4IUBS 2R4QA 2GK7A 5AKKA 2IFTA 3HJTA 4RXTA 2C97A 2ZROA 3AWDA 2NO5A 5SYNA 2MCFA 3W2IA 2J6BA 3K9GA 4GZLA 4DC0A 1V7CA 5IDVA 1CUHA 3C7CB 1G9XA 3DTVD 3VO8A 4RWEA 4JBXA 1COZA 2OCBA 2C2MA 3D6NB 1AXRA 1JEDA 4F5ZA 3HHEA 2WG1A 4YRSA 4L8FA 5TMDA 3KXLA 2X4GA 3GUHA 2A8YA 1A72A 1E6UA 1GZDA 3CMCO 4RVSA 1FPMA 3PA8A 1T3SA 2Q5IA 5GP1A 4M7WA 3VNRA 3TFWA 1KOFA 2PUFA 3D8HA 4NI5A 5JMPA 4EI2A 3DNFA 2F3TA 3R7DA 5CGZA 3BIOA 3MJVA 1TQDA 3DHYA 4JVSB 5K6RA 3I37X 4BX2A 5JH7F 1LLDA 3BZBA 2M6KA 1FFAA 4BY9E 2X58A 3JAKA 2GVDC 3I6ZA 1LDYA 4PPYA 5FD8A 1TD9A 3H1TA 4XYEA 1DIOB 4RK1A 4BB6A 1HTBA 3VOSA 3SOZA 4Q4DA 3SX0A 2WW8A 2XGJA 1U0TA 4DMHA 1Z83A 3A04A 4TWAA 4G8BA 1ARZA 2QWXA 2O8EA 5KVCA 2BEVA 2QRLA 3D0RA 3FPFA 4RKEA 4ZOEA 5K3FA 1VKOA 1CUVA 4OJYA 3ADPA 4HNVA 2X8JA 4M9XA 2FWJA 1Z6ZA 2YYSA 4TSKA 1N2EA 1VMAA 2ILTA 1J2TA 3IXQA 1O5TA 4C5CA 5C32A 1E3JA 4ZQIA 5EE1A 5EUCA 4RF4A 4DTCA 1MEJA 1YOBA 2C5AA 1KYYA 2R751 3D8NA 5H02A 2YC2C 1RYMA 4XQ9A 3WIBA 4UBLA 3SR0A 2YUTA 4IHJB 4Y8VA 4E3WA 3UJCA 4A2CA 5KSWB 3QMVA 4ZCIA 2V7PA 1AJEA 2DY0A 1EWTA 2IOQA 3PGA1 3AW9A 1TA4A 2H2AA 4MLPA 1UFVA 3CTPA 4MJ7A 1GTVA 1USVA 3ESBA 4S1PA 5G0SA 5H3LA 2EFJA 4PYKA 3SVZA 4B84A 1GPNA 5ADWA 2IH5A 4OA8A 4BKPA 1TM3E 3OJXA 1D2CA 2RSLA 4RF3A 3IR6A 3ICPA 3HPQA 4ETIA 5LPNA 1I10A 3GLFB 4RHFA 1AU9A 3UK0A 1DJOA 1NATA 1SHLA 2WJGA 4B8WA 5MFZA 4P36A 2VN8A 1KSJA 4HPJB 5ALKA 4I4CA 1OC4A 4NE9A 5LC1A 5YASA 2D54A 4IDAA 1OZAA 4N5IX 5E1BA 5C46F 1ZMRA 3T1OA 1HLFA 1CZUA 2P68A 3M6MD 2G4LA 3FDZA 5IRCD 2WU8A 3JQFA 3P19A 4OB7A 1YVEI 2AR7A 2O14A 1JV2B 1IN5A 4FEEA 3Q41A 2VSXA 1EINA 2Z83A 2WP8J 4FLEA 4I99A 2ZB7A 1O94D 3R76A 5ELXA 4RTNA 5IEBA 2WSSD 3GVCA 4JZYA 1B8UA 1NJ1A 2QVCA 5C52B 4HGOA 3MCAA 1HOXA 3HXQA 2HEIA 4HY3A 2AMFA 1YJAA 1GRCA 1XYYA 3P71T 5HMLA 3VM6A 4IF4A 4X6YA 1PJTA 3P26A 2QPTA 1GKYA 2IU3A 1LBTA 1CY6A 1ZJ4A 1PJRA 3BYZA 5KTKA 5B1HA 4RKWA 3OO1A 1GAWA 2HMSA 4MWSA 1N5KA 1IEXA 1TIBA 3EGVA 1DMRA 2GUWA 4PN3A 3BICA 4X3PA 3A11A 3R0JA 2PBRA 2QTMA 1I1QB 4YCJA 2VJQA 4XJXA 4B43A 5D7NA 1SVLA 3OI7A 4LY6A 4HEQA 1X7YB 2XUFA 4TLMB 4UTOA 5C3UA 4HAIA 2VYND 3H84A 3ONFA 4QVKA 4X91A 3HSSA 1OWPA 4BJ1A 3AF4A 4KWHA 1V5WA 2LXNA 1MB2A 2AC4A 4IUDS 4LV6A 3ZHSA 4BLRA 2ZXFA 1OCEA 1RCUA 2JGNA 3LHFA 2GPBA 3UEOA 4DSUA 1C7ZA 4LXXA 3T7TA 2W6MA 1HRKA 6ABPA 1XEWY 3OWHA 3VUFA 3GD7A 4BWYA 2B30A 3TIGA 1ZG3A 1XDGA 4UJ5A 3OTGA 4L6CA 4KXWA 3H9QA 3L7BA 4PFSA 4BU1A 4BYGA 2J30A 3LX5A 4L8YA 4EAAA 4J0QA 2IOFK 2KBEA 2R7AA 1J0AA 1AM4D 5JSZA 2SBTA 3EAGA 3ZTTA 1SC4A 3S5UA 1JQLB 3P9XA 3MERA 2HWWA 1LBIA 1XRJA 2JH9A 4EMTA 3WAJA 5FWDA 3WZMA 4YJ2A 5KSYA 3DZGA 3VVCA 1DFHA 2W6JA 2O5VA 1NVTA 1WSAA 2E4VA 5JRDS 4KI0A 6NULA 4A0FA 2FLWA 2X76A 3MGKA 2V4UA 4XWTA 1E32A 2UXBB 2CHFA 3GFGA 2P41A 3FLEA 2IYYA 3E3NA 1I4LD 5EUBA 2Y0CA 5FP0A 2NXEA 4IHJF 3OBIA 2X5JO 2PKRA 5IAEA 1MGOA 2BKUA 3Q7TA 2GN4A 2ID7A 2ZG6A 1F9AA 3WGJA 4E88A 2J87A 1KDTA 3DNMA 3RTBA 4FW9A 1IWBB 1KDOA 2QUKA 3OPYI 4L5AA 1Z2NX 2PKWA 4MUMA 4O2AA 2C98A 3VH1A 5L3VA 5C53B 3SDBA 5KJEA 5ES4B 1M6VA 5IKEA 5K45A 5KQLA 2CLDX 1A4XA 4FN5A 1T2CA 3GCGA 4PG6A 2WD9A 5ICMA 1B42A 4HNHA 5IVHA 4BAUA 4I36A 1Z6QA 4G0YA 4RVUA 4QGSA 4B32A 4HR7A 4F4DA 2RAFA 1M8PA 1WCYA 5AO9A 2ZSHA 4C9BA 2AEEA 1RLTA 3QXHA 3M6WA 1JSLA 1LQUA 1U8EA 5JS2A 2REXB 3DVSX 1V1MB 2C95A 3R9XA 2HRQA 2ZVQX 1TTQB 4TXLA 4YAGA 4ZDIA 5DHUA 4UMVA 2BJHA 4I4NA 2ZUEA 1B4DA 3HYCA 4FGLA 3ZCPA 2DLCX 4G0MA 3T3HA 4ZOQI 2V7UA 4G6ZA 3T1QA 1ESEA 2DWQA 2KM1A 5CDGA 5HA5A 4D3ZA 2O8BB 2Z56A 5FOUA 2W2TA 2CNNA 1QLJA 3PWTA 4NATA 3IRUA 5AXBA 2JH3A 1DRVA 2B92A 2BFDB 1ZIOA 5TSDA 4GRDA 4C4OA 3HBAA 3ILXA 1L1EA 1EXWA 3DE5X 4KP7A 2CSXA 5AVJA 4WXMA 1YBFA 2GXQA 2JVKA 1Y7LA 2ZIXB 4M98A 3K92A 5ITZB 3WLJA 3Q8MA 4M8SA 1P1BA 4GX0A 3FSRA 4DMUB 1TAQA 4GOKA 3WLIA 3J80A 4BX9A 3BX1A 1JNYA 2HUPA 1V35A 2NOAA 1LK0A 2B9EA 3UWMA 5BSKA 4YUYA 2PO5A 5IAOA 1Y7IA 3WV4A 1UM8A 3B9RA 1BEEA 1KERA 4OU4A 3UT0A 3S8MA 1XAIA 1XYVA 3IPCA 3WGGA 5KJ1A 4EI8A 2JAXA 2JFPA 1EVEA 2OXFA 2CHGA 3AZQA 3TLZA 3RS2A 4XQ0A 4KXYA 4BVEA 4Z99A 2DQSA 3L6EA 5FULA 3K2QA 4MP8A 2VHVA 4C4XA 1QLHA 4N9WA 1Z82A 3IVXA 5LP6C 2BP7B 3A25A 1W85B 2E4XA 2W6OA 3N1UA 4FC6A 4PQRA 4ZO9A 1BA2A 1RLUA 4RJ2A 1F3LA 2O7QA 1KORA 1V37A 1GWNA 2C84A 1L5RA 3SI7A 3BXGA 4ALLA 2Y92A 1LPAB 3ZV4A 3I4FA 2H7VA 5KPDA 4I1OA 4AYWA 3O2SB 1BCSA 1RXEA 1WY7A 1RWWA 2AD5A 4NJEA 4AIRA 1GKIA 3FFXA 4NJMA 3RPEA 1IK4A 2ZQ5A 1CUBA 2HJWA 3KALA 2AEMA 2PO7A 1TUEA 3V8QA 2P9TA 5I9BA 1IWOA 5CDUA 1SUFA 2HI0A 3S4YA 1G66A 3GV0A 3I52A 1FLVA 5AKLA 2QRZA 4XI9A 2NIPA 4LYFA 3NHMA 3O4HA 1CUSA 4ES6A 1ND6A 1OFVA 4RM2A 5KQMA 1ODJA 4N0EA 3DVRX 5LQJA 5I7FA 4EJSB 5BV8A 1FJXA 1ZM2A 4E07A 3E7PA 4RLSA 5DTIA 2JLWA 1FMJA 5COQA 1SVKA 5BYBA 3RB8A 4H3KB 3P0RA 1GU1A 1BE6A 4XTRA 3KSAC 1MVLA 2F3PA 5IHXA 1VSQA 3JWGA 4OQFA 1ABEA 4KFTA 3MWJA 5L6MB 1HR0B 2V9ZA 2GF0A 4LMRA 4G5QA 1JSCA 2FUG1 5LJLA 1Q1BA 1CG6A 2PKYX 4G1EB 3W2EA 1GZ3A 3D4PA 3EDYA 4WOPA 5REQA 2PUJA 3U3RA 4CQNA 1Q22A 3HCDA 3S1LA 5UKDA 1NMZA 1FVHA 2NU7B 2NZVG 1Z6GA 2Q8PA 1UEXC 3C43A 1NJ8A 2XA1A 4LV5B 4W9MC 1A5TA 1RRMA 1UMCA 4I55B 3S2ZA 2C9BA 5HM6A 1CJTC 1PVDA 1E2HA 3L7NA 3P2IA 4XUGB 1XKTA 2XOXA 3FXAA 1KMNA 5KYTA 1QGZA 2NP6A 4LHVA 2QQFA 3EX7C 3FHLA 3KKQA 4JELA 5JXWA 4L0DA 2GF9A 3OT1A 2J45A 3ASYA 4DABA 1L8LA 2IYQA 3QE0A 4RGBA 4U2BA 3BRWD 5TQ0B 3VTAA 5JHGB 3IBTA 1Y4AE 1G3RA 4ETMA 3UF0A 2IJGX 1A76A 3QBTA 2VTEA 5EMLA 3T4XA 3ZHZA 2CF6A 1C0KA 1IXZA 3VZBA 1SQSA 1W6RA 4NEGA 3F71A 4RL6A 4RHCA 2CD7A 2P9CA 2WIDA 2V1XA 1N2OA 4DR3B 2VQ3A 2HR1A 1JU3A 4PTLA 5CG1A 1TYCA 2J3QA 5TPWB 1K75A 4KDCA 2E5FA 2O8EB 1UDCA 3O03A 4M55A 5G4KA 2D5LA 3BE8A 5HCNA 3IELA 3SQMA 1L8AA 2ZT6A 4O2BF 4DSNA 4JBGA 1C41A 1G8PA 4OLAA 5ERYA 4GLJA 1OTXA 4O6VA 1MT0A 2I7DA 3FCSB 4RTJA 3DDOA 3IBYA 4KZPA 3X2SA 4CFZA 4URXR 5CLJA 2Z0MA 1RKUA 1NW3A 4IHJA 3KJNA 3T95A 4FFSA 1JIUA 4DCUA 2R84A 3IIMA 4UUMA 3ETGA 3T3PB 1NVBA 2J48A 2Q1TA 1D2GA 1WB9A 2OUKA 4BQOA 5KOHB 1NN1A 3GT3A 2XNSA 4NIMA 1GILA 5CUQA 4DGQA 5BSFA 2Q9UA 4R0NA 1XCGB 3EVTA 3AVYA 4BECA 1FTQA 1G5QA 5ADHA 1G2IA 2IZOA 3CNNA 5DHAA 4EVQA 4WBNA 2CMDA 1OREA 2O07A 4PS1A 3GVPA 4TLCA 2BBOA 3JQ9A 2XAUA 3OHMA 4N8EA 5DI3B 4CT5A 2FR8C 4DA6A 2FFRA 1LH0A 2CMFA 1YSCA 2BHRA 2ZPTX 2ZRNA 1ZM9A 3SJUA 4IRMA 3U17A 1UKCA 1F2TA 5IFKA 1SHUX 2PUAA 2V0GA 3H3JA 3LBNA 1U81A 2H4JA 2IYVA 2BFBB 3A2MA 4JB3A 1KFKB 3GGJA 3GLHA 1VBFA 3OHPA 4M0LA 3HTXA 1D1TA 1S8NA 3MUEA 3BMOB 1VMDA 2H9YA 3L1JA 1P33A 1NQTA 1LXCA 1G8SA 3GUVA 3UC9A 1PJ2A 3LUHA 1GDHA 1V7ZA 5IVPA 2Z3ZA 3O8OA 1U1IA 4OREX 2WTXA 2GI4A 3L6DA 1CR1A 2M32A 2PSFA 4MUJA 3GI1A 2E87A 3Q11A 4KXVA 4GE0A 4NG5A 1AHPA 4DV6B 2OBBA 1XNRB 1OF1A 1JHXA 3A10A 2GPAA 4IDEA 4XH9B 5KTSA 2Q8NA 1EDOA 5KYXA 1KEEA 3GXBA 1FDOA 3HRKA 4UHBA 1FDSA 1LDEA 4C6RA 4ZA2A 3AEKB 4ZC1A 1UWLA 2A5DA 4D56A 2VNSA 2EW2A 4S0XA 3VHLB 4P35A 2DY1A 2EW8A 2G25A 4GBJA 4IHAA 2AJDA 4CUZA 4ZJPA 1M10A 1TQ6A 2QV0A 5BVGA 3ACDA 3GEHA 3TTWA 2YCBA 3MUNA 4RGYA 4RNDB 4W6QA 5AT1A 4KO1S 2HSJA 2WYVA 2OXRA 4MR7B 5FF9A 5HKOA 1ESZA 5HVNA 4N8DA 2W6PA 5K6TA 2Z3VA 4OQEA 5EP3A 1Q95A 4RMGA 1N6KA 5BR1A 2ZULA 1QRAA 3NKLA 3TJMA 1P9RA 4BIIA 2EQ5A 1Z12A 4TWZA 3AF5A 4EA9A 3PC4A 5J1TB 5ALMA 3WS7A 4B6EA 1V8FA 3OOEA 4D98A 2YV4A 4GW3A 1IB0A 1MRZA 3EYWA 1AKWA 1JI0A 1H3FA 1ODTC 4D8VA 1RWPA 4EPXA 3KSMA 2FZLA 3ZEAA 2MSKA 4J1SA 4U7HA 1FEZA 1IL0A 1PDVA 3WB2A 4FZ3A 3CIOA 4WLFA 1EUCA 2PMFA 3JQBA 4J0FA 2CVQA 2C29D 5DCLA 1TEVA 2GYVA 2OVBA 2BHTA 4DV0B 1FYFA 2Q4RA 3WL3A 2C1EA 4X7RA 2H1LA 1GUYA 3UAGA 4GNRA 1OWMA 2ZYHA 3F74A 1AQNA 3T5GA 4DQ0A 1EM6A 2Q9CA 1IBMB 3EUWA 1I0IA 1PDOA 1SR8A 2XDWA 5A06A 3DQPA 2Q3MA 3MAJA 2B4TO 3C3BA 2AJCA 2WUGA 4D26A 2V4MA 1T0BA 1DAKA 3AJDA 3SIRA 2X5OA 1WP9A 1NV8A 3MG9A 4Q3BA 5BUZA 5LWQA 2WTMA 4KR7A 2OV4A 1NVGA 4YREA 3TFQA 5BV7A 3ACBA 2FHPA 3ZXYA 1MXHA 2C31A 3KQNA 2JFZA 1ISRA 4GFDA 1W5TA 3FOEC 1FNNA 2C3PA 1RKQA 4QTYA 1H5QA 1EDZA 1XHLA 5B3AA 3WGLA 1C4WA 5LDHA 3KFXA 3TLYA 3LD9A 4KV7A 3UG7A 2GNPA 3BRCA 4JYCA 1H69A 2B2NA 3K0AB 3N8HA 1UIMA 4KLCA 2Z2YA 3SC6A 4RF5A 3QY0A 1LSJA 1TUBB 2GAJA 4DPKA 4PFKA 9LDTA 3OCWA 3OJFA 3V6LA 4WTOA 3VHQA 1L7EA 4BMYA 2WG2A 3QE9Y 2L18A 5IJ9B 5JQGF 4DOMA 2XKKA 2FSHA 3GLVA 1IUOA 3DMPA 2HREA 1JAYA 4LCEA 5EN4A 2XXBA 2BGMA 3DLIA 2BCJQ 4FR2A 2FVYA 2JCXA 1W9MA 4MQMA 1T4MA 4AP9A 2IPXA 5GQSA 1NFQA 1XA3A 2IYEA 4QPPA 3VNSA 4ZIRB 2JIZA 3GGSA 3SZUA 1APBA 1NDHA 1KEKA 1SOUA 1KP9A 1V8DA 3AV0B 3ZE0B 2HM7A 4TTVA 1AHIA 5AOCA 2JCSA 1C3OA 1SVUA 3SXPA 3WLRA 2K4MA 2VCHA 1BW9A 1V9CA 3E0QA 1PRYA 5JROA 2BFDA 1UDBA 1ID8A 3MTBA 4BLSA 4BNYA 1E1MA 2V5AA 2WDZA 3ZYZA 2GS9A 2R7NA 3EQ6A 4GQBA 4TYNA 3GRAA 5JANA 3ILSA 3W9BA 3H5LA 1IN1A 2OE2A 1PTJA 2EFEB 1C0IA 4E08A 3RIHA 3AUXA 3U39A 5AYVA 2F67A 4EDFA 4A1OA 3K7EA 3L8DA 3LZDA 5C8XA 1TYAE 4CIYA 1E5XA 3GIDA 3ZD9A 2P0AA 2ZSDA 4DR5B 3DL7A 3HVKA 4FGJA 1WOMA 1TDJA 1GYRA 1IJBA 1YI8A 3VGPA 4A6EA 4DMFA 1P7ZA 1LUAA 1YUNA 1RE1A 2WHYA 1BMQA 3QVGB 4OV6B 3V4OA 3KT6A 1HX7A 4AJ1A 5K0ZA 1TEHA 3NM4A 3DDZX 3MJHA 2K2QB 5U4XA 2GZ3A 4G8JA 4ANFA 1MGPA 1B6SA 2Z9CA 4OYRA 4QIHA 4MP3A 4ZCPA 3OIUA 1IJKA 2ZYGA 1L1FA 4D9NA 3AEUA 1DOHA 4Y9DA 4BVBA 3TZCA 4C1BA 1UJBA 2G9NA 2A4MA 1SOWA 1J20A 3WNZA 4DLZA 2VNKA 3LLMA 5DGIA 3WL8A 3PE6A 1O4WA 5JZ9A 1VHTA 2VJAA 1M6NA 4LE2A 4YRDA 3B51X 5LQDA 1A9SA 4F21A 1VP3A 2ZM5A 4I1YA 4S1WA 2VBFA 1VIAA 1GTRA 3UAOA 4NJEB 4A0RA 3U4MA 1U2GA 1P1FA 1YL5A 3D43A 2QRGA 4Q3DA 4DMMA 4HX2A 1RQGA 3W3ZB 2X9VA 4YAUA 4TL8A 3D3NA 3K6RA 5KCZA 3A6JA 1RAAA 2QTCA 2AWOA 4NQRA 1UZNA 4U2CA 3UHFA 1CIVA 2J7PD 1QG4A 3OIDA 5HUQA 4ZAXA 2FLVA 4LFAB 2ODWA 2ZYSA 4CMBA 5EINA 2P8SA 3NUGA 5CDYA 1MHPA 1UK9A 1U9ZA 2ZRIA 5EZYF 1LGYA 2EYQA 3D2BA 3U3MA 4BUCA 5IJWA 2C7VA 2MJLA 1D1PA 2ZS7A 3NG1A 4G41A 3ZJUA 1TQ2A 3VYWA 4GWGA 1UQUA 1F6BA 2ZJAA 2NZUG 3KDAA 2JIQA 4NYIR 3V8MA 4YT8A 3GLKA 2HRDA 5ALDA 1CNEA 1PR2A 4FYPA 5KYYB 3E7XA 4Q9JA 4BQEA 2Y05A 2VYFA 5F3RA 2RI0A 3IEUA 4GVPA 3W90A 4BN5A 4PO8A 1KZHA 4Y0VA 1CEXA 2O3RA 3B1WA 3P9YA 1J24A 2NT3A 3UGKA 1BWPA 1F5NA 4MR9A 1OU0A 5C8DA 3AINA 5E6SA 3SLGA 2WWFA 1XRLA 2HRRA 2ZIXA 1MH1A 2C3UA 3GG9A 4J0IA 4RDCA 3AI2A 3ETLA 4LUCA 4P33A 4U2EA 3NDIA 5AP9A 4CFSA 1P0CA 4LX0A 1KTIA 2YQZA 3P9CA 3MWYW 1XLUA 3A3YA 4EGQA 2Q5EA 4OK6A 4NQZA 1XNJA 1CJMA 3HJUA 3OKCA 2XGOA 2YYYA 5KVSA 3H2SA 4H0FA 1K0FA 1M1NB 2J3IA 1KF0A 3GBSA 1TVCA 3HVHA 4KE6A 4C0BA 2VT3A 5CVEA 2FF5A 4FTWA 2E5WA 3L92A 1UC8A 4OHBA 2X8WA 3MZ0A 4NZMA 5H83A 3FNEA 3I04M 3W2TA 1Z0SA 1P2VA 2QSJA 2W0SA 2UZ3A 2YZ7A 3I3OA 3A31A 4CV1A 2OCAA 4ZEOA 3O3NB 1UM9B 3INGA 1DIRA 1HA3A 1E2NA 4H7DA 4C4AA 3VYRB 1KWGA 2X2EA 3HBNA 4X84A 4J0HA 2POCA 3JRXA 2AG1A 1EX6A 2WNSA 2XYPA 2VUTA 3CURA 3FPCA 2YWDA 3JQ6A 3TMAA 1E77A 2ENWA 3H9EO 4FYWA 4WXEA 1F7UA 4QD3A 3SYRA 4M36A 5SY4A 3A6FA 2WMDA 4PY2A 1UKBA 4YWHA 1PV1A 1TL7C 2J0VA 3N6VA 3X1JA 2P9QA 1X80A 4OXQA 3QWBA 3WRWA 3CTMA 2I29A 5HRUA 1M74A 3V8BA 4H2DA 1TVMA 2EF1A 1NJ6A 5DTMA 4ZV4A 5K8CA 1E0SA 1J0BA 4ZO7A 3TOSA 2JFUA 4RJIA 3G0HA 1N2XA 1JG7A 2O2ZA 3EIXA 5JV5A 5K3CA 4ZTUB 4RD1A 1A9XA 1D7OA 1FX0B 2G5CA 2I5PO 4L16A 4P7BA 3KVOA 3OCJA 3CX6A 3IPAA 1R1DA 5ECDA 1EB8A 2ODAA 2V7XA 3A6HA 4CFYA 5JFOA 2VI5A 1QF9A 2OCYC 2OBMA 2AXNA 4OH7A 1SY7A 2PQ6A 5C18A 1CUGA 4NBTA 3P94A 3VSEA 1TA0A 2WZDA 1M2EA 1S3SA 2QGFA 4LWQA 4R40A 1I5OA 1UXOA 1H9CA 4ZP1A 4KQHA 3IUBA 2QG4A 2HPHA 4PZLA 2ZTHA 4W8GA 1E3SA 2OGWA 1FFWA 3OP4A 4PC3A 3ICOA 3SHTA 1WDTA 1X8KA 1JQEA 1R16A 2DR0A 1HYBA 2WWGA 1C0EA 2B5VA 4HMQA 4LOLA 2A84A 4FGSA 5IM4A 3PRYA 3ABQB 1G1MA 3NWOA 4KIUA 3E9RA 4M9UA 2FPUA 3PUVA 1V5EA 3MTQA 1IVSA 3DT8A 3JSXA 2NYRA 1TJYA 1VI6A 2AN9A 1PFYA 2DYKA 4XX0B 5FR1A 3S27A 2VVTA 2PRSA 3EOBI 3PZBA 1XVIA 3ABZA 1JSRA 3EC1A 2R6R1 1KEEB 5LCXA 3SBEA 4AYTA 3ZBUA 1EFCA 2VCEA 5KYXB 4JJ6A 4YS6A 2HWKA 3U4GA 3IIIA 2AFVA 3LVFO 4FT4A 2IIBA 4DDHA 2HPAA 3P1JA 3R3YA 4MP6A 4WT7A 3F6SA 4EW3A 1YOVA 4JENA 4KV9A 3W5AA 3S6JA 1CFJA 1QIEA 2BCGY 2X4DA 3EDCA 3KYCA 3TR6A 5B1EA 2YR0A 3LDHA 1E1DA 3RUFA 4YDSA 2CYCA 2I67A 2AEFA 5DHRA 4LG1A 1YULA 4G8DA 2JVIA 4RH0A 5I7SA 4YJ3F 4X61A 4NXNB 1EVIA 3PUIA 1XNHA 1RT9A 5JCXA 3I6YA 1WXIA 3P9ZA 3AU8A 4LHXA 3AHJA 4BGIA 1NPDA 4ZAZA 1C29B 1UKVY 4E0BA 4E2XA 1FDIA 1T9HA 3KP1A 3SIPA 3U7FB 1QYXA 2QI9F 4YH1A 2ZXEA 4ZCLA 2D5IA 1R0CA 4W5RA 1U2DA 3G9QA 1P4GA 4MPPA 4XR9A 3ROPA 1XP8A 1V45E 1RVV1 2JGAA 1DINA 5CLHA 4DYHA 1PFWA 4NZZA 1AXEA 1MC5A 2C9DA 1XTKA 2HCTA 1QC5B 2NTVA 2WIKA 2WSIA 2Y1CA 3KLBA 3LFTA 4DLYA 4EW2A 4TM8A 3ZIDA 5JXJA 4YK7A 4G4GA 2IHUA 2WFZA 1S9DA 2ET6A 3JW8A 4JSTA 4ZV9A 5IU6A 5D6OA 2FPMA 4WVLA 4BV3A 4P22A 1VOTA 2JHGA 1V3UA 3ASZA 3U4AA 4DSZA 1OWLA 2O4UX 5CEJA 1IQUA 1GKKA 4MWTA 2O2IA 2CE2X 3B6JA 2H0RA 4M53A 4BZPA 1YHYA 4LRYA 1RHUA 4MLZA 4Y1RB 1AT1A 4CLOA 2N9UA 3OM0A 5CT4A 5A7FA 3GWGA 1N6RA 4CQLB 5AKGA 1JJ7A 1KIFA 3FDFA 5FPQA 1OWOA 1SOMA 2H5LA 4MK4A 4XPIB 4N47A 3FF4A 5H0IA 3P52A 2HIMA 3BCHA 4UDYX 1R00A 3QVXA 7ADHA 3LKBA 1R64A 1RPTA 1C1DA 4HGPA 2PUBA 1PK9A 1NQVA 2K5UA 3KZ1E 3ZQ6A 3K8QA 2WU3A 4KU4A 4LECA 1N1DA 2IDMA 3I5UA 4YN3A 4EGSA 4ESEA 4F4UA 1YFJA 4LOIA 3F1LA 3PV0A 4FR5A 3PQ7A 5BWNA 3TX6A 5C8ZA 3GJ5A 1NAHA 1RXUA 1GFSA 3IGFA 3NTOA 1OAKA 1M8JA 1SH7A 2WKWA 2YICA 2X8LA 1Z2AA 4YAKA 4EF6A 5U1PA 3ANLA 1U4NA 4OP3A 2ZR8A 1F8UA 2F59A 1QTRA 1SO8A 2OENG 3DLPX 3OZSA 4XD2A 4YP7A 2CW5A 1HFJA 1ZLYA 4LBVA 4C7MA 1B16A 5J5AA 1N78A 1PHPA 3ZVRA 4DR6B 3PYMA 1JHYA 4C4SA 1ZISA 4X63A 2C57A 4XSGA 2FG5A 4XYLA 2R1VA 3AKCA 3DW1X 1ECFA 2I6XA 3HL0A 5BMVA 1NMQA 2JGJA 3TOCA 1PFGA 1QJCA 4Y6SA 5AM0A 1YB4A 3G59A 1F6DA 4AUMA 1VYVA 4QTUB 1MXFA 3QFSA 2Y76A 3L9WA 1NRXA 3Q3EA 5F7OA 2PZBA 1D2HA 1U9YA 3HRIA 5JD5A 2VAXA 3AHHA 4W5TA 2JI6A 1Z5PA 5B2FA 2Q1XA 1JT2A 1MKYA 3M2TA 2W2OA 4OHYA 2JGFA 3H7AA 1UBLS 2NTEA 2ZYTX 1MJFA 1T6YA 2CVHA 2XCUA 4FILA 4QUDA 1V6SA 5DCWA 1NXWA 1BHQ1 2FEKA 4AT1A 4N6NA 1JIIA 4IJUA 3KPYA 2XGGA 1L7QA 4YEDA 5DTJA 4PPGA 1Z2PX 1YZYA 4HMOA 3OY2A 3DZHA 1A5AB 2OL4A 2OO5C 1E2LA 3W6UA 4Y2QA 2ANBA 2ERXA 3MOSA 4KPUB 1HTTA 5ABPA 2XKBA 5BNWA 3P9RA 2FEWB 1H8EA 1AN0A 3EEBA 3M83A 3C6QA 4Z4IA 2WM9B 4CG2A 5AQ1A 3E7WA 3O93A 3UQYS 4RL4A 3IMCA 3M82A 1T9GS 3ZH9B 3QBDA 1ISGA 2B8TA 1L6RA 2A9JA 1ZL0A 2I6GA 2QTBA 2Z5FA 1PNQA 5GJBA 2FW9A 4ZOLF 5CB4B 3I1JA 1O0BA 3EGXA 4O63O 2IDJA 2XWBF 3L0PA 3ZWKA 3HE3A 4RYLA 5HZGA 4A0GA 3OEYA 1J21A 1A1SA 2CFTA 2XDYA 3LCCA 4B4VA 3QUCA 2OT3B 2IVZA 4Z4EA 3ZHOA 2DULA 5EWMB 2G72A 1FRVA 1I4WA 3OX4A 3CBGA 4JAVC 4U6SA 3CF4A 5DHFA 3IESA 4C0WA 1LWOA 2PIAA 5C7YA 1GAXA 1DAOA 3L7AA 2A7XA 1MO4A 5DLEA 1V7PC 3AKEA 4NMMA 3EWIA 4BV8A 3LTEA 4L4UA 1GG2A 3DWEX 4H17A 3NH9A 1ECLA 2IHYA 2X4LA 3MJEA 3O92A 1PS8A 4MV9A 4WZAE 2Y2UA 1V2GA 2AFHA 5FEUA 5DX0A 1XVVA 1JH9A 4A26A 4JLMA 1UPUA 4NG4A 1TM1E 3OD1A 3R5FA 4URUR 3DKVA 3KO8A 3OQHA 4UVEA 2YRWA 2B94A 3PPYA 2CFIA 2WSLA 3OKFA 4LMAA 2QUAA 2QTAA 2EBUA 3CRNA 4HNAB 2HRCA 2XUDA 2DKNA 1VIYA 3DPIA 4YA6A 4ZZIA 3C6XA 2ZJ2A 4LXHA 3NHWA 2XECA 2I76A 3N0WA 2CNDA 3GOHA 3GRYA 1COWA 1DG9A 2A88A 4R69A 5B1SA 4DG5A 1PJSA 4GZ3A 1DLJA 1OI7A 3ZWYA 1WNTA 2PIDA 4FP9A 4QJBA 1WQ4A 3UN1A 4ER3A 1QDLB 4EEKA 5JAOA 3EW7A 4ERNA 1ZUIA 4UUNA 1EE9A 4EY3A 1GTJ1 4LYAA 2YBEA 1C9MA 5A6SB 5TGTA 3GDWA 5TC4A 4D6PA 4P2BA 5FIUA 3O8DA 3BCSA 5BSWA 5IF3A 5FT9A 3HUUA 1C7JA 3MBOA 4G0QA 4LK2A 4X1KA 3B6IA 3LGXA 1N9KA 3ZY3A 2VQEB 3RARA 4F6RB 3A37A 1FSFA 1TCAA 4RC9A 4XB2A 3CS3A 4H1HA 4X1YB 5HIAA 4LC9A 3AVVA 2GMWA 4BGVA 1ZFNA 1RBMA 2PS0A 3GRZA 4GM0A 4RQBA 5KTTA 5LQRA 1HQYE 1O3YA 2PAFA 1WXDA 2RGBA 3I6IA 3PX2A 4KBGA 4HB2A 3QELB 5JVDB 3SHWA 5IN5A 3T3MB 3SFZA 1JWLA 4PQYA 2YQ5A 3LYUA 2FPLA 4DIKA 2R5NA 4A10A 2R44A 5PNTA 1XKXA 2ZZKA 4GNKA 1RFLA 2D2XA 2TS1A 2IDZA 2FMUA 4WNIA 1Z9BA 1HE2A 3CN7A 1T1JA 3RASA 1FDWA 4DIEA 5IZCA 4F45A 3LFUA 3TQQA 3HEAA 5C81A 4DYVA 3SE0A 1Y9JA 2QMYA 3L8FA 1IBCA 3VJMA 3EZ2A 2F55A 5J59A 2VZ8A 4JMPA 2I2AA 5KX5B 1F17A 4D45A 4DJDC 1QVAA 1FDUA 4QUIA 3EXHC 4RD4A 3RFUA 4CL2A 1WSDA 1CVRA 1UT6A 1Z35A 2PK3A 2XQKA 4N76A 1DBPA 1DKRA 3HCWA 4ID9A 4ZQBA 4E5DA 4ZKEA 4MVJF 1B0PA 1NYTA 1GSAA 2B25A 2H06A 3BMQA 2P9HA 4QREA 5BQPA 3W8DA 2O1WA 2HY7A 2W2LA 4XZ3A 3P5SA 3MHTA 4JROA 3AR8A 3EXG2 1DRUA 3ETCA 3KVRA 4JOBA 3R6GA 3RSFA 4RV5A 5EFOA 5ECYA 4DDTA 1J06A 5HUHA 2FUNB 2C2XA 3JR3A 4JU9A 4QQKA 3NYIA 1Z3CA 5B58T 3N0TA 3WHPA 1ORHA 1U28C 5FPYA 3C7DB 1FLDA 3OPYB 1FX0A 4WN9B 2WYOA 5AW6A 2GVNA 4BU0A 3GEDA 2L82A 1XPRA 3U9TA 2J6CA 1Z7YA 3DAPA 4NY1A 4JI5B 4B5LA 2MMGA 3WBFA 1B8OA 4OUDB 3OJOA 4RVGA 1Z39A 4RYDA 3ZGZA 2B37A 1B3BA 1EU1A 1Q1QA 5CIYA 1ABFA 3TNFA 3TUJC 4JQCA 3FYCA 4AWAA 1WXWA 1XG5A 2DC1A 2PLNA 2C3OA 3TQOA 2EKQA 3D0QA 1PYGA 1IY0A 4RGQA 4NOJA 4HLUA 4YRLA 5LSAA 2OSVA 1I33A 4AROA 3H0KA 2ODNA 3WX0A 2OORA 3DAHA 5JRJA 4M0MA 2F3RA 4PM4A 4KI7A 1KH3A 4RHUA 3PNBA 3OCCA 4LDPA 4Z7OB 3VU8A 2JATA 2JJQA 3QVVA 1NGSA 2MU1A 2ZYDA 3OQNA 4YV1A 3GJ7A 3C70A 4CT4B 1DEKA 5C9ZA 2NLOA 5JY1A 3PFIA 3QVTA 3N2LA 4D82A 1GU7A 1YRQA 4WLNA 1T9AA 3QPAA 1QU2A 4D9FA 1K9SA 3GN2A 3VYUB 4HGNA 2FOLA 1TC1A 2JFOA 2IZ1A 1WB5A 1HEIA 2Z3WA 3NBUA 3QTTA 2IU6A 4JR0A 4LYDA 3TLGB 4YUAA 4GGMX 2X41A 3JQDA 1QBKC 2HRBA 1WY5A 1ZD1A 4BRSA 1W94A 1BHO1 4ZHQA 3LF1A 5KNLA 2LIPA 4H7FA 2GN2A 4EYEA 3IV6A 2HV9A 3DEFA 1D7AA 4HQRA 4WDRA 1L4HA 3NV9A 5DH9A 5EIXA 4FKBA 2PGJA 3WK8A 5JNLA 3Q6MA 2WUWE 4Q7JB 3IJ5A 4FFWA 4CKEB 2M6RA 4N5DA 3HYNA 4BLQA 5DNYB 1N6OA 3SKYA 1DQRA 1WWKA 1ZD9A 3NIFB 1TC2A 4KE9A 3VI3B 2CMHA 5T8KC 3QVMA 4J1NA 1MNAA 2BOVA 2E37A 3ESYA 3C5WP 1U6KA 1U6IA 2FPKA 1JQJC 4GSYA 4ZAFA 1D6MA 4ZI7A 1I51A 4CMAA 4AAYA 4C29A 4EA7A 2WYUA 1FP1D 5FL7D 4K8RB 3FZYA 3NT5A 1I2MA 2WKPA 3OOHA 2DTDA 2P4UA 4MVJP 5F2KA 2WJ3A 1YCHA 4I55F 4JI3B 3RRBA 2Q2WA 2DGDA 3JVVA 4Z6KA 3O73A 1LDMA 4V39A 3EJWA 1WZEA 2B4QA 4JJGA 4TLLB 1KGDA 5ENZA 3Q7IA 4D8UA 1E2QA 1Z0AA 4HVTA 3ICEA 4PR3A 1HMYA 4KO8A 1IONA 2J0UB 4R2WA 3WYDA 1RXVA 1FU4A 3QQ5A 5JCOA 3F8TA 2PJDA 3R77A 5HF8A 3T5DA 4CLOB 1NA5A 1N8TA 1ZH2A 2CBZA 3ED5A 4HAUA 1M2VB 1PG0A 3F5MA 4EB0A 2FWBA 2I7XA 4E4RA 1B00A 4EI7A 5FTLA 3EPJA 1EEHA 3USZA 1XTPA 4XPIA 4H6PA 4KQ2A 2Y4OA 1UJ5A 1HE5A 1K4MA 1ZKDA 4OIMA 5FL7A 2WQZA 3VHRA 2E5LB 1MPTA 3ELWA 4RF2A 1BN7A 1NVXQ 1VG1A 4LY9A 3X2EA 5EVJA 5LMZA 1JG6A 4AMUA 4G5RA 1OU4A 2QQGA 2CLMB 2XJ4A 3BH6A 1X92A 3DE4X 2LCQA 1FP6A 3U1TA 1GQQA 1JQ3A 4TTIA 4Z0PA 3ER8A 4J4HA 3U4DA 1GRRA 1DTWA 2I22A 2PH5A 3BJIC 4R4JA 4TSFA 5L3RA 3H2YA 2XYRA 3ZHRA 1P9LA 2CUZA 2V7WA 3G89A 4XIIA 3SLRA 1X7DA 2IVFA 1ML3A 2ZCVA 4XX0A 5IDWA 5FTJA 2OP0A 4CTOA 3MS7A 2D1TA 1LK5A 5AOBA 1XHEA 2X9NA 3WNCA 1MN6A 3HFGA 4R9UC 2FWMX 5FA5A 2IV3A 5TIIA 1VG0B 3UAXA 1AGYA 1YK1A 2FTKE 1W4AA 2EJUA 4O1IA 4TSRA 3BH0A 5GGXA 3RYFA 1LW7A 3RWOA 3OZ7A 5EYPA 4ARBA 3GNLA 3QFFA 1YOVB 5JD6A 2NO1A 4MIOA 4ZT6A 5BN4B 1B2RA 4FZVA 3TD9A 4QUBA 3NC1C 2FI1A 4EG8A 2NV0A 3N3AC 5IEJA 4PGAA 5E4FA 1EWRA 3OF3A 5G02A 3ECSA 3I09A 2QPOA 1WDLA 3FLAA 4MWZA 4BZWA 4LHEA 1TA9A 4EG1A 3LOUA 1FFBA 4CR7A 4QJ3A 1OXKB 2RK6A 1KGSA 1EXVA 4GKBA 1QS0B 3BJEA 4JVLA 1PW7A 2ES4A 3QA3E 4M9ZA 3TAXA 3QYPA 4CW7A 4AY5A 1OH7A 4TRNA 3TBHA 4N0QA 3FPGA 3TNYA 2DLNA 4L3VA 1M2HA 2YWBA 3HEBA 1M7GA 1GPKA 5DI9A 3ZDQA 1R0KA 3LDUA 5G40A 1JIVA 1J0DA 3SF8B 2YZ2A 4F46A 4YRZA 5IH7A 4OSEA 1GLGA 3AG6A 1XDDA 3C1AA 3SNKA 1T34A 3VOBA 2FZEA 1EJ0A 1RI3A 2ZI6A 1RJWA 5LZ8A 4ZTZB 1KU6A 1KBZA 1M54A 1EDDA 1SIBE 3S2IA 2ZIGA 1ZVKA 5CNMA 1KHTA 3I5AA 3KB2A 3QLUC 1HC7A 1LVUA 1W36C 1PG2A 3NIBA 1G8MA 4OYYA 2VJBA 4QTZA 1AKTA 3R40A 4FLFA 3HBMA 4ZO6A 3OZGA 2P40A 3ROMA 4D5EA 2BYTA 2CXTA 1V39A 1T5OA 1Z33A 1ZH0A 3RDPA 3EIHA 1FFEA 3MJCA 5C5DA 5ENVA 3IMEA 3OC6A 3VVBA 5SY6A 4F38A 5CB4A 3AF1A 4JHXA 4QJ5A 3RYCB 1QP4A 1C4OA 2OZEA 3MJSA 5DLDA 4B8ZA 3QM1A 4Q1FA 3V5NA 3W9SA 2FUG6 4PSCA 3W8NA 3DXYA 2KQUA 1BMTA 3FBGA 1DQZA 5GTDA 3KQUA 2MDTA 3I2YX 3PB3A 2JGEA 4R83A 1II9A 5KIAA 1KEPA 4F3TA 1QQ6A 2QA5A 5HDQA 2QR5A 4XWWA 4URVR 4HYYA 1GNPA 1N2SA 2COUA 2IY9A 2XDQB 3UOGA 2IPAB 4D0NA 2IEZA 5K0FA 1NI4B 4OXKA