3OIFA

Crystal structure of enoyl-acp reductases i (fabi) from b. subtilis (complex with nad and tcl)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
258
structure length
258
Chain Sequence
MNFSLEGRNIVVMGVANKRSIAWGIARSLHEAGARLIFTYAGERLEKSVHELAGTLDRNDSIILPCDVTNDAEIETCFASIKEQVGVIHGIAHCIAFANKEELVGEYLNTNRDGFLLAHNISSYSLTAVVKAARPMMTEGGSIVTLTYLGGELVMPNYNVMGVAKASLDASVKYLAADLGKENIRVNSISAGPIRTLSAKGISDFNSILKDIEERAPLRRTTTPEEVGDTAAFLFSDMSRGITGENLHVDSGFHITAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Crystal Structures of Enoyl-ACP Reductases I (FabI) and III (FabL) from B. subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 89
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2010-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3oifA00
1LRJA 3WIEA 4Z9FA 5IF3A 4H3VA 4PG6A 2O2SA 3UHAA 1G0OA 3WGHA 1KVTA 3ZU4A 1R15A 3OM9A 5L9AA 1CQJA 1HTBA 4XGKA 4GWKA 4KWIA 2BGMA 3KBOA 2IE0A 2P68A 3BIOA 3H8VA 3WQRA 3OIGA 3HWRA 4A27A 1E7YA 3AW9A 4TSKA 4ZGWA 1GV0A 4NK4A 5KTKA 3VOSA 4CV2A 1Y81A 4O63O 1LDMA 1TT5A 4JCOA 1MX3A 1BVRA 4D0SA 3DL2A 3WLFA 3E5RA 2BHLA 1KERA 4E12A 2O3QA 5JXWA 4J1TA 3U3XA 2XXJA 3M1LA 3NUGA 3NTQA 4JJIA 4DA9A 1PTJA 4D45A 1K3TA 3Q2IA 1CETA 5DDIP 4LCJA 2Y1FA 1LQTA 2C7VA 2AEFA 4CQMA 2C54A 1XU7A 3DBHB 4Y9DA 4N5NA 4OQYA 5F1PA 3RUAA 1LSUA 4NHEA 1KIFA 4WLVA 5DULA 1KEUA 3LT1A 4MPDA 1U4OA 1Z7BA 5IDYA 2BFMA 3MWDB 2VUTA 3GEMA 3PDJA 1UXIA 5COAA 2EV9A 1ZBQA 2ZYDA 3QVTA 1KY5A 2A94A 3D64A 1PJ3A 2QHXA 1PX0A 1H0KA 4JJGA 1QMGA 3PJDA 4IDBA 2E4AA 3PJGA 4W99A 1QYCA 3KM0A 3RUDA 2Z5LA 1KC3A 4M89A 2YHIB 4CM9D 4MVJF 4WK6A 2B4RO 4NDNE 1ZEJA 3JQFA 3IKVA 1SO8A 3O9ZA 1V8BA 4CM7A 4HX5A 1N9GA 3TZHA 4YXFA 3U4DA 1DFGA 2NTNA 2IXAA 3MOGA 4UVEA 2EXXA 2NVUB 3V5NA 1U3VA 3UVEA 1IL0A 3FWNA 4WUVA 3U4CA 4XYMA 4D7AA 1GUYA 4HNGA 4M54A 4IXTA 3E9QA 1E7SA 2PD6A 4ZQBA 3FNHA 4ITUA 4DBZA 5T8KA 3TZQA 4MVJP 3GMSA 1N7HA 3KYCB 1GPDG 5KKAA 4YQYA 2EERA 4YA6A 5U4QA 3AWDA 1XCBA 4J90A 4N54A 1E6UA 2FHSA 3IKTA 5BT9A 1BDMA 1EFLA 2FN7A 3QJ5A 1U3TA 4IMRA 3WGOA 1XIVA 5G0TA 2X9NA 4IIVA 3WMXA 4J0EA 2W2KB 3F4LA 1HSOA 1H93A 4YRDA 2GZ3A 1LQUA 4JP2A 3GG2A 1A7KA 5IAAA 3F9IA 2IRWA 3JD3A 3RC2A 1QXSA 3FTPA 4LN1A 1XDWA 2QX7A 2DLDA 4UUNA 2I3AA 2A92A 4GQAA 4J7UA 4TMFA 2OP1A 3TN7A 3GF4A 3V1TC 3JYLA 1P1FA 3MJTA 3FPLA 3ZWMA 2HRBA 4BO1A 3I6IA 5JAZA 3HFSA 4AJEA 5F21A 2OBYA 1EQ2A 4DC1A 2XXBA 6LDHA 4FN4A 5A5EA 2R00C 5HWSA 2CVQA 3PYXA 3JQCA 1SEVA 2C82A 2IZ0A 5EQFA 1WW8A 1JAXA 1NR7A 4M87A 5AXAA 5A9RA 2PZJA 3RUFA 2ZQZA 4EYEA 1PL7A 3UF0A 5JNLA 1DOHA 1QLJA 4OYRA 4NK5A 2ZYAA 1C1XB 1ONNA 4XCVA 3B1FA 2Y1DA 3KLPX 1U1IA 4HP8A 5JPIA 1B8VA 2DBVO 4EJ6A 1OFGA 1PIWA 1PJLA 2W4QA 1Y5MA 1FDWA 5G2OA 2JFHA 4O6VA 3ETEA 4JN6B 4CL3A 8LDHA 1ADCA 3PP8A 4XEHA 4A73A 4E5KA 4R9RA 5JSFA 1E77A 3QVWA 4PLWA 5L53A 2YHIA 3WWYA 3K9QO 4W7HA 2X0NA 1YB1A 4YTEA 2BMAA 2HK7A 4RF5A 4YT8A 4DTIA 3C3XA 4B4WA 4L0QA 2J5RA 2O3SA 3KVOA 2D1YA 2NWQA 2ZJ0A 4GX2A 1LDYA 1ONOA 1CDOA 2NVUA 1UZNA 4IS3A 4MKRA 3BTVA 4ZVVA 1Z45A 1AHIA 4RVSA 2PGLA 3CE6A 4J1SA 4B7CA 4OXNA 2PZMA 3GUYA 2JHFA 3KYCA 1Q1NA 4RO0A 4IJVA 3V1UA 3TDKA 2R2GA 1LLDA 2VYVD 3AFMA 5TRTA 1WNTA 4A26A 1DLIA 4B7UA 4J9VA 1FDTA 3A9WA 1H6BA 4YJDA 1BG6A 2RCYA 3NDRA 3AJRA 3AUTA 2W2KA 1X15A 4KMSA 3JQ6A 2RAFA 2ZQYA 3F5QA 4WOKA 4S1VA 5HRUA 2I3GA 1DXYA 3JQEA 3FR8A 4YEDA 3SLKA 2VRCA 3ZWAA 4GL4A 1WVGA 1K6JA 1GYPA 4YT5A 4XRRA 1ADGA 1B3BA 2EG9A 4DGSA 3OEYA 3FNGA 3G79A 4U0KA 2GRAA 1XQ1A 3HNPA 1AE1A 1LDNA 2C20A 2C2YA 1JDJA 3DC2A 4FR5A 2FSSA 4RZHA 3WTCA 4CMHA 1ISMA 3ZCXA 4O5OA 3SEFA 4BNUA 1XQ6A 3VHRA 3ZW8A 1NHGA 3GG9A 5DP2A 5IXSA 3ZU2A 3RFTA 2NLOA 2ZTUA 1Z7EA 4EI2A 3H9QA 4QFCA 5IN4A 4IDDA 5DBIA 4F46A 5GMOA 1PZGA 5CEJA 3OP4A 1JTVA 1KC1A 3S8MA 3WBBA 4J1NA 1PJBA 2NQ8A 1E3SA 5BNTA 1DLJA 4L4SA 3ITDA 1XELA 3DOJA 4E2WA 1GQ2A 3GPDG 1VE9A 1YKFA 1NYTA 2VRBA 1O89A 1EVZA 1C1XA 3RJ5A 5KJ6A 1IPEA 2I67A 1EE9A 1PJCA 1OAAA 4YAKA 4O1MA 4PVCA 3NV9A 4AJPA 1DBVO 4CMEA 2JAPA 2VHWA 3FI9A 5T6BA 5KNLA 1R4MB 4D79A 1D8AA 1P0FA 5KJ1A 4YRBA 5DN9A 5A02A 1FDVA 5K6AA 1WDLA 4WLNA 3ROMA 1T4BA 3U49A 3GDOA 1ZK2A 4XGIA 2UAGA 1AXGA 2V6MA 3ZZNA 1SOWA 1DAOA 1GQYA 1WZEA 5HBRA 4GLLA 3ZH2A 5MDHA 4GSKA 2VTEA 3LSYA 4JLWA 3Q1LA 4OQZA 3AM3A 3F1KA 3I1JA 1OBFO 1SNYA 1N92A 2X5JO 3OQBA 1DB3A 2AE1A 4QX6A 2WYWA 3Q11A 1IYZA 1M75A 1YGYA 1HYEA 3VTZA 2DTEA 3ZV5A 3PQDA 4NBRA 5FF9A 2FZEA 1BXKA 3U0BA 4B3IA 3DFUA 3KYBA 2J8ZA 2OP0A 1FXSA 2FZWA 2YV1A 5C7LO 3KSUA 1P1IA 4I9HA 4RQUA 2ZTMA 5I9LA 4CM6A 3T7CA 1IHYA 4NNJA 2ZYGA 1LSJA 2CDCA 5T67A 4EW6A 1LXCA 2X0JA 3V2GA 3WWZA 5I9NA 3DBRA 4NFHA 1PS0A 1RYEA 2OUIA 2PD4A 1MC4A 3B70A 4DC0A 1ZUD1 2HMTA 4RPGA 4Z0HO 4A10A 4CPDA 3VH3A 1LDGA 2BF7A 4LSWA 4FSHA 4MINA 3QWAA 3LYLA 4BMVA 4P4NA 4NR0A 4IJKA 1TI7A 2DUUA 2RHRA 3S2IA 4DMLA 4CM3A 4FW8A 4W4TA 3WJ7A 1K5HA 4HADA 3NTRA 1EUDA 5A1TA 2GD1O 1PL8A 4LVCA 4CV0A 4YQZA 1LJ8A 2Q99A 2AQKA 4OO3A 2AE2A 1DHRA 4PG8A 5TJHA 3AY7A 4BB6A 3GT0A 3INGA 3GVXA 4BGEA 1QORA 1J6UA 3JQ9C 3NT5A 1PS8A 3W8DA 4Z0TA 4DLAA 2E82A 3LC1O 2Y0EA 4U6SA 2O7QA 1D1TA 3OJOA 4QEDA 4BS9A 2RBEA 3DQPA 5K9ZA 1HDGO 1O8CA 1Y8QA 3ZGYA 2BLLA 3N74A 4N5LA 1C0IA 4YT4A 4C7JA 1MXFA 4L73A 1D1SA 1P44A 2Z1MA 4ZICA 5A03A 5L7TA 5B12A 4NBTA 1EVIA 1NVTA 3E9NA 3K92A 2WTBA 3H2ZA 4RLSA 4XYEA 4Y67A 3QE3A 5TNXA 4EJ0A 1DO8A 2UUOA 3O8QB 4LRTB 3RKUA 1MUUA 4WCFC 4R1SA 5FI3A 4L4XA 3C1AA 1NWCA 2P4HX 1LC3A 4WEOA 1XEAA 3GVPA 1Q0HA 4RPLA 3T4XA 4EUFA 2EP5A 1R0KA 1GFSA 2ZCVA 3R0IA 4RV9A 5IZ4A 2FPGA 4QFDA 4WLFA 4AVYA 2XF8A 5AVOA 3VZSA 4TRMA 2JD2A 3OIFA 4DL9A 4I5EA 1MA0A 3RUHA 1PWZA 1VKNA 2YDYA 1QYWA 4YJFB 2VN8A 2Y1OA 3F1LA 1KBZA 4E13A 2WMDA 1VPDA 5A3VA 5KVVA 3VAZA 4II3A 1GCOA 3P2OA 2NUAA 4BGVA 4CLEA 4R5HA 3SC6A 4DPLA 4IPTA 2BFPA 4XYGA 5GZ3A 5L4NA 3D3WB 1ULUA 1M6WA 5ER6A 2F1KA 1E7WA 2WEKA 1K89A 1V0JA 3ICCA 5AXBA 4CM4B 1E92A 2G0TA 1G6KA 4U5QA 4ALJA 1GD1O 3GOHA 2IDZA 2Y0CA 1V3TA 4IGEA 3BTUA 5DCWA 4EZBA 3U4HA 2Q1WA 3INRA 4ZN6A 2W2LD 1Z73A 3NX4A 4DIOA 3H5RA 1JVSA 3I9JA 5BSEA 3SBOA 3CINA 3GK3A 4D46A 4P38A 1EQUA 3OIDA 3G1TA 2A9FA 5AOVA 3PRJA 2OHXA 1ZK3A 4HWKA 1MV8A 3CMCO 1A7AA 2O2YA 2I6TA 5B37A 1LEHA 5TF4A 3MJ4A 3SJUA 3KETA 5KCZA 1IZ0A 2D0IA 1ZXLA 1N1EA 4Q3EA 2FRDA 1IY8A 5COBA 4BV9A 5J23A 3VPGA 3WNVA 1PR3A 4A2CA 1TA4A 3JQGB 2W90A 5T5QA 3V2UA 5TJ9A 2NACA 3LLVA 4JBGA 4CR8A 3JQ8A 4DLLA 3UAGA 4E6PA 4RVDA 3JYPA 1ENYA 3O8QA 4WNIA 4W82A 3WLEA 1ZXBA 3WR5A 4RVFA 1MXHA 3WQQA 3ZV6A 1DC6A 2HJRA 2AW5A 3IJPA 3RASA 3OA2A 3UXYA 5BSFA 2VHVA 4INAA 3GVCA 2NV6A 4IM7A 4N18A 3CH6A 4E0BA 1ONPA 2HMSA 4FDAA 4IINA 4IS2A 1I2ZA 1QR6A 4AJOA 2VYND 2C5EA 1P0CA 4JNKA 4OAQA 2HAEA 2YJZA 4BL5A 5A4DA 2GZ2A 1JWAB 3ZWNA 4U8GA 3M1AA 4CLHA 4EUEA 1GYRA 3A4VA 1VKOA 1WWKA 5DOZA 3RUIA 1U4SA 1T2AA 1BVUA 1MC5A 5T64A 4UEKA 1C0LA 4MVJG 1LA2A 3G1UA 1GTMA 1NFQA 2HSDA 2Y05A 4YAEA 4NBVA 5I8WA 4E33A 2E37A 1C14A 2WDZA 3D3WA 3HDJA 3I3OA 4AJ1A 4ROSA 4B8WA 1UDAA 4CM8B 4AFNA 3RSHA 3PWZA 1I30A 3PI7A 1YJQA 4PLTA 1GV1A 1X7HA 5EMHA 5G4KA 1V35A 4WPGA 5JYEA 1E3EA 3NTOA 1YXMA 5AXCA 4DWVA 3BMNA 4BKQA 4BO6A 4BNXA 4EUHA 5JCXA 2WM3A 2HQ1A 2I76A 4YJGA 1C1DA 2H63A 4TVOA 1H6DA 1TLTA 4NI5A 3G0OA 1PJQA 1SPXA 3GRKA 1SOVA 5U1PA 4A03A 3BHIA 3GR6A 1EEHA 4QO8A 2ZCUA 3PGJA 1ZNQO 1PJSA 1J4AA 2I5PO 5KVCA 4XB2A 5L4LA 2QRLA 1ISHA 1PR9A 1DEHA 2NU9A 3NGXA 1B2LA 3K73O 3D4NA 2O4UX 2H5LA 1NPDA 2JJYA 4Q3BA 4UUMA 4TROA 3UGKA 2Y1CA 4OOEA 1O5IA 4TKMA 5L45A 3TJRA 4XQGA 2A35A 3DEYX 3JQGA 1X1TA 1U5AA 5F3RA 1P33A 4FBGA 3UCEA 1GY8A 3B6ZA 3PHLA 1DC5A 2VT3A 3HFGA 4B7XA 5KJFA 4WLUA 2VHXA 2P9CA 4XQCA 5F1KA 1QP8A 1YBMA 5GZ6A 4C4OA 1T24A 1ENZA 1HF3A 5ENDA 5JCJA 3ENNA 5H83A 4HFNA 4DPMA 5AQ1A 1A9YA 1NQAO 4FGSA 1JA9A 1Z74A 2EHDA 2QRJA 3GZNB 3EC7A 5G0SA 5IZCC 2HMUA 3AFNA 3ZHBA 1I0ZA 4QQRA 3BMOB 2V6BA 4DBVO 3NT2A 3A28A 2QIOA 3GAFA 4BGIA 3GH3A 4MJLA 4RF3A 3DAPA 1A4IA 3FTNA 1TB4A 3EYWA 3L07A 3JTMA 3PIDA 1G0NA 4YJHB 3OEWA 4LGVA 1EBUA 1T2DA 4IQ8A 3DOOA 5DNAA 3WSVA 2Q50A 2P2SA 2NTJA 2ZB8A 1ZZEA 3KB6A 2HMWA 3L4SO 4L76A 4URFA 4A5OA 5CDTA 3PYLA 3R1IA 4GPD1 1JKFA 2Y99A 1I3KA 2I66A 3PIIA 1C0KA 3AM4A 4I9NA 1DIRA 3VH2A 3A1NA 4KDFA 3VTFA 4RPKA 5A5FA 1UP6A 3E5MA 1CJCA 3H3JA 4JQCA 2GYYA 1WMBA 1LSOA 4TRNA 4YYZA 4LVUA 4CQMD 2VUUA 4CM8A 2Q4EA 4RPJA 4BKPA 1JW9B 1I2CA 3VDRA 1F12A 2G76A 2FY8A 3H9UA 3FN4A 4FD3A 2DFVA 3R3JA 1YBVA 3UFXA 2X23A 3LZ6A 3LT4A 1Q7GA 4J3FA 4K28A 2R6JA 4LMPA 3SXPA 1HDOA 5FEUA 1PJTA 4J4BA 4BVAA 5FFFA 3I6QA 4ILKA 4PLCA 1U7TA 2FWMX 2RH4A 3TOXA 3PXXA 4Z3KA 2IEDA 2BKAA 4XQ9A 4XKJA 3ZHYA 1H9BA 4BNGA 1X14A 1HDYA 2BFOA 3DZGA 3PZBA 2BD0A 1K6XA 2DM6A 2EF1A 1CQIA 5TLSA 3C85A 4NU6A 4PZDA 3A06A 1P1RA 3LVFO 1ZW1A 4GKVA 7ADHA 1QLHA 5K0ZA 3K31A 3F46A 3ZN2A 1CERA 4J2OA 4BNKA 1RYDA 1FF9A 5KVQA 3NDJA 3HB5X 4TZKA 4N7RA 1MFPA 5JS6A 3JQAB 3LQFA 4YBZA 4IXWA 3TZKA 4OSPA 5JMWA 4XDZA 5JDIC 4WGGA 1C3VA 3IMFA 3S55A 5IJZA 1ADFA 4GAEA 5BNFA 4CMIB 2V7PA 1UDCA 2PA3A 1ZK0A 4I8XA 5ITWA 1GADO 4JBHA 4GMFA 3TZCA 3GZNA 5DBGA 2HCTA 1PS9A 5BSHA 1JN0A 1GAEO 3QP9A 2EJVA 3BMOA 4BO3A 3FBTA 2JAHA 1R0LA 1ZEMA 4L74A 4E2ZA 4BNNA 5T57A 4Z0PA 2ZTLA 2OBNA 4DLBA 1YRLA 4PG7A 5COQA 3AM5A 2DBRA 3HADA 1KVUA 4M86A 1GUFA 2YW9A 4ALLA 2GN8A 3ZWBA 4YR9A 4YJHA 3LT0A 1ISIA 3IJRA 4PN3A 4O0LA 4OIMA 1EUZA 3ZWVA 1M76A 3KSDO 4IDFA 4B8ZA 3H2SA 5ADHA 4DXHA 5I9MA 5TX7A 3RWBA 1C0PA 4PLHA 3HZZA 4PLZA 1HKUA 3QIVA 4AJKA 1QYVA 1WMAA 2POQX 2NU7A 3G3EA 1ISJA 4RL6A 2HO5A 3QVXA 3HDHA 4XGNA 1YONA 1I10A 5ENVA 5BNIA 4QO7A 3RCBA 4CMKA 3D1LA 4Q3CA 5EINA 3OA0A 5TT0A 1BW9A 3PJFA 4D44A 4J9UE 1I3MA 1N1GA 4X54A 3FR7A 2R00A 3B1KA 2CMDA 3L4BC 1B8UA 3O4RA 2X86A 3ZWOA 4D42A 3DDNA 1PSDA 3HJAA 3ANMA 2C5AA 1PQPA 4H16A 3RC1A 2NTVA 4E5MA 3S1LA 1LDBA 3EZYA 1O94A 2J3KA 5TQVA 1NR1A 4AICA 3IC5A 3S2EA 2YFHA 1NWHA 3X2EA 2AQIA 1EDZA 2FOIA 1EFKA 2AG8A 3IAHA 4WECA 2YY7A 2WYVA 4OMUA 3JYQA 4A0SA 3GVIA 4R1TA 3QW2A 1ZK4A 4XYLA 4YAIA 1BRMA 3AUUA 1JQBA 3PTZA 4JBIA 2NQTA 4RDIA 5GZ1A 1M66A 3PEFA 4II2A 3W8EA 5JAQA 1XWFA 3DZHA 4R51A 3RAJA 3JQAA 2C2XA 4CMBA 4GH5A 5F1OA 3W6ZA 1JKJA 5HS6A 4ND2A 1HE3A 3ZWXA 1HXHA 2CF5A 4J0FA 4OHUA 4ALMA 1F8FA 4CMIA 1Q7CA 4Y8VA 1QSGA 1NFRA 3RBVA 4GBJA 4CUJA 4HFJA 4CLDA 2XPCA 3JD2A 1CEQA 1F14A 3DBRB 2QZZA 1OOEA 5KKCA 4XJSA 3GC6A 2HRZA 4WOJA 5G4LA 4EBFA 3QY9A 3WTBA 4ZD6A 2BFAA 4HV4A 4PLPA 1I24A 1E3WA 4I1IA 2VRCD 2EEZA 3RIHA 2O48X 5MGBA 3DBLB 1XU9A 3I52A 1VC2A 2JHGA 5AXDA 3JV7A 5DCUA 1KOLA 5A06A 1LI4A 2LDXA 3IP3A 1KEVA 3I9LA 1VSVA 3MJVA 1RM3A 4IGFA 3E6AA 2GO1A 8ADHA 1I33A 2HU2A 4KQXA 3CEAA 3ASUA 2QZ9A 2X5OA 3FBGA 5JDCC 2J3JA 2QQ5A 3VZRA 2CF6A 5CHEA 3M6IA 3VH4A 2IEBA 3Q0EA 3GY0A 2HDHA 1NQOA 3H65A 1S7CA 4OOFA 1DIHA 1F17A 4CM5A 2ZB7A 3LF1A 1LC0A 4YAGA 1YL7A 2DC1A 2VNSA 3KZVA 4XR4A 3HN2A 1N5DA 1Y8QB 2YV3A 4R3NA 3UOGA 2EW8A 3QWIA 2HJSA 2VHYA 4OKNA 3LC2O 5JY1A 1N7GA 1NVGA 1WP4A 4IUYA 4B3JA 3DONA 5LDGA 3CIFA 3H3FA 4C7KA 1QYDA 3SJ7A 4TRJA 2PLAA 5IDWA 4PRLA 1I3NA 2NVWA 3C1TA 4CQLB 1BSVA 3DWFA 4UEOA 1HT0A 3ZNQA 4ND1A 4J4TA 1ZFNA 1PGNA 2XAAA 1DPGA 4IJWA 1WDMA 4P4LA 3OQ1A 3SX2A 4CLXA 1YDEA 2ZK7A 4MP8A 4FJ2A 5I8ZA 1NM5A 2SCUA 3E18A 2VZ0A 2DUWA 1JLLA 2O7SA 2PKRA 3ZU5A 4MVJI 5IXYA 3FSRA 1X0VA 3EAGA 4ZRNA 5KJCA 1EE2A 4J4HA 1DDOA 2CSUA 2E6UX 4CV1A 3PWKA 1LX6A 4I5DA 1ISFA 3MJCA 3F47A 2J3IA 4CL8A 1UDBA 2WE7A 3IDSA 4BB5A 2AQ8A 4Z9XA 4HBGA 3V1YA 5LC1A 1YBAA 4FS3A 1HYGA 2NVBA 3GDFA 1HDRA 4WKGA 4FFPA 1ORRA 2EGHA 1TVEA 1AN9A 2D3TA 2PV7A 1SCUA 3NDIA 4BNYA 3SLGA 1VSUA 3MEQA 4DRYA 3CKYA 1KEPA 2HK8A 3PHHA 4NU5A 2GASA 1E3LA 4GVLA 2VCYA 4CLRA 3M2TA 2Q4BA 4BO8A 4AJIA 3RC9A 4BMSA 1EDOA 2YFQA 3ZNOA 4RF4A 3H7AA 1HZZA 3DB2A 4NG5A 4M49A 4YPOA 3P2YA 3DBLA 4WE3A 1DC4A 3ASVA 3AUSA 3UKOA 4WNCA 4IMPA 4D3SA 4ZHSA 2BELA 2C29D 1ARZA 4F6CA 3ZWCA 2ZATA 1UZMA 3AU9A 3I9NA 4OJNA 3TL3A 3JQDA 4BNTA 3ZV3A 1IOLA 2VHZA 4RJTA 1MGOA 3Q2KA 9LDBA 3ONDA 2DBQA 3K5PA 3ENKA 2QW8A 1PQUA 2GDZA 3GPIA 3HHPA 3OJFA 3DO5A 4ONEA 4B4UA 1T2EA 3ANNA 3INTA 1T2CA 2HK9A 2YUTA 5G0VA 4CMCA 5EQDA 3RI3A 2UDPA 2D4AA 3U4IA 4PFJA 4NBUA 3RVDA 4TRRA 4DVJA 1WDKA 3Q9UA 3KTDA 3D4OA 3JQ8B 1H94A 4OL9A 3VKUA 2X22A 1ML3A 3JQ9A 4BKRA 3GN1A 3H5NA 5G0UA 1ID1A 2AEJA 3QSGA 4CQLA 2IYPA 3KSZO 4DUPA 3GGOA 5JO9A 4RVUA 1EVYA 3VDQA 1U3UA 3WMWA 4E5YA 5IG2A 5CDGA 3LDHA 4FPXA 5EL0A 1QV6A 4IQ0A 1ZSVA 1IUKA 2VWQA 1H9AA 3JCZA 3N7UA 3RU7A 1W0CA 3HQ4O 4DQUA 2Y0DA 4G2NA 2DKNA 3JYNA 3BMQB 1ZIDA 3RC7A 5CG1A 1VJ0A 3AU8A 4WCFA 3IUSA 3AY3A 5ER9A 4L4RA 1UP7A 5L3ZA 3GZ4A 1ZSYA 2H6EA 3T4EA 4E21A 3PJEA 2GF2A 3KV3O 3OF2A 4LMRA 1VLLA 3ZHZA 4IZIA 5BR7A 3DFZA 3FPCA 3ZDFA 4NFYA 3MWEB 1ZK1A 5CDUA 4J49A 1Q2XA 2PD3A 4R9SA 4MP6A 3KYDB 3IQDB 1P1KA 5KOIA 2NSDA 1P1HA 3KLMX 3C1OA 3PHIA 4HXYA 1HETA 2HKIA 1MLDA 3EVTA 5TIIA 1ADBA 2Z95A 1DRVA 3D0OA 4JXKA 4XD2A 4BKOA 4F45A 3L6EA 1J49A 4WASA 5G4KB 1A4UA 1IB6A 4QSMA 3ROQA 3UH1A 4F6LA 3IIEA 3PHJA 3OBBA 3BMNB 5I7VA 2I65A 3GMDA 1E1NA 1HDCA 1T4DA 1GEGA 3JQBC 1WAMA 1K2WA 4A7PA 3OFSA 4YJGB 3N58A 1C1DB 3IUPA 2CNBA 3GEGA 5B1YA 2GLXA 1I01A 1ZO8A 5CPBA 3DZBA 1GPJA 1IE3A 4MP3A 4M55A 2E48A 1U7HA 1ENPA 1V3VA 3DZFA 1B3RA 4P22A 3BMCB 4CUZA 4YRAA 1RM5A 2FR1A 1MP0A 2P9GA 1LRLA 1XHLA 1F0YA 1FK8A 4IZHA 4OXYA 1UXJA 3ZNPA 3MTJA 2FPPA 5JY6A 3C7DB 5DP1A 4R16A 3ST7A 1LRKA 3B20A 4UEJA 5I7SA 2Q3EA 5JC8A 3HE3A 4B4VA 2VZ9A 4BIIA 3WYCA 4TKLA 2X0RA 3F4BA 3RROA 1XYGA 3UICA 1MB4A 5H82A 1VJ1A 3ONFA 2ZJ1A 2BGLA 4MIEA 1KEWA 1R16A 1O9BA 1UP4A 2J3HA 2B36A 3WS7A 3PWSA 4NZ9A 1ISGA 4AJ4A 3F5SA 5FYDA 1JKIA 3H4VA 2CVZA 3B1JA 2CY0A 3RUCA 5ICSA 2Q2WA 2DT5A 3TF5A 2PK3A 3D5QA 3NRCA 2AMFA 1LLUA 2DBZA 1OC4A 5FI5A 3STHA 1ZMTA 1VL8A 3HSKA 1UR5A 3FCOA 3BMQA 4MVJA 2PZLA 3AOEC 2C7GA 4BO5A 4YT2A 4W9NC 1W73A 4XQEA 3D7LA 3GUCA 3NGLA 1NQ5A 3RU9A 4E3ZA 1YB4A 3HG7A 3WXBA 4CMGA 5HM8A 4OH1A 4DYVA 4HY3A 1DIBA 1E7MA 3IP1A 3KOUA 2EWMA 4GLOA 1NXQA 1VRWA 4HNHA 1ZJZA 1PQWA 2PNFA 4J7XA 5JAMA 1XA0A 4R3WA 4ZU3A 1DFHA 4OGWA 4QXMA 2G82A 3KYDA 4FJ0A 2BH9A 4IDGA 4ZQFA 3E48A 1CWUA 2DPHA 2D8AA 1XGKA 4NQZA 3EZLA 5TS3A 3MJSA 3GQVA 3WGZA 1VL0A 4ALKA 5L4SA 3VC7A 3OICA 1Q0QA 3MJEA 3DZJA 4PVDA 3DHEA 3QVOA 4CMAA 4I5GA 1D4FA 3NJ8A 1HRDA 4N5MA 1ZJYA 2GN9A 4FJ1A 1Y7TA 1XSEA 1EK6A 4O59O 3ZU3A 3UCXA 3ZW9A 4B3HA 2GN6A 3WGQA 2X8LA 3QLJA 4L75A 3VH1A 2Y67A 1YS4A 2IODA 2GUGA 4CM1A 1E7QA 2RH8A 3W4IA 4XX0A 1G1AA 3BMCA 3DXFA 3DMYA 2VUSA 3WNQA 5A9SA 3EMKA 1MG5A 4I5FA 2PTGA 4NBWA 1OMOA 3OJEA 1YQGA 1BXZA 3BHJA 3COSA 4XIJA 3PPIA 4CLOA 2WD8A 1HWYA 3DMTC 5IFLA 2O4CA 4Y6RA 3CZRA 5A9TA 3AK4A 2YZ7A 1ULSA 3L9WA 4FFLA 2XOXA 2GNAA 3H9GA 2Y66A 4MVJM 2AG5A 4AJLA 5ILGA 3E1KA 2OL4A 1U2DA 1LTHR 3WBFA 1YOVA 5THQA 3QRWA 4CODB 3VPSA 4ZRMA 1Z82A 2RHCA 4JROA 4RVGA 4UUPA 3GGGA 1E1LA 4KTVE 1PEDA 2B4TO 4BKUA 5JCJD 2JL1A 1B8PA 4MVJE 2V6GA 5DF1A 4DIBA 1OI7A 4S3MA 5H81A 5C7OO 4BNJA 1CF2O 1R4NB 4PCVA 1CIVA 3OHSX 3WDSA 4BNMA 2WWRA 5C5IA 1WLYA 3PFWO 1NQTA 1P1JA 2PZKA 2QYSA 1EZ4A 3RBZA 1A9ZA 3GNQA 2Y68A 1P31A 2C0CA 3LK7A 5IZCA 4GMGA 5ILOA 4D3FA 3D3EA 3W4KA 3OJLA 4RORA 2GN4A 4FFMA 5JO0A 2WJPA 3KEQA 3WX0A 1NFFA 2JFFA 4FB5A 4LSMA 4QUKA 4Y98A 4E2XA 3GGPA 1PJ2A 4NJMA 5TGDA 1Y8RA 5IDQA 3DZIA 1B7GO 1U28A 4AJJA 4FCCA 4UVDA 2IZZA 1BW9B 1OC2A 3Q9NA 3ZV4A 4G65A 2Q46A 3EW7A 2GSDA 3IOYA 4QT0A 4U6QA 1HDXA 1EK5A 1KVSA 3LLSA 1EMDA 4WEQA 1H6CA 2EIHA 2J6IA 2OGUA 4GKBA 4BO2A 3PQEA 4NFSA 4EDFA 1UH5A 1EVJA 4UVHA 2WD7A 4J16A 1BTOA 4XR9A 3K30A 5KIAA 3A14A 1Z75A 4JK3A 4PRKA 3DAGA 3QWBA 4GSLA 3JQFC 2X6TA 3K8ZA 1HE4A 1JU9A 3H9JA 4GX0A 1SB8A 4IBOA 4HUJA 4DMMA 1VM6A 3MCVA 3O26A 1I8TA 5I7EA 4PLVA 2VOEA 3I5MA 3BAZA 4CM9A 2B4QA 1NASA 2JD1A 4K6FA 2RIRA 3FNFA 5FWNA 1E1MA 1VJTA 2QRKA 4FC7A 4TVBA 3F3SA 5T8KC 3ON5A 5ICMA 3KXDA 5KWEA 1IPFA 5B4TA 4H15A 4FFNA 3PLRA 3EDMA 3NT4A 1I2BA 5ES3A 2ZB3A 3FWZA 2YQ5A 4XZ3A 1NAIA 3KO8A 3ZWYA 3QA9A 4NJOA 1UUFA 2O3UA 1YO6A 3K96A 2HLPA 3GDGA 3HDYA 5A3JA 1NBOA 3L6DA 5EJ2A 4RQTA 2CVOA 4CV3A 3NJ4A 2O3RA 2BI7A 5JMPA 3L6OO 1R4NA 3M2PA 5F5NA 2OFPA 4OM8A 4CJXA 5CG2A 4FIZA 5JDIA 1QV7A 4W7IA 1E3WB 4GWGA 2B5VA 5CFZA 1ZKMA 2V65A 1E3IA 4RGBA 2Q2VA 1DRUA 2JD0A 3AOGA 1U2GA 1PJ4A 3GVHA 2D2IA 3GNTA 1NX6A 1I36A 4J91A 1T26A 3CUKA 1DJNA 1XLTA 2BI8A 4GI2A 4R1UA 2X7HA 1RJWA 3KEOA 3OECA 1AXEA 5EPOA 3RBXA 9LDTA 1DRWA 1NP3A 1ZH8A 2BGKA 1I3LA 1GUZA 2DQ4A 1M6HA 2W98A 3G49A 3TOZA 4ZJUA 1R12A 1JAYA 2FSVA 1B16A 3RQSA 4BQRA 1UJMA 1YDWA 2YDXA 3R3SA 4R4JA 3WGYA 3BZUA 4DYDA 2FR8A 4BO4A 4EJMA 4K9DA 5JW6A 5THKA 4I08A 4B79A 4K26A 3VZQA 3GHYA 1W4ZA 3TFQA 2UV8A 3V8BA 3V2HA 1R37A 3HN7A 1LSSA 5EESA 2CUKA 3I83A 5DCYA 1B14A 3DBHA 5TSDA 4P4GA 2VNAA 3TZ6A 2VQ3A 2Y1EA 1E6EA 3O38A 4MVJH 1B15A 2FP4A 5A05A 3GHHA 4K1LA 5A04A 5KVSA 3QVSA 1X13A 2OO5A 3L4BA 3TQHA 1GEEA 5HS4A 3W8FA 1HE5A 3U62A 4IDAA 5L95A 1IZ9A 1KYQA 2OOSA 2X58A 2LDBA 1RWBA 2B37A 2JCVA 3ZWWA 1Q7BA 3CTMA 1R6DA 4PGFA 3UW3A 4L9RA 3BTOA 4QTZA 6ADHA 2YHUA 3MOIA 1N2SA 1KVRA 1YJ8A 2CDBA 2GR9A 3BTSA 3JQAD 4P8RA 1BHSA 2F00A 4KWHA 5AYVA 2D5CA 3ANLA 2G1UA 4D0RA 5JFOA 4E4YA 2ZB4A 5B4VA 4KUGA 4OKIA 3EGOA 2VWGA 3TSCA 2PWZA 4YWJA 3C8MA 1M67A 4G81A 2VYVA 4CLRB 1R0SA 3LT2A 1PGQA 3FD8A 4J43A 2OMEA 1UXGA 1V3UA 3QWFA 1UAGA 2FMUA 3EVNA 4RPHA 3RFXA 4B4OA 4Q3AA 1YL6A 1ZSNA 3TFOA 4WLOA 2PGDA 2Q45A 3DZKA 4BOYA 4AJ2A 1YQDA 4ZQHA 5F5LA 3H9EO 4IQGA 5DOVA 1MG0A 2OZPA 2UYYA 3ADOA 4IDCA 4MKZA 3ZI0A 3S2FA 1E6WA 4ND3A 4TZTA 1CRWG 1ZCJA 2NADA 3QV1A 1EUCA 4BNZA 4UVIA 4TWRA 5DT9A 1T2FA 1T1SA 4EEZA 5C37A 4BNIA 2YQ4A 3K6JA 1QYXA 1X1EA 2P9EA 1TT7A 1YH3A 3AI2A 1B26A 3SC4A 1HSZA 1PZEA 5JE8A 4BNWA 4BGUA 4E32A 1XKQA 2AQHA 3VKVA 2DVMA 1UAYA 3AI1A 3P7MA 4UAGA 5G0WA 4CR7A 1NTOA 4FGWA 3PVZA 3C7CB 1BXGB 1E5LA 1HEUA 1H2HA 2P91A 4AJHA 2EJWA 2AEMA 3I9OA 3E03A 1L7DA 2J5QA 2VWHA 3D5TA 2Y1GA 1LU9A 3X2FA 1WZIA 4R5MA 5JDCA 2DTDA 2Q1TA 4JJFA 4KUEA 4RLHA 1GU7A 1HL3A 1DIGA 4OXKA 4CMEC 2WYUA 2DAPA 3HUDA 3TPCA 3MZ0A 4L8VA 3U9LA 4DQVA 4XA8A 2JCYA 5LDHA 5JLAA 4R68A 3DHNA 3S2GA 4PG4A 5K6AC 4J7CA 4BMNA 4FQ8A 4XDYA 1J5PA 5HTOA 3BHMA 2Q49A 1YB5A 2PH3A 1NHWA 3ORFA 3E82A 4PLYA 4LRSB 2EP7A 3ZWPA 4BNVA 5CDSA 4KUHA 4IJUA 1K6IA 4NMHA 5L7YA 2OORA 4WCFB 4BNHA 3E9MA 2G17A 1QG6A 2B83A 1SAYA 2CDAA 1JVBA 2JFGA 3RUEA 1ENOA 5LCXA 4PZEA 4Q9NA 1A5ZA 5CP8A 2B5WA 5C7IO 2OXIA 4BO0A 1RM4A 2I9PA 2NU8A 3WOHA 3G17A 2H9IA 1U8XX 5HA5A 2GCGA 2TMDA 4MDHA 4Q3NA 2Q1UA 2X1HA 3GRPA 4HFMA 2IXBA 1OZAA 4D3DA 1NNUA 1PZFA 3I23A 4MOWA 5BSGA 2EKQA 3VPFA 1KY4A 4JX8A 3DHYA 2UVDA 3EY4A 2HMVA 4AL4A 3JQ7B 4CUKA 2ZTVA 1DC3A 4YB8A 5DBFA 4NIMA 3DTYA 4XYBA 3BXXA 1PU2A 3EHEA 4PG5A 3OSUA 4MIOA 3DAFA 3TRIA 1YL5A 3JD1A 3LF2A 4PIVA 1GZ3A 3WYEA 1BDBA 3H5AA 1KS9A 1SEPA 2ZKLA 1NAHA 2B0JA 1P3DA 2Z1NA 1ZMOA 2VZ8A 2YV2A 1GCUA 3WG9A 1HLPA 1GDHA 1H2BA 2X9GA 3PHGA 4KTTE 1RKXA 2GGSA 3WFJA 2FPIA 3NKLA 1QKIA 4MO2A 1PGOA 3C24A 5EIOA 3WYBA 2I99A 3MTGA 5C3MA 1E0DA 4RCVA 1YWGO 2PKQP 3WICA 4ALIA 4PLFA 4GGOA 3OETA 4U0JA 4E2YA 1IULA 1YE3A 2P4QA 1PWXA 1BXGA 2IYOA 1UXHA 2VT2A 4UVGA 3VPXA 4RF2A 4HKTA 4R41A 3VPHA 4ND4A 2DU8A 3ROKA 3DOCA 3T7EA 4IIUA 2YYYA 2EW2A 3JYOA 3WIDA 1PL6A 3ETDA 3GFBA 1F8GA 3QQPA 3QWHA 2O3JA 1UXKA 3W6UA 4D43A 1Y5RA 3IS3A 1BGVA 4LCEA 4D41A 3W1VA 4FOSA 4Q39A 4UUOA 2ZIZA 3GLQA 4E5NA 3ZHXA 4BNLA 3PQFA 1GQQA 5DZSA 2B69A 4AJNA 3VVBA 2BRUA 1QRRA 5BQFA 4R69A 4RVHA 3GEDA 1TXGA 1LNQA 4BV8A 4Y6PA 3RJ9A 4ID9A 3PK0A 1KVQA 1Y9EA 2W8ZA 1VI2A 4Z3DA 1D7OA 3OQ6A 2VOJA 4YACA 2AXQA 1R4MA 4DIFA 2PFGA 3PFFA 4XJTA 3AI3A 3RD5A 3HDQA 4WCDA 4NPCA 2Q1SA 3ZNNA 1HDZA 4PZCA 1V6AA 2NM0A 3LC7O 2AHRA 1PZHA 3EK2A 3NAQA 3K2BA 3WGTA 1RPNA 3P5SA 4M8SA 3U09A 3PGXA 1SB9A 3ONEA 1V9LA 3PYMA 4DPKA 3FHLA 4LW8A 1Y9AA 2QYTA 3I4CA 4BNFA 4K6CA 2Q2QA 3ULKA 3FNEA 1DFIA 5TC4A 1AGNA 3ETGA 3W4JA 3JQ7A 4LK3A 4BO9A 3L0DA 4R54A 1L7EA 2DFDA 2HUNA 3BYZA 2D59A 4XRGA 1NPYA 3UUWA 4QECA 4J6FA 1ZVMA 1S6YA 1P9LA 4RDHA 7MDHA 5I7FA 1N8KA 4UREA 1F06A 1W6UA 3FF4A 1W8DA 3FRJA 4H7PA 5GY7A 1NVMB 1FJHA 2C59A 3CPSA 3WGIA 1X0XA 5TT1A 4EEXA 2EGGA 1LLCA 1FMCA 1B0AA 1HZJA 1FDSA 4FFOA 2PGJA 2X0IA 4GGPA 1RM0A 3CMMA 4CR6A 3GN2A 4ZQEA 3E8XA 3ADPA 4BUCA 5A9SB 1DHTA 4BHTA 1L1FA 4Y6SA 1U3WA 3I9MA 2W2LA 2JCXA 3H6KA 2AA3A 1U5CA 3JQBA 2JKVA 4KQWA 4JP3A 4CLOB 5L40A 3IL2A 3KHUA 4G5HA 1M2WA 1D3AA 1Q0LA 4DREA 2VWPA 4I9UA 1P77A 1BWSA 4RZIA 4YCAA 5IDXA 2VTDA 4XIYA 1GYQA 1DSSG 3DR3A 3OJ0A 1BMDA 5KJEA 3VZPA 3JSAA 3TL2A 4PLGA 2A4KA 3EUWA 4W6ZA 1O6ZA 4CMJA 4E31A 3OH8A 1YOVB 4TQGA 1YVEI 3UCFA 2PR2A 1E1KA 5JBIA 1IHXA 2H1SA 1X7GA 3PZRA 2NU6A 2WSBA 2DTXA 4EGFA 5B4UA 5CDYA 1X7DA 2GPTA 1J0XO 1AHHA 3U5TA 2WE8A 4BO7A 1XR3A 2X5KO 4ZQGA 4AG3A 3VVCA 5CEFA 5CEEA 1XG5A 3OMLA 4R1NA 3LU1A 3PLNA 4WJZA 3C7AA 3KRTA 3WJAA 1DJQA 3NYWA 4ESOA 2PY6A 1DIAA 3GFGA 5IN5A 2E49A 2G5CA 1R66A 1SZJG 3PDUA 1A71A 3JD0A 4MVJD 2PKQO 1HYHA 4F3YA 3QHAA 4IY1A 3CXRA 1GL3A 1GZ6A 3R6DA 4ND5A 2GZ1A 2CZCA 4YAJA 4E30A 4EITA 2X4GA 2VYNA 2V6FA 2O3TA 4KOAA 2CD9A 3TWOA 5L7WA 3I9KA 3AY6A 1E5QA 1YQXA 3SVTA 3ICPA 1E3JA 1Y1PA 4DQXA 3DTTA 1SMKA 1TEHA 3AOEA 3AUAA 1P45A 3ROPA 4W9NA 1TT5B 4NH4A 4ALNA 4Z6KA 1I5RA 2P5UA 4NJMB 1PGJA 1Y8RB 3UN1A 2UUPA 4BQPA 4J2HA 4YJFA 4M1QA 1MFZA 3P19A 1SBYA 1E7RA 2O50A 4R01A 4MKXA 3KUXA 1K0UA 1LUAA 4E5PA 1FDUA 1PGPA 5ITVA 2ET6A 2C07A 2O23A 3WGGA 4FOOA 3TNLA 2IZ1A 1LDEA 3GNSA 4Q3DA 4YVFA 1GR0A 1JWBB 3GA0A 1H6AA 1UZLA 2D5AA 1HLDA 4CQMB 5JAIA 2TMGA 3JD4A 2WD7B 2EKPA 4Z9YA 1KETA 2NNLD 4JIGA 4IDEA 4MIYA 3Q3CA 3CZMA 4LISA 4J1QA 4CM4A 2FR0A 4WLEA 3K2EA 4XWYA 4HFRA 4KDEA 3BA1A 2DPGA 4XB1A 5JC1A 3CSDA 3HB4X 3RFVA 1CYDA 2ILTA 4FC6A 3RKRA 3L77A 3ABIA 4YDRA 3L9XA 1WPQA 3WQSB 3NEPX 1LLQA 1T25A 4ZA2A 1T1RA 1WXDA 3O03A 4GX1A 2X9VA 2J5KA 4UULA 5EN4A 3GAZA 1U9JA 1Y6JA 1N9GB 5JYDA 1I32A 1GZ4A 5CPFA 1Z6ZA 4KP7A 3WSWA 1EBFA 5CAEA 2GERA 4JGBA 4U7WA 5EERA 3DMTA 5L51A 2P5YA 4KZPA 2CFCA 1AUPA 5U9CA 2B35A 2PH5A 1DAPA 1NPTO 1LBEA 2EKLA 1O95A 3F6YA 3ITKA 1A27A 3Q6IA 1SC6A 1P74A 3WB9A 1U8FO 4OSOA 1H5QA 3D4PA 2QG4A 2Y93A 4GX5A 3WFIA 3I4FA 1A72A 1VL6A 1O0SA 4GVXA 4FFRA 3DBVO 1HE2A
chains in the Genus database with same CATH superfamily
1NNI1 1LRJA 1ORVA 4Z9FA 1UXOA 2NTYC 2OCGA 1HL7A 3GQBA 4N5IX 5ALPA 1C29B 4KXNA 3GWGA 3VC3A 1OLSA 3DM5A 1GL9B 1WLSA 5D87A 3WGHA 2F8TA 1XKTA 4HZUA 1ICIA 1YU6A 2I2BA 3KLNA 4QUGA 4CDNA 1GPNA 1T5DX 1L5OA 2FQQA 3OM9A 1BHJA 4UZFA 4QSHA 4Z2AA 3AHCA 4ZEVA 1ZM2A 1WQ1R 2P68A 4XB6B 4C5BA 2XTNA 5BSTA 3SYTA 3UHOA 1IY0A 1RC8A 4FNGA 4OUKX 3I6YA 1E7YA 2R7LA 1LBTA 1YJCA 2IHNA 1KYVA 4UJ3A 1GV0A 3OCJA 3C3KA 5KTKA 2V59A 2R1TA 2B7LA 4CV2A 4RCZA 1Y81A 1LDMA 2R8PA 4H3KB 1Q6ZA 4IH4A 4LG1A 1KDYA 2O8CB 2PH7A 2BHLA 1KERA 1PSWA 4S1OA 1EUYA 4LZOA 3U3XA 1E9SA 2YC2C 4YFYA 2BFWA 4QBHA 4F60A 1Q44A 4DMUB 1QFYA 3NUGA 1ORWA 1TEXA 1P8AA 3ZLTA 4QBGB 2WJZB 4KXXA 3V9AA 2XBLA 4D45A 1Y5LA 1K3TA 2WPDD 2BPOA 1PWHA 2YXDA 1M54A 2CEAA 2Y1FA 2VVTA 1O97D 1VG9B 4INPA 1DOAA 3BJMA 4ZXFA 3UZUA 5LOVF 2QE7D 1KMMA 5D3MB 2ZTHA 1GITA 3RUAA 1MJFA 1YS2X 1LSUA 3AHDA 5DHFA 4NHEA 4F3TA 1G8GA 4LXTA 5DULA 2CXUA 3BOSA 3DDHA 4O02B 1U4OA 4AX4A 1QK5A 1T2UA 1DGQA 5AW8A 3AB3A 3MWDB 1Z2DA 4KZKA 4KO4S 3U7GA 1FUEA 1Q1BA 2BLNA 3GEMA 3LK6A 1UXIA 2IF0A 1PNRA 4YRNA 1KQ3A 2X2EA 2ZYDA 1EGMB 1EVQA 1EXMA 1XAGA 1KFBB 1PJ3A 1T4CA 3IPAA 3KL2A 3DKRA 4NICA 4TTPA 4AWAA 1H0KA 1DQNA 1H23A 1O5TA 3PJDA 4JJGA 3PJGA 4E2XA 1QYCA 3N2ZB 1N1MA 3DEZA 2Q3CA 1L0BA 4B85A 4EM6A 3RWOA 3QMMA 1K7SN 1SVSA 2EJBA 2AYXA 4M89A 4CM9D 4MVJF 5MN4A 2B4RO 1NVBA 5DBEX 1ZOIA 3AEYA 2E4UA 3JQFA 3ZVMA 5I8PA 1K5PA 1SO8A 1YACA 2C57A 3HPRA 1FFCA 1N9GA 3M83A 3OZGA 4LDQA 4MUEA 1CFJA 4US0R 3TZHA 4ZKDA 1XKXA 3MOGA 1EM8B 3FE2A 2NVUB 2QP4A 1Z2PX 5EJ7A 3BE8A 1LJLA 5LWHA 2HRDA 3U4CA 2ODTX 3OF5A 1RI3A 2H11A 4MW7A 1E7SA 5HZKA 2PD6A 4AIIA 2QL7A 2GLTA 3GRRA 3FNHA 4ITUA 5ALTA 3V8PA 1N7HA 2CWWA 5IBQA 3C5EA 3KYCB 3OX2A 3K94A 4F97A 4M0DA 5LP6A 3VSCA 4ZT4A 1XJWA 2WJ4A 3LX5A 1E2DA 4J90A 2GXAA 2CYAA 3G8AA 5IW8A 4ZARA 5BT9A 2HF8A 1ZH6A 3QJ5A 4IMRA 4IJ6A 2QD2A 4IIVA 5G0TA 4J0EA 2RHGB 1KI3A 3VUFA 1RZUA 1IY1A 1KIMA 2P6MA 1EI9A 1TUBA 2GZ3A 1JG1A 3CLSD 3RPEA 3WYGA 2JEOA 2FUCA 2XUDA 1LWNA 2XKKA 3GG2A 1KHHA 2PL5A 4MS1B 3F9IA 3RK0A 1IWOA 3JD3A 3OC6A 3F7MA 4PZ9A 4H18A 5ALIA 1XDWA 4UUNA 5ALFA 2ZIAA 1W88A 3FZEA 4JLJA 4GQAA 2E9SA 4KIJA 4TMFA 1N8NA 1ZGGA 1ZOOA 3V1TC 1Q17A 3HSYA 3B3GA 3MJTA 4F0JA 2ZJOA 3K05A 1ZIOA 3G9TA 3HRHA 2Q4DA 2RARA 1CW2B 2BR3A 3MM4A 5EMKA 1WR8A 4AJEA 3EMBA 5F21A 2H5EA 4WNAB 3WOVA 3TLGA 1SXJB 2Z3ZA 4JI2B 2OGZA 3U6KA 2DWUA 2CVQA 4HGRA 2GHRA 5SZIA 1SEVA 2C82A 1Z6XA 4HLUC 4EP1A 2YWRA 4YRKA 1UMDA 1JAXA 5EGSA 1RXYA 5BWCA 2OV6A 1N2CB 5GGXA 1IVNA 3BRCA 4DY6A 1ANKA 1MQ8B 5A9RA 1RQGA 4EYEA 3UJ3X 4ZVNA 4UASA 1QLJA 4DCSA 1GGFA 2VDQB 4JI0B 4TXNA 1C1XB 3VYWA 2HL6A 1ONNA 3RVSA 2QQEA 5HE9A 1R9GA 1KJIA 2Y1DA 3B1FA 4HP8A 4MW0A 4Q82A 4MH0R 2DBVO 3SQLA 1YU9A 2YIMA 5JISA 3C15C 1FDWA 1EINA 2R6R1 3CX3A 3WY9A 4JN6B 2M1ZA 1IG0A 2VF4X 2ZIEA 3N53A 5D51S 2IELA 5CVTA 3RVQA 1KXJA 4CL3A 1FC0A 4XEHA 1QIFA 4R9RA 5AM5A 3EQZA 1H2XA 3H87A 3OHPA 4AKTA 5AW0A 2RG7A 4KREA 4PLWA 2GYVA 2OO3A 1EDDA 2JFZA 4I14A 3FFWA 4RV5A 5HNKA 3K9QO 4W7HA 1IPHA 4AQYB 3DOHA 4YTEA 2L2QA 4CIVA 3VR4A 5CITA 4DOMA 4KK4A 4L0QA 3KT3A 3TQRA 1CIJA 2EKZA 2O3SA 2XUOA 2NWQA 1W87A 2XNJA 2J3EA 3FMGA 3GEHA 2X9LA 1QB8A 2CV1A 3ER9A 4EMSA 1AZTA 5IDVA 1ONSA 4ZYTA 4ZCPA 2JDID 2B8JA 1UZNA 4DMKA 3UKDA 4ZVVA 4FEGA 3AFIA 4WJKB 2D1FA 4BIMA 3NTUA 5E9JA 4NCNA 3IEPA 3PU6A 2ZYVX 3R3XA 1YR6A 4LQDA 1PHRA 2JHFA 3KP1A 1ECFA 2OCIA 1OXKB 2XZDA 3F6EX 1Q1NA 3IRUA 2F4NA 3D3QA 3QEJA 4IJVA 2A14A 1Z3CA 3B6IA 4N0DA 3HO1A 3FMVA 2FW7A 2YIVX 1KTVA 1WB6A 4G5SA 3THYA 4IUBS 4J9VA 3CUTA 2BE7A 1QQAA 3SF8B 4P7KA 2W2KA 4GOLD 3KSMA 3T7IA 5L3QA 3JQ6A 4B6RA 5LYJB 3EPKA 2RAFA 3F5QA 4WOKA 5C5EA 1XQXA 1GPLA 4TSFD 3ZVKA 1C8VB 1OWLA 3NHYA 4I8DA 2Q5HA 2J4CA 1DXYA 4NONA 3WLRA 3OZBA 5JTTA 4LJAA 2CNDA 3T06B 2V5AA 2Q5FA 3ZWAA 4Q19A 4GL4A 1OB2A 2NO0A 2VT7A 3JVVA 4DGSA 1MAWA 2HWYA 1P19A 2F1RA 4H1TA 4YASA 4MQEB 2BFDB 2GRAA 1IM2A 1LDNA 1HO3A 3R3WA 3CNLA 4EJ2A 2OUKA 3W5UA 2WM9B 3HKBB 4DRZA 5F7JA 4AS2A 1T0PA 1BE8A 1R4AA 3I6BA 4M4SA 4M53A 2ZTUA 4FMDB 5T3YA 4F2GA 1AKTA 5BR4A 1EUDB 3H9QA 3I39X 4IGKA 1DWPA 2FCRA 4IDDA 4KE6A 4RHYA 5DBIA 4LFBB 3F5DA 3OP4A 2FVXA 4B45A 4BRWA 2LTAA 4KIWA 3DPSA 4ZTZB 3CX6A 4W5RA 3M49A 3PNPA 1LD3A 3LOQA 2NQ8A 1U8UA 3NIGB 1JIUA 4LRWA 1OH8A 3A6GA 4L4SA 3ITDA 4IAOA 2GK4A 4JEHA 4YP9A 3A4LA 1RAFA 2F4VB 3LSTA 3GPDG 4P7JA 3SK0A 1NYTA 3S2YA 1IOZA 2Q21A 3RJ5A 4BLTA 1E8DA 4BE7B 2C5GA 2VNKA 1IPEA 5TPWA 2I67A 1EE9A 3LUBA 4L5AA 2V9PA 3NPMA 1OAAA 4J03A 3ZTYA 4ZFNA 4CKWA 2DB3A 1DBVO 1QVVA 3M5DA 2ZJ6A 4QVKA 2E21A 1OLXB 4PIMA 5T6BA 5KYXB 2QJRA 1FS4A 2CXXA 5KAMA 2FN9A 2KI5A 3K0KA 4GOKA 4RFSA 4D79A 5J2UF 4YRBA 1FDVA 1YI1A 4UXIA 1YA6A 4BB9A 2V3VA 2CB0A 3OU6A 2RI1A 3H5WA 3MCZA 4MLPA 3GDOA 4MWZA 4AECA 3FGZA 4DAOA 1IXYA 3IPRA 5KMGA 1RCFA 2UYHA 1GSHA 4AZ0A 5HBRA 4GLLA 3ZH2A 5JAHA 4LSGA 1JR6A 2VTEA 2H4XA 2ZRQA 5A0VA 2BBSA 3LSYA 3FUXA 4OLAA 2WYOA 3AM3A 2X5JO 3QVKA 1NY6A 3OCZA 3OQBA 2QSYA 1DB3A 2ZRPA 3FKQA 1IYZA 1CRZA 4E5UA 5AK4A 3LHSA 1XDUA 1MW9X 2QWXA 4HGNA 3HKDB 3B52X 2XNDA 3DFUA 3Q3EA 2P9JA 2D3WA 2J8ZA 2P2LA 2YJ3A 3NHBA 3O8OB 1R0WA 1FNDA 2FZWA 3QQ5A 4EYOA 4FM9A 2DGDA 1P62B 3BXHA 3RH0A 2NUAB 3KSUA 1P1IA 2HFKA 2VL7A 3HO6A 3T7CA 1X87A 2G40A 2L0XA 3JAWB 3K4QA 2QNBA 4DEYA 5HKKD 3HVRA 2ZYGA 1LSJA 2CDCA 3IIJA 3OO1A 4AKHA 2C8VA 1A76A 2X0JA 2XTAA 3UWMA 2WV7A 1NVUQ 4HWRA 2QD3A 3W77A 5AOAA 1UM9B 3KKZA 2XLCA 1XNJA 2OUIA 4D96A 2N42A 1RAIA 3EB9A 1MC4A 1DCMA 3T0FA 3T4UA 3B70A 3HA7A 5HJ2A 4DC0A 4RPGA 4DJEC 3U6BA 1LDGA 4MV6A 5LFAA 2Z8YM 3GGCA 1P0PA 3IODA 3L0YA 5ELLA 1RXVA 1DAHA 1QVRA 3OTOB 3UENA 4IJKA 4DMLA 5CURA 5GPBA 1AQIA 3HMKA 1J0DA 2AFIA 2DE0X 3HA2A 1MJ5A 4LXUA 4YMVA 1NMQA 1SXJE 2OC4A 4W4TA 4MI3A 5CTJA 2YOHA 5A1TA 3CTPA 1P73A 4NARA 1PL8A 1R5NA 4CV0A 1JG3A 4HNQA 1TAHA 5ALVA 2WQ6A 2GJSA 2JGIA 1I3OA 1N2CE 5K09A 3TCXB 3VOTA 1DTWB 3GD7A 4PG8A 5TJHA 1QHHA 3AT1A 3INGA 4LF5B 4TKUA 3TPZA 3W8DA 3HO8A 1ODFA 4JQSA 2BTQA 4PBRA 2O19A 1ZINA 1JSLA 1U7WA 2Y0EA 3ZLVA 4RD6A 1D1TA 2DEUA 1YR3A 1QE3A 1Y8QA 4JP5A 3ZGYA 2V7EA 2Z4RA 4G1UC 4A8PA 4JYPA 3GLRA 1F2TA 3GJRA 2AKAB 1UIMA 3MLBA 2WB2A 1Q12A 1S2OA 2Z1MA 4F5EA 5DDIP 1B2RA 2F9LA 2W2XA 4NBTA 5FLKA 3UQYS 1V11B 1PK7A 1T1IA 3QUTA 4MV1A 4A0FA 2QPTA 2PVPA 2ZUSA 3I9V6 4Y67A 3UHFA 4BFWA 5JAOA 3A4NA 4EJ0A 1DO8A 4LRTB 3RKUA 2LIPA 5FI3A 4PC2A 1XZBA 1YVUA 4AI6A 4IHJA 3PL1A 4EL5A 1U63A 4E5DA 3NI2A 4N0QA 4GPIB 4M98A 2DHRA 4WEOA 3LCCA 3M9LA 4XLLA 5DHQA 4F1JA 5J9FA 4POAA 4ZMBA 3GVPA 1Q0HA 3QVLA 3T4XA 1OJ7A 1C7JA 2MIIA 1R0KA 2WWXA 2X13A 4AJ9A 1WB9A 4AQDA 5BQ3A 1VYUA 2UYCA 1V8PA 3CVOA 1PEAA 3HTXA 2OK8A 1T6BY 1G59A 3ZJTA 2X2PA 3E7FA 1KMHA 1E64A 2F43A 4QJ5A 1D1QA 4RU1A 2J0EA 4K9QA 4TRMA 5BPHA 2DG2A 4G07A 2DWOA 3CF0A 5EUQB 4A6EA 1D04A 2ST1A 2XVZA 2WAAA 1JDTA 2Y1OA 5EIEA 5K0CA 3QBJA 4GD3Q 3F1LA 4E13A 1UC8A 3GRZA 5GONF 4HYQA 4BBAA 2VQ6A 1U2RA 2X1VA 2CXQA 1OJLA 5BQ5A 4JD5A 4X92A 3IBFA 3KJHA 2B5OA 4P82A 2C5FA 2PRSA 3N8DA 3P2OA 3PE4A 4F8EA 2AI1A 4O4IF 2G28A 4HS4A 3WKDA 2BFPA 2BH2A 4OYYA 1C8KA 1V43A 2J3LA 2CYBA 1D07A 2H0AA 3D0RA 1M6WA 5ER6A 1YA4A 3K0CC 1YQWA 3KT8A 3U1VA 1LK7A 3EPPA 4XWGA 5AXBA 4O4HA 1T9GS 2HY7A 1G6KA 3AHHA 4U5QA 2ZIXA 4ALJA 4AMYA 3ZCQA 3EUAA 3OPYA 1GD1O 4BLQA 4C88A 4D02A 3PSHA 1Z4OA 1NXTA 2Y0CA 1QRUA 3BTUA 5TXGA 3HB9A 2P0EA 1P4RA 3I2HA 4R2MA 3W9SA 3EXAA 4EZBA 3U4HA 5E2IA 4DF3A 2YCBA 2Q1WA 5LPNA 5BWOA 4DMRA 3EXIA 4DIOA 4E1BA 5I4IA 1DCFA 1JVSA 4QDXA 4YIKA 4ZT6A 3R7AA 4ASUA 3CINA 3IUNA 2C97A 2MYUA 2ZSIA 1W96A 3I2GA 5SZJA 2ZZNA 5M7EA 3LMKA 1AZSC 3QKUA 4UTOA 2EQBA 5IC5A 3CMCO 2I4NA 1GZHB 2YJGA 4MQFA 3JVIA 1L4LA 3CF6R 1Q84A 1Y6ZA 2LV8A 3H83A 1UEIA 3O92A 3R24A 4G26A 3PX7A 4DCOA 1PK9A 4I50A 4YI5A 3SJUA 5K3FB 4ZV7A 3KETA 1SBTA 3VO1A 3U5ZB 4OLFA 3IR6A 4RTSA 3QLUC 1VLQA 5EJ4A 3E9DA 1FNSA 4BTEA 4UAJA 1PR3A 1RZVA 2ZI3A 1RPAA 3JQGB 2W90A 3Q15C 4C0XA 4FNMA 1SD1A 2O7RA 2NACA 3DA8A 3H97A 5KYYA 3AL0C 1ESCA 4H7HA 5FP0A 4CR8A 1HTWA 3L40A 5IHXA 2QTMA 5FR2A 4DV6B 2RHDA 2ZBRA 3EFOA 4B7CA 5HUQA 3O8QA 4C4RA 1XO1A 4OLHA 2H7XA 2G9RA 5ESDA 1JDBC 4TMVA 2C95A 3F9RA 1QC5B 3TLGB 1DC6A 3GRYA 2PGXA 2QR3A 3O8NA 5EXXA 1U9CA 1ZN9A 1XVTA 1R3DA 1PYOA 4XJVA 1O58A 3RASA 3S1SA 3FDFA 5BSFA 4FFSA 4KIFA 5F2OA 2SNIE 3TAUA 2VHVA 3ACCA 1UPXA 1XZQA 1NOIA 2NV6A 3L8DA 4PSUA 1OASA 3P97A 2X0EA 3ZDBA 1J2JA 4FDAA 1JPUA 4G85A 2PAFA 2VYND 3UMBA 4FEYA 2C5EA 2QTGA 2BT4A 5LZ2A 2FP3A 4MUKA 4RS4A 3WLHA 3ZWNA 1JDVA 3LCUA 5T4FA 1K88A 3NIBA 1BYUA 3ML1A 5FFMA 4EUEA 3UMYA 4CGYA 1EFVB 5KKNB 1BHO1 4C89A 1A2OA 1P7VA 2XA2A 2XMDA 5DNCA 2INGX 1FXWF 3ETJA 1KI2A 4HPWA 5JW6A 1D2EA 3T1OA 3T9FA 1T2AA 4EG7A 2O2CA 1WXXA 5CCXA 1RWWA 2HLDD 3QPVA 4V03A 5KQLA 2CNWD 5TVKA 1GTMA 3FHCB 2JNWA 1IY2A 4OQXA 5EGNA 2J08A 4RZQA 3ESYA 1BMFD 3L8YA 3LXMA 3TBFA 3VNBA 1C14A 4F72A 5FTLA 4DR5B 3W5DA 3DDZX 3O2JA 4P5EA 4YFVA 4BZWA 5BORA 1C7RA 4P4TA 4HQOA 4MGZR 1J5XA 1PE0A 1TE2A 4O2RA 1DBIA 1YQUA 3PWZA 4NE7A 5EXPA 3VGPA 1YJQA 2AXNA 1Y6GA 3VJMA 3BL6A 1WDTA 4ZREA 5G4KA 4PXAA 4HQ6A 4EW2A 1JR4A 1U9ZA 3A31A 3QX3A 4GXNA 5KNCA 3R5JA 5AXCA 4MRSA 1QCDA 2G6BA 2X42A 4BNXA 1GQRA 2FEOA 2HQ1A 2I76A 3CH7A 3Q5GA 5AP9A 3TW0A 2J67A 5I51A 3CX7A 2OZLB 3HVUA 3K1TA 4YJGA 1SURA 3RVNA 1TLFA 3G8BA 4HWPA 1DRJA 3QV2A 2H63A 4MUBA 2FMFA 4K03A 4TVOA 3C7TA 1TLTA 4ODIA 2FA9A 5AKGA 4UTZA 5AVKA 4B4DA 1S02A 2J33A 4H1VA 2PHZA 3IHKA 3GR6A 2JIMA 1TJ4A 2B1GA 1TW2A 4G56A 4BAZA 1ZNQO 1QQTA 3D3JA 1J4AA 1KEEA 2C99A 2I5PO 3DLCA 3OE7A 3NHFA 1KK2A 1NU6A 5KVCA 1IK6A 4P7GA 3P0FA 3MRTA 5FTKA 4TPKA 3RFUA 2AD5A 1WETA 2O4UX 2H5LA 4HHEA 4UE2A 4D8XA 3QVJA 4TROA 1FDIA 4MR7B 2LP4Y 5CYOA 4QYTA 1FSSA 3TJRA 1DNPA 1O95D 1TQ2A 4RLFA 4TMKA 1M2KA 1X7WA 4R2KA 4DLYA 1NW7A 3BFKA 1PT6A 3DCYA 3EMDA 4OUDA 1FTWA 4PSKA 4ZHQA 3G5TA 2UYOA 1I4TD 3PC2A 3UCEA 4ARUA 3K4HA 5K8TA 2GBLC 4WLUA 3KSAC 4XQCA 2XHEA 2GRUA 1KE2A 1Z2AA 2J3MA 5F1KA 4CG1A 1CUFA 2J5XA 4JUBA 2ONYA 3HGTA 1CB7A 4L1KA 1WZ2A 1ZR2A 5H83A 1OT3A 4DPMA 3T5AA 3T7DA 3G5AA 2IH5A 1D5WA 4FGSA 5DYWA 5G0SA 3B8EA 2P1RA 1I0ZA 3P9XA 3R6TA 3ZYZA 2XGOA 4I1YA 3T3OA 3PF9A 3O2NA 4AUNA 3UK7A 4ZEWA 4QREA 2HA2A 3ED5A 1YBFA 3HH8A 4CYMA 5JVDA 2I6XA 1C7IA 1GRVA 1A4IA 1R9NA 1UJNA 3DAPA 3FTNA 4HTFB 4QM6A 2OESA 5BN4A 1IVYA 2VJOA 2FPSA 4FLEA 4CWAA 4YJHB 1G0NA 3OEWA 4Q4DA 3IQWA 5JWHA 1VMAA 4ZK2A 1D0SA 3H2IA 1M7BA 3GCXA 4X8MA 1PX2A 3UPDA 1C9DB 3WL8A 2VI5A 2YWEA 4KQ1A 4CEIB 5ICEA 2GUWA 2IIBA 1CR0A 1ZONA 2NTJA 2P2SA 5CDTA 4P32A 1QX3A 3PYLA 3WV4A 4JT8A 2ZR7A 2DUJA 2FKAA 1J8YF 3PIIA 1IRXA 3RV3A 4I9NA 4JL8A 2K4MA 5KTOA 4DKJA 3UJ9A 4XX1A 3IAM1 4QYIA 3K1JA 4B3CA 1L5MA 3E5MA 3NS7A 1CJCA 1L4EA 3BH7A 4OMFG 5CVCA 5J5AA 1D2AA 1LSOA 3DV0B 1XJ0A 2RK4A 5B6JA 4CG0A 1Z6TA 3DFIA 1EIZA 3O4JA 4ABTA 2IZ6A 3SD7A 4C6HA 5AW2A 4C2BA 3GV0A 1MOQA 1Y80A 2IU6A 3TNJA 5JH7F 1YS6A 2G76A 4ND8A 3H9UA 3M4NA 3T5MA 3UIEA 3HJUA 4MVYA 4JU9A 1U0FA 4QFMA 2XCTB 1T0BA 1SG0A 4HB2A 4RZUA 4KHPB 3UFXA 2JGJA 2XA1A 1XKLA 2H1LA 1G21A 4JH0A 4O2BB 1E2MA 4KAXA 4J4BA 4TL9A 4BX3A 4F5WA 3DO6A 3I6QA 2RAVA 2RH4A 5I01A 3PXXA 5HUJA 1CIPA 3EXEA 4PYQA 1R6UA 4UTXA 5AHKA 4F3CA 3NWPA 4XQ9A 3LTNC 4IH1A 1JJ7A 4DAEA 1EX1A 4FDMA 2Z5VA 3FUCA 1FCJA 3FXAA 1BVYF 3I32A 3P52A 3QKWA 5ALEA 4UNIA 5F7ZA 3DZGA 2YRXA 4BNGA 4DLSA 1NP6A 4DR1B 5T4HA 4FILA 1D9XA 2EF1A 1CQIA 5E6SB 3C85A 4NU6A 2Y0BA 4PZDA 5EJGA 4YYEA 3ZIAA 1DC8A 1ZI8A 1ZRSA 1ZW1A 3UT6A 5AVWA 1BN6A 1E94E 2PEYA 3NZEA 2CJWB 1Z2CA 2PSJA 3HP4A 3NBXX 4V0KA 4ZI5A 3ZN2A 4HG2A 3KKKA 1B43A 1CERA 2GPBA 1IXZA 2F9FA 4BNKA 2WFLB 4KXFB 5KVQA 1JSRA 1UWVA 2JI7A 2XUIA 5DNVA 3HB5X 3CUVA 4N7RA 4NENB 1ZUWA 1G9TA 1GA4A 2P3QA 5CK5A 3NVKI 2VAMA 4IXWA 3WI7A 3ET5A 2G0NA 5JDIC 2ADOA 1F60A 2HHJA 2WF5A 5D5HA 1C3VA 1M6EX 5K0BA 5CHYA 2QLJA 4GAEA 4P4SA 3ROFA 1UL1X 4KO2S 1ST2A 3K8QA 2BYTA 4BMDA 3TZBA 2PA3A 4F21A 4QLOA 1U2GC 5HGXA 5BVGB 5ITWA 3CW8X 4ZCRA 1GADO 4GMFA 1BMQA 1TDJA 1M1YA 3AL3A 1PS9A 5E0OA 5B5SA 2O5EA 2PUCA 5HQJA 1JE0A 1GAEO 3QP9A 3BMOA 2B30A 4OATA 3Q3GE 2XXAB 3HCPA 5CX1B 3L7AA 2PFSA 3AFGA 2WF9A 4EL0A 3CNNA 4DLBA 2CLHB 4PG7A 3W6OA 2H7VA 5JSZB 2Z2KA 4O1IA 2YVKA 2ZYSA 1USGA 1ZD5A 4H9GA 5JCOA 3L7NA 4DZRA 3ENVA 2XEXA 3KS9A 4I9FA 4EYKA 1AKUA 2G1PA 3AZPA 4O2AF 2FSVC 3T34A 1ISIA 2OXRA 3A4YA 5FNZA 3UGQA 3USZA 5J1SB 1EUZA 3ZWVA 3G5MA 2H5IA 2QY6A 5BNWA 5EJIA 2PS0A 1V47A 1H4TA 3FVRA 4LJYA 4RIFA 1PUJA 4IVQA 3RT7A 3WK5A 4FOTA 2D7DA 4PYIA 2GFIA 1D2CA 3QH4A 4K9SA 3L7OA 4O08A 4G0VA 3E2IA 5GONB 3I01A 4ZV4A 4RL6A 1II8A 1EVLA 2IYFA 3R0VA 1ZGHA 2OHGA 2QW1A 2VJMA 3D1LA 4MV0A 1FYFA 2BUCA 4LGYA 5EZ6B 1IMOA 1XL1A 4JJAA 3OA0A 4L8FA 4ZOCA 3U3ZA 1ODSA 3ILSA 1JAHA 3AVTA 1E62A 3AERA 2C31A 2LUOA 5FCDA 3RU2A 4U2GA 1E3MA 2CMDA 3L4BC 3DT6A 3O4RA 5K6RA 5TEWA 3O3NB 1W35A 2X86A 4G89A 3ZWOA 4D42A 1GNSA 4NABA 4PSCA 2G1AA 4YP5A 3D0KA 1BA3A 3MT0A 3LZCA 1PSDA 5B57C 4RA9B 3ABZA 1BE0A 1JEOA 1XDZA 5EY5B 2YS6A 3H6GA 3S1LA 1WUYA 3EZYA 3QBVA 1ORHA 1VDZA 3E3MA 2AN5A 3LBNA 4PZAA 2SCUB 5C8YA 2HYIC 4G2TA 1S5PA 4F3NA 1CQPA 1NWHA 1HYBA 3VR4D 4RSGA 3K0EA 2AG8A 1RWMA 3IAHA 4FHFA 2F59A 1CUVA 1IATA 2CLLB 3D1VA 3WBJA 4LQLA 4EY4A 4R1TA 3TE7A 4HQLA 2E4ZA 2W83A 1X1DA 1TAUA 4IFIA 2DQZA 3OQNA 1NE2A 1JQBA 4RHCA 5IAEA 4XVCA 3KNZA 3U3OA 2V9ZA 5AVYA 1JDNA 1SUAA 1HFKA 4I3HA 2WZDA 4WCVA 3MTQA 4QPJC 4ADSG 5I47A 3MW8A 4XPIA 5JAQA 5DGDA 4R51A 3RAJA 3BWMA 2QAJA 3V8RA 1L3BA 4KXWA 3D2LA 2CV0A 4GH5A 5GJVC 1MU0A 2JFBA 2PGAA 1I80A 4MHOA 1DQYA 4B5LA 2AOXA 4JJZA 4ND2A 5IVIA 3A6LA 4CIWA 3ZWXA 2CF5A 1NQUA 4J0FA 1J9EA 1F8FA 2D6FA 4F2DA 5JD6A 4MRMB 3UWDA 3GJYA 2VSXA 4GBJA 1FUYB 3RBVA 3ZGNA 5IT4A 4HFJA 1DV2A 1CEQA 3DBRB 3JD2A 3NQ41 2QZZA 1OOEA 3OPYI 2HRZA 1NVWQ 1M2GA 1OY1A 1QFSA 4WOJA 5DIZA 4QHSA 4EPWA 1HFJA 3GH1A 4X20A 1W36B 3FZGA 4FIDA 4Q1BA 5JXGA 4MCIA 3IAS6 4QOHA 2J0QA 1US8B 1E3WA 4I1IA 4D4LA 1JFRA 3W3ZB 2EEZA 4G97A 2CNLA 3RIHA 4HWGA 3DBLB 4NBLA 5MGBA 2AOUA 2AN9A 3LBIA 3LGSA 5BVHA 1OLOA 4EF5A 1T4MA 2ZBPA 3V2IA 2IYQA 3C48A 3I9LA 3BXFA 3LUHA 1YFZA 1RM3A 3ELDA 4IGFA 1NOKA 3E6AA 2PU5A 5A62A 2VDRB 1JHMA 5FLYA 4E3WA 1P4HA 2VHTA 3CEAA 3CQ9A 2VF5X 1SXJC 2ZBDA 3BDAA 5IUNC 3WADA 2QRUA 1K7EB 4Q4AB 2A9RA 3NASA 2ZR8A 3FUVA 5JV5A 4L5JA 3CB4A 1ZX1A 3W2EA 4GUAA 5DN6A 3GFPA 5H1YA 4YJKA 1LC0A 4YAGA 1YL7A 3RF6A 4Y1GA 3WIVA 1SU4A 2VNSA 4HSEA 2EZ8A 3LW7A 3MT9A 1P3JA 4XR4A 3DLAA 4UTRA 2YV3A 2ZJ4A 2JW5A 3ASYA 4LDZA 1JBKA 3JZIA 3E8SA 3MAGA 4C01A 1UWKA 5JY1A 2NUBA 4KKVA 1L5HA 2P0YA 4W6ZA 1N6HA 2BKEA 2C42A 1D4ZA 4JEIA 4TRJA 4RTJA 4HMQA 2IJGX 2PLAA 3RUPA 1OUMA 2V9CA 3OZFA 4FE7A 1VGVA 1CZLA 2LCFA 3DWFA 4HPJB 4UEOA 3ZNQA 1QBKC 2LGJA 4ND1A 5AJHA 4US2R 4R0MA 1DPGA 4IJWA 3AP1A 1N2BA 3JQQA 1O1YA 4B0OA 4CLXA 1KZ4A 5REQA 3W3AA 1YDEA 2FJPA 4MP8A 4FJ2A 3ETLA 3IR5A 4LHZA 2W4IA 4ZO6A 4ECEA 3N0VA 1XALA 3KZKA 2O7SA 3C6QA 4XXHA 3MAJA 3C5VA 1P9RA 3WGMA 1SXHA 4A0HA 2G5PA 5TV2A 1DDOA 2C4WA 2CSUA 4QG7A 3PWKA 2D1SA 2HCBA 2GZHA 4RD2A 3KXIA 3EQ2A 4BV3A 4C0SA 4C29A 2ZBEA 4KQMA 3WLOA 2AGVA 4BB5A 4EY7A 1MB2A 4KVZA 2BISA 1II0A 5DASA 2A9PA 4IV8A 3G2QA 3KCNA 2QS9A 3AHEA 2P9ZA 5A1JA 1DBWA 2O57A 4ECAA 4Y9TA 3SQOA 1CVRA 3D2CA 3GGJA 1UPBA 1GTRA 1GTZA 1ORRA 1SHJA 2XNDD 4HQRA 5B64A 5HMMA 3K5WA 2GPNA 1OYOA 4BZXA 4Q9HA 2V5VA 3RYCB 3SLGA 1VSUA 3BCUA 3MEQA 5B2EA 3C7KA 1UK6A 4XCXA 1KEPA 3JVUA 3KU4A 3U48A 1MNQA 1W52X 1TYEB 2FPXA 2G7MC 2QM3A 2YASA 3ODGA 3ONNA 5FOTA 1XAJA 3AEXA 4MAMA 1IXKA 1X80A 1Q1QA 3WK9A 1W8IA 4GOMD 4P6VF 4BO8A 2NO7A 1EDOA 2NQ2C 3H05A 1FJXA 3WWDA 2DWCA 5K03A 1JIQA 4GYKA 4NMWA 4C0AC 4CXMA 4Y2PA 2I9KA 4R8VA 1HZZA 3DB2A 4NG5A 5KVAA 2F7SA 3P2YA 4LBWA 2A0YA 4WE3A 1NL3A 5DI3B 3EPJA 3ASVA 2Z98A 2CVHA 3SYKA 3TW8A 3UKOA 4KODA 4RJIA 1XA3A 1J2RA 1ARZA 3HCFA 4F6CA 1K98A 3I9NA 4W5JA 4OFWA 2HA6A 3HBLA 4ZDIA 4V0OA 4TS4A 1TIPA 3Q2KA 2Q6KA 1SIBE 4YCJA 3WGVA 2ZM6B 3HXMA 4FQ7A 3ZR4B 2VH2A 2JLQA 3F73A 2PMWB 5E7JA 2FPPB 3VRHA 2MYNA 1E2LA 4W1QA 1IMJA 1WM1A 3E22A 2AH5A 3IDZA 3OJFA 2X8JA 1BJKA 4W5HA 1T91A 1ABBA 3B2QA 4LHXA 4CMCA 3AYZB 3IUBA 3U1BA 3LPDA 4RA6B 4YPFA 4DFDA 1KPIA 1IU9A 5EEGA 3RVDA 4H7KA 4CL0A 5IYZF 1WDKA 2G04A 3KTDA 2VJKA 1ODKA 2F6RA 1L3IA 3I73A 4AQ7A 1F7VA 4E6EA 3S5UA 2HSEA 1N7IA 2X22A 1JEDA 2EBUA 1ML3A 3RW9A 2DFLA 3OCVA 3QSGA 1EBBA 3GGOA 4LPKA 3TE6A 1U8ZA 4RH0A 5AMXA 2ZSJA 5J4VA 3WJ2A 1MA3A 2ATVA 2DHCA 3MFQA 4HD8A 3LDHA 1W25A 3DDUA 4TS1A 4IQ0A 1H8EA 3JALA 1E6KA 1QO9A 3S1AB 3N7UA 3E05A 5MN5A 5J3JA 1WEKA 4Y6QA 3F2IA 3HQ4O 3RJTA 1FS5A 2J9YB 1RI5A 2AFHB 2G4LA 2BZGA 3PDWA 1O0BA 3I62A 5CLFA 2HIHA 2QAIA 4JSTA 1RJDA 5CG1A 2H06A 5BW4A 3WIOA 1FLVA 4KQIA 5ER9A 3S7TA 4L4RA 3ZUPA 1UP7A 5FOQA 3D1JA 3OURA 4DR4B 2MTBA 1QIHA 3GZ4A 2I1WA 2HLHA 3I37X 1ZSYA 4W1RA 1AS3A 1TO1E 3W5VA 4A82A 2H6EA 4NRDA 3A6EA 3PGVA 5IVDA 3T4EA 4E21A 4L6CA 3MINA 2YMPA 3CH4B 3CJTA 3EZGA 4NFYA 1ZK1A 3T9EA 1A8HA 2V5UA 3A3PA 4IDQA 2WSMA 2V1XA 2C4VA 1FIUA 4BQEA 1TQ4A 1XRJA 4ZGBA 1TO2E 1X1AA 1VL1A 1P1KA 1FYWA 1P7WA 1QTNA 1SUDA 2NSDA 2P67A 1LWOA 2X7JA 3IUMA 2I54A 4ILEA 5JJLA 4HXYA 2F9MA 3L6CA 1A8UA 5SY9A 1P2SA 1LLFA 2J41A 3BXGA 1V8ZA 2Z95A 1DRVA 1SU7A 3TGPA 4YUZA 3ZQKA 1DJMA 1G2QA 2WJVA 4KC0A 3L6EA 4WASA 3QSYA 3RVBA 4C3VA 2ZI6A 4QSMA 3LLCA 1D09A 1IFXA 1O96B 1N2GA 3PHJA 2BI4A 5CLHA 2ONJA 4C0QC 2G67A 2P35A 1JA0A 2QUBA 3UBTA 2BWJA 2C9ZA 3DXYA 2VIIA 4RJKA 1HDCA 1BN7A 1HFWA 3PCRB 2WTMA 4A7PA 1U3GA 2EFEB 3N58A 3SM3A 4AUMA 4BXOA 4LOLA 2CNBA 3GEGA 4LMBA 4P2BA 2JS7A 3BFPA 2IPLA 4DQDA 2GAOA 1M34B 4L02A 3AEQA 5EIWA 1ENPA 2IUTA 1Y63A 1Y42X 1V3VA 4OL0A 3HWX1 1XB2A 4ASUD 3U13A 4CUZA 4EX6A 4CEHA 1WY7A 4UU8A 3M89A 5KS2A 1LRLA 4IZHA 2OCPA 1UXJA 3Q8WA 4PHHA 4R05A 2CBXA 2PBZA 3C7DB 3HHEA 7YASA 1DBRA 2NU9B 5CB6A 3VR5A 3GXBA 3N5KA 1LTQA 1YC5A 3KHTA 2IHYA 2PIDA 4TMXA 4UEJA 5D6NA 4IHKA 4H7FA 1RYYA 2P2CA 2WHPA 5DU2A 4QPDA 5JC8A 1GU1A 2D7CA 4BIIA 2FFRA 3EMVA 3EW9A 3L0BA 1MRNA 3O1JC 4FMBB 1S8AA 4I2NA 4J0CA 4RK4A 4YGXB 4BWYA 4HDNB 4X00A 1L4MA 5AVZA 1VJ1A 3EIUA 4MIEA 4NPAA 4ZPXA 2WWHA 4DLTA 2ZYUX 1RRCA 2J3HA 3AR2A 3G2OA 1I13A 1ZIYA 1P7ZA 1D0IA 3Q5EA 4I4LA 5HZMA 4AJ4A 2FSPA 1JIKA 5FYDA 1NIPA 2CVZA 4LXHA 2JZOA 4O4JB 5ESWA 1ZD3A 1F4PA 2CY0A 3MUOA 2FZVA 5ICSA 2BEVA 3OAAA 1KYWA 3PUYA 3SZRA 1UFKA 4Z4QA 2IZOA 1ZOPA 1EKXA 2JJ1A 2WMOB 2XTMA 3PUZA 4IMJB 2ZWPA 2QJTA 5FNVA 3IEMA 2WF8A 1WDWB 3HXLA 1Z5ZA 3DVSX 4DXAA 1Z0AA 1IZ7A 1SQFA 3BMQA 3FCOA 3R0JA 2NSYA 1CR6A 4KH1A 2NN3C 3AOEC 4TUYA 1FLDA 1BGXT 1FYVA 1W73A 3LIIA 1KI1A 3PPXA 4URWR 1NQ5A 4KVAA 5FBQB 2BHTA 5AESA 2H2HA 1E2UA 4LF8B 3FTFA 3R2JA 4PU0A 2FI1A 3WLLA 3IP1A 1XCPA 3KOUA 3SFZA 2EWMA 1VRWA 3O0TA 2YHAA 3PDCA 1G7SA 2JHCA 4J7XA 3BGIA 2NXWA 1G291 3GT3A 3BORA 2AJTA 2XB9A 4GO1A 1XA0A 4WJLA 4R3WA 4EB3A 4Z3OA 1XPJA 4HNRA 1Z06A 3T99A 1MOSA 1KHTA 4PSDA 2C5SA 4I1OA 1RHKA 3E48A 4IDGA 3TD6A 3B2NA 5E1MA 2D8AA 4HEJA 1XGKA 3WGZA 4PY2A 4MR9A 1N5RA 1CEEA 4LWZA 4UW9A 3I34X 1ISSA 3RYFA 4V0ME 3UB4A 1TM7E 3OUZA 4URUR 2GOYA 3KR0A 2DFPA 3DHEA 5KWIA 1VE5A 1L5RA 1U0NA 3SQDA 1N0HA 4Z7NB 1ZJYA 4LDAA 4D0NA 1EFHA 1Y7TA 1HDIA 2XI4A 4L6AA 4O59O 5KNCD 3UMSA 1V16A 4ACAA 3ZW9A 2XVMA 4U4AA 4B3HA 4U7DA 5CA1F 3WGQA 3N0WA 4BVEA 4L75A 1YS4A 2M2IA 3DTVA 5HHTA 1G5RA 3BMCA 3FTDA 4PYMA 3KSRA 1Z8HA 4IIEA 3ROTA 4MVCA 2PTGA 4NBWA 3RLFA 3OJEA 1G5IA 2PPLA 2F90A 3UJNA 3MWJA 2AXPA 2RGAA 3FKJA 5F23A 5BN5A 3C1UA 2R7AA 3WISA 1ZVVA 1HWYA 3QUCA 4XVQA 4M99A 5IFLA 1MV5A 1NV9A 3OE7D 4GWLA 5FBZA 4JVMA 1K7XB 1L5VA 2YZ7A 1W34A 4FFLA 3X0DA 4JR1A 1CG6A 3DOFA 2ZCJA 4GQBA 2CK3A 2ZI4A 1TK3A 1FP6A 2GJ9A 4HGQA 4ZVPA 2CLKB 2JLCA 4CCSA 2RHMA 1H4SA 1H05A 2A1UA 4TT8A 3WL7A 1OA1A 2RHHA 4M0UA 2Y66A 4MVJM 3CR3C 3WDLA 3B6MA 2AG5A 4YRCA 4A0RA 4DC9A 2IYZA