3OIFA

Crystal structure of enoyl-acp reductases i (fabi) from b. subtilis (complex with nad and tcl)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
258
structure length
258
Chain Sequence
MNFSLEGRNIVVMGVANKRSIAWGIARSLHEAGARLIFTYAGERLEKSVHELAGTLDRNDSIILPCDVTNDAEIETCFASIKEQVGVIHGIAHCIAFANKEELVGEYLNTNRDGFLLAHNISSYSLTAVVKAARPMMTEGGSIVTLTYLGGELVMPNYNVMGVAKASLDASVKYLAADLGKENIRVNSISAGPIRTLSAKGISDFNSILKDIEERAPLRRTTTPEEVGDTAAFLFSDMSRGITGENLHVDSGFHITAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Enoyl-ACP Reductases I (FabI) and III (FabL) from B. subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
total genus 89
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2010-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3oifA00
4Q3CA 5A5FA 2HUNA 1BW9A 4FSHA 3DZBA 4ZQBA 5C37A 2BFPA 1LU9A 1X15A 4GX1A 4DMMA 1KERA 3KSUA 3PHJA 3ZWAA 4HNGA 1UXHA 2YHUA 3PHLA 3RFVA 4C7KA 1E3WA 1I2ZA 4L8VA 2FR1A 1I2BA 3OICA 2JD0A 3I9KA 3GVHA 4IDFA 3AY3A 1P1IA 1LXCA 1WXDA 3GLQA 3Q0EA 4RQUA 2ZYDA 1KIFA 1ARZA 3DOOA 5G4LA 2IE0A 4MO2A 1MG5A 1X7GA 1YJ8A 2E48A 3DB2A 4BKOA 2RHCA 1QXSA 1F06A 1YB1A 1EMDA 1GPDG 4FDAA 3RBZA 3DL2A 4NBTA 3TZ6A 5GZ1A 3RU7A 4HBGA 5DP1A 3V1UA 4KP7A 1HYHA 1P74A 3RC7A 4BB5A 4LMRA 2GUGA 3BIOA 1NWHA 4IPTA 3V8BA 1ZK0A 1R4NB 3E9MA 4EEXA 2JJYA 1HE4A 3JTMA 3I23A 2GNAA 3HB5X 2YJZA 3QVOA 2Q99A 1YRLA 4KDFA 1T26A 3CKYA 3FNHA 1QG6A 2FPGA 4WLEA 3K96A 4J2HA 4FW8A 3VPGA 2RCYA 4UVDA 2IODA 1WMBA 1KS9A 4PGFA 4CM8B 4IDGA 3RAJA 4R4JA 4NBUA 2WEKA 3X2FA 1RM3A 2JCVA 3MCVA 4P38A 3RC9A 4LGVA 4QSMA 4XJTA 2Z5LA 1DSSG 2NUAA 4DBZA 1VJTA 1Y5RA 3JYQA 3IJPA 4G2NA 1V3UA 4A10A 1DC4A 1B8PA 1ZXLA 5T8KC 3LLSA 1HF3A 1GCUA 4XB2A 4YACA 5IZCA 5T6BA 1ZVMA 3OJ0A 2GZ1A 3ITDA 3OJFA 4CMJA 3RUFA 1UP6A 1PGNA 4U5QA 3Q9UA 3RFTA 3IQDB 1HDXA 4KUGA 5T5QA 4Q9NA 1XQ1A 4XX0A 3WTCA 2I66A 1UZLA 3QE3A 1KEPA 1YQDA 3R1IA 3WS7A 2G76A 3AU9A 3U4IA 4FFMA 1YDEA 3D5QA 2ZTUA 4U6SA 4J1QA 4CM8A 1K6JA 4Z3KA 4CMIA 4ZRMA 4BNIA 1O0SA 1QKIA 1HRDA 4XJSA 4Z6KA 4E5MA 3GRPA 1EE2A 5A1TA 4XCVA 2O4CA 1VJ0A 3VOSA 1XHLA 1Y8RA 3LC1O 1RM5A 4ITUA 2YYYA 3UOGA 2QW8A 3VH1A 1QMGA 4R9SA 1T2AA 3GDFA 3KUXA 4LN1A 4A7PA 1U9JA 4TKMA 4AJLA 1SB9A 2GGSA 2YUTA 1HDCA 5C7LO 3LU1A 3VZPA 6LDHA 4QFCA 5F3RA 5LCXA 1WP4A 5GMOA 3GMDA 1FXSA 1RM0A 3KYCA 3RUEA 3QLJA 4WOKA 2AG8A 5F5LA 1T2FA 3C1TA 1EUCA 3ZWYA 1LDBA 1YBMA 1N9GA 4IZHA 4LCJA 4ND3A 4FOSA 2CDAA 4JP2A 3VHRA 1HYGA 1IE3A 4HKTA 4IS2A 4EJ0A 1K5HA 2EKPA 4R68A 2E4AA 1PS0A 3BTSA 3H2ZA 1ZXBA 2X0JA 3GFBA 5U9CA 2DKNA 1PGQA 4NBWA 3RASA 1B2LA 1QYDA 1LLQA 3IP1A 4X54A 5TJHA 4AJJA 4EJMA 3GNTA 1IB6A 3H9GA 2VN8A 2HU2A 2I5PO 5AXDA 3ZZNA 1E1LA 2GF2A 3K73O 5FF9A 3IP3A 2GCGA 1PU2A 1C0IA 1YL7A 4N18A 3Q6IA 3H5AA 4PFJA 4HADA 3BMCA 2WE8A 1KYQA 2VHXA 3X2EA 4BO2A 2UDPA 2VYNA 3EGOA 4NU6A 3SJUA 3VVBA 4RZIA 5THKA 3GHHA 2G5CA 4KQWA 3I3OA 5DT9A 4DYDA 4R69A 3Q3CA 4YCAA 1X0XA 1RPNA 3T7CA 1S6YA 4RVHA 3LLVA 1U8FO 4CLEA 1ISHA 4J7UA 3K30A 5ER9A 4J49A 4AFNA 3U9LA 4IMRA 2I3GA 2YDXA 3U09A 3ZV5A 5JY1A 2FHSA 1BXGA 3FPCA 3GNSA 4GX5A 4LSMA 3PVZA 2NV6A 1B3BA 4CM5A 1DBVO 4RVGA 1WDMA 4JROA 1EK6A 1F8GA 1T2DA 3ROKA 3UVEA 3PYLA 3AFNA 1NVMB 1MXHA 1MB4A 2FP4A 4J1SA 3BMOB 3JQ7A 4BGUA 3P2OA 4YJDA 4Y8VA 4CLDA 1DC5A 3AM4A 1GQYA 3WX0A 4I5DA 4BIIA 1B8UA 3VVCA 1CJCA 3KM0A 1PIWA 1Q2XA 2CY0A 5K6AA 1ISJA 5TQVA 2C59A 4LSWA 1ONOA 3IIEA 4NH4A 1XSEA 4AJNA 4RDHA 2FPPA 3NT2A 4ONEA 3WTBA 5GZ6A 1IZ9A 1K2WA 4LRTB 1ENOA 3NX4A 1M67A 1PJBA 5BNFA 1O95A 1GUZA 2QRKA 3ONFA 2UYYA 3GDOA 4XGNA 4PG5A 3SXPA 3PFFA 1TA4A 2AXQA 1Q0HA 2FMUA 4LMPA 2Q2WA 3RD5A 3S2FA 4BNUA 3RJ9A 2FSSA 4W9NC 2VWQA 1KEWA 4BNZA 4HV4A 1LC0A 3ZWWA 2EW2A 5JCXA 1C3VA 2PH5A 4JXKA 3A1NA 5ILOA 3DMTC 4BO4A 5JO0A 4NG5A 3WWYA 3VPFA 5DOVA 3GUYA 3JSAA 1EDZA 4FGSA 4IQGA 4CQMB 2HK9A 4DWVA 3TFQA 4XYLA 4AVYA 2Z1NA 3DXFA 4D42A 4DL9A 2FY8A 3CZMA 2P2SA 3HSKA 1F12A 1ISIA 3K2EA 1OBFO 4R5HA 3INTA 3BXXA 3PIIA 1HDGO 2JCXA 3W6ZA 3WNQA 2EIHA 4FBGA 3BMOA 3PFWO 3TZKA 1GYQA 4FJ0A 1ZNQO 1KVUA 4O0LA 1DAPA 1HE5A 1DHTA 2PK3A 3DAFA 1Y9AA 1ISGA 3FWNA 1PGPA 4TVOA 3NGLA 3GDGA 1PL8A 2HCTA 1GZ3A 4LVUA 1JAXA 2PH3A 1XIVA 5IAAA 4CLOB 3JQBA 4PIVA 2NNLD 2ZJ1A 1J6UA 3GH3A 3Q11A 3NTRA 4JBIA 3EAGA 3KB6A 2YY7A 1VM6A 1PZHA 3K8ZA 4WUVA 5EN4A 4BNTA 3P19A 3D3WB 1BDBA 1B8VA 3DONA 1G6KA 1MGOA 1NQTA 2UAGA 2AQKA 4EBFA 4GQAA 4Q3NA 5FI5A 1UXKA 2AEMA 1F0YA 1ZFNA 1U8XX 3D4PA 3GEDA 2QRJA 3PDUA 2CVQA 4C7JA 2NTNA 4RLSA 4XD2A 4J90A 1P77A 4NBRA 4KOAA 5A9SA 3ZWOA 2NWQA 2Y1OA 5GZ3A 3OA2A 4LISA 1PS8A 2PKQP 3OFSA 4K9DA 1E6WA 1PL7A 4OM8A 4AJ4A 1CETA 1XQ6A 2GERA 4E2WA 3FR8A 1A7KA 2PZMA 4DQVA 3CZRA 1F8FA 1E7QA 3NEPX 3F9IA 3QV1A 3D4OA 3ASVA 5JDIA 1RWBA 5CEFA 3MEQA 1I0ZA 1YB4A 5FYDA 2EG9A 5IFLA 5EQDA 2W2LD 2RIRA 1YS4A 3PZBA 2PNFA 2X9NA 3ANNA 1VPDA 5CFZA 3H8VA 1EE9A 1C0KA 4FFLA 1HSZA 4NMHA 4XQCA 4NU5A 5A5EA 3EC7A 3E5MA 3OIDA 4ND4A 3JD1A 3ORFA 3TSCA 3ZH2A 2Y68A 4CLRB 2ET6A 2CUKA 2Y99A 4PG6A 3R6DA 5EQFA 3JQAA 4Q3AA 5KVCA 1HZJA 1O5IA 2C07A 2DU8A 2YDYA 2PGJA 1HL3A 3ONDA 3JQ8A 3NT4A 3F5QA 2DC1A 4M54A 5AVOA 4BO8A 4OMUA 3SJ7A 1M2WA 3ICCA 4EUEA 4D3DA 1YQGA 3BMNB 1M75A 3HNPA 1P1HA 4CMEC 2G1UA 4UEOA 3NDRA 4CR6A 2HMWA 1IL0A 5C7IO 2OO5A 3TZHA 5CPBA 2FZEA 3GZNB 5ADHA 1HTBA 2A92A 3OBBA 3UN1A 4BNGA 3AUAA 5A03A 1EFKA 3L77A 3E48A 4G5HA 4UUOA 4E5PA 5FEUA 1EVJA 1VC2A 4Z0HO 1HE3A 1N9GB 2J3HA 4WE3A 1V35A 2ZYGA 3D64A 1XWFA 4GVLA 2C54A 2PA3A 2DAPA 4YA6A 3KYCB 5ICSA 1PL6A 3MTJA 4W82A 5A3JA 1N1GA 3S2EA 1BTOA 3H2SA 3T4XA 2GPTA 1QORA 3MJSA 4CMHA 1JVBA 4BHTA 4TZKA 4E5KA 4J0FA 2QZZA 2O3JA 3DZGA 4I5FA 1PJSA 3QVXA 3PHIA 2DPHA 3RKRA 3VDQA 2Y1EA 3GAZA 4CQLA 1YKFA 4GMFA 5DCWA 4AICA 1BHSA 3GA0A 1H0KA 1YL6A 1T1RA 3ROMA 5K0ZA 2AE2A 1UJMA 1WAMA 2NU8A 3WQQA 1IULA 5TNXA 4RLHA 1GQQA 2B0JA 1LDGA 3U5TA 5CG2A 1I30A 3RUDA 4PG8A 1SO8A 4OSPA 5BSFA 1TI7A 2WD7B 1ZIDA 1P0FA 4J0EA 1A7AA 3V1TC 2QRLA 5EL0A 1G1AA 4EUFA 5I9MA 4GKBA 4RJTA 3RUAA 2DTDA 3PYMA 4J4TA 2SCUA 1LQUA 3GZNA 1NFQA 5KCZA 3AFMA 1BVUA 4YT2A 4WLFA 1N92A 2VWPA 3NJ4A 4BO3A 4CL8A 3EZLA 1PWZA 5KVVA 1E6EA 4XA8A 4I08A 3TDKA 1KEUA 2LDXA 4BNJA 1YDWA 2P91A 2PGLA 4JIGA 3ZU2A 1HKUA 1LRKA 3N7UA 3ZN2A 3HQ4O 2GYYA 1M66A 1JN0A 2E82A 1JDJA 4HFMA 4CM3A 3D0OA 3UF0A 4D0RA 1CDOA 1QV6A 3INRA 3JQAB 2BKAA 2ZB7A 4DC0A 5C3MA 1ZJZA 3TOXA 2NVWA 1PEDA 2D4AA 1YO6A 2NU6A 4YAEA 3B1JA 4CUKA 5I8WA 4RQTA 3KSZO 1PTJA 1OMOA 5HWSA 1NAIA 2WSBA 5TF4A 1L7DA 1GEGA 3O8QB 3P2YA 4AJEA 2Y0EA 1B15A 3F6YA 4N5MA 3RBVA 5L4NA 1I2CA 1ZEJA 2OXIA 4BNXA 1E1KA 1TT5A 3F3SA 5DBFA 5TGDA 3WLEA 1AN9A 2B36A 3GC6A 3L6EA 2NU9A 1ENPA 3WQSB 3SX2A 1UDBA 1NPYA 5A9SB 2G82A 3HDYA 3TJRA 4R1NA 5F21A 3D4NA 4RVSA 2X7HA 3KYDB 3W6UA 4JLWA 1AHIA 3AOEC 1GUYA 1X13A 3U3XA 3JQFA 1PJ3A 4MVJM 1YB5A 2ZCUA 2IXBA 3UW3A 3SBOA 1UXIA 4W7HA 4TRMA 3H5NA 2P9CA 3ZWNA 3RC1A 1NPDA 2HAEA 4CM6A 5TT1A 1H94A 2VYVD 3DBVO 4DQUA 4IINA 4YT4A 4N7RA 4QFDA 4R16A 4D41A 5MDHA 5JDCC 4B4OA 3ROPA 4MVJA 3NYWA 2YV3A 4RPLA 4UUNA 1TT5B 2X9VA 1YBVA 4GX2A 3B70A 3VZRA 3DAPA 5COQA 1I24A 2EW8A 4MINA 3WMWA 4BKRA 4TVBA 4CV1A 4Y67A 4DQXA 3HJAA 4KQXA 1EBFA 4EITA 4CJXA 3PK0A 4O59O 1GDHA 3NUGA 5IDYA 3WQRA 1K3TA 1ZK1A 3QWFA 3UICA 1JLLA 4BO1A 2EJVA 1GZ6A 3NTOA 1IHYA 4FFRA 4PLTA 3AK4A 3QHAA 2X58A 1Y7TA 2VCYA 4K6CA 5ICMA 2ZB8A 1A9YA 3JYNA 2GO1A 3SC4A 1HWYA 2R00A 1GV0A 2O3SA 3DO5A 3M6IA 4CPDA 4UUMA 2X0RA 3GY0A 3I52A 1MXFA 1PJTA 2ZB4A 4R01A 1GR0A 1VKNA 1J4AA 5T67A 4N54A 1VSVA 2VRCD 4WLOA 5AQ1A 3BTOA 1AXEA 1LLCA 2J5KA 1KY5A 4CM4A 1V3VA 4PLFA 4XZ3A 3ZWVA 3BA1A 2H6EA 4M8SA 3AI1A 4YB8A 1CIVA 1ZO8A 2O50A 2UVDA 4MVJI 4PCVA 3O9ZA 3Q2IA 4I9HA 4GWKA 3ULKA 1P33A 3V2GA 4BB6A 5L95A 2Y67A 4XYGA 1O6ZA 3BZUA 3S8MA 3QQPA 3SC6A 3BAZA 3EK2A 4YTEA 2AEJA 4OSOA 1D7OA 3DDNA 3PQFA 4XQEA 4EZBA 3C24A 4RDIA 1B26A 3H9UA 4QO7A 4YAKA 3ETEA 1R4MA 2HSDA 2WD7A 1P1KA 2YV1A 3PJEA 1A27A 4E33A 1FDVA 2WMDA 2D3TA 2ZYAA 3N74A 5JMWA 1PZFA 5KJ6A 2E6UX 3PHHA 3DOCA 4L0QA 2B4QA 3OP4A 5EIOA 4B79A 3ANMA 1NNUA 1H6BA 2V7PA 5KKAA 3RSHA 5I8ZA 3JQBC 3T7EA 4AJOA 3OSUA 3WWZA 3DZIA 4OYRA 1R15A 3FTNA 1CF2O 1VJ1A 2EV9A 2P9GA 3JYLA 1SNYA 4D43A 3W8EA 1XEAA 2ZCVA 2Q1SA 4PRLA 4ZQGA 4R5MA 4MP3A 4R1SA 3ZU4A 1MLDA 2X0IA 4YAGA 1P44A 1MP0A 2QIOA 2WWRA 5JPIA 3TRIA 1TXGA 1I36A 4DUPA 4XYMA 4XQGA 3PQEA 2OBYA 2Y1FA 4HP8A 5IG2A 4UUPA 3IUPA 1ENZA 4FJ1A 4A2CA 2BGMA 4Q3DA 1GCOA 3U49A 4YT8A 3A28A 4WNIA 1VKOA 3AM5A 2DBRA 4KMSA 1E77A 1V6AA 1GAEO 3CINA 4E2YA 1DEHA 1I32A 5KOIA 2ZIZA 3GFGA 3KXDA 3ETDA 4WJZA 4Z9YA 2UV8A 3OQ6A 2P5YA 2IRWA 9LDBA 1CYDA 5ER6A 3OQ1A 5JC1A 4ZQHA 2VHWA 4GGPA 2ZB3A 5A06A 1DB3A 4II2A 4IQ0A 4EYEA 3PHGA 3WFJA 2D5AA 4TMFA 3GVCA 3LZ6A 3IKVA 4FFPA 5G0VA 5HM8A 5G2OA 5IDXA 3G0OA 5CDUA 1EQ2A 1UZNA 1EVYA 3PZRA 4XEHA 4W4TA 3E1KA 5U1PA 3WIDA 1UUFA 2CF5A 5DULA 4P4GA 1B16A 4AJPA 1TEHA 4WCFA 2C2YA 3HDQA 4MP8A 5DBIA 1MA0A 1WW8A 2W90A 4GLLA 3H65A 1BRMA 2X22A 2XXBA 2ZTMA 3NDJA 1YVEI 1LBEA 3CSDA 2CDBA 2VHZA 4BV9A 3AUSA 1E1MA 3OIGA 2JKVA 4XRGA 3QW2A 3WGHA 2WD8A 3MJTA 1KBZA 1EZ4A 2BELA 3TL2A 7MDHA 3MZ0A 4A5OA 1I5RA 4FFNA 3DZJA 3DTTA 1DRUA 1ID1A 2CZCA 1H6AA 3OECA 1KVRA 2PY6A 1KC3A 3ZV6A 3G79A 2VUUA 4OGWA 5DZSA 3MOGA 4LW8A 4HFJA 1LUAA 3DBLB 2DBQA 3LT1A 4DVJA 4FN4A 7ADHA 1YBAA 3IS3A 2QZ9A 3E5RA 1WZIA 1J49A 5BNIA 3VH2A 3JQCA 3D1LA 1GD1O 3KSDO 1A72A 1PQPA 1OC2A 1U4OA 2I65A 3ST7A 5L7TA 4U6QA 3JD0A 5T64A 3BTVA 3B20A 4IZIA 4J6FA 1DIHA 2JFGA 1OAAA 1E7RA 1HDRA 1HSOA 5JAIA 3H3FA 4GAEA 1A4IA 4MKRA 4Q39A 4RPGA 1DXYA 4NFYA 2J8ZA 1H9BA 1W0CA 1PQUA 3W8DA 1LLUA 3LT2A 3LVFO 1Z7EA 1PJQA 1M6WA 1YGYA 3EUWA 3U62A 3ZNQA 2ILTA 3CXRA 4IS3A 3GUCA 1N5DA 3FR7A 3ENKA 5CPFA 1SEVA 1ENYA 5JCJD 4OKIA 5A4DA 5TIIA 5FFFA 1UR5A 4E12A 3RROA 1I3LA 2C20A 1A4UA 2BF7A 4OQZA 4F3YA 1M76A 5AXAA 4WOJA 4Q3EA 4TSKA 1VI2A 1EK5A 5MGBA 2OGUA 4L9RA 1KY4A 1PJCA 3QWHA 4BO6A 3RC2A 1OOEA 3RWBA 3HDHA 1EEHA 1HDZA 1PS9A 1SEPA 1CERA 2Q2QA 3A9WA 3VTFA 1DC3A 2NVBA 3L9WA 5DP2A 2W2LA 1WPQA 2BD0A 1L1FA 3DQPA 5G4KB 1B14A 1SB8A 4FPXA 4F6CA 2QG4A 2DQ4A 1NVGA 3INGA 3JQFC 2B35A 3AU8A 1DFGA 2PD4A 1YOVA 2IZ0A 2F1KA 3DHNA 4P4LA 3EW7A 1NR7A 1ZJYA 4RCVA 3O26A 1N8KA 3GK3A 2D0IA 2O3RA 4D3FA 1ONPA 3I6IA 4CM4B 1VLLA 5EJ2A 5FI3A 1LA2A 4GMGA 2B4TO 4JJGA 4Z9FA 4EI2A 3K5PA 4ZA2A 2OORA 1SPXA 3B6ZA 1V8BA 3FPLA 3O4RA 4IUYA 4BGIA 5CEEA 2B37A 3PEFA 4DPKA 3EY4A 3L07A 1NQ5A 4BNWA 4MVJD 1YXMA 3MWEB 2Q2VA 2VZ9A 4BMSA 4M1QA 4E30A 3FI9A 1JA9A 2DT5A 2VNAA 2F00A 4XRRA 3I9JA 1P45A 1K6IA 3ONEA 4YAIA 3I4CA 3AWDA 1NR1A 2PTGA 1H6CA 4DREA 3UHAA 3WSWA 1LDNA 3C7AA 3VPXA 3QVSA 5F1PA 1P0CA 3OH8A 2X6TA 3EDMA 1JAYA 3RFXA 4BKUA 4DYVA 3A4VA 4OOEA 4J1NA 3CTMA 3KO8A 4UAGA 1V3TA 4HWKA 4YRAA 3CE6A 3FWZA 3RU9A 1HT0A 4I5EA 4YYZA 3OA0A 4U8GA 3R0IA 1YOVB 1G0OA 1UXGA 1E3IA 3AOEA 5JE8A 2Q1WA 4J91A 2OHXA 4J1TA 4WK6A 3PJGA 1IPFA 3EHEA 3DBHA 4IJUA 3E8XA 4WKGA 3ADPA 4XR9A 4K28A 1D3AA 1Z74A 1R0LA 1C1DB 2NQTA 2YFQA 2VHVA 4URFA 1U5AA 3MTGA 1NVTA 1OFGA 4RF4A 4O5OA 3ENNA 4OOFA 2D8AA 4ALMA 3IL2A 4H15A 4PLHA 3TPCA 2QX7A 1Y9EA 2Q1UA 3BMQB 5KIAA 4RPJA 5B37A 4CUZA 1DRWA 2CFCA 3GT0A 4INAA 4J9VA 4YQYA 4J9UE 1NFRA 3K6JA 5EESA 2B5VA 4P8RA 2CVOA 4YT5A 5T8KA 2AQIA 5G0TA 1NPTO 3JCZA 2EGGA 3GPDG 4MOWA 1XELA 5CDGA 4L4SA 3VDRA 3EVTA 4UEKA 2Q3EA 5B1YA 2HJRA 2I3AA 2Q49A 4ALIA 1I3MA 4R1TA 3M1AA 3LQFA 4QT0A 3I4FA 2VZ0A 3BYZA 4W7IA 3UH1A 2BI8A 1M6HA 4MIOA 1NQOA 2R00C 3GR6A 3R3JA 3JQ9C 4FIZA 1QP8A 3RJ5A 1UDCA 1NBOA 5H83A 2WDZA 2POQX 1NX6A 1T25A 5GY7A 4L75A 2C7GA 3LK7A 2PZLA 3H7AA 2X5OA 5COBA 3I9LA 2VZ8A 3RI3A 3PLRA 2UUOA 4B7XA 3P5SA 2HO5A 1H93A 1Z45A 2J5QA 5H81A 3KVOA 3H9QA 3GGGA 1H9AA 4RL6A 2WYVA 4OHUA 2VUTA 2D2IA 2Y93A 1RKXA 4UREA 4JN6B 4AJHA 3FTPA 4UVEA 3RCBA 1HDYA 5BQFA 2TMDA 4CV0A 1R37A 4B3HA 5I9NA 3ADOA 4JGBA 2ZK7A 3TWOA 2OOSA 4EDFA 1ZUD1 1EFLA 3DAGA 2JFFA 3AOGA 3G49A 3VKVA 2IXAA 3JQGB 4XYEA 4FFOA 1GEEA 4U0KA 1U7HA 2Z1MA 3RIHA 3H9EO 3OJOA 2C2XA 1U3TA 5CDTA 2NSDA 3E82A 4MVJE 4R51A 1LDMA 3FCOA 1JKIA 1GZ4A 3WIEA 5JW6A 4NJMB 4CMAA 1U1IA 4OXKA 1DIGA 1ZK3A 1WMAA 2PKRA 3ANLA 4PZEA 4CM9A 1SMKA 3NTQA 2X1HA 4PLCA 3RUHA 1LSUA 3U4HA 4YJFB 2EF1A 1DC6A 5COAA 5BSEA 1ONNA 3W4IA 4DLBA 5KVSA 3TZCA 3WGTA 1SBYA 4HXYA 4MIEA 2HRZA 4DA9A 3GHYA 4E6PA 2YW9A 1BXZA 2IYOA 1P1FA 5DCUA 2VYVA 5IDWA 2OFPA 2OUIA 3F47A 2GD1O 4KZPA 2EXXA 2NLOA 2PD6A 3ZWXA 5IJZA 1ZSNA 4G65A 1BWSA 4GL4A 1N2SA 2CF6A 5JNLA 1UH5A 1NM5A 3DTYA 3ZWPA 3RUCA 5CDYA 3ZGYA 2GZ2A 3C1OA 3CIFA 2VOEA 3PPIA 1MC5A 3AI2A 1Y81A 1FMCA 4U0JA 5TS3A 2D5CA 3AY6A 1GL3A 3OJEA 4DBVO 4NHEA 1DRVA 1E0DA 1J5PA 1XGKA 2HMTA 1CEQA 2DBZA 2HMVA 4UEJA 2GASA 1DLIA 4L4XA 2I67A 4HFRA 4LCEA 4OH1A 1JQBA 5DF1A 1RJWA 2DFDA 1ZKMA 2H5LA 2VWHA 1LLDA 3S55A 4XIJA 1HDOA 2HDHA 3AW9A 4NFSA 1HE2A 1Z73A 1GV1A 5BSHA 5L4LA 4TRRA 2FPIA 1K6XA 3K31A 3FHLA 4BKQA 5B12A 1GU7A 4YJHB 4BUCA 4YJFA 4BVAA 2VQ3A 3VPSA 1QLJA 2X9GA 4L74A 5AXCA 3F1KA 4Y98A 3STHA 1KVTA 3CPSA 3FNGA 4W9NA 1KVQA 4BGVA 4Y6PA 1MUUA 1VSUA 1LQTA 5CAEA 2VRCA 4XGKA 4JP3A 4KDEA 5IXYA 4QUKA 2O3UA 2X5KO 4J43A 3JYPA 3JQDA 4M89A 4CMEA 1DPGA 1W6UA 3BHMA 3I9OA 3I1JA 2FZWA 3ZI0A 2VT2A 5KNLA 4ND5A 5BNTA 1E7MA 1Y1PA 3GVIA 1DHRA 4I8XA 4JJIA 4Q3BA 1PSDA 4J16A 3WGZA 5IZCC 5J23A 5ES3A 1XU7A 2P4HX 2NTVA 3NDIA 2AA3A 2CNBA 2GDZA 4OL9A 4WGGA 1X7HA 4B8ZA 1U3UA 2W98A 3VAZA 5THQA 1E7WA 1E3WB 5LDGA 4A03A 1UP7A 4MVJH 3E9NA 4ZVVA 1CQIA 1XA0A 4HNHA 3WICA 5JCJA 3A14A 1B7GO 4B7UA 1T4BA 3JD2A 1VL6A 3U0BA 2PZKA 2YHIB 2NM0A 3GF4A 5A9RA 2Y1DA 2O3TA 4CLOA 5KTKA 3VTZA 4GSKA 1JWBB 2Q45A 4RF3A 4XWYA 5F5NA 9LDTA 3WR5A 5TJ9A 3FSRA 2PR2A 5L40A 3FF4A 1J0XO 1AE1A 3R3SA 3F4LA 3ZU3A 4IIUA 4R3NA 5DBGA 1UZMA 3LYLA 2EGHA 1U28A 3DBRB 3PYXA 4ILKA 1DLJA 5ILGA 4CMCA 2EEZA 2OL4A 3MWDB 1C1XB 2IEDA 5JAQA 2IEBA 3AUUA 3Q2KA 3L4SO 4Z3DA 4OKNA 3G17A 3GN2A 3O38A 1X1EA 1R4MB 5G0WA 5KWEA 1PR3A 1XR3A 2H9IA 4YJGA 5L7YA 1DDOA 3BMQA 3HZZA 4OIMA 3Q9NA 1RM4A 4R1UA 3MJVA 4E21A 1B3RA 2BMAA 4J7CA 3HHPA 3KHUA 2HRBA 2XXJA 5L3ZA 6ADHA 2A4KA 3WLFA 1D4FA 3V5NA 2BI7A 3HE3A 3KLPX 4IXWA 3WB9A 2PLAA 5B4TA 3DWFA 4E5YA 4EUHA 5HS4A 3UKOA 3PQDA 2JFHA 2BGKA 3MOIA 4CM7A 4BNYA 1SC6A 2J5RA 2B4RO 4GKVA 4JQCA 3ZWBA 5JSFA 4TZTA 1XLTA 1QYXA 2V6FA 4FC7A 1YL5A 1EDOA 1GYPA 2HK8A 3QP9A 2W2KB 4KUEA 4AJKA 1UAGA 4NI5A 4OQYA 2O3QA 1FJHA 1GTMA 1D8AA 2VYND 1LI4A 4YRDA 3I9MA 3LC7O 4WEOA 3UGKA 3FNEA 4DIBA 2ZQYA 1N7HA 4IJKA 4QO8A 4E31A 2AG5A 1PWXA 4A26A 2FSVA 1TLTA 3FN4A 3UXYA 5I7VA 4BO9A 1WDLA 4B4VA 4CM9D 4PLWA 3ETGA 3I9NA 4BMVA 3ZHXA 4D45A 2I99A 2HLPA 2O7SA 3WBFA 3BMCB 2C82A 3PDJA 2ZATA 5IXSA 4K1LA 3ZW9A 1EVIA 4XKJA 4A27A 2PWZA 4PLYA 2PGDA 4MJLA 3L0DA 3ZNPA 2YV2A 4EJ6A 4QQRA 2NACA 4JNKA 2HK7A 3WYBA 2YFHA 3PJDA 4FOOA 5G4KA 1LEHA 3ON5A 2J6IA 3FD8A 3HWRA 2YQ5A 3DOJA 3EVNA 4J2OA 3H6KA 1HLDA 4L73A 3KEQA 5L7WA 3KYDA 4DGSA 1ZSYA 2Y1GA 3DZFA 4NK4A 5F1OA 3HDJA 1BGVA 4ZD6A 2B69A 3MJ4A 3ZHZA 3DMTA 1ZK4A 3IDSA 2RH8A 1IHXA 2UUPA 2VOJA 1P31A 3QWIA 3FBGA 1NFFA 4NBVA 4C4OA 4HX5A 3PJFA 1CWUA 1G0NA 1I33A 4IM7A 2DM6A 4OXNA 4YJGB 5DNAA 3M1LA 1PGOA 2IDZA 1YE3A 1LX6A 2NQ8A 3OJLA 1P1JA 4YVFA 4YAJA 5CDSA 3JQ7B 2OP1A 1DO8A 2Y0DA 1U2GA 1FF9A 2FR0A 3T4EA 2C5EA 3AI3A 3O8QA 3OEWA 3F5SA 4UVGA 4M55A 2D1YA 2VUSA 2QYSA 4BNMA 5ITVA 4YWJA 3MJEA 1BXGB 3F1LA 5KJ1A 4WASA 1JVSA 2JHFA 1CQJA 1LSSA 4YJHA 4CMGA 2Q4BA 3HN7A 5EPOA 3TOZA 4BQPA 3GN1A 3DC2A 5JO9A 4PZDA 5EMHA 5L51A 1BDMA 1HZZA 4IDEA 3HB4X 3KOUA 1EUZA 5TC4A 4I1IA 1E3LA 1LTHR 1ISFA 3WXBA 2DTEA 2OZPA 1KETA 5CP8A 1JKJA 2FRDA 1O89A 3OM9A 4BO0A 1I3NA 1JW9B 4GGOA 1Q7GA 2WTBA 1RYEA 1UXJA 1DFHA 4FD3A 8LDHA 1N7GA 3L4BC 3TL3A 1YH3A 4ZJUA 1PX0A 5KKCA 2X86A 4OAQA 1F14A 3GMSA 4WNCA 1DIBA 1ZMOA 4XR4A 1NTOA 4UULA 2GRAA 3PXXA 2OP0A 3WYEA 2DVMA 5DN9A 3E18A 3G1TA 5CG1A 4B3IA 4PLZA 2HQ1A 1FDWA 4Y6SA 2Z95A 3LC2O 3PGJA 4W6ZA 3OEYA 3HUDA 4BO5A 4BV8A 4FS3A 1VL8A 3SLKA 4KUHA 1VL0A 2Q4EA 3WGIA 4YR9A 1S7CA 4ZRNA 4TKLA 3TQHA 3CUKA 4PLVA 3BMNA 4ZGWA 4FB5A 1E5LA 3NAQA 3NV9A 2VTDA 3QWBA 2FOIA 2O2YA 1K0UA 1MV8A 1NXQA 5JXWA 3D5TA 1R4NA 4CR8A 3VZQA 2BFMA 2EHDA 4CQLB 2IZ1A 3GG2A 1NP3A 2A9FA 4RVDA 4WCFB 4K26A 1IZ0A 1SCUA 1IUKA 2B5WA 2NVUA 2RHRA 3GEGA 3KLMX 4NIMA 3WDSA 3GGPA 5JLAA 2AW5A 4D46A 4GBJA 4W99A 3RUIA 5TSDA 2G0TA 4ZHSA 3PI7A 3WG9A 1IPEA 2Y05A 3O03A 3BHIA 4TWRA 3B1FA 3JYOA 2BHLA 3WGQA 1N1EA 4XB1A 2VWGA 3C7DB 1Q0QA 4KWHA 4IIVA 1X0VA 5EERA 1I10A 1Y8QA 3QRWA 4CLXA 4M49A 4IMPA 5CHEA 3IC5A 2I6TA 2C5AA 3U4CA 4O1MA 4RVUA 2EWMA 5JBIA 1C0PA 1JWAB 4WCDA 2C29D 1QSGA 3QIVA 3P7MA 4WLUA 3ZNOA 2XOXA 3COSA 3FBTA 5I7SA 3KETA 4FGWA 5JMPA 1XYGA 1OI7A 4XYBA 2V6BA 4CQMD 4PG4A 1DAOA 5B4VA 1T1SA 3RKUA 4DLAA 5JC8A 4BNNA 2EKQA 2DTXA 1WDKA 3GEMA 1BG6A 5HBRA 3GGOA 1FDTA 4IY1A 2Y0CA 3GPIA 4J3FA 4XIYA 4NQZA 4ZICA 5AOVA 4CR7A 3JD3A 2P68A 1Z75A 1BXKA 4IXTA 3RBXA 2NADA 2HJSA 4JCOA 4MIYA 4E4YA 3V2UA 1NYTA 1PGJA 1O94A 2PV7A 4B8WA 4FC6A 1PJ4A 2X23A 2GR9A 1VRWA 4NZ9A 3M2TA 4RO0A 4DXHA 2D59A 1ZMTA 2PD3A 1E3EA 3DHYA 3CMCO 4DPLA 4HUJA 3IJRA 2VHYA 2GN4A 3BTUA 1VE9A 3F46A 4E0BA 3ICPA 4RV9A 5C5IA 3JQGA 1LSOA 4ND1A 4GVXA 1EQUA 3AUTA 3OF2A 3QY9A 1ZBQA 2NU7A 1LC3A 2X5JO 3ZNNA 4F46A 4R3WA 1HETA 4K6FA 3QSGA 4GX0A 4BS9A 4AG3A 4PG7A 1MX3A 3GOHA 5KJCA 2JL1A 3GQVA 3A06A 1W4ZA 3TN7A 3G1UA 4DLLA 3JQ6A 5L9AA 2QQ5A 3HFSA 1LJ8A 5JAZA 3ZW8A 4DPMA 1ULSA 3JQEA 3JQ9A 1H6DA 2JHGA 2QHXA 4D7AA 5JS6A 5L45A 3IAHA 1DIAA 1TT7A 4L4RA 5EINA 3N58A 1SOVA 4D3SA 5G0SA 3VC7A 3QJ5A 4ROSA 5HS6A 4I9NA 1EVZA 1QYVA 1X1TA 3EMKA 4J7XA 3WYCA 1HXHA 2G17A 4GI2A 4BNFA 1E3JA 3WMXA 4RVFA 1E6UA 4XDZA 3V1YA 1MFPA 3H5RA 2B83A 1B0AA 2AHRA 3ZDFA 1YJQA 4IBOA 2ZJ0A 4IDCA 3VH4A 5JYDA 4JJFA 4YPOA 4LRSB 3WNVA 3LDHA 1WZEA 1Q7CA 4ZQFA 4XDYA 5ENDA 4IDDA 1ZW1A 2YZ7A 3H9JA 1C0LA 4O63O 1OZAA 3PWKA 4LK3A 1PZEA 4AJ2A 4E32A 3HG7A 4Z0TA 2O2SA 3H3JA 1Z82A 1E7YA 1IYZA 1R12A 4NPCA 4NNJA 1I01A 3IOYA 4WEQA 5FWNA 4TRJA 1QR6A 2DFVA 1E1NA 1QLHA 2I76A 4E5NA 3QWAA 1LDYA 5TT0A 3WGOA 1YONA 1D1TA 1QV7A 3UCXA 3NGXA 4U7WA 3VPHA 4CV2A 1AUPA 3B1KA 1KVSA 3L6DA 4Z0PA 2J3IA 1FDUA 1GUFA 2DLDA 1XDWA 3KRTA 4I9UA 2O4UX 4R54A 1KEVA 2HMSA 3ZV3A 1PQWA 2QYTA 5BR7A 3CH6A 1YQXA 2BFOA 2JCYA 2AMFA 4GLOA 1Y6JA 2J3KA 1IOLA 1CRWG 4NJOA 5IN4A 4TRNA 4UVIA 4B7CA 2RAFA 2BGLA 3KZVA 3GNQA 4RORA 4XQ9A 2PFGA 1XCBA 1ZH8A 3VKUA 3WSVA 3W8FA 2HMUA 3JV7A 3K92A 1I8TA 4IQ8A 3TF5A 1SAYA 4EW6A 3UUWA 4TROA 1Y8QB 2LDBA 5JDIC 4GWGA 1U5CA 4RPHA 1QYCA 5TRTA 1ISMA 2EJWA 2JAHA 1JKFA 3DR3A 1C1XA 2J3JA 1U4SA 3NJ8A 4DTIA 1Z6ZA 3NRCA 4BNHA 2IYPA 5DDIP 4QECA 2NTJA 3DMYA 5TX7A 3DHEA 2HKIA 1EUDA 1ZEMA 1P3DA 4NFHA 3VZSA 2XPCA 1ADCA 5T57A 2NVUB 1R0SA 4DIOA 4EEZA 5G0UA 5K6AC 5I9LA 1Y8RB 3QVTA 3AY7A 1WLYA 5IN5A 1H2HA 5IZ4A 2EERA 3MJCA 2BFAA 2TMGA 3OETA 5DCYA 4A0SA 2RH4A 3SLGA 4IGFA 1O8CA 3IUSA 3W4JA 1ZK2A 4QXMA 3CEAA 1A9ZA 4RF5A 4MKZA 2RBEA 1LSJA 4DMLA 1DIRA 4JX8A 4LVCA 1HEUA 3W1VA 4I5GA 1ULUA 3DFZA 3PWZA 4F6LA 5HTOA 4BL5A 4F45A 3KYBA 5AXBA 2EKLA 3ZHBA 4ZN6A 1WVGA 1NHWA 1BVRA 1FDSA 1HLPA 4UVHA 3RQSA 1O9BA 3HFGA 1PJ2A 5I7FA 3LSYA 4FCCA 3PTZA 4E2XA 4PVCA 1MC4A 4JBGA 4P4NA 2WJPA 3QA9A 3ZU5A 5JY6A 2ZTLA 1R0KA 3W4KA 1HYEA 3L9XA 1OC4A 4IDAA 5IF3A 2X8LA 3KBOA 3HN2A 1ADGA 2FN7A 3AJRA 2R6JA 4OJNA 1NQAO 4BNLA 1AXGA 4BOYA 4TQGA 4Z9XA 4DC1A 1EBUA 3M2PA 3NT5A 4FJ2A 1T2EA 3K2BA 1DJQA 4B3JA 4D0SA 3ITKA 4ND2A 2DBVO 2AEFA 2EP7A 4L76A 1LRLA 2WYWA 2P4QA 3DZKA 2V6GA 3IMFA 5U4QA 1KC1A 5C7OO 4DRYA 5ENVA 1XU9A 5ITWA 2CMDA 4M86A 4MP6A 1WNTA 3KEOA 4B4UA 1V0JA 1W73A 5A04A 3UCFA 4IGEA 1GFSA 1D1SA 2CDCA 3PLNA 2FR8A 3U4DA 3SEFA 3HADA 1FK8A 1E5QA 2GN9A 1UP4A 4E13A 3EZYA 3L4BA 5AYVA 5A02A 1ML3A 3DBLA 4EGFA 1LDEA 2O48X 3I6QA 4J4BA 2R2GA 3WGGA 3ZWMA 4S1VA 4WLVA 1ZZEA 1Q7BA 2PKQO 2Q1TA 1QRRA 2AE1A 4ALNA 4YQZA 1H5QA 4ZQEA 2X0NA 3C3XA 3C7CB 2VT3A 4II3A 4CMBA 1UAYA 4FQ8A 4D79A 4IJWA 5BT9A 2DUWA 3PP8A 4PVDA 4NDNE 2DUUA 5I7EA 4B4WA 4BMNA 5JYEA 3JQ8B 4JBHA 5HA5A 4PN3A 4E3ZA 1WWKA 4AL4A 5IDQA 4QEDA 4BQRA 1JU9A 4HFNA 1GY8A 5L4SA 3C8MA 1I3KA 1LNQA 2W4QA 3FRJA 4J4HA 3DZHA 4PZCA 5JDCA 3IKTA 5KVQA 1Q1NA 4QX6A 3VH3A 4MPDA 2V65A 1IY8A 2C0CA 4BGEA 4H16A 4NJMA 2ZTVA 2XF8A 4CLRA 1PR9A 3WOHA 2CSUA 3GAFA 4WPGA 3KV3O 2XAAA 2Q50A 1MG0A 4RGBA 3WJ7A 3D7LA 2DPGA 4IJVA 4MVJP 2W2KA 4GPD1 1Y5MA 5BSGA 2WYUA 2GZ3A 3LT4A 1AHHA 3GVXA 5LDHA 3ASUA 4RF2A 3LF2A 4KTVE 5A05A 4YRBA 2H1SA 2YQ4A 3V2HA 2Y1CA 4M87A 3OQBA 2GN6A 2VNSA 4NR0A 1E3SA 5DOZA 3UFXA 3GZ4A 5K9ZA 3OIFA 3GG9A 3UAGA 5B4UA 2JAPA 1C1DA 3WBBA 2OMEA 4Y6RA 4FR5A 5A3VA 2BH9A 2BRUA 3Q1LA 3I5MA 4OO3A 4PLGA 3JQAD 5LC1A 1PJLA 1AGNA 5KJFA 3BHJA 1DFIA 2EP5A 3D3EA 4YEDA 3QVWA 1TVEA 1BW9B 1L7EA 3D3WA 1DOHA 3LF1A 4H3VA 4CODB 1Q0LA 1ORRA 1MFZA 3RVDA 3GRKA 2O23A 2WM3A 4YDRA 3NKLA 5JFOA 3PWSA 5L53A 5KJEA 1ADFA 1R16A 2C7VA 2JD1A 3AM3A 4Y9DA 1X7DA 1ADBA 3C85A 4N5NA 3L6OO 3PRJA 4ALJA 3TZQA 3EYWA 4CM1A 5A9TA 1RYDA 5TLSA 4CUJA 1SZJG 1BMDA 1GQ2A 3OMLA 4IDBA 2PZJA 3DBRA 1YWGO 1W8DA 4CLHA 3KTDA 1E92A 2E49A 1U2DA 4JK3A 3TFOA 1T24A 3JD4A 5CEJA 1Z7BA 2CD9A 3LT0A 4KWIA 2A94A 3DEYX 3TNLA 4AJ1A 4YBZA 4BKPA 4BNKA 4CQMA 2W8ZA 2VTEA 1U3WA 4QTZA 4MDHA 1DJNA 2CVZA 2IZZA 1NHGA 3S1LA 3WGYA 1T2CA 4S3MA 4MVJF 5F1KA 4ALKA 2YHIA 1PZGA 3OHSX 3S2GA 5H82A 5JAMA 8ADHA 4NK5A 4ZU3A 3DBHB 4DIFA 1T4DA 2V6MA 3F4BA 3ZHYA 4WECA 4GH5A 4WCFC 4WLNA 2ZQZA 1LRJA 1TB4A 1XKQA 4KTTE 3C1AA 4OXYA 3ZV4A 1SOWA 1V9LA 2Y66A 4BNVA 4CMKA 1ZCJA 4O6VA 2GN8A 4P22A 5HRUA 3GVPA 1A5ZA 1X14A 3S2IA 1U3VA 2OBNA 4E2ZA 2H63A 1NAHA 2FWMX 4MKXA 4RPKA 3WJAA 4PLPA 1A71A 1UDAA 2I9PA 3UCEA 1K89A 4CV3A 1U7TA 4G81A 4N5LA 3E6AA 2AQHA 2AQ8A 3E03A 1NWCA 4ESOA 4R41A 2ZKLA 4D44A 2VRBA 1XG5A 3G3EA 1H2BA 3SVTA 1JTVA 4XGIA 1KOLA 3CMMA 3FNFA 3WFIA 4ALLA 1R6DA 2Q46A 3ROQA 4CL3A 1E7SA 3PIDA 4R9RA 4YXFA 4GSLA 2O7QA 1C14A 1NASA 2E37A 4A73A 4AJIA 3K9QO 1F17A 3PGXA 1QYWA 3H4VA 4H7PA 1R66A 3ZWCA 1P9LA 3ABIA 1P1RA 4BO7A 3ZCXA 4RZHA 2JD2A 4CMIB 2GLXA 3DFUA 2X4GA 2A35A 2P9EA 4MVJG 1GADO 2WE7A 1BSVA 2P5UA 3I83A 4ID9A 2GSDA 4HY3A 3E9QA 2BLLA 1GYRA 1GPJA 1ZSVA 4PRKA
chains in the Genus database with same CATH superfamily
1KDRA 4Q3CA 4LOJA 4P35A 1ADJA 1PG2A 4ZAGA 5P8WA 3HLTA 1OH7A 2ZAIA 1SXIA 3DZBA 4QYIA 2DEUA 2O5RA 2RARA 1C9MA 3OCJA 4ZQBA 2VCEA 1BOFA 5LD2C 2G7ZA 1QZUA 1GPMA 2IHJA 2QL5A 1LU9A 5FNVB 5C34B 1X15A 4BC1A 4GX1A 4DMMA 3W5SA 5TQ0B 1KERA 3KSUA 4TVSA 4GZ6A 3PHJA 1KJQA 4MWGA 4Q7MB 1E6KA 2HU8A 1FSSA 3DW3X 2XUAA 3IILA 4ZC1A 3RFVA 1TTPB 2IU6A 1NN5A 1JBEA 2JDID 2FR1A 3KQSA 4IEFB 4MUAA 1I2BA 4BRWA 2Y1LA 3P20A 1L4EA 4BASA 4XWKA 4IDFA 2I80A 2ZIWB 4QT4A 4F38A 1P1IA 1Z63A 1LXCA 3Q0EA 4B3MB 1KIFA 3RM3A 5G4LA 221PA 2IE0A 3SQLA 3EOBI 4MO2A 1XEFA 4JKIA 3RJZA 5C80A 4REQB 3AWIA 1JFSA 4BKOA 3AESA 3KUKA 5EJMA 1N7JA 1QXSA 1F06A 1G9XA 1H5NA 1XMQB 4L95C 1VYHA 4HMQA 4Q4LA 2A0FA 3EXAA 3OT4A 4MDYA 3GD5A 4Z86A 5C8DA 1JR6A 4QXRA 2WHPA 4K9RA 4YGYA 5F23A 3G6KA 1A8PA 5DP1A 3RU7A 5GZ1A 3DE4X 5LXTA 1HYHA 1P74A 2FCAA 3Q4GA 3ZTTA 1FBNA 4BB5A 3PRHA 4PS1A 4PRZA 4TPKA 2C4TA 2JI8A 2V7WA 2XQIA 1JU3A 1PFWA 4TQAA 1M7HA 3G0CA 4IPTA 5K3CA 4BLRA 4CTKA 4MB2A 3NPAA 1WJGA 2JJYA 1HE4A 3L18A 4H4CA 3T3EA 2FE1A 4PEVA 4KYVA 1E0KA 3ZD8A 1TKAA 2HN9A 2I34A 2Q99A 1T26A 1TW2A 3QW4B 1RR6A 4P7JA 3MERA 1NRIA 2ILVA 2ZYUX 4ZHQB 3K96A 5EKTA 4J2HA 1YZFA 1ICEA 2RCYA 3HZOA 1Z34A 2CWDA 3L7IA 1KSHA 4LDRA 1QGUB 2YKGA 3UKDA 3A7EA 3FCXA 5FADA 4ZYTA 2HFJA 1JA0A 2H52A 3SHVA 3IXMA 3H5VA 1UMBA 1XZGA 4KE6A 5DIZA 3ROTA 1RM3A 4AULA 5E4JA 1FMLA 4LGVA 3GJ4A 1ECBA 1Z5GA 3OX2A 1MQSA 3FZYA 3HCFA 4JLMA 3PPVA 1FFEA 3LHDA 4DBZA 1C9NA 4K8RB 2EFGA 3GRCA 3D1VA 1T5IA 1V3UA 4G2NA 4KMMA 4WXRA 4A10A 3U1BA 4A0FA 4IQFA 3JZAA 2HXSA 1L7XA 2OVFA 1IJKA 1HF3A 1HGXA 1NBMA 3DV2A 3PRKE 1GCUA 1ODIA 2LVBA 3IE2A 3Q85A 2NMVA 1K2VN 3D3KA 2AMVA 1B6GA 4GVPA 3CGWA 1CDDA 4BPRA 3K4QA 5IZCA 4BXOA 3OJ0A 3RUFA 1E79D 4BTVA 1M1YA 4U5QA 3RFTA 1J2TA 2OTCA 1Z2PX 2FW0A 4TMZA 1OGJA 3H6GA 4OA5A 4Q9NA 5FLYA 2J0VA 4XX0A 3LTEA 3WTCA 2VHQA 4GNRA 4I4TF 3WVNA 1KEPA 1YQDA 3TGWA 3R1IA 4IICA 5ECWA 3WNCA 5FI0B 3AW8A 4OU5A 5E7JA 5JZ9A 2ZM5A 3NBQA 1YDEA 5L3SA 3WLPA 2V1UA 4U6SA 1EK0A 3EMBA 1K6JA 4RKQA 4BNIA 1TK3A 1PX2A 1SH7A 3JASA 1O0SA 1PP4A 1QKIA 2XKJE 3QKRA 3QXJA 4E5MA 3GRPA 1N6IA 2GESA 5A1TA 4PIPA 2BGGA 4PYLA 1JQEA 1WCIA 2ZBRA 5BWOA 3LKVA 1XHLA 3L8EA 1WCV1 3BWCA 4Q9KA 1L5FA 1CFJA 1V4VA 1Z6AA 4MUNA 1R6TA 3FPHA 3O4IA 4PQFA 4UHFA 2MYTA 4D97A 1JG2A 5H70A 1LWNA 3VH1A 3WZMA 1T2AA 4FCVA 1G3MA 4DEXA 1VBFA 3TLKA 1SB9A 4FSXA 4H1VA 4INOA 2MSDB 4XH9B 2ECPA 4RK6A 2PA0A 5FBLB 3A32A 4JC4A 3KV1A 3ZV7A 5C7LO 6LDHA 5F3RA 5I3ZA 2XCOA 3GMDA 5GMOA 2OK8A 3G2JA 4I4TA 1RM0A 2W6QA 1U3FA 1ZGBA 3R9XB 1Q5PA 3ERCA 4MLZA 2HLHA 2PKWA 5FOXA 1T2FA 1ZL0A 3DP7A 2UKDA 4H7DA 3W1EA 1W36C 5CBPB 1YBMA 5J2UA 1HYGA 3EODA 2BEVA 2GRUA 4OP1A 5KYVA 3LOQA 3NYQA 4A8PA 1PS0A 4BCCA 3H2ZA 1JR3D 1C5KA 1ZXBA 2X0JA 3AHHA 4RK0A 4TGLA 2DKNA 2IYXA 2JCGA 4EMSA 3RASA 3I6ZA 1GTSA 3WMEA 4AYXA 4TV8B 2W6NA 4UTZA 1QYDA 1R0CA 4R7TA 1T36A 2BUCA 3IDZA 4DB2A 3GNTA 1IB6A 2H5JA 1HM5A 4GM0A 3ROGA 3ZVLA 2YWXA 4CG3A 2I5PO 4F3TA 1QO9A 3CJQA 2HNKA 3GJZA 5ALHA 5FV7A 2GF2A 3K73O 1XTIA 1T4GA 1WZNA 2BJWA 3OUTA 3V7UA 1PU2A 1C0IA 1TO1E 3C39A 3GWGA 2CLCX 5E2IA 5ESWA 4N18A 2OGZA 5EEGA 4UC0A 3HVJA 3Q3VA 3RSCA 3WLLA 2WE8A 1KYQA 1W5BA 2VHXA 1CY2A 3AIIA 1KXJA 4UTRA 2F8SA 4WTOA 3BUSA 2A0UA 2WAYA 1AV6A 1P18A 1PT8A 1S01A 2G5CA 3B2NA 3MWJA 4MS3A 4R69A 2AYZA 2VDUE 1A95A 3CWQA 3Q3CA 1ACJA 3VU8A 4RVHA 3V9AA 3LLVA 3WL4A 5BN4A 4Z4GA 3VZDA 5LQDA 4AFNA 1P2GA 1QG2A 1TVKB 1W87A 2YDXA 1CZLA 3CNNA 5FP0A 3DCIA 3HR7A 1N6KA 1WOMA 1XJCA 3FPCA 2QE6A 1Z22A 3ZX5A 3U37A 3IIKA 4CNBA 1U8ZA 1WDMA 3AB8A 4JROA 1FRFS 4NMMA 4ZU1X 3PCXA 5JJBA 4H4EA 1W5EA 3I2IA 4ICIA 1G3RA 1NVMB 2OSBA 3IQHX 2WPDD 4FYWA 4TTVA 2OD2A 3QG5A 3L6UA 3M4YA 4J0GA 4HWRA 3T0FA 4IIJA 2WU3A 1RXEA 3M6FA 1B2RA 1KYVA 3F6BX 2XUGA 4RM2A 1EHCA 3C5WP 1GQYA 4R9NA 4ZAYA 1VMDA 1KMIY 1L5OA 1Q2XA 1QO0A 5E4YA 5ALKA 5I01A 2YMMA 1ONOA 4JIMA 4NH4A 1XSEA 3E53A 2PBRA 3NHMA 1V1JA 3NT2A 4RDHA 4EF4A 1V3QE 1YR3A 2J0EA 5GZ6A 2CLDX 3D3QA 1FNNA 2BFCB 2XTAA 3R2JA 5LQCA 1PJBA 2REQB 3ONFA 2W22A 3GDOA 4XGNA 4PG5A 4BLSA 1C50A 5CA0B 2J7KA 2Z8ZA 1UDRA 3QLUC 3DEIA 3ESQA 2FMUA 5EFOA 2R8EA 4KSCA 3IRVA 3DMFA 4BNUA 2H4YA 2PT7A 4UHEA 3CX4A 1ZBDA 2RGGA 4OQPA 3G8YA 2V4UA 2AF4C 3AGQA 3RYTC 3ZWWA 4RY8A 3VR5A 2PH5A 4JXKA 4B31A 3A1NA 4A6XA 4CDGA 4NG5A 4PC1A 1HE1C 3WK7A 1PO7A 4YJ2A 5KWIA 4ECEA 2HK9A 3FPEA 3QVLA 4EHNA 4XYLA 3H2HA 1QTIA 2DYKA 3DXFA 3RV4A 4JXZA 1IOZA 2EHJA 3RLIA 3QMWA 4D42A 4DL9A 5JMOA 1ZH0A 1EX1A 2P2SA 1OX4B 1U2EA 3RIEA 4JL6A 4GG1A 4QUIA 5EP3A 4KPYA 3OQPA 1OBFO 2ZWOA 4R5HA 1CJBA 1HDGO 1XQWA 2JCXA 5EWJA 3HFJA 3T4PA 2COKA 2VATA 3P9ZA 3PFWO 4A92A 4O2AB 4FJ0A 1A8SA 3L43A 5M3BA 2WW8A 2EZ9A 4O0LA 1DRKA 1TUEA 1HE5A 1H9CA 4TKUB 5I3CA 4LJAA 3PHBE 3T0GA 4DM3A 1JJFA 1MENA 1J06A 1Q84A 5AHRA 4D96A 4LXUA 4ER0A 4LMBA 2H4FA 2QOEA 5EJ8A 4O08A 4QU8A 2OWDA 3UB3A 1GZ3A 4LVUA 4I4IA 1XIVA 2YASA 1DG9A 4OQMA 3N7AA 4UBIA 4RTOA 1XNHA 3ZVMA 2TRSB 4N6NA 2XMGA 2YWGA 5C1BA 4Q4AA 4KWEA 3I0ZA 1YS7A 2NTEA 4LBZA 3BK2A 4EENA 2YY7A 5EN4A 2C4HA 3K8ZA 3JQPA 2Z5GA 3HLYA 4AY2A 3P19A 3VO1A 1BDBA 3CLTD 3VSBA 3E2MA 3WRYC 3FOCA 4TWZA 1LF0A 4JJZA 4ODIA 1G6KA 4FDVA 4CKEB 1NQTA 2UAGA 4ZI7B 3CNBA 1BCRA 4Q3NA 2P62A 3F8TA 3P45A 3TLXA 1F0YA 2PSDA 1MNQA 1U8XX 1KQPA 3GEDA 2QRJA 3G59A 3KOWA 1Q91A 4HLQB 4C7JA 4L9WA 4P5PA 4J90A 4JOCA 5AOBA 2YOHA 5EPUA 1VLVA 2ZYHA 3KB8A 4FOPA 5C31A 2XVXA 3IR7A 2H2AA 3ZWOA 3LP5A 4F8YA 5BR1A 2OD9A 3LNTA 3OFSA 4KI0A 4DHEA 4RIEA 1XZLA 3FUTA 1E2HA 1XQ6A 2GERA 2QW0X 3KLBA 4LYHA 3CF4G 2R4TA 4PHHA 3CWZA 1IJEA 2PZMA 3CZRA 5J1SB 5CCXA 4IIBA 3GMIA 1EG7A 3NHPA 4IIJB 2FFJA 5FO1A 3WLAA 3ASVA 1KO5A 3SIRA 1O4VA 4LE2A 3H0KA 4DV6B 3D4IA 4TYNA 2DHCA 2IY7A 2G80A 4S1OA 2J32A 1J33A 3U81A 3E9DA 4EY4A 5JYBA 2VXCA 2X9NA 3ANNA 2C3PA 4JBNA 4L5IA 2GF9A 3IUQA 4YIHA 1M8GA 3FYUC 1C0KA 4NMHA 5KHOC 4NU5A 5A5EA 4QJBA 4DBLC 2GCEA 3E5MA 3MUFA 2FFAA 2VP3A 3PX2A 3OIDA 4ND4A 2J87A 3ORFA 3TD9A 2ET6A 2Y99A 1CZHA 3HTXA 1X1CA 4M7PA 4QNNA 4HNAA 1B23P 5HIMA 2IUEA 5DV9A 4OUDB 2DXIA 1JDPA 2NZUG 3N2EA 4AYWA 2C07A 4GHWA 2YDYA 4HUTA 3GLFB 1H1LB 3JQ8A 2QTAA 3OQIB 1RPAA 2AUNA 1MIOA 2H2GA 2X4LA 1RRMA 2A30A 3DDZX 1YQQA 4RW0A 1CNFA 3HU1A 4BO8A 1XVIA 5KINB 3KQTA 4I55A 4XIIA 5BW6B 3ICCA 3BILA 2OCGA 3EQ7A 3O4FA 3ZD6A 1NUHA 2QTTA 4C0QC 3BXPA 4RSMA 4A1FA 1SPBS 3HNPA 3RSGA 3FZGA 3L4EA 3NDRA 4AB1A 2HMWA 3ESBA 2Q4RA 4JUCA 3WLTA 4I1SA 1QH0A 1GKKA 2OO5A 3WKEA 3TZHA 5CPBA 1QIIA 4X8LA 4UAUA 3SSAA 3RS9A 1GZ7A 4J76A 3B3QA 3QEMA 4BNGA 4ZOEA 3WYGA 1EFKA 1KO8A 2X13A 3E48A 3L77A 4E5PA 5JALA 4JJ8A 1C9KA 4NH0A 2O1WA 4EB3A 3R0ZA 1QB8A 4WE3A 1V35A 2ZYGA 721PA 2C54A 3FJOA 2HJWA 3GQBB 2DAPA 1JWLA 1DV1A 1P1CA 2GJKA 4G01B 4PPGA 1PL6A 4EFDA 1KKUA 2QGZA 4FI3F 4BX0A 2H5EA 4B43A 2R8OA 2X2EA 3T4XA 5JZBA 1QORA 3MJSA 2B61A 4V0ME 4P2GA 4ZCMA 4TZKA 4MV6A 4FFSA 3U7JA 1YDMA 1YT5A 4J0FA 4QXQA 4XFDA 2BP7B 1V1MA 4INJA 4EW1A 1G2QA 2QVBA 4CKCB 2C7PA 4A36A 1FTQA 2VT6A 2W8BA 3PHIA 4LIPD 4ZCLA 4KFUA 2NO1A 2DPHA 1XRNA 2IJGX 4NCAA 5AKKA 2ZWAA 4UM5A 1YKFA 1O96B 2GM5A 1BHSA 1V45E 2I2XB 1Q19A 1U0EA 4IV5A 3SHFA 1H0KA 5A7FA 2FUKA 1YL6A 3JASB 3ROMA 4JXXA 2RONA 3WI7A 3RTAA 3T06B 3TNDA 4RNDB 3Q0TA 2IBSA 4BRUA 1P72A 3C1UA 4FILA 4EF6A 5C7YA 2HIMA 2Y0PA 5TNXA 3Q7TA 4EKIA 2BDEA 3TKAA 2QW1A 2BEWA 2OM2A 3MM4A 2V0CA 1SO8A 4OSPA 2NPIA 5BSFA 1TI7A 1CJUC 3PIRA 1I6KA 2O2DA 2VJLA 1P0FA 3K5WA 4KIFA 5LLTA 2ORWA 3V1TC 2F9LA 3FPKA 1G1AA 4EUFA 3LO5A 1H3EA 2XNJA 2R5NA 2DTDA 3NVDA 3RTDA 4DABA 3GZNA 1NFQA 3I5YA 2QXTA 4Z4FA 1J25A 1BVUA 3AFMA 5SZJA 3TBKA 2HK6A 2WU0A 1M6EX 3I12A 1N92A 3H9CA 2NO6A 3PNPA 4KWCA 3FNRA 4ENRA 3THXB 4BO3A 2J46A 2CXQA 3L1UA 4QUBA 1OY1A 3ILSA 4PX9A 5DNWA 5KVVA 1KL7A 1LVGA 1YRBA 2LDXA 4H2DA 3A1VA 4FDUA 1JZQA 1QDLB 1CRZA 5GGXA 1YDWA 5IMBA 1PNVA 4JIGA 5M04A 1JHAA 1UANA 1SKYE 1UFRA 3N7UA 2HR1A 1M8FA 3OFJA 1FFBA 2MU1A 4I1OA 1Z5UA 2E82A 1QO7A 2OFWA 5K7SA 3D0OA 3PNYA 4Q4AB 4B4KA 3P2JA 3QF7A 2BFDA 1CY8A 1MBZA 4LK2A 2PJRA 1TA9A 3HGMA 1XZAA 2D4AA 3X1KA 1PG0A 3SQNA 5BVHA 4YAEA 3B1JA 2WTXA 4KH1A 5I8WA 3KSZO 1CHDA 1GG5A 1HC7A 2JA2A 4NSNA 1OMOA 1VB5A 4BN0A 3NHBA 1W93A 4AAYA 4URXR 3WYAA 5HWSA 1U04A 3QSYA 3U44B 1AZWA 3ETNA 1G291 1ESDA 3ETJA 2Y0EA 4JMLA 4KB5A 3M6AA 3UV7A 4OUKX 4UJ5A 1G20A 1R8JA 4HPJB 4QUAA 4CHTA 1G1MA 2JJ1A 3N87A 1CUGA 3MCAA 3NS7A 2EP8A 3FNQA 3VV3A 2QORA 2WILA 2R68A 5L4NA 1I2CA 1K8RA 1ZEJA 5JRZA 1A9SA 5TGDA 3WLEA 1EQAA 4IUDS 2Q2NA 4HN2A 5CGZA 1A8IA 2JIOA 3IR5A 2PZAA 2DHQA 4FUTA 4HDKB 4N6GA 3DLTA 2EATA 1XNRB 5A9SB 3ACBA 5H9VA 1E2GA 2GN2A 3LY7A 2OV2A 4R1NA 4RVSA 2X7HA 2NUBA 2ZIXB 3DEKA 2JDIA 4JLWA 1AHIA 1GQRA 4KQEA 4O4LB 1YB5A 1CY0A 4LGMA 2ZCUA 2E5FA 4MO9A 2QPOA 4OTZA 3CPHA 4R6XA 5BVGA 3FTFA 4MYHA 2VQDA 3L7LA 1RZVA 3SX0A 2AIRA 3C4QA 5CMLA 1YGPA 1CZNA 1R64A 1VFPA 2IPNA 2JBAB 2VYVD 5ANRB 4BLOA 5ES4B 2VXBA 4QIHA 2F7SA 4FSDA 3B6KA 3W7BA 4KSBA 4QFDA 1MO6A 3AONB 4TLMB 5HHTA 4DA4A 4JYAB 5JDCC 3VKHA 3OKCA 1AKTA 3LUCA 3PDWA 4B4OA 3NYWA 2PGXA 4ABTA 1Z07A 2X9VA 4RE6A 2J07A 5K4GA 1M83A 2A2ZA 3K9BA 5FPPA 1Z0ZA 1HOXA 3DAPA 1I24A 2XQFA 3Q3JB 3QXGA 5HUQA 1LH0A 4TVBA 3VPDA 5KPJA 1EBFA 4GRIA 2VHCA 3PNOA 2PWPA 3ESZA 4PQEA 3PK0A 1WXGA 4ILEA 2IHVA 1L5ZA 3T6KA 1K3TA 2FYTA 1ZW6A 2R6AA 1JLLA 2V03A 4MWSA 3TBFA 3NTOA 4FFRA 4PLTA 1WS6A 1K06A 2BW0A 2FFQA 4EFLA 1Y7TA 4K6CA 4LRQA 3QBVA 3EGDB 4MGZR 2QR3A 3OIYA 3PT5A 2XWBF 3RUHA 1KMHB 3EVGA 4P5EA 4CPDA 2Z2KA 4K05A 1I4WA 2V7QD 1E79A 3AP2A 3GY0A 3ODGA 3R6TA 4NS4A 2ZB4A 1XP5A 4QPPA 4R01A 4B33A 2PHZA 4GP9A 1VKNA 3OVMA 1J4AA 1RHKA 4FHEA 4HEQA 1VSVA 4M38A 5T67A 1Y7HA 5LD2B 4C1NA 1A8HA 5A2GA 1AQYA 2Y71A 1KP9A 1VYUA 3OZTA 3N86A 2XQJA 3R3VA 3SBEA 2LD4A 3PC4A 1V3VA 4PLFA 5JAPA 1UBEA 3BA1A 4M8SA 2C5LA 4BEVA 4UEQA 3W5CA 4OH7A 3TE6A 4DV2B 1CIVA 1ZO8A 2GEVA 2O50A 2UVDA 3REOA 2F3QA 2ZRNA 4MVJI 2HGSA 3VX4A 4M0PA 5KDDA 1AGRA 4OBWA 3S4YA 4UASA 4I9HA 3QFCA 4WK4B 4I9FA 4KBYA 3V1NA 3NHLA 3OMWA 5H3CA 1P33A 1XN1A 2LR0A 2X2FA 1BE0A 3ROXA 3ULKA 3V2GA 4ASUA 5AVZA 5L95A 1DINA 1O6ZA 3BZUA 4DNXA 3QQPA 3ED5A 4OSOA 5J63A 4HAUA 3IO3A 4BX2A 2J0UA 4YAKA 2X1MA 2K7FA 2QU8A 3MMZA 1KK1A 5HRAA 2GPWA 1P1KA 4BWGA 4WSOA 4GS5A 4QOGA 2V7GA 2REBA 2WMDA 2D3TA 4EB0A 2FMIA 2I6UA 1J2EA 4CEIA 3EIEA 2Q5LA 3II6X 2QT0A 2ZULA 2E6UX 1P73A 1GM5A 1LPMA 3DBOB 4GBED 1HDIA 3H16A 4PICA 3I8OA 3RRFA 2A9RA 2VPQA 2X15A 2G6BA 4P3OA 4JZKA 1NIJA 1OAKA 1X7XA 5AKHA 3SE7A 2OFXA 2Q7XA 1JSZA 3RSHA 3DPIA 1ZINA 3OSUA 1OA0A 1V8ZA 4JR0A 3DZIA 3SSNA 4OYRA 3KJQA 3T7RA 3FTNA 2W42A 1M2GA 3G0IA 2QVZX 4LAFA 1T9HA 2BGJA 5K0BA 2NT4A 1BH2A 3IRUA 1SNYA 2PS9A 3W8EA 1QVVA 3QHQA 4HXEB 3COVA 4PANA 1XZPA 2UU9B 4ZQGA 1PK9A 2WU8A 4ZO9A 1N5JA 1MLDA 3ZIAD 2CV1A 4YAGA 3G2HA 1GHTA 1PNRA 1Z62A 4G0UA 3FCUB 4K9KA 4K46A 1M8JA 4XYMA 4YRCA 3PQEA 3UIEA 3M1IA 4HP8A 4CIAA 5IG2A 3SBXA 4BECA 3HY6A 3CUUA 1ENZA 3IUPA 4FJ1A 1M1ZA 2QRPA 4HLDA 1GCOA 4Q3DA 1B0UA 1S3GA 1J2JA 1YDGA 2XVZA 4GQBA 4WNIA 4Z8XA 1VKOA 4YI3A 2PANA 1NRWA 2I91A 2DBRA 4PYIA 4HDNB 3I58A 3C2QA 4AKTA 1E77A 2OG1A 3KXKA 2Z9CA 4EG7A 4ON9A 4E2YA 3FSJX 4V2IA 4DJEC 2ZAOA 3B2QA 4WY2A 5DRTA 1XTPA 1F8YA 3DE2X 4P4SA 4DCOA 1ABBA 3KXDA 5DNCA 3ETDA 1U8TA 1QG0A 3MLBA 2BGWA 1BX0A 4RAOA 2WFMA 4JB3A 2WWGA 5FLEX 5JC1A 3O8OA 4IOJA 4ZQHA 2Q1YA 2CHQA 5A06A 1DB3A 4II2A 2PO5A 3UQZA 1FMTA 2IY9A 2GTHA 3OLVA 1H1DA 3GVCA 3SBDA 1XZQA 4LJRA 1ONBA 2Z30A 1PV1A 1A4XA 5IDXA 2ZE7A 2B4YA 3ZWCA 4JV5B 4C2BA 2J9FA 4FHFA 4V1CI 5D3ZA 5FQNA 2VH1A 4Y7DA 1QF9A 3HO8A 3EQ8A 1GKUB 1ZESA 3L7CA 1TX4B 4RTPA 2NU8B 3BJRA 1TAUA 5DULA 1MX1A 2ZSAA 3RU3A 4YP5A 1NLZA 3K8QA 1JTFA 4J8PA 4D4GA 2PL9A 3L5KA 3HDQA 3K20A 4UQOA 2B21A 5GAJA 3HXQA 2PV0A 4BB9A 4IH4A 3H65A 3VKGA 2CLOB 4UDOA 4DMGA 2FWIA 1J9GA 2XXBA 2AUTA 5T4FA 1KORA 1YVEI 3CEHA 3NDJA 2NZVG 4CNQA 2WHPB 2MR6A 3CZAA 2NSYA 3QOFA 4GLFA 5ALMA 5EZYF 5DO9A 4WBSA 3D6VA 1D2NA 4F93B 3NUZA 4XRGA 3QW2A 2VAXA 2FUG6 1KBZA 2WD8A 2BELA 4Q5IA 7MDHA 1ZHFA 3KAJA 1WB5A 1GPBA 5K3DA 3AF6A 3H8WA 4A5OA 3A37A 3JQQA 1TJPB 4FFNA 4TXNA 4RACA 1SQ0A 2EYUA 1N5LA 1EESA 3GYBA 1KVRA 2PY6A 3NBMA 2VHJA 2RHLA 4GOKA 5T4HA 3ZV6A 4OGWA 2WR8A 3IAAA 4C0KA 4EY6A 1ILWA 5B1YA 5CK5A 3KHSA 4HQNA 5ESXA 2HQRA 3LM8A 1TA0A 1RPTA 2W93A 3MW8A 1F2UB 1VTKA 2X0FA 4B6EA 3SSMA 2P27A 2VJOA 3NIGB 3AYXB 3C45A 5TQ0A 3S99A 3AF5A 7ADHA 1GA1A 1YBAA 2CBXA 3IS3A 4WXEA 5E95A 4HTAA 3STVA 4A8JA 1T13A 2L2QA 4RFSB 2VFAA 4PN7A 1NG9A 3CW8X 1QGED 2XBMA 3D1LA 3DFFA 5LMUB 1GD1O 4QYIB 2VJPA 1KYYA 2ZW9A 4KIWA 1OC2A 2DCMA 4PF1A 1GL9B 1KZ1A 3TLYA 2QDKA 1HH4A 3QI2A 3UTDA 3ZZUA 1EEXB 3HBMA 3JD0A 4V03A 1CUWA 3B20A 5MN6A 1ES9A 4AY6A 2QM7A 4JA2A 1NI5A 1SKBA 1E7RA 5ALRA 5JAIA 2P2GA 3H3FA 2WIAA 3BH0A 1RHJA 4JLPA 1YR1A 4RGYA 5JJLA 2FZKA 5J5VA 3WLMA 2I1QA 5FWAA 3ZJYA 4A15A 4Q19A 1W0CA 1QC5A 1VCOA 4QUGA 3UJAA 1PQUA 4D3ZA 2DR3A 3GJ6A 4ZAXA 4KJXA 3A6ZA 1YGYA 4RTKA 5FBKA 3NOQA 3OFND 4B2PA 1HX7A 4UBLA 3BMXA 4JI6B 1SU6A 3FR7A 3HU5A 4YJKA 4XTCS 3ENKA 4RE5A 5CPFA 1MJNA 3I34X 3ZIUA 4FWBA 1CJKC 4WL0A 4OKIA 5FWXA 3VOBA 2RGRA 2JJ2A 3RROA 1I3LA 2C20A 3N70A 2JB9A 5F35A 4KO3S 5AXAA 2OCPA 1WQ3A 5MGBA 1PJCA 4BLQA 2A9QA 1ESCA 3RF6A 4BO6A 1N2JA 1WMFA 1OOEA 4B40A 4F92B 2W6OA 3D6MA 3O4VA 5EJ9A 2IFTA 1E32A 1QDEA 1NYQA 2PH1A 1CERA 4J07A 2ROQA 5IM4A 3QUTA 4RDXA 1WPQA 1WPGA 1BGWA 3HVHA 2BD0A 5HJ7A 1XFDA 3HY4A 3E70C 3PXUA 1YQ9A 2JGAA 1SXHA 4M0KA 1B0PA 4JJ6A 4PNZA 2FMTA 3TEMA 3U6BA 1JI3A 3PA6A 2AKAB 3JQFC 4GC5A 4O4JA 4RADA 4EZEA 4GXNA 2P40A 4I7EA 3Q7PA 4OAOA 4P34A 2PD4A 3JARB 5EMNA 3SICE 4B74A 3DHNA 1VCMA 3ICVA 4N9WA 6Q21A 3DM9B 3W2HA 3TOSA 1C1HA 1SVOA 4ZO6A 4PBTA 2II6A 2W2TA 4O4HB 1VIDA 4LMAA 4IZ6A 2P35A 3LCVB 2B4TO 2QN6A 5EUCA 4EI2A 4JJEA 5F77A 5LQKA 2OORA 4ZODA 3B6ZA 3FPLA 4IUYA 4UXHA 4BGIA 1GN9A 3MINA 2E9SA 3CPJB 8ABPA 5E0OA 4RV4A 5DHRA 3K0HA 3QVGB 1XJQA 3DUWA 4BNWA 1V48A 4MVJD 5AHWA 2HH9A 1YXMA 4RZSA 1Y1KE 1UODA 3SJCA 1TPZA 5HRCA 3CRW1 1B74A 4BMSA 3T5DA 3FI9A 3NHUA 1ZJ5A 2XMQA 5C51B 1E2PA 2Z58A 3AEUB 2E6KA 3PR2B 2VNIA 5E3JA 3R7WB 3UT0A 3OX1A 4EBBA 5BMVB 2XMSA 1K6IA 3I2YX 3KUDA 4C43A 3I4CA 3AWDA 2CNLA 3PD7A 2J6HA 2BPOA 3BOSA 3CBGA 4HMOA 4XGQA 3SR0A 4DLPA 2O0KA 4G8BA 4Q48A 4G41A 3CNHA 2O52A 2FFBA 3EDYA 2I8LA 4QGFA 5PGMA 1JJBA 4ETNA 2K4MA 1P5RA 4NEHB 2X6TA 3SMQA 5LQUA 4TZ6A 4C7VA 1D2CA 4BKUA 5FBRB 4YMUA 1N33B 2C9BA 1GR1A 1KOFA 1P62B 3FMVA 4J1NA 1C7IA 1W1IA 3GEBA 5T6MA 5JS2A 1IIBA 2PX6A 4NAVA 2CC2A 5E0KB 4ZAWA 2CB0A 4WBNA 1RWVA 4I36A 4QFBA 4R2IA 4YRZA 3HA3A 1FBTA 1E0SA 4N1AA 2WF5A 3RF7A 1Z7WA 4I5EA 2EOAA 3BIWA 4MUKA 4KRFA 5SZKB 2CXUA 5JE8A 2VO1A 4WXPA 5TPWB 4WK6A 3TNFA 3PJGA 1IPFA 3EHEA 3IODA 4JODA 4IJUA 5LM3A 5FA6A 4KFCA 1VBMA 5J3JA 2R84A 4M0MA 3M5WA 4PO1A 4Q7LA 4LV8B 2PL5A 3TXAA 3VC2A 1Q0SA 2H8GA 1SCQA 3MTGA 1NVTA 1OFGA 4RF4A 3N6VA 3CGGA 1WV0A 4I3FA 1E9DA 1Z4KA 4ES6A 5KYUB 1Q77A 3TGLA 3E5HA 1HNXB 2VQFB 5K0NA 1UM8A 3TPCA 1Y9EA 5KIAA 3B8EA 4I8IA 4FR2A 3ZBPA 5CR9A 3M34A 1DRWA 1YNSA 2CFCA 1YU9A 3B7WA 3GT0A 4J9VA 3KB1A 3ZUGA 2YJGA 4BP9A 4XEUA 3KXLA 3E05A 1WD5A 2B5VA 4W1SA 4P8RA 2CVOA 3GLVA 4DCGA 3EDRA 5HCNA 4S1TA 3WWCA 3JCZA 4EHKA 2P3LA 2EFYA 5CDGA 2CSXA 2OXEA 1BJRE 3D5EA 4DM4A 4UEKA 1HNZB 4P81A 2VJNA 3MMNA 4IMJB 3ID6C 4IJ6A 3AHCA 3U44A 3CH4B 4R2JA 5DSZA 2VDLB 3H13A 4BMOB 5F12A 3M1AA 3CRRA 2PQMA 3FYSA 1I2AA 5HCUA 1M6HA 1R9NA 1MH9A 2KM1A 5CLGA 3BORA 3RJ5A 1UDCA 4IRMA 3T1NA 2IV7A 4FFBB 2QZJA 1NBOA 3QPVA 5H83A 1NX6A 1T25A 5JSQA 4Q0MA 2IT1A 3DS8A 1RCTE 2O2GA 2WWVD 3H7AA 4HH3C 1CKEA 1E2LA 2DMRA 3W77A 2YN0A 1EPUA 3I9LA 4NV3A 5HZGA 4KO2S 1WTCA 1N6LA 4AIIA 3A0RB 1Y6ZA 5HDQA 3U7QA 5EAIA 2J5QA 1SKUA 2ZI9A 4OIFA 3K5HA 5H81A 1FDRA 3VSCA 5J47A 4RL6A 5K3EA 2QAJA 1E6MA 2QN2A 4LSGA 1Z29A 2I8AA 4EO9A 3WKBA 3NDBB 2J85A 3R5XA 4JN6B 2ZS9A 3FTPA 4GEGA 4RL4A 4UVEA 2J0QA 4RSHA 1H3NA 1Z06A 5ALWA 3ZK7A 3AVTA 1H5UA 1LKZA 1N2ZA 1R37A 3CG4A 1IM8A 5SICE 1N3YA 3WIUA 3WY9A 4B3HA 4EMTA 4FMCF 5I9NA 1O0CA 2BMFA 2NUPB 3NGMA 3DF9A 4G5RA 4LNUA 4N40A 1SXQA 4EDFA 4Q6WA 2Z56A 3DAGA 2D4HA 2IXAA 2JJMA 1ABEA 3EZ9A 3OBIA 3CE9A 4JSRA 3KUCA 2IX3A 4W9MC 3FW1A 1DKUA 4ZGBA 4OA8A 4Y2GA 3NZEA 2RCNA 1MEOA 2C2XA 5FBQB 4YUYA 1RBQA 4R51A 4JLSA 2VSOA 1L9XA 2E5LB 3AIKA 1JKIA 1RRVA 1GZ4A 3TDNA 5EYPA 5AESA 1G8MA 4NJMB 5JW6A 1J9ZA 1XZBA 1U1IA 5BN5B 3I2FA 2ZZMA 1DIGA 1ZK3A 1WMAA 3ANLA 4PZEA 1SKAA 1AQIA 1V1RB 1SMKA 4CM9A 3UA3A 1RADA 1V7ZA 3I28A 3U4HA 1ZCFA 1LSUA 1U0NA 3LGAA 4X63A 3THWA 2EF1A 1DC6A 3VM6A 4ARIA 3L82B 1BEEA 2JFOA 5DEOA 4WINA 5KVSA 2E4VA 4R1MA 5HS6A 3WGTA 3K6KA 4KR3A 2NSHA 1TYCA 2XJ9A 1YV9A 3AG5A 3GFVA 4HXGA 4BAUA 2YW9A 4NEGA 3RVQA 2WTAA 1KEKA 2JVJA 2IYOA 3LVQE 3S3TA 2DCUA 3W2IA 5DCUA 3WA6A 7GPBA 2OFPA 4N03A 2DZDA 2LKDA 3F47A 4KFTA 3ZVKA 2EXXA 3CONA 2AI2A 3HJNA 5IJZA 1BD3A 1KBQA 1ZSNA 3RYFA 1BWSA 1N2SA 3RYIA 2CF6A 1GNSA 2GQ0A 4GWLA 3UGQA 2TS1A 1B6SA 1UH5A 4LV6A 5D51S 1V95A 4RJLA 5ALLA 1EDDA 3IOEA 6ABPA 5IH7A 4UOQA 1FNSA 5ERGB 1W5FA 1ZI9A 1RXCA 2GZ2A 1G8HA 1N0IA 4XM0A 4NNOA 2UUBB 5BOVA 5GGYA 1L1QA 4ID3A 3CIFA 2YIVX 1QM5A 2BZ1A 1EH5A 3PPIA 1NVVR 4YNBA 4B82A 5MHTA 1Y81A 4ATNA 3VO9A 3G02A 4Q1FA 1IAVA 2EL9A 1ZD3A 2W4MA 4ZTBA 3ZXYA 4DBVO 2ZBDA 5E1OA 4N0EA 2FPSA 4MW9A 5A7GA 2HMTA 3O4GA 1CEQA 3ZGNA 4RTMA 2C3MA 2HMVA 3K2IA 3V46A 1JKXA 2XUPA 3DJFA 4DLWA 4Z4IA 1DLIA 1PAUA 4HFRA 1FL9A 4OH1A 2JAQA 2XADA 1BVYF 2H5LA 2QMHA 1LLDA 3ECAA 5BN3A 1XRJA 1CY7A 2GWHA 3S55A 5K0TA 1W46A 2Q8NA 4NFSA 1UBJS 1GV1A 1K6XA 3HZRA 3VBCA 3CPEA 3ZLJA 1GU7A 3PG5A 4EUNA 1RNLA 5JQGF 2WG1A 4TKVA 2QRMA 2IU4A 2IZ7A 3JTEA 3VPSA 4F6RB 2X9GA 4FYVA 4L74A 4KO8A 3WLNA 3LO8A 4EHDA 3ZHVA 3MAJA 5E1MA 3MMSA 4FYPA 3W6NA 3STHA 1M2OA 4BDSA 3L0SA 1SVIA 1S8OA 2PYZA 2QBYA 3FNGA 2LIVA 3LXRA 4D4JA 2PTHA 4RAQA 2ESRA 2VRCA 4KDEA 1KY2A 2D6FA 3QBTA 4UU0A 1TZ2A 1G9SA 4UBJA 3WMGA 3NBXX 4FYMA 3MS2A 1IHPA 1SUCA 2JFZA 1WZCA 3QPAA 3G0GA 4M89A 2ZR0A 3KJXA 1DPGA 3I9OA 3SX4A 1B8NA 3I1JA 4CMEA 2ZS7A 5IMSA 3J7TA 4GPIB 4X6UA 3TAXA 3SNHA 1GLNA 1HQCA 4P93A 3PT9A 1VMKA 1Y1PA 1WUIS 2YWDA 3CYFA 4TXHA 5F33A 4Q3BA 4XGRA 5DI9A 1V37A 4DV0B 1PSDA 2DFPA 4J16A 5ALEA 5DLYA 3WGZA 5K6RA 2P9FA 4Q16A 1TZBA 3NDIA 4OL9A 3KDSE 2W98A 2Q7DA 2R6R1 2RAPA 1RQNA 1ULHA 1E3WB 3A3PA 1KQFA 1MJGA 1Y42X 4LF8B 4LWOA 3RVMA 3BWVA 4H7HA 4JUFA 2FX5A 4LJ6A 4TM7A 2GPNA 5CVVA 4HNHA 1DCMA 3OLQA 3WICA 1PCXA 2WP0A 5JCJA 5K0CA 1JAZA 3JD2A 4B83A 3MB8A 5K1ZA 3USES 1VIMA 4PZ0A 2NM0A 4YAWA 3L6CA 5EMJA 3G2MA 4Q02A 4YRFA 2BEUA 2RHWA 3IMCA 5A9RA 5IJ0B 1K92A 2D1QA 3P5BA 4EMBA 3HB0A 3E8SA 1Q1QA 4D9NA 4RF3A 4O3FA 3WWDA 3N3AC 3GAMA 1UBMS 2V96A 1ZD1A 2KX7A 2VP6A 5D85A 3PKIA 3OQNA 2QP3A 1U65A 4DCJA 5L40A 2R5FA 3MUOA 3GP8A 2GEKA 2XUZA 2YQZA 1AE1A 4PZPA 5EP4A 4ZQCB 2JEOA 4FGLA 2QTLA 1RYZA 4IIUA 3REQB 1JE0A 3H99A 4IJ5A 4ANFA 1OFHA 3LYLA 5CJJA 3PYXA 2DF8A 4B3RB 1CS4C 1DLJA 2XBUA 4FT4A 3A4YA 2DQZA 4IHQA 4DCPA 4RIIA 1C1XB 1JFLA 3HB9A 4JFRA 3R3XA 3DL0A 2OYSA 2Q0XA 4TL7A 2R47A 2JIMA 4URUR 5ALXA 4OKNA 2LXNA 1XMIA 2VZEA 2ID4A 3OCXA 1EB8A 4B5KA 3O38A 5JS1A 5HE8A 1KK2A 1T6BY 2FSGA 1XR3A 2P41A 1IPHA 1XBTA 3D8SA 3K0AB 1Z4IA 3ET5A 4Y6QA 1QFZA 2HEGA 2C7RA 1N0WA 4XSGA 1DDOA 4M0DA 4MDEA 1DX4A 4JEUA 4R1UA 2YZNA 4E21A 2Q3DA 3CJTA 4AP5A 1B3RA 2OO3A 1W2GA 2CLHB 2BMAA 3P8ZA 1Y89A 1G4AE 1LZKA 4V38A 1MO5A 3QQ5A 1UBGA 4NAUA 1ESNA 4XLTA 1U8CB 4E70A 4GLJA 4TS1A 2BONA 3NOVA 3FBWA 4I8DA 2P65A 2CLEB 1UC4B 4X1YA 4YHBA 1A3CA 4KN5A 3TK1A 2B9VA 2ZWMA 5KNBD 3VNQA 3V5NA 3JRNA 3A1TA 3ZHSA 1DCKA 1ZG3A 4MLCA 4HMPA 2ATCA 2GN1A 2AJCA 3FTCA 4MARA 4E5YA 4RA6A 2UVPA 1ZD9A 3UKOA 1KQOA 5AVRA 4KYUA 3MOIA 2M98A 2FDRA 1LI7A 4BNYA 4CL0A 5KNCA 2CE2X 3AVXA 3ISTA 2OCXA 4MA5A 2DFTA 2PKCA 5JQGB