3OIFA

Crystal structure of enoyl-acp reductases i (fabi) from b. subtilis (complex with nad and tcl)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
258
structure length
258
Chain Sequence
MNFSLEGRNIVVMGVANKRSIAWGIARSLHEAGARLIFTYAGERLEKSVHELAGTLDRNDSIILPCDVTNDAEIETCFASIKEQVGVIHGIAHCIAFANKEELVGEYLNTNRDGFLLAHNISSYSLTAVVKAARPMMTEGGSIVTLTYLGGELVMPNYNVMGVAKASLDASVKYLAADLGKENIRVNSISAGPIRTLSAKGISDFNSILKDIEERAPLRRTTTPEEVGDTAAFLFSDMSRGITGENLHVDSGFHITAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Crystal Structures of Enoyl-ACP Reductases I (FabI) and III (FabL) from B. subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 89
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2010-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3oifA00
4B4OA 3JQDA 4EGFA 1GCOA 4OXKA 4GGOA 4YB8A 3WBBA 3DBLB 4XD2A 5BNFA 3BAZA 4GX2A 5FFFA 4OL9A 5EIOA 5B4TA 3ZW9A 1RYEA 4DL9A 3IC5A 4P8RA 4F6CA 1O89A 3ZU5A 3WLEA 2VHVA 4R4JA 5JAMA 1DBVO 4YWJA 1JU9A 2GLXA 1Y1PA 4L76A 3OA0A 2OXIA 4BNYA 2B83A 3EVNA 5ICSA 2VHWA 1BDBA 4GX5A 3VDQA 3ZGYA 2CY0A 4TRJA 2Q4EA 1Y7TA 2W4QA 3KUXA 1SMKA 4JJGA 1MUUA 5KJEA 3TZ6A 1PGOA 2FSVA 2O2YA 4S1VA 1Q7GA 3U4DA 3WIDA 4BNMA 5DBGA 3BMOB 3WGYA 1C0PA 4PLHA 1HWYA 3AM5A 3GVPA 1UDBA 3K6JA 3DMYA 1NM5A 2FMUA 4IY1A 2EGGA 3DHNA 4I9NA 4QQRA 5IG2A 2G5CA 4R1NA 4GSKA 5ITWA 3PJFA 2DBQA 4YT8A 4QTZA 3DFUA 1JKFA 1RM5A 1S7CA 4I5EA 4ZD6A 1PWZA 5BSHA 5I8WA 1BSVA 1E7YA 4JP3A 4AJPA 1EK5A 1B8UA 1UXGA 5EQFA 1PIWA 3OJOA 4CMHA 4DQVA 2VYVD 2AE2A 4MVJM 2CFCA 4XRGA 1HLDA 1KEWA 2WMDA 2JCYA 3PGXA 2WD7A 4XYGA 4BO4A 3PTZA 4R9SA 3OJEA 1C0LA 3A9WA 4B79A 1H93A 4NFSA 4DLAA 3GK3A 1L1FA 4BOYA 5JNLA 3WFJA 1DPGA 5HWSA 4B4WA 2CDBA 2IODA 3HHPA 1ISIA 3ENKA 2Y0CA 2PR2A 4PRLA 2FZWA 3HDHA 3AFNA 1LXCA 3DMTC 2ZATA 3I6QA 1N1GA 5T6BA 3SLGA 2C54A 1NQAO 2FR0A 4BB5A 1LJ8A 3QJ5A 1HSZA 5IZ4A 3JYOA 3ONEA 3LLVA 2YJZA 2H1SA 3C1OA 3C8MA 3JQGA 1RYDA 1ZJZA 4RPLA 4YAIA 4A10A 1R66A 1VJTA 1G1AA 1XYGA 1YJ8A 2W2KB 2HJSA 5DOZA 3B6ZA 3W4JA 1WMBA 3DBHB 1D1TA 3BMCA 3JQ9C 4R1UA 1NR1A 1ORRA 3UVEA 1YGYA 5G0WA 5AXDA 3FCOA 1DOHA 2OMEA 1Z7EA 4G81A 2VTEA 4CQMA 1PTJA 1SAYA 1HZJA 2BI8A 3K73O 4PLFA 3GMSA 3WS7A 1LDMA 5DBIA 1MXFA 4PZCA 4Z3KA 4OMUA 3IKTA 4J43A 3GZNB 1CDOA 5EMHA 1U8FO 4XQGA 3E5RA 4ZQFA 4YT4A 5L40A 1E92A 3HB5X 4GL4A 4RPHA 1ZK1A 1X0XA 2Q2QA 1E5LA 1MX3A 4K9DA 3I5MA 4XX0A 3IQDB 3LDHA 3D5TA 2Y66A 4L4XA 1ADGA 2FR8A 2RIRA 1QLHA 5CDYA 4MPDA 3GAFA 5DCUA 2ZKLA 4TZTA 2NADA 6LDHA 4Y98A 4JCOA 4DLLA 1QLJA 1KERA 3SEFA 5LDHA 1QYXA 2Q49A 3QWAA 1TA4A 4HADA 5KVCA 4LRSB 4LN1A 1EEHA 5BQFA 2P4HX 3KO8A 1AXEA 3QQPA 4BNHA 2Z1MA 2YDXA 2BKAA 3GUCA 2GERA 4BVAA 3QW2A 4UVIA 4BQPA 4CUJA 4WCFA 1A4IA 2C5EA 4AJIA 2Q3EA 1X1EA 1WPQA 4RVHA 1M67A 1Y8QA 5BT9A 1SBYA 3WB9A 2IYPA 4TMFA 3ZCXA 1LQUA 3L0DA 4CQLA 4RO0A 3HE3A 5L7TA 4BNJA 3K2EA 1R4NA 3DAPA 3TZCA 3MOGA 3FNHA 1K0UA 3VZSA 3GDFA 2Y68A 2POQX 4E13A 5FWNA 1T2DA 3WNQA 3B1JA 5CG1A 3RIHA 4YJFB 4MP8A 2PFGA 4WASA 2O4CA 1IE3A 3DTTA 5C7IO 5ER6A 3HDQA 3JQ7B 3LT0A 3I3OA 5T5QA 2XPCA 1LSOA 2NU9A 5ILOA 2NQTA 2BFPA 3HDYA 3PYXA 1DIHA 2FY8A 2PKRA 3ZNNA 2NVUB 4HNGA 4XIJA 3KBOA 4D3DA 1ZUD1 3AWDA 3VZRA 4BIIA 1GEGA 3HZZA 4RLSA 3JD3A 3F1LA 1N8KA 4NIMA 5C5IA 3ZNPA 2GF2A 4QSMA 2DU8A 1DFHA 2DQ4A 1YQDA 4RQUA 1SCUA 4EUEA 1HYGA 1C0IA 4MDHA 3ASVA 4IMRA 2CDCA 3UXYA 1OBFO 3JV7A 5A4DA 1L7EA 3ZWXA 3LU1A 2ZYDA 1CJCA 1ZNQO 3ZWYA 5KJ1A 4FBGA 4XGNA 4YT2A 3RD5A 3MJVA 3MCVA 5A9SA 3V1UA 2NLOA 1HYEA 4CLOB 3IJPA 3L77A 4GLLA 1ZXLA 4QUKA 2IEBA 3WMXA 4DIOA 2H6EA 4NQZA 4BNUA 5JDCA 4IJUA 4CR7A 1KC3A 2P9GA 4EEZA 1F17A 5B1YA 1UUFA 2FSSA 1PS0A 2PY6A 3ZV4A 4FFOA 4Z9YA 3V2HA 2Q1UA 5THKA 4QFCA 3WLFA 3QIVA 4QX6A 2AQHA 4YEDA 3NYWA 2YDYA 4DVJA 4F45A 5CEEA 2CMDA 3QWBA 1LX6A 4Q3EA 5CEFA 1MP0A 1V9LA 3JQBA 4NHEA 4R5MA 4WJZA 4U0JA 2AE1A 3R3SA 1TXGA 2QQ5A 3OQ6A 4KUGA 4OO3A 2RHCA 1GPDG 3NGXA 5KJCA 1BVUA 5C3MA 4WKGA 4RF3A 1PJSA 2O7QA 2ZB4A 2X6TA 3V2UA 3E9NA 3PHGA 1B2LA 4WLVA 4FCCA 4OXYA 1IZ9A 2EKQA 5H83A 3KYBA 4LSMA 1HYHA 1NPTO 2J8ZA 3HNPA 3PP8A 3PHLA 1N9GA 3QA9A 1VL6A 4FGWA 4I8XA 1UXHA 3DHYA 3HJAA 4JGBA 1U8XX 1GV0A 4J6FA 1PZFA 2JAPA 1JWAB 4GKVA 2BRUA 5ILGA 1MLDA 2GYYA 3ROKA 4CMBA 4CMIA 4DBZA 1Q0LA 3CZRA 1JWBB 2UUOA 2I9PA 1A7KA 3A28A 3LF1A 3VKUA 4R01A 5C7LO 3FSRA 3OJFA 3I9JA 2Y1DA 2NU8A 2AQIA 5L3ZA 1T1SA 4A03A 1YONA 3AI3A 2X0IA 4ZGWA 4QEDA 4NPCA 5AOVA 2NU6A 1E3SA 5GMOA 4J4HA 4E5KA 1UXJA 1P77A 3AUSA 2FPIA 5IAAA 3ITKA 5AXBA 1EK6A 4MKRA 3DR3A 1VJ0A 3ASUA 3VH1A 4AL4A 1RM4A 1P33A 4R68A 3X2FA 4YXFA 2I6TA 2O3RA 2WM3A 2QZZA 2C20A 1H9BA 3JQEA 4YAGA 4E0BA 1TT5A 3IMFA 1Q7CA 1NBOA 1I0ZA 3P19A 4YR9A 1T2CA 4BO1A 4NG5A 4XIYA 4J90A 1ZK2A 1LTHR 3ZWBA 5EQDA 3SC4A 1C3VA 1E3IA 1PJLA 1BXZA 1PJQA 4FFMA 4YA6A 4UVGA 1NVGA 4B7XA 2ZTUA 5I7SA 1UR5A 3AY3A 2GO1A 1Z74A 3IKVA 5DNAA 1B3RA 2OBNA 1DDOA 1MV8A 4AJHA 3DTYA 4BNKA 2BMAA 3ADPA 2AG5A 3INTA 2GCGA 4Q3DA 4IS3A 1B0AA 1WXDA 2JFHA 5COBA 1ONPA 4OAQA 1VKNA 1B14A 1XEAA 3GVIA 3IUSA 5A9TA 4QO7A 4Z3DA 3BXXA 4O0LA 1DIAA 1XWFA 1BMDA 1CERA 3NTRA 2Q2VA 1WDMA 5JAQA 3ZNOA 3D3WA 1GQQA 3SX2A 2WE7A 2X0RA 4IZHA 1LLUA 4BO2A 3GGPA 2WD7B 4XYEA 5T8KA 4HUJA 1W6UA 3MJ4A 1IUKA 3S1LA 8ADHA 5LDGA 3WNVA 4KQXA 4MVJI 4U7WA 1Q2XA 1NHGA 2B5WA 4AVYA 3F3SA 5CP8A 2VZ0A 4MKZA 3NRCA 1EVJA 1K3TA 3PLRA 3EVTA 3W6UA 2PH3A 4IDEA 2PZMA 3FRJA 1E3LA 3F6YA 3JQ8A 3JQGB 1YB4A 2QYSA 4OSOA 4ITUA 5DN9A 4CV1A 1WLYA 4UEJA 4UEKA 4A2CA 1BXGA 3PDUA 4TRRA 4D43A 5JS6A 4OSPA 3DBVO 3CINA 1LSJA 3AI1A 1DAPA 4BMNA 5A3VA 4J7UA 4BB6A 3WMWA 3JQAA 4CQMB 1P1HA 3DONA 3MTJA 2F00A 3H5RA 1K89A 4ILKA 4U5QA 2X9NA 3F46A 3VVBA 5KTKA 1ZBQA 3GAZA 1K6IA 4CMEC 1X13A 1SB9A 4OYRA 2EHDA 1NP3A 4E2YA 2OOSA 4RQTA 4PLVA 3ZHXA 3PYMA 3RJ9A 4L9RA 1PJ3A 3ZU3A 2HAEA 2YZ7A 1C14A 5KWEA 5ICMA 1VPDA 2GN9A 3LC7O 3VPXA 4IDAA 1HDCA 1H0KA 3ON5A 3OP4A 3OJ0A 4J49A 4OJNA 4GSLA 2J3IA 4JROA 3O4RA 1Y6JA 1NQOA 3GN1A 5L51A 2UYYA 2JL1A 2PLAA 3IDSA 4LMPA 2A94A 4HNHA 4Z0PA 4HY3A 3I9MA 1ZK4A 5TS3A 4U6SA 5TIIA 2VYNA 5JC1A 4KTVE 2ZB3A 4Y6PA 2BGMA 3H2ZA 4N5MA 3GUYA 4I5DA 1TB4A 3F9IA 3GPDG 3ICPA 5TSDA 3DAGA 5TJ9A 4ZQGA 4GMFA 1LLCA 5CHEA 3VTZA 4WCFB 3AOGA 1CQIA 3IJRA 2DTEA 2NQ8A 3OQBA 4IZIA 4JXKA 5FYDA 4RPGA 3AJRA 5CPFA 1Y8QB 1EVIA 2CD9A 1C0KA 2CVOA 3RBZA 2UUPA 1P44A 1T24A 3KLMX 3NAQA 4KDFA 3K92A 1H2HA 3TZQA 4CQLB 2IYOA 4LGVA 1GUFA 1P1RA 3QVOA 1QR6A 3S2GA 1ZK3A 1KEUA 1RM3A 2EEZA 2HLPA 1R4NB 2GZ3A 4N5NA 4CV3A 4IGFA 1O95A 4CV0A 4RJTA 1NQ5A 5L4LA 2GR9A 4OKIA 3RC9A 2RH4A 3C1TA 4J2OA 3KRTA 4Y6RA 2D5CA 1E6WA 1DB3A 4RV9A 2OORA 3I9LA 5KVSA 3SVTA 3ZHYA 5JW6A 1ENOA 2AG8A 3M2PA 4MVJE 4UUNA 2BLLA 1QKIA 2EP7A 2HMTA 4NBUA 6ADHA 1WMAA 2EJVA 2Y0DA 1ZKMA 4YCAA 3ZWCA 1IPEA 4INAA 1PEDA 2ZYGA 4JBGA 1HXHA 3V2GA 4E4YA 3VC7A 3D4NA 4RVFA 4BNNA 2D0IA 2D1YA 4NMHA 1QP8A 1Y9EA 3PI7A 4JNKA 1Q0QA 3AU9A 1T4DA 3DBRA 1CWUA 2NSDA 2B4TO 4TZKA 2QW8A 3L4BA 4NBRA 1ADBA 1GFSA 3O26A 2ZB8A 1HDRA 1XCBA 3CTMA 4TSKA 3ZWVA 3RQSA 2G76A 2BFAA 3ADOA 1MG0A 5COQA 3DQPA 2X9GA 3PJGA 3W4IA 4CMCA 5A9SB 3WWYA 4R54A 3CMMA 3I4CA 3KETA 1GPJA 3AUAA 2QZ9A 3STHA 1JA9A 3ZWMA 1YKFA 3AM4A 1ISFA 3C3XA 3JYPA 4XYMA 3VDRA 4DMLA 4DYVA 5JY6A 3G1UA 3Q11A 5EPOA 2PWZA 3LK7A 4B7UA 3S2IA 3HG7A 5JC8A 4IQ0A 2HJRA 3DFZA 4MVJD 4P38A 2CUKA 5A05A 2CVZA 4FOOA 2DVMA 3BMQA 1RM0A 4PVCA 3TJRA 4MVJH 4XJSA 3GRPA 1YRLA 3OHSX 5TT0A 4GI2A 1HF3A 2Y1GA 3HQ4O 4IGEA 4MIEA 5CAEA 4E31A 4FFRA 4G5HA 2Z95A 3E9MA 3W4KA 5CFZA 4BNZA 3OIFA 3L4SO 2XAAA 1NAIA 1I3NA 5DULA 3TL2A 5TT1A 1DSSG 1DEHA 2VHYA 4DXHA 4DPKA 1SB8A 2PKQP 4WK6A 4CR6A 4I5GA 4ALNA 1NYTA 1DLJA 1NR7A 3EGOA 2JCXA 2PD3A 3O8QA 1P3DA 4AJ2A 4D45A 1IL0A 5G0UA 3FWNA 3DZJA 4YJGA 1N9GB 1NXQA 1WP4A 3E48A 4OQYA 4BGIA 3NGLA 4B3IA 5A5FA 4WCFC 4F6LA 5TF4A 4MOWA 4KP7A 3NT5A 4CMIB 3BTUA 4HBGA 1XHLA 1VL8A 4W9NA 3FN4A 2NACA 5JCJA 3BTOA 5KIAA 5L95A 4NDNE 1A9ZA 3A14A 1EFLA 1XLTA 4WEOA 4A27A 3WGZA 2O48X 1F06A 1BGVA 2NVWA 3K96A 2LDBA 3V5NA 1QV6A 4D3SA 1GDHA 1M6HA 2HK7A 1H6AA 2RCYA 2JD0A 5KKAA 3VPSA 2FHSA 5B12A 3V1YA 2ET6A 1AN9A 3SBOA 3AOEC 3TDKA 3ZZNA 3N58A 1NHWA 3IS3A 1PSDA 5AXCA 1HDZA 5COAA 5EN4A 2GRAA 4MKXA 2B0JA 2FPGA 2YYYA 4A0SA 1FDUA 4RF5A 1P74A 1HDYA 3UF0A 1ZCJA 2X0NA 1TT5B 1U1IA 2VUUA 2PZKA 1QYVA 2FR1A 3GOHA 4CM8B 3ZWNA 3WGHA 1R0KA 3ROPA 5HS6A 5TC4A 1JAYA 4E5MA 5IXSA 3RC2A 2Y99A 1ZH8A 1ISGA 1I8TA 1X7DA 3ROQA 4ALLA 2O3JA 3JQCA 1D1SA 2V7PA 3INRA 3NDRA 3ZU2A 4IQ8A 3PIDA 2BFMA 1GYPA 4BNLA 5HM8A 2QG4A 1XU9A 1YOVA 3UKOA 1VI2A 3OEYA 2IZ1A 3N74A 1LLQA 1AE1A 4WPGA 4JIGA 4LVCA 2JFFA 1MA0A 2HU2A 4BO3A 4NU6A 3FWZA 1VJ1A 2EKLA 4CM4A 5JDCC 3ZV3A 3VH2A 2EG9A 1KS9A 1EVZA 1KVRA 1NVMB 4PG5A 1QYWA 3D3WB 3U9LA 1M6WA 2O23A 3HN7A 1PQUA 4IIUA 1E7QA 3GNTA 3Q2KA 1LSSA 3L6OO 3WTCA 5B37A 1UXIA 4MP3A 1CQJA 4NK5A 3RROA 9LDTA 4PG8A 5EERA 3WYCA 4JK3A 5AVOA 1T2EA 4B3HA 1RWBA 2W98A 2BH9A 3AUTA 3G17A 3PYLA 4B7CA 3JTMA 3OECA 3SXPA 3JQBC 1ADFA 1OC2A 1N5DA 3G3EA 3INGA 1PGQA 4MJLA 1LEHA 2P5YA 4CMGA 1HDOA 1KIFA 3WQRA 3VAZA 7MDHA 1MXHA 4BNIA 5A3JA 1T4BA 3KOUA 1O94A 3JYQA 4IDFA 4RDIA 4DRYA 1FDWA 1PJ2A 2RAFA 3NEPX 1BXGB 2BFOA 2QHXA 2J6IA 2W2LD 4L0QA 2DUUA 3I9OA 2Q45A 3FD8A 2C29D 3WSWA 2JHGA 2R00A 4NZ9A 3FI9A 3T7EA 1V3TA 5JDIA 4PG6A 3RSHA 4K6FA 3JQAB 3PDJA 3H8VA 4OKNA 3RUAA 4AJ1A 1D8AA 3BMNB 3WGOA 3RUHA 4DGSA 3WGQA 1HE3A 3HFSA 4XYBA 3ONDA 3ZWWA 1DHRA 2AHRA 4XQCA 1EUDA 3BHIA 3WR5A 3KM0A 4J1NA 1UP4A 4KDEA 1K5HA 4NFYA 3GPIA 5IFLA 4XR4A 3GGGA 1QYDA 4ND1A 1W4ZA 1JQBA 5L7WA 5IZCA 1DIRA 3H9JA 2X5KO 4HFNA 1U4OA 3FTPA 5BSFA 3FBTA 4PLZA 4OHUA 2VNAA 4DIBA 2HKIA 4XJTA 5G4KA 1WWKA 1ZK0A 4O1MA 4W4TA 1NX6A 1R16A 4Z9FA 2DLDA 4E6PA 1F14A 2IXBA 4FC6A 1VM6A 3P7MA 2GN8A 3RAJA 2R6JA 1QG6A 4OQZA 3QE3A 3WGTA 4YVFA 3AY6A 3LQFA 1GTMA 4J2HA 4KZPA 4GVXA 4AJ4A 5A02A 4TVBA 3GA0A 3MJTA 2GNAA 1P1IA 4H15A 1U3TA 4PLWA 1I5RA 3G79A 4YRDA 3SJUA 1YO6A 1FK8A 2GD1O 4E30A 3PFWO 1DAOA 1GUYA 3ULKA 4D7AA 2DT5A 4GVLA 5F5LA 5L7YA 1O5IA 4DUPA 1DRWA 1IPFA 4IJKA 3QRWA 4LRTB 1LC0A 3U4HA 2YHIB 2AQ8A 4DWVA 2JJYA 5I8ZA 1XQ1A 4FW8A 3B1FA 5F1PA 4DC1A 1P1JA 1HE2A 1L7DA 4FJ1A 2NTVA 1GZ6A 4J16A 2Y05A 2Y67A 3FNGA 4ALJA 2JCVA 2DUWA 4WLUA 2OFPA 1ZFNA 1SOVA 2YV1A 3WG9A 3KLPX 5BNTA 3MJCA 7ADHA 3Q9UA 4M86A 4OOFA 4X54A 5AYVA 5TQVA 3B20A 3OIDA 5JFOA 1HDXA 1A7AA 3ORFA 1A9YA 1VL0A 3RFXA 3WWZA 4ALMA 4DPLA 1Q0HA 2J5QA 1HDGO 3JCZA 4FC7A 3DBRB 2RHRA 4CMAA 1HZZA 4CMJA 3H9EO 1T26A 5ES3A 5GY7A 4YRAA 3OA2A 3RUIA 1D4FA 3GVHA 4HXYA 2X1HA 3O03A 2ZJ0A 3VVCA 5ITVA 1U28A 1XIVA 4WUVA 4RVDA 3PRJA 3MJSA 4IBOA 2X0JA 3GNSA 2EW8A 4L75A 5I9LA 4C7JA 2CNBA 2EKPA 2Y1CA 1MC5A 2F1KA 2I66A 3GVCA 1FDSA 3KSZO 3K8ZA 4J7XA 5I9MA 4A73A 3GDGA 1V3VA 3COSA 3BMQB 4ZICA 3GN2A 1B16A 2WTBA 3ICCA 4GX0A 5JY1A 4XR9A 4Z0HO 1EBFA 3RJ5A 1MFPA 1UZLA 4CV2A 1O6ZA 1P45A 4PIVA 2EGHA 3WICA 3OF2A 3PJDA 2VOJA 2D5AA 1R0SA 1UP6A 3GF4A 3EYWA 3TFQA 3WGGA 3UCXA 1YXMA 2Q1WA 5F5NA 2RH8A 3LLSA 1QYCA 4OXNA 4PLCA 1R37A 3MOIA 4CM7A 2NTNA 2VRBA 1JAXA 2AW5A 3OICA 1BHSA 3RC7A 3QVWA 4R3WA 2EV9A 2YHUA 3DMTA 3O8QB 5FEUA 1AHHA 5EESA 1HL3A 4TKMA 3ZNQA 1XQ6A 3KYCA 2O3UA 4XEHA 4YJGB 4AJNA 4QO8A 3DZIA 3GRKA 2CF5A 3I9NA 5TGDA 2E82A 2I67A 4EBFA 4IJVA 3U09A 1ISMA 5K0ZA 2VWPA 1R12A 2Q99A 3I4FA 3EZYA 2WSBA 1M2WA 2NNLD 1IY8A 4PRKA 9LDBA 2B35A 3U62A 1P1FA 3VZPA 2P91A 3H9QA 4UUPA 1WAMA 1ZMOA 1W73A 3FF4A 1Z6ZA 4WNCA 5JPIA 1LA2A 2UAGA 5CDGA 1ID1A 1G0OA 4FJ0A 4M1QA 2AEJA 5L53A 5KVVA 5JMPA 1DIBA 1DC6A 3H9UA 1MFZA 1TT7A 4RL6A 2LDXA 5HTOA 3HADA 1UP7A 2EF1A 2PGJA 5AQ1A 3JYNA 2BD0A 3H3FA 3GEMA 4IXTA 4E3ZA 1GV1A 4CQMD 3KXDA 2DPGA 4RVSA 3K5PA 4ZRNA 4D0RA 1NPDA 3GY0A 2WE8A 1B3BA 1LDBA 5A5EA 3UH1A 3DB2A 5JMWA 2D8AA 1XKQA 2VRCA 3H5AA 3RI3A 1ZVMA 3NX4A 1H94A 2YQ4A 3LC1O 2DM6A 3KTDA 5MDHA 4MVJG 2G0TA 4GMGA 4R51A 3L4BC 2V6MA 1YVEI 1EQUA 1YOVB 2HK8A 1FDVA 3DEYX 1PR3A 3BMOA 3HFGA 3B1KA 2GN6A 1GZ4A 1MB4A 1KEPA 1E1LA 3M2TA 1X1TA 1TVEA 1N7HA 5DF1A 3WQQA 4AJJA 4U8GA 3GHHA 4CM4B 1I32A 4GPD1 2WDZA 4XGIA 1N7GA 2DFDA 5B4VA 2X7HA 4D46A 1LNQA 1YQGA 3AUUA 5CDTA 2G82A 8LDHA 1WNTA 1O8CA 5H82A 1EDOA 3I1JA 3UFXA 3WTBA 1UAGA 4HP8A 5GZ6A 2V65A 2CVQA 1U3VA 4J0FA 5BNIA 2VWHA 3E5MA 4QECA 3D64A 2YQ5A 4YACA 3PWZA 4LK3A 3ZW8A 3OM9A 1U7TA 5CEJA 4NJOA 3PWSA 4LISA 3BHMA 1EE9A 3D3EA 4MP6A 3GNQA 5KNLA 1LDNA 1U2GA 1DJQA 3GFGA 2EXXA 3DXFA 4PG7A 3WDSA 3BMCB 3S8MA 4OH1A 3JD4A 1DC5A 5IN4A 3ZU4A 1IHXA 1MGOA 2OZPA 4BNWA 1DRVA 4H3VA 3KYDA 2PZJA 4NFHA 1M66A 2NUAA 1PZEA 4XDZA 1ONNA 4XYLA 4I08A 2E6UX 4AJKA 4WLEA 2D4AA 3E18A 5CDSA 2X23A 2OP1A 5IDYA 1Z45A 5JO9A 3LYLA 1XSEA 1P0FA 2X5OA 3TN7A 4M54A 4YT5A 2OBYA 3AFMA 1GY8A 3BTSA 1EUZA 2PD6A 3V8BA 3H4VA 3IIEA 1NNUA 1LQTA 1Z7BA 3QWFA 1RPNA 3EK2A 4NU5A 2HQ1A 1UJMA 3NJ4A 1I36A 1KBZA 1PR9A 2YFQA 5DP2A 1E3EA 4PN3A 5KJFA 2E37A 1HRDA 3ANLA 5HRUA 3CE6A 1WVGA 4HWKA 3H6KA 3MTGA 3P2YA 4ZHSA 1YWGO 3WJ7A 4EYEA 1HSOA 2NU7A 3MZ0A 4Q3NA 1OOEA 4FJ2A 3U0BA 5G4KB 5KCZA 4L73A 3E82A 1I2ZA 1CF2O 4YQYA 4AJLA 2Q1SA 2E48A 5HS4A 4K26A 3PHIA 2HMVA 4YJDA 1QXSA 2O2SA 2UV8A 5AXAA 1MG5A 3FPLA 1ENZA 4EJMA 2VYVA 1EFKA 4N5LA 4XQEA 5T64A 4XZ3A 1GL3A 4BV8A 1I3LA 2FN7A 3K2BA 2VHZA 1ADCA 4CODB 1XELA 3ROMA 5ER9A 1U3WA 4GKBA 3IL2A 1UXKA 1J6UA 4DC0A 4RDHA 2D2IA 3F5QA 3UCFA 4BV9A 1PU2A 4G2NA 2IXAA 4R1TA 4J3FA 3KSUA 3DO5A 4NR0A 3GHYA 3M1AA 3ENNA 3VPHA 4BNTA 3CIFA 3KB6A 3KVOA 2O50A 1PX0A 2QX7A 4BKUA 1LSUA 2NWQA 1ENPA 1GEEA 4YPOA 4EEXA 3ETDA 4L4SA 3R6DA 1CETA 2GDZA 3DDNA 1HLPA 3DWFA 1EVYA 4DTIA 2Y1EA 3KSDO 3OEWA 4DLBA 2ZYAA 3DZBA 3ZDFA 1ZEMA 1LRLA 1ZSYA 1SOWA 2ZK7A 2VQ3A 4YYZA 3GG9A 1IOLA 2OL4A 1BXKA 1KY4A 5IN5A 1PJ4A 2DTDA 4RLHA 1I3MA 2Q4BA 3D5QA 4XQ9A 2H5LA 2Y1FA 4M87A 2H63A 4O59O 1CYDA 1LDYA 4I1IA 4EZBA 2BI7A 3MWDB 4FSHA 3ZV6A 4LCEA 4Y67A 2FRDA 1E3JA 2PA3A 5DCWA 2VCYA 4ND5A 3EUWA 4P4GA 4FB5A 4FN4A 2C07A 2Q1TA 2WJPA 3KZVA 1BWSA 2ILTA 1O0SA 1UAYA 4QFDA 1NFRA 3OH8A 2D3TA 1OAAA 2HSDA 3WYEA 1YL5A 3C7CB 3PXXA 3RBVA 2R00C 3VTFA 1PJTA 3NDJA 1LI4A 5JDIC 3RUDA 2HUNA 1JVBA 3F4BA 4RF2A 4D42A 3JYLA 2WYVA 1H6BA 4OGWA 4BKOA 2DBVO 3JQFA 4IINA 4IMPA 4J91A 3U3XA 3W1VA 4TVOA 2GN4A 1IB6A 1PZHA 2X8LA 5CPBA 5G2OA 4PLYA 1A71A 1I33A 4NI5A 1F12A 4BUCA 3O9ZA 4UVHA 1C1XA 1Y8RA 4HV4A 2FOIA 5JCXA 3DAFA 3GH3A 4XRRA 1F8GA 4YJHA 4Z9XA 4AJEA 4LSWA 2X86A 2Y0EA 1FMCA 1KY5A 1F0YA 1Y81A 2ZTLA 3H3JA 5G4LA 5FI3A 4B4UA 4BMVA 3F1KA 4CL8A 5IDQA 3KHUA 4FIZA 4E5PA 4J1SA 2J3HA 4KOAA 4RGBA 5IZCC 5ADHA 5EJ2A 4R16A 5L4SA 4WGGA 2BGLA 4R69A 2X22A 3WFIA 1JN0A 3ETGA 1E5QA 3H65A 3ITDA 3PQDA 2DBRA 4QT0A 3HUDA 3K31A 3UOGA 1HKUA 2ZCVA 3KYCB 1UDCA 3H9GA 1GD1O 3GC6A 5DCYA 2C59A 1J5PA 2ZQZA 2G17A 4RVUA 1JTVA 3R3JA 4RPKA 2DC1A 3TZHA 1R4MA 3GDOA 5C7OO 3WX0A 3UGKA 3S55A 4UULA 1OZAA 1ZSNA 4UEOA 4NJMA 5ENDA 5BSEA 4DIFA 2W90A 2YFHA 2GSDA 3BA1A 3NTQA 3ST7A 3UW3A 5JAIA 4C4OA 4BHTA 1K2WA 3UAGA 3GGOA 4EITA 4BNXA 5HBRA 1ONOA 1GUZA 2PGLA 5DZSA 1PZGA 1VRWA 4CUKA 4CMEA 2CDAA 2HMWA 1C1DA 1JKIA 2IRWA 1GADO 3BTVA 2AEFA 4BO7A 5JYDA 1EZ4A 4JN6B 1YL6A 3GMDA 4G65A 3QVXA 4RPJA 1Z75A 4UVEA 2BF7A 4FOSA 4BO0A 1PQPA 3DZFA 2WYWA 1HE5A 1LU9A 4O5OA 4PLGA 3FHLA 4ND4A 1V6AA 1PJBA 1LLDA 3JQ6A 3QWIA 4CLDA 2B37A 2ZTVA 3E1KA 3JQAD 4HFJA 1PGPA 4RZHA 3HSKA 4BGUA 4ESOA 3DC2A 4C7KA 1FXSA 1HETA 2AQKA 2X58A 1YQXA 3FNFA 3OQ1A 2VZ9A 2GUGA 3L6EA 4MIYA 1KOLA 1NFQA 1A72A 1U4SA 4CR8A 3U5TA 1V3UA 3ONFA 3MJEA 2Q50A 2OP0A 4IS2A 1E7MA 4E2XA 5KJ6A 3JSAA 4WNIA 4BGVA 4HKTA 1E1NA 3FBGA 2YUTA 2HCTA 4Y8VA 5C37A 4B4VA 4R3NA 2VYND 4K1LA 3V1TC 4XKJA 1SNYA 2XXJA 2VZ8A 4ALKA 3ANMA 4E2ZA 3DZGA 2VNSA 3GEDA 4TKLA 1E3WA 5K6AA 2I3AA 1SC6A 3F4LA 3ZWAA 1DC3A 4E2WA 1YBVA 4K28A 3RWBA 3OBBA 2C2YA 3G49A 3PQFA 3OSUA 1VLLA 1P9LA 2GASA 3VPFA 1X7GA 3D0OA 1NWCA 2I76A 4GH5A 1J4AA 3LC2O 1PS8A 4H16A 3JQ8B 1DFIA 3VOSA 1CEQA 3RKRA 3HDJA 1SEPA 1VSVA 3I23A 4Z0TA 1KVSA 4OIMA 3JD2A 3TRIA 2PK3A 4E33A 2QRLA 4D79A 5JLAA 1XDWA 3FNEA 3GZ4A 2ZCUA 4LW8A 5DOVA 3C85A 4BGEA 4CMKA 4NNJA 3MEQA 2P9CA 4UAGA 2OUIA 5CDUA 4CLEA 1DLIA 1EDZA 1XG5A 2A35A 3KYDB 4AICA 5U9CA 4LMRA 3DHEA 3EHEA 3FR8A 1WDKA 4CLRA 1PL6A 2XOXA 2C2XA 2DBZA 3QVSA 4CUZA 1P1KA 2PTGA 4J1QA 4LVUA 4CM1A 2C5AA 5TJHA 4JLWA 5JAZA 4HFRA 2NTJA 2QRJA 5F1KA 1GCUA 1YB5A 3H5NA 4IM7A 2OGUA 4BKQA 2GZ1A 1RJWA 2V6GA 1DFGA 4A7PA 3QP9A 4TROA 3F5SA 4BNVA 4MO2A 5L45A 2JD1A 1GR0A 4FFPA 2IE0A 3EZLA 2D59A 5F21A 1QV7A 2G1UA 4YAJA 3UUWA 2J3JA 4XCVA 4PG4A 5L9AA 3CH6A 3WOHA 4Q3AA 4TRMA 1GYRA 4ALIA 3S2EA 4MIOA 1I01A 3T7CA 4A5OA 1H5QA 3RFTA 1IZ0A 4UUOA 3CMCO 4TWRA 3OJLA 4IQGA 1SZJG 3PIIA 4E5YA 4RORA 4GQAA 3W8EA 4BS9A 3TFOA 4PZEA 3UCEA 4BO6A 3W6ZA 1EQ2A 2Y1OA 1ENYA 2HRBA 4L74A 4XGKA 5IDXA 4BNFA 1E1KA 3AK4A 3PGJA 4II3A 3ZV5A 1DHTA 1BVRA 1O9BA 3GQVA 1KC1A 4R1SA 1Y9AA 5TRTA 2A4KA 3ABIA 5JE8A 3HN2A 2DKNA 5LC1A 1YB1A 3DOOA 1GZ3A 3WSVA 4ZN6A 1Z82A 1PQWA 1IYZA 2IDZA 1HE4A 4Q9NA 4KMSA 1ZW1A 1E0DA 1Q7BA 3AW9A 4W82A 3GT0A 3Q9NA 3PZRA 4II2A 2P68A 3NDIA 3MWEB 3RUEA 1H6DA 3JD0A 4W7HA 4N7RA 4UUMA 1JKJA 2BELA 4ZA2A 1E77A 1CRWG 4FR5A 1TI7A 2IZ0A 4L4RA 3IOYA 3WQSB 3TSCA 4DREA 4XWYA 4B3JA 1NFFA 3M1LA 4AJOA 3W8FA 1OI7A 3VPGA 3RU7A 1I30A 3U49A 2X5JO 4BO5A 4Y6SA 1I10A 5A1TA 5T8KC 1MC4A 5A03A 2J3KA 2EIHA 3RFVA 3GVXA 4ONEA 1KVUA 1NQTA 3AOEA 3DL2A 1E1MA 1WZIA 1ULUA 5JCJD 1H9AA 4CM5A 3D7LA 3AM3A 3RUFA 5B4UA 1UZNA 1LUAA 3WBFA 4YRBA 1NASA 4PLTA 5JBIA 4BKRA 1IHYA 3K9QO 1YL7A 2O4UX 2VUSA 4CL3A 3EC7A 3LZ6A 4ZU3A 2DTXA 4B8ZA 4D3FA 5H81A 2TMGA 2PH5A 1BW9A 4J9VA 5TX7A 1OMOA 2WEKA 2VT2A 4W7IA 3GEGA 2AA3A 4H7PA 4WOJA 5G0VA 4CLHA 1ZZEA 3ZH2A 1M75A 3I9KA 2PZLA 4E21A 4ID9A 4EUHA 1I24A 1AXGA 1LBEA 2EP5A 5DP1A 2JFGA 1WZEA 1LRJA 3LF2A 1YBAA 3QV1A 1DRUA 4GX1A 3FTNA 3E9QA 1G0NA 1U5CA 2C7GA 4PCVA 3T4EA 3GR6A 4NBWA 1DIGA 3L9WA 4O6VA 1H2BA 4DMMA 1ZEJA 3S2FA 2V6FA 1Y5MA 2P4QA 2EERA 3DZHA 3CXRA 4FGSA 4D41A 4B8WA 1VKOA 4LCJA 5THQA 3UHAA 1C1XB 1UH5A 1Y8RB 4PGFA 5I7EA 5IXYA 3TWOA 1UZMA 4XB1A 4YJHB 4JP2A 4WLNA 3RKUA 4J7CA 2XXBA 3C7AA 1PL8A 1A4UA 4OM8A 1WW8A 5A06A 1FJHA 3LT1A 4ZQEA 3JD1A 1X0VA 2P2SA 1N1EA 4DBVO 1ARZA 3L07A 3RASA 3CZMA 1QORA 3KV3O 4A26A 1QRRA 2NVBA 2VN8A 4YTEA 4MINA 3SJ7A 3CPSA 4BQRA 4CJXA 2A9FA 1DJNA 2AEMA 2Z1NA 4UVDA 2BHLA 1T1RA 4GGPA 1ISHA 1LC3A 1R0LA 3NKLA 4GLOA 4NK4A 4TRNA 1I3KA 4WCDA 2GGSA 1JW9B 3JQ9A 2TMDA 2UVDA 2FPPA 3U4CA 2P5UA 4YDRA 1U5AA 4PZDA 4S3MA 5F1OA 1R4MB 2CZCA 4F3YA 2E4AA 4I5FA 3TZKA 3PZBA 4NJMB 3LT2A 4JQCA 1SPXA 1A5ZA 1ZXBA 5T57A 1B7GO 1X14A 3R1IA 4DA9A 3EW7A 1N2SA 3I52A 3ETEA 3OIGA 5GZ1A 2OO5A 3EMKA 3G0OA 3UN1A 1U2DA 1NPYA 1C1DB 1DXYA 4CM8A 1NWHA 4AFNA 4DYDA 4W6ZA 4GWGA 3DBLA 4PLPA 3WXBA 4ZQBA 1U9JA 1HT0A 4KQWA 5JYEA 1YBMA 4FFNA 3CUKA 3NUGA 4Y9DA 2NM0A 2ZTMA 2C7VA 4JBHA 5J23A 4BKPA 4M89A 5TLSA 2YV3A 3DOJA 3NT4A 3IP1A 4WE3A 3RCBA 4IJWA 1B8PA 3VHRA 4QXMA 1NAHA 1ZJYA 4MVJA 3WIEA 1DO8A 1ZMTA 3F47A 3NV9A 4J4TA 3QLJA 2GZ2A 3EY4A 3QHAA 4N18A 3T4XA 2PGDA 3I6IA 2EWMA 2J5KA 3PPIA 3BIOA 5JO0A 4WECA 1KYQA 2X4GA 3TQHA 5IJZA 5JXWA 1NVTA 4FQ8A 1U7HA 5BSGA 3GFBA 4M49A 3Q1LA 1QSGA 3VKVA 4U6QA 4EUFA 2ZIZA 3Q0EA 4W99A 4ZRMA 1H6CA 1D3AA 5I7FA 5IF3A 1X7HA 1BTOA 2FWMX 4CM9A 4EDFA 4FS3A 4I9HA 1N92A 3ZN2A 2P9EA 1XGKA 4L8VA 3Q2IA 3ANNA 3JQFC 2QRKA 2VWQA 4ZVVA 1E7RA 3LSYA 1E3WB 2J5RA 2JAHA 5KKCA 4K6CA 5G0TA 3TL3A 4JJFA 2IZZA 1PGJA 2RBEA 1KVQA 2Q2WA 4XDYA 3TPCA 3BZUA 1WDLA 3IUPA 1AUPA 4N54A 3L6DA 4D0SA 1BDMA 1ZSVA 2UDPA 1ULSA 4R5HA 3H2SA 4FPXA 3QY9A 4CM3A 5L4NA 4KUHA 4IDCA 1NTOA 3QWHA 4BO8A 1T25A 2V6BA 3PHHA 1M76A 1S6YA 1VSUA 4KTTE 5MGBA 2QYTA 1P0CA 3TOXA 1J0XO 4NBVA 2PNFA 2CF6A 2R2GA 4M8SA 4EI2A 4IDGA 2HMUA 2W2KA 4Z6KA 3E8XA 1G6KA 3DBHA 4GWKA 4W9NC 1P31A 3Q3CA 2XF8A 5FI5A 1E7SA 1YS4A 2FZEA 1EBUA 3PHJA 2WD8A 4JX8A 4CLRB 3UICA 1E6UA 3OETA 1PJCA 3ZWOA 2HRZA 3WGIA 1SO8A 1XU7A 3ZWPA 1E7WA 2OHXA 3CKYA 3R0IA 4XB2A 5LCXA 4WEQA 1AHIA 2SCUA 3SC6A 4YAKA 4YQZA 1DC4A 5EL0A 1HEUA 3EAGA 4D44A 1XA0A 1FF9A 4F46A 2B4RO 3BMNA 3D4PA 5KOIA 4URFA 4RZIA 3GZNA 3U4IA 3QSGA 3QVTA 4HX5A 1VE9A 4GBJA 3C7DB 3A4VA 5U4QA 2HK9A 2VWGA 4OOEA 1GQ2A 2I99A 3PWKA 4RVGA 5DT9A 4R9RA 1OFGA 2WWRA 1LDGA 3IAHA 1YH3A 4BNGA 3A1NA 3EDMA 2ZJ1A 1BRMA 1PGNA 4RF4A 3CSDA 1TLTA 2IEDA 1Z73A 3D1LA 3CEAA 3O38A 5KVQA 3A06A 5JSFA 3AI2A 1GYQA 3TF5A 4ND2A 1JDJA 2I5PO 1IULA 5IDWA 3GLQA 5EINA 3E6AA 2GPTA 1KETA 3AU8A 4PVDA 4BO9A 1D7OA 4IPTA 4IXWA 4GAEA 2DAPA 1PL7A 2E49A 3ZI0A 2X9VA 5ENVA 2VT3A 1VC2A 2DFVA 4CPDA 2EJWA 2VHXA 1JLLA 1GQYA 3PQEA 3HWRA 1K6XA 2O3SA 4KWHA 5DDIP 4DPMA 3RU9A 2QIOA 3PVZA 4JBIA 1E6EA 4YBZA 5F3RA 4Q3CA 4ZJUA 4CM6A 1V35A 4KWIA 4KUEA 3NTOA 3GG2A 2JD2A 2DPHA 4E5NA 4E32A 1J49A 3K30A 3P2OA 1AGNA 1T2AA 2PKQO 2JKVA 3OMLA 1PS9A 3KEOA 4BL5A 4YJFA 1LRKA 5HA5A 1UDAA 4U0KA 5K6AC 3JQ7A 1YJQA 2W2LA 1K6JA 1LDEA 4IDDA 3RVDA 3AY7A 3PJEA 1YDWA 2B36A 2AXQA 1OC4A 2YHIA 1CIVA 2YW9A 5FF9A 2NVUA 2B4QA 3PLNA 2WYUA 3M6IA 5I9NA 1V0JA 1BG6A 3LT4A 3N7UA 4DQXA 4WLOA 2YV2A 4E12A 2Y93A 2NV6A 1TEHA 3H7AA 3D4OA 1R6DA 1B26A 2PD4A 2O7SA 3DOCA 4TQGA 1BW9B 1RKXA 3RC1A 4IIVA 1B15A 2HO5A 4UREA 4WOKA 1W0CA 4CLXA 4EJ6A 3RBXA 3VZQA 4XA8A 1ISJA 3G1TA 2O3QA 3B70A 4IDBA 1Q1NA 2Z5LA 4CLOA 2CSUA 1ML3A 3PEFA 3IP3A 1I2BA 1QMGA 3X2EA 4O63O 3RUCA 2EW2A 5I7VA 2W8ZA 5CG2A 4ROSA 3TOZA 1GAEO 1A27A 1JVSA 1XR3A 4IUYA 2PV7A 4EJ0A 1YDEA 4I9UA 3VH4A 1GU7A 2VOEA 2YY7A 2FP4A 2VRCD 1ZIDA 4J4BA 4MVJP 4YAEA 3WYBA 2C82A 2ZB7A 2B69A 4HFMA 2B5VA 2HMSA 3C1AA 4MVJF 5K9ZA 3WJAA 1W8DA 1EUCA 4PFJA 4Q3BA 4RCVA 5U1PA 3FPCA 4AG3A 2AMFA 4J0EA 2I3GA 5G0SA 3W8DA 2BGKA 2O3TA 2HDHA 3HB4X 4NBTA 1KEVA 1B8VA 5A9RA 3PK0A 1KVTA 1U3UA 5TNXA 3C24A 5BR7A 4NH4A 3ZHBA 4CM9D 4JJIA 1YE3A 1V8BA 2VTDA 4ZQHA 4BMSA 1R15A 1FDTA 4EW6A 3L9XA 3LVFO 3E03A 1Y5RA 1X15A 2JHFA 2A92A 4FFLA 3I83A 3OFSA 3PFFA 4ND3A 5GZ3A 2H9IA 2I65A 3NT2A 4FDAA 3SLKA 3NJ8A 4WLFA 1EE2A 5T67A 1HTBA 3TNLA 3Q6IA 4P4LA 1I2CA 4P4NA 2Q46A 3P5SA 3VH3A 3ZHZA 4FD3A 4Q39A 2C0CA 4J9UE 4DQUA 3DZKA 5A04A 1PWXA 1ZO8A 3FR7A 4R41A 3BHJA 2ZQYA 3KEQA 1F8FA 1SEVA 2VUTA 4J1TA 4P22A 3BYZA 5DBFA 4M55A 1T2FA 1EMDA
chains in the Genus database with same CATH superfamily
3IP7A 2ZUBA 5E95A 1PP4A 3HA2A 2A84A 2ZB2A 4YB8A 4JGIA 4JKIA 4S1PA 5CYPA 1FNCA 1QCZA 2C5BA 2PT9A 4GX2A 4KRGA 3NANA 5BV7A 3VA7A 4R1PA 1HR0B 2QI9C 3ZW9A 2VSFA 2XR1A 2QSJA 4GUAA 1D2NA 1UPTA 4KXNA 3IC5A 5EIBC 1EWQA 3AO0B 1A2KC 1O89A 2HXGA 1OH6A 3QPBA 2PT6A 3H2JA 4OGFA 3HYRA 4UHCA 4WZAE 2OKCA 4YWJA 2GLXA 3CY6A 3NJRA 4L76A 3OA0A 4Q9LA 2I91A 1FP4A 3LX5A 3FZNA 2B83A 3LG2A 2JH8A 2VHWA 1QHFA 1FQJA 3QVGB 4FGUA 2CY0A 3C15C 4BJHB 3LKDA 1HTTA 3KDPA 1KMHA 3KUXA 1CUCA 2FDRA 2EKBA 3CBQA 4XCXA 4CKYA 5LPNA 1EM8A 2ZXFA 2H3EA 4M7RA 2VDVE 4BNMA 4JUFA 1C0EA 5A6SA 1UBTS 4PLHA 5AK0A 3AM5A 3GVPA 3OZWA 3ANTA 1UDBA 4YMGA 3DMYA 3OE7D 2FMUA 3FDIA 5LQMA 3DHNA 3UC5A 3EQ9A 2WJ3A 2G5CA 4R1NA 1DBRA 1U7WA 4LYAA 5ITWA 3U80A 4YT8A 2J4CA 2B1JA 5FI0B 4NYIR 5E0OA 3PEUA 1XU4A 2YZMA 1JYSA 4YJ2A 3F74A 4XWAA 4F2GA 4FFVA 1E63A 1R0ZA 1VE7A 4TSFA 5I8WA 2C9OA 3N0WA 3U6BA 1U0RA 3AUXA 1VYHA 2EOAA 2Y8EA 3IMGA 1T4GA 4AIIA 1ADJA 4DQVA 5IXJA 5B3LA 1OI4A 1R0WA 2AE2A 4MH0R 3EWAA 1W2GA 1RKVA 3CR8A 3QBDA 4AO7A 1VHJA 1HLDA 4XRGA 4XQ0A 1KEWA 3OPVA 4DCPA 3NCTA 1IN6A 4FWBA 2PVSA 4B34A 2F8LA 3L79A 4R9SA 2YN0A 3Q85A 3A9WA 3HR4A 2HRRA 3UWSA 1AQJA 2I62A 1EFHA 4NFSA 3FNQA 1OZGA 1J8FA 4E51A 1BE8A 4DN6A 4EHBA 2OECA 2UZ3A 5JNLA 1DPGA 3WRYA 3KVRA 3HO6A 1QAMA 2CDBA 1E2GA 3HHPA 1K8YB 1WEKA 2IQIA 2PR2A 2Y0CA 3G5AA 4M8IA 5ALTA 1Y4AE 3P0RA 2ZATA 4RA6B 4M21A 1JEYA 2JC3A 4IDOA 1LJ8A 2NIPA 2VUIB 1HSZA 2LBPA 1QZ3A 3JYOA 3LLVA 2YJZA 1KFKB 2H1SA 2JGMA 2WTNA 3FUWA 1KFEB 3JQGA 1ZJZA 1PNVA 3PWTA 4IFBA 4RPLA 5G3ZA 3QV2A 2H7CA 3SWWA 3Q7SA 4UD6A 4ER6A 2AB0A 2IA5A 1M8KA 5DOZA 2HJSA 3ZDZB 2WQZA 5KB3A 3GX1A 4IDQA 4R1UA 3Q6NA 1SBIA 1JECA 1GKLA 4KIJA 4A6PA 3DEIA 2VJCA 2A67A 3EXEB 1DOHA 3IA7A 5CBKA 1VOTA 4CHGA 1KAOA 4OB6A 1D9ZA 3AFHA 2PSHA 5GADl 3D54D 4RGYA 1Y9JA 5I4CA 3FNBA 2PJDA 1PTJA 1OXKB 1RWWA 1SAYA 3SF8A 5KVAA 1PR1A 2DH6A 4DCJA 4DMCA 1G4HA 1F2VA 4XIIA 1L4GA 4RXUA 2PZAA 4FEYA 4JEMA 3WS7A 4RWZA 1JVNA 3JRWA 4BN5A 3OJWA 1LDMA 1L5HB 3NHWA 4O2BA 5DBIA 3RB8A 4PZCA 1WBJB 3PQ3A 2OO5C 1KY2A 4OMUA 5DM70 1U2DC 3ADBA 2J3QA 2BHNA 5LWQA 3UK1A 4ZQFA 3E5RA 5B1HA 2HFKA 1Z12A 1WXIA 2NU7B 3OCUA 3MK31 1JP7A 2LV8A 3FYUA 3R8XA 1XE3A 3FOZA 4RPHA 2GX6A 1L4BA 1ZK1A 1IHPA 1FSGA 3H05A 2CHEA 1CS0B 2Q2QA 2TMKA 4Z2YA 4XX0A 3GJYA 4OA5A 2WNHA 3K0CA 2Z04A 2HJVA 2O2JA 5CA0A 2PUCA 1DX9A 2GT1A 4BZXA 3T5CA 3RFUA 5DCUA 2FN8A 4YP0A 3R3YA 5DV9A 1DZIA 1IEQA 3FVRA 3AVQA 3K7EA 3PHCA 1EPUA 1TVKB 1QYXA 2Q49A 3L7DA 3QXXA 1H5UA 4K9RA 3X1KA 4HADA 4P2BA 5KVCA 2ZRLA 3SHOA 4DV3B 4LN1A 1SOUA 3AEXA 1CY6A 2FRXA 3TVYA 2BKAA 1BYUA 2CKDA 3KQLA 2H1HA 1W59A 3WXMA 2O6HA 4C7XA 2EJUA 2FLWA 2QTLA 4DDVA 2C5EA 3BJZA 1Z47A 5LP6B 2BM9A 4IXDA 1D2GA 5GJWC 5IPFA 2HNAA 2ZSUA 3TECE 2H2HA 1Y8QA 2RIPA 3P32A 3ZCQA 2JBWA 3TDMA 2GK3A 4YUXA 3THWB 4XH9B 2UZIR 4LXGA 4B17A 4IHKA 3Q3VA 2XJ4A 2XYGA 5EEHA 4N3AA 4PO9A 2V59A 2YCBA 4PCAA 5F64A 3K2EA 4S1OA 1G21E 2EEPA 3DAPA 4D3XA 2BGGA 2IYNA 3UJAA 4RHEA 3ET5A 2PXAA 3FNHA 2PGNA 3PL1A 5JROA 3GDFA 2WOOA 1JHPA 1G9XA 1E79A 3B1JA 4UTXA 2WV7A 3L04A 1CR4A 1J06A 2PUBA 1IE3A 4JVSB 2XUFA 5GONB 5EE9A 2B9EA 1ZH0A 3JQ7B 1LPPA 5UKDA 3ZZ1A 4IKPA 1HMYA 2XPCA 1RC8A 1GKKA 4MEJA 1VLZA 4O4IB 5ILOA 1TU0A 2AHOA 2NQTA 3HCOA 3IPAA 3WGMA 4C4XA 3SQDA 1NZJA 5I7RA 1EGVB 2IKSA 4A6DA 1H23A 4YRZA 3VNRA 2C5FA 4XIJA 2NVUB 4D3DA 5LSAA 2VAPA 3AWDA 4D9NA 2Z98A 1A5SB 3WK6A 3GL9A 3LPDA 1N8KA 2FKAA 4NIMA 1VG1A 3DLAA 2GF2A 3ZNPA 3UUEA 4X0EA 2DQ4A 2B8JA 1SCUA 1SWWA 1YJXA 1Z5OA 3HS3A 2BUAA 2E5WA 2J9GA 2X1LA 3ASVA 2JI6A 1T29A 2X9QA 1OBFO 1J9ZA 1POXA 1WV0A 1XL1A 3HU1A 3JV7A 2BMDA 3BORA 4KE8A 4XDHA 1ZHHA 1VLMA 3QYFA 3DQZA 4JBYA 5DNWA 4B0OA 2AZXA 1RZRD 4Q00A 1S4MA 2BFEB 5A9SA 4B84A 1JDTA 2AOXA 4O2RA 1HYEA 4R8LA 5HF5A 3HUEA 4IX9A 1UK9A 4X41A 1KTIA 1NG1A 2A78A 1V2HE 4JSTA 1O8BA 1RYHA 2C4KA 2FZCA 3CRZA 3K5WA 1CP2A 1PJRA 3E1SA 3RRJA 4DIOA 4NQZA 1ZD1A 1XAJA 3A9TA 4EHHA 4C01A 4I1PA 3IP9A 4XJXA 3NASA 6GPBA 2H00A 3BWYA 5KTRA 4JYAB 1S2DA 3LJKA 1QVZA 1UJ5A 2FSSA 1NNI1 5MN4A 2BISA 2QDXA 3KBBA 4Z9YA 4YRCA 4D96A 2B78A 2W93A 1WMFA 2JJQA 5HFAA 2ZJ4A 3LCCA 2VS1A 3ZW7A 3P2MA 2FP3A 4C2UA 5HK9A 5JQWA 3QIVA 1KI6B 3HP7A 5D86A 2XQJA 1XTKA 3THXB 1T2UA 1ZGBA 2YDYA 3NYWA 4QUJA 5DRTA 1EFPB 1KXZA 1UBLS 4I7EA 1G5PA 4URWR 4C4ZA 4F45A 4WBNB 1ECBA 1IPHA 3QWBA 4RTJA 1EUCB 5JWHA 5K0CA 4IDHA 4DRXA 1FSFA 1JLMA 2MHCA 4Q3EA 1L7VC 1V9LA 2PUFA 1K88A 3W5AA 3F7OA 2DB3A 3BBLA 3R3SA 4N4AA 5G41A 3RUPA 4BCBA 1GN9A 2JK1A 3S5JA 4P1ZA 1NA5A 1V7CA 5IJWA 4I66A 4WKGA 4RF3A 2O7QA 2L82A 1VKRA 4AY5A 4EY3A 5IAGA 1E8NA 1L6RA 3PHGA 3QTLA 5AOBA 3WK7A 3LKVA 2EKQA 4HAVA 2HT6A 2ZS9A 3PC2A 3HJAA 1YACA 5BOVA 4JGBA 2OXEA 3ZGZA 4ILEA 4J6FA 1S9DA 4ZO9A 1KO7A 1DX6A 1GPWB 5FPTA 4X1YA 5BP7A 2W2VA 4CMIA 3EPRA 2P9HA 3F2IA 1OBVA 4K6MA 5TQ0B 1V4NA 1C9YA 2C9BA 1A77A 1WHTA 1WSDA 3MHTA 4D9EA 5JJCA 3PA8A 2ZUCA 1KAMA 1A96A 2CYCA 4G25A 4GZMA 3LF1A 3W5CA 5FNVA 2I4LA 1DKMA 2OZLB 2ZCJA 5C7LO 1PT5A 3NEJA 1XQXA 2Y4NA 3OJFA 1UWCA 2X8JA 1NT2A 2C2OA 2Z43A 3QPUA 2NU8A 2AQIA 3RS0A 2A6PA 1T1SA 4DCOA 1WABA 1YONA 2W2MA 1OWMA 4ZGWA 4X61A 2FU5C 1F3LA 2Q2OA 5I7HA 4LV6A 2XSZA 5DYWA 3V1KA 1KDVA 4GOOD 1VE3A 1UXJA 3VDXA 3TFWA 5AXBA 5LVAA 1SUEA 2JGEA 2ZUVA 3KFXA 4X7PA 3DMRA 4A6EA 1T9BA 4G4SP 1ZMXA 5BQOA 2X15A 2I6TA 4O4HF 2O3RA 2QZZA 1M10A 3CURA 1V45E 4QVIA 4YFYA 3JQEA 5LMUB 1E3MA 1TT5A 3IMFA 1Q7CA 4XDGA 1LV7A 4ZIRB 4MDFA 3P19A 2J7PD 1OXUA 2RHBA 3R0JA 3DB1A 2BE9A 4N3BA 4G24A 1SELA 3H16A 1S1MA 2QN9A 5LDDC 1LVUA 2FW1A 3NPAA 4NG5A 4XIYA 1GXSA 1KYWA 1LNSA 3ZWBA 2AS0A 3FVVA 1NUAA 3L7CA 1VBMA 2VPZA 1E3IA 4HWRA 1IXKA 2ZWVA 2QS9A 4FFMA 5C5DA 1CQZA 4MV8A 5C8VA 2A7XA 5F3DA 4B7XA 2OCKA 4O4LA 1A8IA 2YNMA 1HA3A 2X8WA 4WESA 3RRBA 4L72A 1QOPB 3ICEA 4FNAA 1UDXA 1MV8A 4J2TA 4AJHA 4QNMA 4XLLA 2WT4A 2RK4A 4ESVA 4TMWA 2YHSA 1AQYA 1C3OA 2PT7A 2GCGA 4IEIA 1L5NA 1ACJA 4DMGA 3HO1A 1U7PA 2JFZA 3TQOA 1WXDA 2VQFB 2PXXA 3TNJA 4OAQA 1NSTA 4ACBA 1CUUA 4DKJA 1XEAA 4X6YA 5LUBA 2X4IA 1D2CA 4KH0A 3FPSA 1ZONA 1ITZA 3AHCA 5DB4A 3ZKWB 4ZCIA 4O0LA 4R2KA 4R81A 3SZUA 1OAKA 1P7WA 4MCIA 4UU1A 2VJDA 3ABQB 2Q2VA 1WDMA 3CHYA 5BN1A 2DE0X 4B2YA 3HSSA 1GQQA 3QUTA 3WRWA 4E08A 3LO8A 4MQ6A 2BJVA 2WE7A 1V6CA 5BSMA 4CBVA 2H5JA 4BO2A 3N70A 2WD7B 2Q5LA 3W5HA 4UFNA 4HUJA 2COUA 5HZHA 1M2KA 1FYXA 3QEMB 5FLYA 2AI1A 3MJ4A 3U4MA 4ADSG 1K4KA 2O20A 3H8WA 5LDGA 3O75A 3W2GA 3MCAA 3WNVA 1OB2A 1VGQA 2WJJA 4PPQA 1VLHA 2Z2XA 3CT6A 4OGKA 2ZM5A 2VBCA 1SCJA 4J7AA 2Q6LA 3JWEA 1S5PA 1A76A 3FLBA 3IE0A 1Y9DA 1EVJA 2DZDA 2CFSA 3QXGA 5DBEX 2J46A 3EVTA 1D1PA 3AJ9A 4WY2A 1I7DA 2GXAA 4IDEA 4UXIA 2PZMA 3EMVA 4DDKA 4GOND 2EWWA 1DDIA 3D0RA 3JQ8A 3OCWA 4MMXB 3ROEA 3W6OA 4D26A 1IXSB 2IOQA 1L3CA 2JVKA 2NUTB 4H7JA 4QYXA 2VF8A 4GMHA 3G5MA 3ZI4A 1VFPA 4MSUA 1WLYA 4UEKA 2VTKA 3ZDYB 1MN6A 1EI9A 1U8TA 2WHQA 2XYRA 2TRSB 3PDUA 4TRRA 1T35A 1PQYA 2FSFA 4OSPA 5LQSA 4LZLA 3D6TB 4D43A 4WOBA 3MD9A 3DBVO 3AI1A 2V7EA 1DAPA 1PVVA 4MWBA 1FNNA 3DL4A 2XUOA 3DONA 2PU5A 3H5RA 1K89A 4DCUA 2GO7A 1R5NA 2X9NA 4ZOAA 4BYMA 3F46A 3OZUA 3QNUA 2PAAA 1K6IA 1U3GA 1Z2AA 1X13A 1WY7A 5JIBA 1SB9A 4OYRA 1NP3A 1J24A 1OLUA 4RQTA 4PLVA 1T9DA 4XIFA 3PYMA 5AH0A 3AJAA 2A1UA 2R4UA 2Q7DA 3VU9A 2K6GA 3PRYA 4L9RA 1PJ3A 1BMQA 1V5FA 1K92A 2XITA 1AKEA 3SZGA 1PD1A 2QUIA 3T1NA 1NLFA 1AGXA 1IWBB 3LC7O 4P81A 1NATA 2XE8A 3T9EA 1HDCA 3VPXA 2B0CA 3BD7A 3OJ0A 4J49A 4II7A 4OJNA 4DLTA 4GSLA 1E6KA 2GN2A 1W7AA 3G5UA 3R3WA 5L51A 1AOXA 3MFQA 1XX6A 2GNPA 2JL1A 3EPJA 1U9CA 2FE4A 4LMPA 4AQDA 3I8XA 2A94A 2FF5A 3LK6A 3HA5A 1I14A 1E9AA 3KG2A 4HY3A 4G86A 1ZK4A 3W7BA 4U6SA 3NUZA 2VDOB 4IIGA 2VYNA 4HNTA 4FOLA 1G59A 2JIOA 5JC1A 5C52B 1I6LA 1NQVA 3T1OA 3GUYA 2OQVA 4FK8A 5FR1A 5DYYA 3CTPA 3ICPA 5TJ9A 2FWNA 2JJ1A 1II9A 1Z6AA 2H4XA 5ECWA 1ETUA 3VKWA 4GO1A 1IQUA 4WCFB 4EDHA 4C2TA 5CT9A 1RXIA 2OBXA 2NQ8A 4IZIA 1HV8A 2X13A 3A1TA 3BBPA 4EKNB 5C51B 3WISA 2RBGA 3IDQA 3V4OA 1R0BA 1EVIA 1KH1A 2CD9A 3H18A 2EL7A 2UUPA 4JEUA 5IRCD 3B7PA 4B3XA 2P8SA 3I53A 3KLMX 3K92A 3C0KA 2JEOA 3KTAB 3M5PA 4CQLB 2G9RA 5FO0A 4LOHA 3RS9A 1E69A 2D2XA 1PUXA 2UVPB 4GF5A 4IGFA 2RGXA 2VXCA 5JMTA 3BFKA 3M5CA 2C3PA 2I2WA 3WVNA 3EY9A 3L93A 4FDTA 3T06B 3WLQA 3M4YA 4QGSA 2FDCA 3BPSA 3GT4A 4FYKA 3L0YA 2XUJA 5J2UB 4BWFB 1WUYA 2BZSA 1HOXA 3W5DA 4Q66C 5AI6A 4ZT2A 2D5CA 2ETVA 4FONA 3Q0TA 3QVKA 4MW9A 3A31A 1DB3A 1NONA 5EC8A 5FOUA 3WL5A 3K94A 4E3WA 2AG8A 3KFLA 1JPJA 3MRTA 3HDTA 3KS9A 5HFJA 4MVJE 2V7QA 1ZU5A 1ILWA 1T8UA 3RARA 2HMTA 4NBUA 3QHQA 1WHSB 1JUDA 3IESA 3DVQX 2EJVA 1GGVA 1CY1A 3K1JA 4D1YA 1P5FA 1ZKMA 4YCAA 1IPEA 1M2OB 1RWOA 1SBZA 1K8ZB 1PEDA 4HUQA 2ZYGA 4BQSA 5AVVA 4NV1A 3IOCA 1HXHA 2WSMA 3NXSA 5C46F 2WHPA 2QRZA 2QR3A 3A3OA 3PUVA 1A8PA 1ORVA 3UKDA 1GO2A 3W79A 3SFVA 1Z0DA 3CZ5A 3AU9A 3UEOA 1T4DA 5D2CA 1I1QB 1RZ3A 1CWUA 2POCA 3DBRA 2PSEA 3JTEA 4LNUA 3W06A 1KAQA 3T1HB 1ZI6A 4EB8A 2JGJA 1GFSA 2R62A 2ZB8A 4IG4A 4W5OA 1QE3A 1LJLA 1I94B 2A0UA 1N6KA 2FW6A 3BXHA 3ZTWA 2NSYA 2LNDA 3A26A 1MG0A 3CH4B 3DAYA 3DQPA 3I4LA 1Y34E 3R6GA 4NZZA 4OVKA 4PO3X 4R54A 1N7JA 3NDBB 1GPJA 1WD7A 4Q15A 4ZEWA 4Z9AA 3JYPA 5HK8A 4KLCA 1EGMB 1ODLA 1J2RA 5E6SB 3TLEA 3Q11A 1LNZA 5KTOA 2Q3DA 3R9WA 2O59A 3LK7A 2JGIA 3EOBI 3PDWA 3KEGA 1E61A 3ETCA 1Q7RA 4IQ0A 4MHOA 4B8YA 2I2AA 3RGGA 3GQBA 5GM2A 4M46A 3NCHA 4YO8A 5EMNA 2B92A 2DVMA 2WPDA 1SJ9A 3D8RA 1RM0A 4JQYA 2M2IA 4JP1A 2H4FA 4MQEA 3CGGA 4PVCA 1XCLA 1C41A 4URYR 3SLRA 4ZKDA 5HKKA 1CJBA 2Q29A 3T7AA 3T1TA 4H6VA 1RE1A 2H4HA 1P9RA 5E3JA 5CB0A 4D4JA 4OI0A 1WPXA 3CLSD 1V8FA 4EJSA 3L4SO 3AVXA 2XAAA 1Q0TA 1NAIA 5JMOA 3K6SA 3MTIA 1VJ5A 1Y3IA 2JHAA 4R8RA 2IT1A 2GPBA 3TL2A 3B1VA 5TT1A 5A4AA 3R41A 1DSSG 1XWWA 4LVNA 4TV9A 3SMVA 1U1CA 3RTEA 3GLGA 3GELA 1M34A 4HG2A 2XWJI 1SB8A 1VBFA 1V25A 2GQ0A 2MR6A 2PKQP 3EJ6A 3QUBA 4WK6A 1L7QA 1P9WA 2GPJA 2I8LA 3ZQ4A 4G0VA 3ZWDA 4MS4A 3KOZA 1NYTA 4AKEA 3S5UA 4O8ZA 2JCXA 4AJ2A 2BWJA 3U7QA 3UHOA 2PS9A 5G0UA 3CPHA 2H1IA 5CVJA 1NN1A 4YJGA 3E48A 3K0BA 3I34X 3I1FA 1HLFA 2ZVDA 3KWFA 4HX9A 4MIKA 5EXPA 3OWXA 3WC4A 4JVMA 1JJ7A 1U02A 2F43B 3NGLA 3VU3A 4B3IA 5TF4A 3FA2A 4D8WA 4ZHQB 3RHZA 3PUZA 4HDSA 4HR7A 2FMFA 2EIXA 2IHBA 2M9MA 1L5KA 2B21A 4KHPB 2TYSB 1JFFA 3FN4A 4G1MB 1VQ1A 1Z15A 3BTOA 5JCJA 2DUNA 4GR4A 4JLVA 2A9JA 4NDNE 3UWDA 1ZX1A 2JIDA 3ELYA 1EFLA 4Y2UA 4QUGA 3SDZA 3WGZA 4D74A 5SZJA 4EBBA 2NVWA 3DTNA 2O2CA 4D9HA 4M1OA 3N8GA 1W1IA 1J8DA 1QV6A 1UMCA 2OQRA 4D3SA 1GP2A 2Q3BA 1GDHA 3SIXA 4U9UA 2V74B 2YYAA 5A5VA 1LW6E 2JD0A 2HA6A 3K72B 4MS3B 5HQTA 5B12A 1EXVA 1U0SY 1VBNA 2CXPA 4BTLA 3ZE6A 1I3OA 3SBDA 4ICIA 3SBOA 1L3BA 3IDAA 4CFSA 4ED9A 2FEOA 2Z83A 4QPPA 4JHLA 2EJTA 2FPIB 5AW5A 3WLAA 1XMIA 1UDWA 1B1CA 1P2TA 2J5XA 1J33A 4ZOLF 2C97A 3BQ9A 1K7XB 1HDZA 4YUZA 4QDXA 4JB0A 1IG3A 2PBRA 1FDUA 4RF5A 5ENZA 3DSRA 1D4ZA 1SXIA 1ZCJA 2MIIA 3TLYA 1TAUA 4QELA 5BYBA 1U1IA 1RYZA 5LOVA 3F78A 3ZLVA 4DHEA 1UT6A 2PZKA 1QYVA 3TQIA 2BM8A 4RS4A 3WGHA 5F2NA 1UPBA 2X4DA 5HS6A 3EXIA 1PFKA 4WHMA 3NWOA 1TAHA 2NAFA 5IXSA 2D00A 2I6XA 1OYOA 4ALLA 2Q0HA 2XCLA 2IELA 1E96A 3K5IA 3W2TA 4FMBB 3EFOB 3ENWA 4QYIA 2OM6A 3WYGA 2N0SA 3FPJA 3ZU2A 3RAFC 5CT4A 2ZG6A 1Z8HA 3QE9Y 5K0JA 4CG0A 4L3VA 1PEAA 5EHZA 1IBKB 2G72A 2IZ1A 3N74A 2GCPA 4GC9A 4X1IB 3OJCA 3VZDA 4DLYA 1JFLA 2JFFA 4B83A 1VCMA 4E5VA 1FSPA 3AF6A 1OH7A 1Y6RA 1RQ2A 3AIIA 5EIWA 4BO3A 1EFUA 1MZVA 2AZDA 2EKLA 3A6DA 3C48A 3CGWA 1T0JB 3ZV3A 5K3FB 5BWMA 1Q5PA 1ZOIA 2FOXA 4RESA 4JFRA 2BH2A 1KS9A 2R8PA 4KCGA 5J9FA 1XRQA 3D3WB 3U9LA 3OCYA 2PEYA 3H1GA 3S6JA 4IIUA 5DPMA 3BGSA 4S35A 1MX1A 3Q2KA 5J4YA 5DNCA 1BS2A 1WMSA 1J8YF 1OYVA 2QNIA 3WTCA 3D3JA 4A82A 1NVAA 2QVGA 2O2ZA 2FRVA 4DR7B 3TIIA 5GJBA 5AVOA 1A7JA 2FN4A 3PQ7A 4PC1A 1IUNA 1HEYA 2PJZA 1T4CB 3PYLA 2HHJA 2BSAA 2C5HA 2ZYIA 3QE2A 1EIZA 3ESBA 4BQFA 4R0MA 3FNIA 4KR7A 2WQ6A 2OSBA 4GLJA 10MHA 2YXLA 5LZ7A 2XUQA 1EP1B 3CM0A 1HDOA 3JAMA 4X7RA 3VAZA 2WU3A 2IOYA 2WFZA 5HDQA 3JYQA 4RDIA 4DRYA 1YRAA 5HILA 1QZZA 2PIDA 4LS3A 1RE0A 3PR1A 5G1NA 4GUDA 5HYVA 1PG2A 1POWA 4KR3A 4DLPA 3PRKE 4QXRA 4XPIB 2DUUA 2YUIA 3WSTA 5LMCA 4ZQIA 2ZAIA 4J76A 3FI9A 4J6EA 3T7EA 5JDIA 3RSHA 2Y2VA 4K6FA 4A0HA 5FEMA 2DSNA 3ZCUA 5JD5A 3RUAA 2FPOA 3D6VA 4CDRA 1COWA 4WV3A 5B55A 2NUBA 2AI2A 1FUKA 2P41A 4A9AA 4FSXA 4L7QA 5E4JA 3K35A 1C7IA 2ZJ6A 1QE0A 4MJXA 3ZQJA 4DGSA 3OTIA 3ESQA 4MDYA 4JJ4A 3TR6A 2E7ZA 3ONDA 3CLTD 3QYAA 1SVSA 4KFTA 1H22A 1I4EB 5ICCA 4ACAA 2CWWA 2LGJA 4ZVNA 1R0XA 3BHIA 1XN4A 1T9GS 1OAOA 1UP4A 1K5HA 3WLOA 4BZZA 3R77A 2P9JA 4P31A 5FD8A 5E0KB 3GGGA 2A1TR 1QYDA 4KN6A 3RF7A 1I1OA 5BYJA 2CE2X 3N8NA 1IMOA 2C8LA 1X6VA 4I36A 2Z57A 4HVTA 1S01A 2KB0A 3M49A 2E21A 1SQSA 4YHBA 1QIEA 1C3LA 1JHDA 1U4OA 2VP6A 2NYUA 4LYHA 1WDTA 1KXJA 1GL9B 4ISBA 5IJ0B 4L3OA 4N76A 3EG5A 3EBOA 2OKGA 1K7YA 3OO1A 4OP3A 4DSZA 1UINA 2HKIA 5BXQC 1GNRA 3S8EA 3E9CA 1U2EA 1ZK0A 3IAAA 4JVLA 5I3ZA 3L6UA 5K01A 2DLDA 4HJRA 4N5IX 4N9WA 2B4YA 2DHRA 5EIXA 1F14A 4FZ5A 4US0R 3ZHRA 1I51A 1S2NA 4FLFA 2GN8A 3DMFA 1E1DA 1HT2E 4RM2A 3RAJA 4NESA 1U0HC 4ZT6A 2Q6OA 2R6JA 3TM5A 1P5RA 3T1QA 2GF0A 1ULAA 3QE3A 4JIMA 3AF2A 3WGTA 3W1WA 4JITA 4EI7A 3WAKA 4ZEOA 1GTMA 1S2GA 1RZUA 3IX7A 3FCYA 3P9QA 5F33A 1ISRA 4L08A 2O2HA 3T7SA 2GNAA 3NNNA 1DKRA 4X20B 4DGQA 1H66A 1U3TA 2R5NA 1Q0UA 3BQNB 2WK1A 1BMFA 1I5RA 2BV3A 3D6AA 1Z9BA 4X94A 4YRDA 1YO6A 4LXHA 5AO9A 4P5DA 1CRLA 1FK8A 4YRFA 4X5OA 1JG1A 3TLKA 4MK4A 3PFWO 5A3SA 2ZUFA 1CUBA 1GUYA 1AMUA 1TM3E 5L7YA 3EVFA 4AJNA 4ZVPA 1DRJA 3QRWA 1T5OA 4IVNA 4LRTB 4PO1A 1LC0A 3K5HA 3U4HA 1C3JA 4HZIA 3N8KA 2JJYA 3QITA 5I8ZA 5F1PA 4DC1A 2XMPA 4OBXA 4C7VA 1I4LD 1NVKA 3KWMA 1OGIA 4FJ1A 5ALFA 4DCGA 4DNPA 4M37A 1GZ6A 4J16A 3PGKA 2YCLA 4LOIA 3CONA 4ALJA 1M1XB 3SHWA 2JCVA 2AN1A 4KWEA 3HB9A 2IYFA 2GVDC 2INGX 2MYPA 2PL5A 4M86A 4X54A 3OIDA 3NH9A 5G1OA 4PGMA 3RVQA 4XOIA 3ORFA 3RFXA 3ZVKA 5AR1A 1CUYA 1I4TD 2QQFA 4IGAA 1PDWA 4LJ7A 4FC7A 4DZTA 2JLUA 2OLKA 5K6TA 1XZFA 5J4HA 5AK5A 4X85A 3ORQA 5GY7A 3QUSA 1X2BA 1T1IA 2CUZA 2BFNA 2CJYA 3P9YA 3OA2A 1SK8A 1Q1ZA 4YAFA 1CEEA 3EE6A 1NY5A 2P6UA 1YDGA 4HXYA 2X1HA 1LPMA 4RS3A 3N6RA 1EK1A 3UIEA 1SXJD 2F3UA 5F52A 2C57A 1WBDA 2EW8A 1JSXA 4OH7A 5I9LA 1NW7A 2EKPA 1KO5A 2PX6A 3FPHA 3GFRA 2HLHA 2H07A 3GFSA 4ISCA 3PXGA 3F5DA 1FDSA 2I71A 3K8ZA 3EG9A 5I9MA 1YAHA 4IFIA 1V3VA 2XODA 3HACA 4EQ6A 1WUTA 2CEAA 3BMQB 1KAGA 1Z62A 2ZRPA 4FZJA 5GV8A 5JVDF 2WTBA 4Z0HO 2BBSA 2GZHA 5JXHA 2OFOA 4EOGA 4IJMA 2R751 3OAAD 1I7QB 3BRSA 4G1UC 1FFWA 2D5AA 4CIAA 5IBPA 1R0SA 5DHFA 3ZY4A 4RFLA 3GF4A 3OFJA 1XVTA 2QVXX 4Q1VA 3TFQA 3BH6A 1KAHA 5FV4A 5CIYA 2WJVA 2QW1A 1RXEA 1R37A 3MOIA 4PLCA 2VRBA 1A04A 2NT4A 3BDVA 1BVYF 2BHRA 4FTWA 3CC8A 1GDDA 4FX5A 4I55F 3AERB 3Q8MA 3O8QB 2VYQA 2ZIUB 4TWAA 4D0NA 1A4XA 1HL3A 2BZ0A 3IHKA 1SIUA 2CLCX 3B6KA 3VYTB 4H4CA 3ZNQA 4XB6B 1WZ2A 4YCCA 1EBBA 1NI3A 2O3UA 1DI0A 3A6JA 1UOQA 4FN5A 4IVRA 4XEHA 1K7SN 1UJNA 1V95A 2CF5A 3CX3A 4CCSA 2E82A 2I67A 4YCDA 4IJVA 3AH8A 2ZE6A 4OAOA 5FYQA 3U09A 3SSMA 4KZKA 4YRLA 2HW8A 5T4HA 2Q99A 1UBEA 4R98A 4RJKA 5JCPA 1JHQA 4QOJA 1U2ZA 5ES4B 3JWIA 4UU0A 2A9RA 3DLCA 3PC8C 1ZVQA 3IKJA 1RAFA 1JYEA 4PAMA 2B35A 1E2DA 1N0VC 1ZJ4A 3DT6A 1P1FA 3TAHA 2AFIB 5CURA 5J2TF 3LUHA 4ENQA 5K4GA 3FF4A 4UFPA 3HPQA 4PFQA 2XECA 4TN5A 4L5JA 4A8TA 4LJAA 4MB2A 4MI3A 1W5FA 2YFYA 5JFGA 1LKZA 4Q0MA 4ZOBA 5LB4A 3BT7A 4KVZA 2NZ8A 3ZLTA 1UFRA 2UAGA 3WZLA 2FG5A 3DO8A 3TZLA 1L5QA 3OF3A 5IEBA 4BYGA 1DC6A 2G09A 1TT7A 4RL6A 4KPFC 4AW9A 5HIAA 4KK4A 3NR2A 1CK4A 1A97A 1JBQA 1NV8A 1ODCA 3I05A 3P71T 4J8PA 4Q7LA 4YROA 4Z4CA 5AQ1A 2ZI6A 3JYNA 2BD0A 4DMKA 1XPOA 1G5TA 3H3FA 3R6LA 5FOXA 2ACKA 1J1UA 3D7SA 3KXDA 2XVZA 4RVSA 3K5PA 4M7OA 1DTWA 1UM9B 4HDMB 1VG9B 1NLZA 3GY0A 1AKMA 3MOSA 1B3BA 1JHVA 3LMKA 4M76B 1I6KA 4QU8A 2XJ9A 4P53A 3UH1A 3FMIA 3L8DA 1CDZA 1FS4A 3DB2A 1LX7A 4CT5A 5BR1A 5JMWA 3H5AA 4LRWA 1ZVMA 3ASYA 4OJMX 1H94A 4CGZA 4LJLA 2FUNB 2DM6A 4MUAA 1J21A 4BRSA 4YJ3F 1H2YA 2GM9A 4TLEA 3IE1A 2QX4A 3LBIA 1RYYA 4G4IA 4HHEA 2IHVA 2J9FB 4MVJG 5MDHA 1A1VA 3K20A 2Q6KA 4ZXPA 2WU0A 3NNSA 1Q57A 1SN7A 1YVEI 3FDZA 2HSEA 1V16A 1YOVB 3HI4A 3HJGA 3M3PA 3OEED 4ZAWA 1FDVA 3DEYX 3VHXA 2HF2A 2O54A 2JS7A 1N9ZA 3A10A 1GZ4A 1MB4A 2DWPA 3GB9A 3EIXA 5CNIA 2WFAA 1PWEA 4B3GA 3DZDA 3LS2A 3UJ3X 1N4DA 3LGXA 1D5CA 1I32A 4GPD1 3I2YX 3NXKA 2ZSFA 2I3ZA 1N7GA 3KSMA 3T3PB 4Q4AB 4NMLA 4X60A 4D46A 4LIPD 3HKDB 1YQGA 2J08A 3ZS8A 3KQPA 1ZQ1A 4MRPA 3DW3X 3PVCA 3GRCA 5M04A 4UCWA 5KQRA 1X7YB 2YIDA 4RK7A 2JJ8A 3FMFA 2B25A 1CEXA 2WSYB 1G5IA 2FQWA 3L8MA 3UFXA 4MWOA 3WTBA 1A7UA 1M6NA 1E2JA 1U3VA 1KWKA 2P1DA 3KVVA 2YRFA 4EJSC 4QLBA 4QECA 5EJEA 2R1ZA 5EQTA 5B6PA 5MN6A 2LRHA 5FPHA 1QFXA 2UZAA 4FI3C 4Q9DA 3E2MA 2KBEA 1LVGA 3UUGA 1CFZA 1EE9A 2WILA 3D3EA 3EVAA 1PDOA 1QGDA 1WXXA 2DFLA 4G5YA 4MP6A 4TKUB 1XRJA 2PUAA 2QTWB 3R9IA 3V2IA 1CS4C 3E53A 3DXFA 4ER3A 2WHEA 2EBHX 1HMPA 3HVJA 4OH1A 3DLIA 4CU2A 3QF7A 1HRKA 1PEKE 3I2FA 3P9XA 2ZKIA 1WUJS 5IN4A 1X1BA 1P81A 1Z36A 2OZPA 2R87A 4BNWA 1C2YA 5B57C 1SKBA 1DRVA 3KYDA 4NFHA 1RC0A 2QTBA 2NUAA 3L02A 2HQRA 3ZIAA 1BU8A 4I6JA 5C8YF 5T41A 1ONNA 3PFKA 1L8QA 2VP3A 5BV2P 4D9KA 4P6VF 3TZBA 2AH5A 2D4AA 2VT7A 3Q40A 2X23A 4PX9A 4F93B 1GJRA 5AI5A 1C5KA 1Z45A 1J8VA 3TVTA 3FKSD 5IT4A 5A71A 5J1TB 2I4TA 3TRHA 5JYBA 2X5OA 1NTRA 4Q01A 5DX0A 3D7NA 4QKQA 1E2EA 3CWCA 2QIPA 2NSLA 4OFWA 4KXQA 4R2LA 3IIEA 1NNUA 1LY1A 1EUDB 3EK2A 4R2HA 3AKZA 3CYFA 2XTMA 1KBZA 3EDCA 3ONVA 4G9EA 2YFQA 2R6ZA 1MEOA 3OESA 5DP2A 3V00A 5KJFA 4AKIA 3N2GB 5HZMA 1L5RA 3DXXA 4QLAA 3IIMA 5IYZA 4JLKA 2OUKA 1WVGA 3MTGA 4XVUA 4MTCA 1YWGO 2ZTSA 3DKKA 2NU7A 5KO2A 3IIJA 2UZ0A 5EMMA 3JAKA 1CY8A 4JBNA 3U0BA 1FMFA 5ESRA 3EFEA 4AMBA 4GQIA 2YC4C 2F9FA 2ZBPA 3H5TA 3PFBA 4TS9A 1UPFA 3DLPX 3FMVA 4L73A 3O4GA 3BWVA 5J5VA 4AWAA 1AU9A 2W2PA 3UV7A 3DMPA 2WLSA 5HS4A 5JFTA 3PHIA 4YJDA 1D0IA 1GPYA 1EWRA 1QXSA 4KBYA 5FULA 1LVHA 1JMKC 4P2GA 1Z0UA 1EFKA 3OHPA 2NO0A 4S04A 3BILA 3R6TA 4KO4S 1YOBA 4G1EB 3HLTA 3ELWA 4GZ3A 1I3LA 3UUFA 1LCIA 2BBOA 1E2KA 4PIPA 4F86A 1J5XA 2XE7A 3MWEA 4X3OA 4TWZA 5KNDH 1OBCA 1N0WA 2CZQA 3KQQA 1J6UA 1KNXA 1RRVA 3V4ZA 2CNDA 4FVTA 3C74A 2Q9AA 4PHFA 4W6QA 4EFKA 4Z7JA 5LLTA 2CJFA 2VPPA 4ZQCB 1XPRA 1N32B 2CXTA 1PU2A 3FHCB 4ZODA 1LQ2A 1C3XA 2WKSA 1XF9A 1DL5A 3VPHA 1OFVA 1ZC3A 3HYCA 4AP5A 4X97A 2E18A 5A3RA 3JRXA 1CJVC 2AF4C 3AEKA 3N75A 3TI7A 1RAGA 2V9PA 4PSAA 1LSUA 2OCGA 5AM4A 4EEXA 1XMXA 2YWRA 5KYXA 4DUZB 3K0FA 4PC6A 1TZJA 4KRFA 3DTVB 4DTIA 2ZYWX 4NFLA 1MORA 2IP2A 3GLVA 4DLBA 4EY7A 3P9KA 2C7QA 2ZYAA 1LRLA 4N40A 3BUSA 3GPBA 1PLJA 3R4CA 1XN1A 2WM9B 2ZK7A 1SWVA 3IILA 1KK3A 4GZ5A 1BXKA 4AKSA 4YYZA 1PJ4A 2P78A 4OUDB 1W581 4OKSA 2OPHA 3ESDA 3G02A 2YZKA 1KEKA 1UK6A 2VXYA 2QQ0A 2D7DA 2H5LA 2Y1FA 1BS1A 4M87A 4ON9A 4RC9A 4KXYA 2C2BA 1UPUA 2H57A 2ZSDA 3MWDB 1TTHA 4RPIA 1OF1A 2BGTA 4LCEA 2PLNA 5EWLB 2FRDA 4XWKA 1E3JA 5L3QB 3K1AB 2HWUA 5TPWB 1RJFA 2VCYA 3EUWA 2ZJAA 2I6UA 3OX4A 4G8DA 1Q0SA 3OKPA 4X44A 4IDPA 3J7TA 3GFPA 2C07A 2GHTA 2WJPA 3QE4A 1OPRA 3T5MA 3RHFA 4GKAA 1OJ7A 4JXJA 2AIRA 4QJ3A 1I1HA 1QZTA 3I2JA 4CKZA 5EJ6A 4KGVA 1K7FB 3LY5A 1O0SA 1IUOA 2Z56A 1G8FA 2Z4TA 4QAJA 2HSDA 1G64A 4Z9BA 1M2FA 5CJ2A 4K2HA 4GYWA 3VTFA 1LI4A 5JDIC 4RZSA 4HVLA 3JARB 3B8EA 1E32A 2WAXA 3F4BA 4D42A 4YCNA 2QLMA 3N6VA 1XQWA 1TE2A 4IINA 3ZX5A 5I7UA 1SHZA 2FJ0A 3GLHA 4TVOA 3M89A 3PNKA 3F3KA 4NENB 5CFRA 3GLSA 2QN7A 4Z0NA 2FSPA 1I33A 1SURA 4HV4A 4IX1A 1FNMA 1C1XA 1PR0A 3FOBA 2HBYA 5JCXA 4U39A 1RYBA 1TTQB 2J85A 4TTVA 3ZY3A 2X86A 4X7MA 2Y0EA 1O03A 5IAEA 1Z7GA 1F0YA 2C2HA 3H3JA 4KXMA 4B4UA 5FI3A 4AUMA 4ZDWA 3F1KA 4BMVA 2BM0A 4CL8A 1VIMA 1T5TA 3KHUA 1ID8A 5EIFA