3OIFA

Crystal structure of enoyl-acp reductases i (fabi) from b. subtilis (complex with nad and tcl)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
258
structure length
258
Chain Sequence
MNFSLEGRNIVVMGVANKRSIAWGIARSLHEAGARLIFTYAGERLEKSVHELAGTLDRNDSIILPCDVTNDAEIETCFASIKEQVGVIHGIAHCIAFANKEELVGEYLNTNRDGFLLAHNISSYSLTAVVKAARPMMTEGGSIVTLTYLGGELVMPNYNVMGVAKASLDASVKYLAADLGKENIRVNSISAGPIRTLSAKGISDFNSILKDIEERAPLRRTTTPEEVGDTAAFLFSDMSRGITGENLHVDSGFHITAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Enoyl-ACP Reductases I (FabI) and III (FabL) from B. subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
total genus 89
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2010-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3oifA00
2WYVA 3RWBA 4D45A 4CM9D 4QO7A 3U4IA 3QVXA 4RPJA 5A06A 4NBUA 3NEPX 4URFA 3KTDA 1Z7EA 3BTSA 3JQ8A 2AA3A 3PTZA 4YACA 3WBFA 2GDZA 2OL4A 1BWSA 2B69A 4DYDA 3L4BA 3JQGB 4IDAA 1B8PA 4F3YA 2VT2A 4XEHA 1GR0A 1GZ4A 4EDFA 5A05A 3RUAA 1LDBA 4Z0TA 2OP0A 2X5OA 4BNUA 3ZDFA 3JV7A 3PQEA 1ZZEA 1ZNQO 4BNTA 3DAFA 1ZSYA 1K5HA 1IPEA 5JBIA 2W2KB 3DZFA 3LC1O 1OI7A 5AYVA 4B7UA 1KY4A 3WGYA 2AW5A 2I5PO 3HB4X 4RZIA 3ZV6A 3JQAA 4KP7A 1E1NA 1E77A 1BVUA 1XR3A 3KEQA 1P1HA 4XR4A 4HNHA 2BFMA 2HAEA 3PJGA 4OAQA 3I9NA 4CJXA 5ENDA 1Y6JA 4PLHA 5JAZA 1V3VA 5FEUA 2PKRA 4WLNA 1EE9A 1MP0A 4CM1A 1ZXLA 3JD3A 2CDCA 3QE3A 4CMHA 3GLQA 1I32A 3IUSA 2NSDA 4XB2A 4PRKA 2VHXA 1PSDA 1C14A 5L7WA 1VM6A 4CPDA 4UEOA 4CM4A 1WAMA 3G1UA 1CWUA 4QFDA 4BUCA 3TZQA 3EMKA 4CV3A 3NT2A 4HNGA 2IYPA 5EMHA 3U4CA 2GO1A 3DZIA 3EVNA 2C7VA 3KUXA 3RCBA 2UAGA 4E2ZA 2NVWA 3DTTA 1NM5A 1LEHA 4OHUA 2B4RO 3AY3A 9LDBA 3ZNPA 4I8XA 5GY7A 4AJJA 4OOFA 1ZK1A 1PZGA 4GI2A 1I3LA 4XDYA 4R3NA 2WE8A 3ZHYA 1M67A 3OQ6A 3C3XA 2I6TA 4W7HA 2YQ4A 3RI3A 1NQ5A 1WLYA 3QVSA 4FFOA 3S2FA 3GN2A 1QV7A 1B3RA 3LQFA 3VTFA 1PGOA 5JY1A 3EGOA 2FN7A 2D1YA 1JTVA 3GFGA 4R5MA 3VDRA 1YDWA 2VNAA 3OQ1A 3H9UA 1DIGA 3NX4A 1DEHA 3RIHA 4CODB 4FIZA 5JCJD 4XYMA 1E7MA 5BSHA 3K92A 4JP3A 3I4CA 1GYQA 2BRUA 1LLDA 2PKQO 4LRSB 1DBVO 3QA9A 2AG8A 1D1SA 3FBGA 4RCVA 1W8DA 1H5QA 1MG0A 1T4BA 3CPSA 5B4TA 1MUUA 4UUPA 5BR7A 1D3AA 4PG6A 4ZICA 2I76A 1OMOA 1WXDA 4L4RA 1LLCA 3EC7A 4DPLA 4GMFA 3OSUA 1C1DB 2JCYA 5THQA 2H63A 2X9VA 5JXWA 3LVFO 1RYEA 1ZEMA 1HT0A 3BTOA 4DTIA 2X58A 4RVHA 2BKAA 3WLFA 3ZNQA 4CM9A 4XZ3A 3SXPA 2C82A 1BW9A 3JD4A 1HDOA 3GEGA 3PDUA 2ZIZA 3WQSB 1NWHA 3QW2A 2EP7A 5G4KA 5A9SB 3D3WA 2DVMA 2QX7A 3GH3A 3OEYA 3IL2A 4GX2A 3PDJA 3BMQB 1M6WA 5JLAA 5G4KB 3IP3A 5A9SA 5T8KA 5ITVA 4HFRA 3FNFA 5ES3A 2Q2VA 2V6BA 3ON5A 3UHAA 4E32A 3GG2A 3INRA 4HV4A 5AVOA 2EKLA 3JD2A 3H4VA 4BB6A 1GEEA 2VQ3A 5AXBA 5IZ4A 3AY7A 1DOHA 4NK5A 1R0SA 3DMYA 3ZV5A 1HWYA 3CXRA 5L7TA 2C2XA 3DBLB 1P1RA 1CF2O 5HRUA 2RIRA 4RF3A 3WGHA 5CDTA 4XX0A 5L4NA 5TX7A 1DHTA 1PL8A 4ZD6A 4G2NA 1ZJZA 3LC7O 2O3QA 1N92A 3RASA 4KTTE 2DT5A 3O4RA 2B5VA 2GZ3A 3GG9A 3ANLA 5ICSA 1LNQA 2Q49A 3G1TA 4WNIA 1YBAA 3I9JA 4IDDA 4CL8A 1ZXBA 1ZO8A 4XYBA 2HUNA 3DFUA 1UR5A 4CLXA 4B4VA 3D0OA 3WGGA 4O1MA 4BKOA 1LLQA 5L3ZA 5G2OA 1P77A 3EVTA 1KOLA 4RVDA 3TL2A 2BGKA 4R1SA 3AY6A 5F3RA 1GAEO 1YBMA 5EN4A 4IS3A 2AE2A 4TVBA 4Y8VA 4BO1A 4BGVA 4CM4B 1WP4A 3H5NA 2D8AA 3WGTA 1KEPA 3G49A 1XSEA 2DC1A 1T26A 2C07A 3U5TA 2GN9A 3GGOA 3IUPA 4R9SA 4L74A 1QYVA 3LK7A 4BNIA 4A0SA 3OJLA 2BFAA 2EWMA 3ZWMA 4I5EA 1Z73A 4ONEA 2EIHA 4YAIA 1ONOA 4ZA2A 2VZ8A 4FJ1A 4N7RA 2B36A 3PZBA 1MXHA 4ALNA 3TPCA 1JN0A 1SPXA 5JDIC 1EBUA 1M75A 2D5CA 4E5MA 1DIRA 4J3FA 3MWEB 4BNFA 1DC6A 3NT5A 2IZ0A 4HADA 3DOOA 4NQZA 1ISGA 3TL3A 2GR9A 4Z0PA 5KIAA 1FMCA 4TRRA 2NV6A 3UOGA 1A5ZA 3ZI0A 2VWPA 4HKTA 4CM6A 2BFPA 1V6AA 3PLNA 4R54A 3QWHA 1RPNA 1PWZA 2A35A 3TDKA 4BNLA 3GRKA 1HLDA 2XOXA 1R12A 1UZMA 2OHXA 3T4EA 2EHDA 1XLTA 1HSZA 3SBOA 2YHIB 3WGZA 1X15A 1PGNA 1PJBA 1T2FA 1D4FA 3A9WA 1ENZA 2C2YA 2VHZA 3SJUA 4XDZA 4WE3A 4PLWA 4AJPA 4DPKA 3Q0EA 5A5FA 2YHIA 1ZW1A 3B1JA 3C85A 3ZWPA 4E5NA 4XRGA 2I67A 4LRTB 4W7IA 3RAJA 7MDHA 2AQHA 2OZPA 3CZMA 4JROA 2YUTA 1HETA 1EQ2A 2JFGA 3CZRA 1H9AA 3OIFA 4J1NA 1BMDA 1H6CA 2ZB3A 4U6QA 5EPOA 3VOSA 4OYRA 3JQ6A 1BW9B 5JAIA 4DIBA 3JQFC 3FPLA 3WYCA 3MJCA 1NQOA 3F9IA 5F5NA 2AQ8A 1P3DA 2VYVA 4WECA 3WYEA 4WJZA 2JHGA 4BGUA 1E3WB 3FNEA 2H6EA 2HMSA 1YONA 1IE3A 2DTXA 2X7HA 4AJEA 3HFSA 2RAFA 1Q7BA 2DU8A 4B4UA 2O3RA 2X0IA 3I9LA 4M8SA 1C0PA 4J0EA 3U4HA 3Q9NA 2OBYA 4PVCA 1NQAO 2OORA 1GEGA 3C7CB 1DIBA 4PG8A 1NFQA 1DJNA 3RJ5A 3GEMA 3JQAD 2QYSA 4MIOA 3ASUA 1UXGA 3JQAB 3P5SA 3ICCA 5I9NA 1YJ8A 4JQCA 3E9NA 4YAKA 1GUFA 2NWQA 4GKVA 2GN6A 2EKPA 2JL1A 4PLCA 4N5LA 1GYPA 3Q2IA 1DO8A 3VH3A 1KEWA 2GZ2A 2JJYA 4BMSA 3LZ6A 2OO5A 4G5HA 3E48A 3GHYA 1H93A 4CMIB 4Z3KA 2O3SA 5B12A 4CMGA 3KEOA 1K0UA 1D8AA 2Z1NA 3ZWVA 1HDYA 3GA0A 3F5QA 3EK2A 3BYZA 4PCVA 5H82A 2VRCD 3ZNOA 3IIEA 2GYYA 1I36A 3DBVO 1JW9B 3JD0A 2GZ1A 3Q1LA 1CERA 2GUGA 3KHUA 5EINA 1NHGA 2UV8A 1J0XO 1MA0A 2HK8A 2ZQZA 1FDWA 1P45A 5C7OO 1HE2A 2ZTMA 1IUKA 1KC3A 4FN4A 1NAHA 4A26A 5CG1A 4GX5A 3AOGA 4GL4A 3GF4A 4JX8A 4GMGA 3JSAA 1B16A 3S2EA 1LBEA 4CLRB 3FF4A 1T2AA 4XWYA 5GMOA 1M2WA 3DQPA 1XCBA 1WMBA 4Z9XA 5BSFA 4JNKA 3FI9A 1C1XB 4PG4A 1YB1A 2C5EA 2ZATA 1BXZA 2B35A 5C37A 1ZEJA 1ZVMA 2JD2A 4PG5A 4QTZA 4L75A 4W9NA 1G0NA 4FOSA 1TT5B 4NNJA 4TVOA 3DBLA 1E3EA 4BL5A 2EGGA 5HTOA 2GN4A 3STHA 4MJLA 5EL0A 4UUNA 4MP6A 3UH1A 3OETA 2ZTVA 4AL4A 3C1OA 4QUKA 4MIYA 1NBOA 3DOJA 4YJGA 1Y5MA 2P68A 2IRWA 3VPFA 3V8BA 3E1KA 4RPGA 4B7CA 3QVWA 4HFNA 4Q3NA 3WMXA 2VCYA 1YH3A 4GX0A 1ULUA 1NR1A 3QLJA 1AXEA 1D1TA 2OGUA 4OGWA 5JE8A 5COQA 3V2HA 3OA2A 4R51A 4U5QA 2E4AA 1F0YA 4U6SA 5DNAA 9LDTA 4CQMA 3ENNA 3RC9A 4P4GA 4YJFA 4J6FA 1K6JA 2WMDA 1DSSG 5T64A 1AXGA 4DC1A 2PKQP 4XQCA 1A71A 3H6KA 4I5DA 2EEZA 3VKVA 4CV1A 1QORA 4CM5A 1ONPA 3HG7A 1H0KA 1HE4A 2ZYGA 3E9MA 4D43A 1E3WA 2DFVA 2FR0A 1FK8A 3JQ9A 2J5QA 4ALMA 1GUZA 4L4XA 4WNCA 3W1VA 2I99A 1Q0HA 1CJCA 2Y68A 4A7PA 4B7XA 1XYGA 4E3ZA 2WJPA 1PR9A 2D59A 1UAYA 3DZGA 4J4TA 3OICA 3RU9A 4X54A 5L53A 2ZJ1A 3ETGA 2HJSA 1NFRA 3ONDA 4R69A 1VPDA 5KKAA 1LRJA 1JAYA 1ZH8A 5U4QA 2IZ1A 4CMKA 1N1EA 1YE3A 3KYDB 5JDCC 1P1FA 3FR8A 5L40A 1Q7CA 1Z7BA 2JFFA 3KRTA 4CQLB 2HKIA 3AFMA 2V6MA 1PQUA 2YV3A 4KUHA 1LA2A 3K8ZA 5ER9A 3TOZA 3LT4A 1Y9AA 2JAPA 3NT4A 2Y66A 1TLTA 4JK3A 4QFCA 4IY1A 3GFBA 1I3MA 3UAGA 3V2UA 2B83A 4YTEA 1F17A 4NI5A 4UVDA 3GR6A 2CD9A 3BMCA 1KVTA 3D5QA 4GX1A 4J4BA 4NJMA 1E3LA 2OP1A 1UP7A 3NV9A 1K3TA 1B3BA 4D46A 1A9YA 2OMEA 3I1JA 4AFNA 3L6OO 3EYWA 1ZK4A 4RVGA 2X9GA 2VRCA 1YQDA 3KYBA 5EIOA 3GC6A 4DA9A 3WGOA 3IDSA 2HU2A 3V1YA 3KETA 3RBVA 1XA0A 2W2LD 4IZIA 5DP1A 5JO9A 3PFFA 5FI5A 1RKXA 2EW2A 1UDCA 2DBVO 3TQHA 5IF3A 2D0IA 4U0JA 3I9OA 4BO4A 1SNYA 3VPHA 1D7OA 4ND1A 1BHSA 2F00A 4NU6A 4F6CA 1F12A 5CDSA 5ILOA 2XPCA 2IDZA 3SLKA 4D44A 1AHHA 1NFFA 1P44A 2BI7A 2Q4EA 2DUWA 3WS7A 3X2FA 3GVCA 1UDBA 5KCZA 5AXCA 3PI7A 3UCFA 4C7KA 3ADOA 5IDYA 2FWMX 2O48X 3ZV4A 5JCXA 1Q1NA 2VN8A 5TSDA 3V5NA 4Q3AA 4GVXA 5B1YA 4NFHA 4RF4A 4LSMA 2W90A 4E5KA 2Y1EA 1TT5A 1QXSA 2PV7A 1ZSNA 4YRBA 4C7JA 1EDOA 3OM9A 4LGVA 3LLVA 4GWGA 3JQEA 4ALIA 2I3GA 1Y8QA 1EQUA 3VZSA 1GQQA 4FJ2A 1N8KA 3OJOA 1MC4A 3RC2A 3ZU3A 3VPSA 4YDRA 2X22A 5LC1A 2PR2A 3AUAA 4ROSA 3NTRA 4MKZA 1LSOA 2IEDA 1X1TA 1AHIA 1ARZA 4CLEA 4I5GA 3ULKA 1SOWA 4NPCA 3GNTA 3PHIA 3PHJA 3PHHA 4NBRA 4BNJA 4NFYA 1PJ2A 3HFGA 3PXXA 3WJ7A 1KVQA 5B4VA 4B8WA 4DMLA 4JCOA 1BTOA 2JFHA 5F5LA 4FW8A 2V65A 4BKPA 1EFKA 2WD8A 1VE9A 3D4PA 3PHLA 4N5MA 4Q3DA 4K28A 4IINA 2AQIA 5JAQA 3MJ4A 2GN8A 1U1IA 3DBRA 3G17A 5CPBA 4I9UA 1QG6A 4FFPA 4E21A 4RV9A 1QYXA 2PFGA 1I5RA 2Y0DA 6LDHA 3C1TA 1BXGB 3RBZA 1IHXA 3K6JA 4B3HA 3HNPA 2WM3A 3E5MA 1CRWG 4RO0A 4FDAA 1F8GA 2BF7A 4R4JA 3KM0A 4RVUA 3RBXA 1P31A 3ZU4A 3RUDA 4RDHA 4MIEA 4D0RA 3Q9UA 3GDGA 3DMTC 4QT0A 3WFJA 1ISFA 4OOEA 3DO5A 2PTGA 2GASA 2I65A 5KVCA 5TLSA 1U5CA 1Y7TA 1LSUA 1P74A 1TB4A 1YWGO 2FHSA 1MFPA 1ULSA 2GF2A 5DULA 1A7KA 1XGKA 3SLGA 2EW8A 4FGSA 3W4KA 4DWVA 4XCVA 5IZCA 3K96A 4AG3A 1TA4A 2NQ8A 2FPIA 4NJMB 3L9XA 4E6PA 2Y93A 3KLPX 1I3NA 5CP8A 3WYBA 3ZW9A 1E1KA 3RUEA 1E1LA 3WB9A 1JQBA 1DFIA 2DBQA 3RQSA 3NRCA 3ZWYA 4KTVE 4Q39A 1JKIA 2I3AA 4CMBA 1LLUA 1ADCA 1IB6A 2ZQYA 2PD6A 3GRPA 4GGOA 5JC8A 1ADBA 1XU7A 2DBRA 4IJWA 1IZ9A 2HDHA 1LSJA 3H3JA 3MJVA 4CL3A 4RVFA 5TIIA 4CMAA 1B14A 3HN7A 3KLMX 4MVJG 2VUTA 4AVYA 2RBEA 3OIDA 3UCXA 3IQDB 2JAHA 2NNLD 3BMQA 3TZKA 3DONA 1OFGA 3ZWWA 4PN3A 3VH1A 2P4HX 3GZNA 1I30A 1DAPA 2Y67A 4A5OA 1Y8RB 4XR9A 1A7AA 1SB9A 4XA8A 4KQWA 1BG6A 3HZZA 1JAXA 4BV8A 3HB5X 3MOGA 4YQZA 1DPGA 3A06A 3VKUA 3WLEA 3ZWNA 2DTDA 4WK6A 3WGQA 2Y1GA 1LDMA 4DBVO 2YDYA 3TFQA 3BZUA 2VWQA 4E33A 4YT4A 1LC0A 3O8QA 2FY8A 2YFQA 4II2A 1CDOA 1DFHA 4XQ9A 5L9AA 1C0IA 5KWEA 1AUPA 4B4OA 3RC7A 4BNNA 1FDVA 5HWSA 3JQ8B 1FJHA 1EE2A 5I7VA 3B20A 1KS9A 1U5AA 1NQTA 2RHCA 4M1QA 3QWBA 3RUFA 1GY8A 4KOAA 3VH2A 4E5PA 5I7FA 1DIAA 3O38A 3OECA 3MOIA 4O5OA 1A72A 8LDHA 2JHFA 2Q1WA 4YQYA 4YR9A 2UYYA 3ORFA 4OXNA 4FS3A 1TI7A 2XF8A 4YRDA 3WSWA 2WD7A 4DBZA 5TF4A 3CTMA 2CF5A 1UZNA 2Y99A 1PU2A 1L7EA 3GK3A 3W8DA 3L07A 2TMGA 2FOIA 2X0JA 3FHLA 3D4OA 3ZHXA 5EQDA 1DRWA 2C0CA 4GKBA 4MINA 4R1UA 1SB8A 3Q2KA 3EHEA 4I08A 4ND3A 4RGBA 3UN1A 3QIVA 4P8RA 3PIIA 5B37A 4CM7A 4D79A 4RZHA 3D4NA 2G0TA 2CVZA 2CDBA 3KYCB 1E6WA 2O3UA 4QX6A 2AEJA 1NVMB 4J7UA 1T24A 3HQ4O 5C7LO 4K6CA 1PJ4A 4JN6B 1KETA 1UZLA 3JQDA 1R0KA 3P19A 4MVJP 4EYEA 1I0ZA 4MVJI 1PZHA 3DXFA 4DLAA 4R1TA 4GLLA 3PLRA 4FFNA 4E31A 1E5LA 1U2GA 5L95A 1Q0LA 4BNWA 1LDNA 1ZSVA 3PFWO 3MJTA 1I8TA 1E7YA 2VHYA 3JYNA 2J5KA 1O0SA 2V7PA 3WQQA 1O94A 2P5UA 5LDHA 2ZK7A 1P0FA 4Q3BA 4XGNA 1GUYA 3DR3A 1UXHA 4J90A 1I24A 4CM8B 8ADHA 4WLFA 1UP4A 2R2GA 2W2LA 1GL3A 3LT2A 3VAZA 2QG4A 2Q2WA 5G0UA 1U7HA 3B6ZA 3JQ9C 3ONFA 4IMPA 2BD0A 3PWZA 2HMVA 1L1FA 3GVXA 5BT9A 1VL6A 1UXJA 1VL8A 5F1KA 1JA9A 3BHMA 4MP3A 4FSHA 1N9GB 3S2IA 1M76A 1FF9A 4D42A 5AOVA 1A4UA 2R6JA 3N74A 2PK3A 3D3WB 4BVAA 1BVRA 4ND2A 1NPTO 2QZZA 5HS6A 2XAAA 5CPFA 3U9LA 4CMEA 1X13A 3F1KA 3FWZA 3RJ9A 1GU7A 2J8ZA 3QWAA 1PGJA 3ADPA 2NVUB 3WBBA 1XWFA 3CH6A 2PD3A 1IZ0A 4WCDA 1X7GA 3GN1A 3AI3A 1HZJA 4DQVA 2VHVA 3TOXA 1BGVA 3E82A 4HWKA 3K2EA 4TKMA 2OFPA 2W2KA 2ZCVA 1H94A 4XKJA 2HK9A 3QWFA 1ZK2A 3EZLA 1P1KA 3H9JA 4BQPA 5BNIA 2UDPA 1P1IA 1P1JA 2NU9A 1GV1A 4ZVVA 3L4BC 3V1TC 1ZIDA 4WUVA 3QVTA 4Q3EA 1PQWA 1AGNA 3KSZO 1QMGA 3W6ZA 1G0OA 2POQX 1EZ4A 3MEQA 1WDKA 2PWZA 5DZSA 4DQUA 2OUIA 4UUMA 4RORA 1T2EA 1T25A 2XXBA 4S1VA 4Z3DA 1VJTA 3JYPA 4Z9FA 1KVSA 3M2PA 4FJ0A 4J1SA 4FD3A 4IDCA 1SCUA 1E0DA 3WOHA 4E5YA 5CEEA 4BHTA 1XHLA 2NTVA 2X4GA 4BO9A 3DC2A 4J91A 4D0SA 2CF6A 4OIMA 3DB2A 1BXKA 2BFOA 3AM5A 5G0WA 3DOCA 1U3TA 3C7DB 4MP8A 3A14A 4INAA 1KVUA 4EGFA 3HHPA 4GLOA 1GFSA 2NQTA 2C7GA 3M6IA 2P9GA 3AUSA 4J7CA 3ZH2A 4BNZA 4ESOA 3U3XA 1PL7A 5EESA 1JKFA 1NNUA 1VKNA 4KWIA 2VNSA 4LK3A 3PJDA 2C29D 3I5MA 1UUFA 4IMRA 4CLOA 3JQCA 4G81A 4RF5A 4Q3CA 2BGLA 1A9ZA 3KYCA 5FWNA 4UVIA 2YV2A 2TMDA 1ZK3A 1KBZA 4RLSA 4XJTA 4HXYA 4XGIA 2NTNA 3W6UA 3WDSA 1VC2A 4DMMA 3NKLA 5T5QA 1LC3A 2EP5A 5DCUA 2YJZA 4XIJA 2IE0A 1Y9EA 4AJIA 3ZW8A 3O26A 3PEFA 4XD2A 2DAPA 2JKVA 3RC1A 2Z95A 1T2DA 3E6AA 2QIOA 4E12A 4F45A 2CUKA 4HFJA 4QEDA 2IZZA 3RFTA 4BIIA 4FCCA 1PJLA 5TRTA 3ZNNA 1ONNA 1NAIA 4BO7A 3HSKA 3DL2A 5L4SA 2PA3A 4IBOA 1I3KA 4BKRA 5JAMA 1ZBQA 2O3TA 2O50A 2HMUA 5KTKA 4E30A 4RPHA 3AI2A 4D7AA 2HRBA 5ENVA 3OQBA 3WIDA 1LXCA 1LU9A 3PPIA 4PLFA 3VVBA 2QZ9A 4LVCA 4YYZA 3JQ7A 2NTJA 1LJ8A 3FRJA 3SX2A 1AN9A 1FDUA 4AJHA 5A3JA 4IJVA 4EZBA 3VVCA 1EVJA 4L4SA 3FTNA 4J16A 2DPHA 4MDHA 3WWZA 2O7SA 4PLYA 3VPGA 4K1LA 3FR7A 5JMWA 3GQVA 4LSWA 2PZMA 2HLPA 2HJRA 1PTJA 1HYHA 5BSGA 1K6IA 1ADFA 3DAGA 3WXBA 4EBFA 2J3IA 3D3EA 5IN4A 1YL5A 2YQ5A 1YGYA 4PVDA 5JY6A 3LSYA 3M1LA 4IZHA 1R4MB 1I01A 1ID1A 4IIVA 1G6KA 2FR8A 1J6UA 2CZCA 3GVIA 3H65A 1QLJA 4TROA 1T1RA 5G0SA 1NYTA 4PIVA 3KSDO 4RDIA 1YB5A 3NDJA 4LMRA 2UVDA 1ENOA 1JU9A 4TRJA 2YDXA 4ITUA 3L6EA 5KJEA 2VUUA 4XYLA 4DIOA 2CDAA 4CQLA 2EV9A 4XYGA 1MG5A 2D3TA 1QRRA 4LN1A 1WMAA 4BO6A 3OMLA 4UAGA 3ETDA 1CQJA 3NJ8A 1E3JA 1NASA 5H81A 4YEDA 4IIUA 3TFOA 4FQ8A 4EUEA 1S6YA 1UP6A 4B3IA 5JYEA 3VZQA 5DP2A 1WW8A 2YYYA 4R9RA 3NYWA 4FC6A 1NR7A 2CVOA 2G82A 4L8VA 5H83A 4I9NA 3OFSA 5DOVA 1HE3A 1GQYA 2HMTA 1YJQA 2FZEA 2X86A 2AEFA 3DBHA 5KKCA 7ADHA 2C5AA 5COAA 5IDWA 4R3WA 5IAAA 1YQXA 4DXHA 4XIYA 3AUUA 1HTBA 2JD1A 5L7YA 4ALKA 3MTJA 4MO2A 3COSA 1EVYA 4FGWA 1QYCA 1WDLA 1OC4A 3CEAA 2UUOA 1TXGA 3G79A 4HBGA 3H2ZA 4ND4A 4MKRA 4DQXA 1FDSA 3GVHA 2OXIA 2J3HA 3UW3A 3PGJA 2PNFA 1HYEA 3GNQA 4NJOA 2Q99A 5GZ3A 2R00C 4BNVA 4OQYA 4IXTA 4RQTA 5CAEA 4JP2A 2PD4A 5EJ2A 4ZHSA 3TZHA 3RUCA 3F5SA 4NBVA 4GBJA 5BQFA 1YVEI 3UGKA 4KMSA 4EJ6A 2RH8A 1JDJA 3DAPA 1M66A 3KOUA 1UAGA 4LVUA 1DRVA 3UFXA 1VSVA 2BH9A 3NUGA 5ADHA 3UICA 1ISIA 4M86A 1E7RA 4UVGA 1TT7A 1YXMA 3RKUA 3RD5A 2G1UA 1EK5A 5IZCC 1U4OA 4YWJA 1HF3A 4Y67A 2VZ9A 4E0BA 4AICA 4BS9A 5F1PA 1PZEA 5BNTA 5IN5A 1E7SA 2X9NA 1IPFA 1HZZA 2AQKA 3BHJA 4J43A 2I9PA 1NHWA 3ONEA 4XYEA 3JQGA 2EG9A 5GZ6A 4YAGA 3UKOA 1N5DA 4ZQGA 5LDGA 1X0VA 4B4WA 1V3UA 2H9IA 1GADO 4OH1A 3UF0A 4OXYA 1ZMTA 1WZEA 4PZDA 3ZWCA 3K5PA 3U62A 3AOEA 2P9EA 5TGDA 3WR5A 4BNMA 2VOEA 3ROMA 1ZFNA 1I2BA 3BA1A 3FTPA 2PGJA 1C0KA 2HK7A 2O4CA 5C7IO 1U7TA 2DLDA 4IGEA 1C1XA 1HYGA 2YHUA 1RJWA 4KQXA 3HDHA 1X7HA 4ZN6A 1SEPA 2BELA 1PL6A 4RVSA 1EUDA 2ZTLA 2H1SA 4GSLA 4ZQBA 3A28A 2Y0EA 3U49A 2P4QA 4Y6PA 3GZ4A 5G4LA 4UULA 1K2WA 3ZGYA 1QYWA 3TWOA 4AJ2A 1LTHR 2R00A 1DDOA 1U8XX 2CMDA 3MWDB 4MKXA 4CUKA 1V3TA 2EF1A 3M2TA 4NBWA 4U8GA 3R3JA 5DOZA 4GQAA 4K26A 4BV9A 1B7GO 2RCYA 1DC3A 1XDWA 5KOIA 1DLJA 2HQ1A 1VI2A 3CINA 3CMMA 5A9RA 4H7PA 3RKRA 3VDQA 3AW9A 4BGEA 4MVJE 1C3VA 3G3EA 3OF2A 3ZHBA 4EI2A 3JTMA 3H9GA 4PZEA 4ZRNA 3GUCA 3EY4A 4IQ8A 2IXBA 1B8VA 1V35A 2ET6A 3QP9A 4CQMB 2Y1DA 3F4BA 1M6HA 3DBHB 1RWBA 1SAYA 4J0FA 4DPMA 4TWRA 1VKOA 1PS9A 2FRDA 1F14A 1Y81A 3QHAA 2UUPA 1GV0A 3GNSA 3SJ7A 3GOHA 3BXXA 1QV6A 1WNTA 2PZKA 1JVSA 2V6FA 4KZPA 2JD0A 1HXHA 3GEDA 2AMFA 3INGA 3NTOA 5HBRA 4BNXA 2Q1SA 1RM5A 3ASVA 3DBRB 3BMOA 5FYDA 4D3SA 4AJOA 4IDGA 4EITA 2NU7A 4YBZA 2HSDA 5KVSA 4JJGA 4FFMA 4HX5A 2F1KA 3ENKA 3Q6IA 5CHEA 4DREA 1A27A 1T1SA 1UDAA 3X2EA 2AG5A 2O23A 3PZRA 4GSKA 4E2WA 1PIWA 3WMWA 1KVRA 1GZ6A 1XQ1A 2CSUA 5DT9A 1PS0A 5MGBA 5K6AA 3TZ6A 1ZUD1 3GT0A 1UH5A 3ICPA 4WGGA 1EEHA 2ZCUA 5C5IA 2E82A 1LDEA 2JCVA 3O9ZA 4BMNA 2E49A 2O3JA 3ANNA 3TNLA 1W6UA 1V0JA 4BO8A 2VWHA 1O89A 1PEDA 4WLUA 3BAZA 2EKQA 3JD1A 2Q45A 4DIFA 5ILGA 2VWGA 3HJAA 3R6DA 3FBTA 4PLZA 1LDGA 3NDRA 3OA0A 2SCUA 4I1IA 3IOYA 4AJ1A 1R4NA 3TJRA 4J4HA 4J9VA 4TSKA 5TT1A 3RROA 6ADHA 3K31A 3K30A 2W4QA 1Q0QA 2QHXA 1OBFO 5AQ1A 3WIEA 4EEXA 1OZAA 3IKVA 4HY3A 5G0VA 3RSHA 3RUIA 3NDIA 4JBHA 1E6EA 4OO3A 3ZV3A 1NTOA 1H2HA 4M55A 4EUFA 4ZGWA 3PJFA 4AJ4A 3L4SO 4L76A 1RYDA 4KWHA 4DVJA 4TRMA 5JW6A 4RQUA 3KSUA 1IL0A 1GYRA 2NVUA 1WVGA 3R0IA 2J3KA 2NM0A 1GPJA 1EDZA 2ZJ0A 3ZU2A 5I9MA 3BMOB 1Y8RA 2GGSA 3JYQA 2EJWA 3E18A 5BNFA 5U9CA 4NK4A 5BSEA 1G1AA 4BNHA 3WWYA 5HM8A 4J49A 1I2CA 2VTEA 1W0CA 3GGGA 1OOEA 5HS4A 1RM4A 1NPDA 4C4OA 1W73A 3JQFA 2Y1OA 3OEWA 4F46A 3JYLA 3I3OA 4XRRA 3TRIA 3A1NA 4E2YA 2P9CA 5A5EA 4NMHA 3L77A 1MLDA 5F21A 1RM3A 1J49A 3GDFA 1YOVA 3ZN2A 4RL6A 4CMJA 3L6DA 1HDRA 1DC4A 4CUZA 4NZ9A 5F1OA 4NR0A 2B37A 2IEBA 5JSFA 5A02A 1CQIA 1KERA 3B70A 3TF5A 2X6TA 5A04A 1MFZA 4CQMD 1PGQA 3MZ0A 2NU8A 4CMIA 4QO8A 2P5YA 3ROKA 5T6BA 2B4QA 2O7QA 3CMCO 5DDIP 1E7QA 1CYDA 4YJHA 3D64A 1Z82A 1XIVA 3PVZA 5K6AC 1W4ZA 1ZKMA 4QXMA 3IS3A 5JNLA 1TEHA 4BQRA 3FNGA 1KEVA 4PG7A 2FMUA 3BHIA 3DHEA 4NBTA 3U4DA 1DHRA 2WD7B 2ZB7A 3OP4A 1PX0A 3PWSA 5COBA 1SO8A 4M89A 1HE5A 1HRDA 3V1UA 2PH5A 5G0TA 4JLWA 3CKYA 1DJQA 4FC7A 4EW6A 4E2XA 3LU1A 1LUAA 3SC4A 4DYVA 1UXIA 2DM6A 2VYVD 4R16A 4W4TA 2ZKLA 3N7UA 2HO5A 2IXAA 2O2SA 1DLIA 1R66A 5FF9A 3OBBA 4OMUA 3BMNA 4WLOA 3GHHA 1BDMA 1NX6A 5IXYA 2ILTA 3PHGA 4IDBA 4E4YA 4PLVA 1EUZA 2GD1O 2Q4BA 2BGMA 3OHSX 1R0LA 2WTBA 4WASA 1EK6A 4WCFA 2IYOA 4AJLA 4P4LA 3ZWXA 4L9RA 2WYUA 4U0KA 3AM4A 2CVQA 4CUJA 2VT3A 4K6FA 3ZWAA 1O8CA 1IYZA 5TJHA 2Q1TA 4J9UE 1LX6A 4AJKA 2CNBA 4R5HA 2O4UX 3H9EO 2WDZA 3I52A 4P38A 3S8MA 3VTZA 4DUPA 2VUSA 5IDXA 3SVTA 3EDMA 4OQZA 4N18A 3H3FA 1B2LA 4BO2A 1H6AA 2DQ4A 4J1TA 4WEQA 2CY0A 4Y6SA 3ZZNA 3WGIA 3D5TA 4TQGA 4CMEC 2D5AA 1Y1PA 3AFNA 3PWKA 4J2HA 4S3MA 3U0BA 3QV1A 1DIHA 1O5IA 5KJ6A 3CUKA 3GAZA 3R1IA 4HP8A 1MB4A 5K0ZA 4DGSA 1F06A 4D3FA 2PZLA 3HE3A 1Z75A 1P9LA 3IMFA 4II3A 3FCOA 4ND5A 4YJFB 3IAHA 3ABIA 3ANMA 3AJRA 1GQ2A 1Z6ZA 4J2OA 3H7AA 4MPDA 4MVJM 4OJNA 4U7WA 5CFZA 4NHEA 1VL0A 2GERA 1GZ3A 2PY6A 3GZNB 1HDGO 4TMFA 5JS6A 1YDEA 1I10A 3IJPA 1O9BA 1CEQA 3ROQA 3I83A 1HLPA 1R37A 2BMAA 2QYTA 2ZYAA 2W8ZA 4YT5A 2E6UX 3FWNA 1B26A 3NGLA 4EJMA 4IJUA 3IKTA 1HKUA 2Y1CA 1KYQA 2B4TO 2FPPA 3DHYA 2VZ0A 4H16A 3I23A 3I6QA 4OSOA 4WOKA 1KY5A 2Q3EA 3K2BA 3KYDA 1QLHA 1QR6A 1S7CA 3DZKA 2OBNA 1GPDG 2X8LA 4R68A 1NWCA 2QQ5A 5A9TA 1WDMA 2Q1UA 1Y8QB 1O6ZA 4CR6A 4WOJA 3OJFA 2AXQA 1E3SA 1YOVB 2YV1A 4RLHA 4IJKA 2X23A 5IXSA 4A03A 1F8FA 1YRLA 3GGPA 1B15A 3BMCB 4TKLA 3RU7A 3C8MA 3I6IA 4IM7A 1OAAA 4YAJA 5T57A 4CR8A 2Z5LA 2HRZA 1PQPA 1JVBA 3OJEA 1ISMA 4CMCA 2WWRA 3E8XA 4MVJD 4I9HA 1C1DA 1C0LA 1VRWA 2QRKA 5L51A 2FZWA 5J23A 4XJSA 4A27A 2GCGA 5A3VA 1YO6A 1MC5A 1EUCA 1QP8A 2Y1FA 3W8FA 4YT2A 3JCZA 2A4KA 3D1LA 5AXAA 2ZB8A 4CV2A 2GLXA 2NADA 2X5JO 1XG5A 4ALLA 2W98A 2EERA 3VH4A 3S1LA 3IP1A 1SMKA 4ZQEA 4GAEA 4PFJA 4QSMA 1LDYA 3TZCA 4D3DA 3QRWA 4ZU3A 4BGIA 5TNXA 1XQ6A 1NPYA 4MOWA 4XB1A 4CLRA 2ZTUA 3U09A 1YS4A 5CDGA 3C24A 1H2BA 4RPLA 2EGHA 2GRAA 2VRBA 3N58A 4IQ0A 1PS8A 2VHWA 3F47A 4DRYA 3K73O 5HA5A 4I5FA 3NTQA 1NP3A 1NXQA 3O8QB 1CETA 1VSUA 4JJIA 1SC6A 1V8BA 2X0NA 3PQFA 1BRMA 4MVJF 1HSOA 4UREA 3ZWOA 1T2CA 3AUTA 5DBFA 4YXFA 3OIGA 4IQGA 4BOYA 3DZBA 1VLLA 1O95A 3FNHA 4QECA 4A10A 1JWAB 4R1NA 2YY7A 2AEMA 3LDHA 3S2GA 1PWXA 5ICMA 2GSDA 1PR3A 2FPGA 1LRKA 1ADGA 2O2YA 3D7LA 3CSDA 3WTBA 4W6ZA 3GAFA 4O0LA 3WNVA 1DC5A 3KZVA 5FFFA 5ER6A 4YCAA 5AXDA 4KDFA 4PGFA 4Y98A 5IG2A 1BSVA 3PP8A 4M87A 1ENPA 2HCTA 2D2IA 2JCXA 2VYNA 5JDIA 2V6GA 5KNLA 1GTMA 3WNQA 2DTEA 4B3JA 3FPCA 1X7DA 3QJ5A 5DN9A 1Z45A 2NACA 3Q3CA 4YT8A 3AOEC 4KDEA 5CG2A 3C1AA 4OKIA 4UUOA 1BXGA 2QRLA 3S55A 2DPGA 1MGOA 4PZCA 5CEJA 1I2ZA 1ML3A 2FP4A 3DDNA 1TVEA 2IODA 4FPXA 1H6BA 4Q9NA 3EW7A 1WPQA 5LCXA 5A1TA 1N1GA 3Q11A 5JPIA 1SEVA 2CFCA 3HDYA 2PH3A 1PZFA 3EZYA 5I8WA 1HL3A 1Q2XA 4JBIA 5JCJA 1E92A 3UCEA 4YRAA 1ZCJA 4PLTA 3DZHA 3T7CA 5I8ZA 5THKA 2H5LA 5I7SA 1WWKA 1FDTA 4JXKA 4F6LA 3MCVA 2PZJA 1IULA 1ZJYA 2PLAA 1YL7A 5EQFA 2YFHA 4EUHA 2QW8A 2LDBA 4L0QA 3A4VA 4WKGA 4UEKA 4FOOA 1P33A 4UVEA 3F46A 4JBGA 4E13A 3IJRA 2Y05A 4OM8A 5CDYA 1I33A 4DC0A 1PJQA 3DZJA 2J3JA 3BIOA 4A2CA 2RH4A 1X0XA 1KC1A 4MVJA 3EUWA 1VJ0A 1ISJA 3F1LA 1N9GA 5B4UA 4CV0A 1NVTA 1U4SA 3M1AA 4Y6RA 2EXXA 3O03A 4CLOB 4WEOA 4N5NA 3AM3A 5EERA 2NU6A 2B0JA 3ETEA 3HWRA 3EAGA 3H8VA 3B1FA 3KVOA 3PJEA 3VC7A 3W4JA 1PJSA 1H6DA 4G65A 4IGFA 3P2OA 4FBGA 4BB5A 2XXJA 5T8KC 4CR7A 4OKNA 5GZ1A 4NDNE 3MJSA 2PGDA 1UXKA 4HUJA 4KUEA 3ROPA 1L7DA 3V2GA 3FD8A 1ZK0A 4LISA 2X1HA 1EMDA 3PYMA 2OOSA 3H5RA 4B79A 4IS2A 4RPKA 1DXYA 1IY8A 2B5WA 5JDCA 1Q7GA 2GPTA 3GVPA 1KEUA 1SOVA 4R41A 1AE1A 4BNGA 3WFIA 4B8ZA 3PYXA 3DMTA 3TSCA 4Z9YA 3ITDA 4BO0A 1YBVA 3HADA 4K9DA 4NG5A 3F6YA 4WLVA 1U8FO 3H9QA 1MXFA 4CM8A 4YJDA 4IDEA 4CLDA 5IJZA 1U3UA 3KO8A 3VZPA 1KIFA 4GGPA 4YB8A 3JQ7B 5JO0A 3LF1A 4GH5A 1GCUA 3LF2A 1HEUA 3IC5A 3TN7A 2NLOA 1WZIA 4XQGA 1J5PA 4P22A 4MVJH 5JFOA 5L45A 3E9QA 2WSBA 3LT0A 3F3SA 4YA6A 3HDJA 1U2DA 1B0AA 3I9KA 2ZYDA 1RM0A 4BNYA 4H3VA 3GY0A 3LLSA 2WEKA 4KUGA 3WG9A 1U3WA 1E3IA 2FSVA 3QQPA 3KBOA 4YJHB 4YPOA 2VOJA 4EEZA 4LCEA 1T4DA 2E48A 1SZJG 2PGLA 4TZTA 5KJ1A 4FB5A 3SC6A 3VPXA 4JJFA 5FI3A 4PRLA 3VZRA 3UVEA 2QRJA 1CIVA 3MJEA 3C7AA 4PLPA 1HDCA 4O63O 2A9FA 3DEYX 3DWFA 4XGKA 4M49A 3I9MA 4FFRA 4NFSA 3WQRA 1R16A 3PIDA 4ID9A 1U3VA 1VJ1A 3WSVA 1QSGA 4GVLA 4BO3A 1PJTA 3QWIA 4IUYA 5JYDA 5TC4A 1EBFA 3E03A 3AU9A 1JLLA 3I4FA 4A73A 3ITKA 3B1KA 3T4XA 1XU9A 1J4AA 1GD1O 4BNKA 3AWDA 3DFZA 3KV3O 3L0DA 5A4DA 4LMPA 5ITWA 4P4NA 5KJFA 1YQGA 1K89A 4J7XA 3R3SA 1MX3A 3GPDG 2AE1A 1E6UA 2NUAA 3PRJA 4D41A 2DKNA 5TQVA 2X5KO 1X1EA 1XKQA 5DBIA 3JQBA 2C20A 1GDHA 1YB4A 5T67A 4QQRA 3ZU5A 4NU5A 4L73A 3AI1A 2X0RA 1DRUA 1V9LA 2NVBA 3WJAA 4TRNA 4NIMA 4YAEA 4ZJUA 1N7HA 3AU8A 2I66A 3SEFA 3FSRA 1ISHA 1N7GA 1JWBB 1LRLA 1R6DA 3WTCA 5I7EA 3PYLA 1LQTA 3KXDA 4Y9DA 5U1PA 3KB6A 2Y0CA 3H5AA 4FR5A 1IOLA 1R4NB 2P2SA 1DFGA 4YVFA 3LC2O 3WX0A 4BKQA 2P91A 4AJNA 3CIFA 1HDZA 1ORRA 2Z1MA 4NH4A 3ZWBA 4IDFA 4ALJA 5C3MA 4FFLA 3HN2A 4TZKA 4LW8A 1QKIA 2FSSA 2BHLA 4CLHA 1LSSA 3ST7A 3GDOA 4WCFB 3GMDA 4Z0HO 2D4AA 4PLGA 1R15A 2BI8A 2YZ7A 5DCWA 1B8UA 3GMSA 5TJ9A 5IDQA 5DCYA 1NVGA 4W99A 4DL9A 4GWKA 4WCFC 3P2YA 3PQDA 1IHYA 1QYDA 4WPGA 3RFXA 1H9BA 4YJGB 2RHRA 5K9ZA 5A03A 2Q2QA 3DHNA 3G0OA 4DLBA 1MV8A 1U28A 2G76A 4R01A 3INTA 4HFMA 4O59O 5I9LA 4WLEA 1Y5RA 4O6VA 1LI4A 1OC2A 4DLLA 4M54A 3L9WA 1YL6A 5CEFA 3VHRA 2LDXA 3ZCXA 5KVVA 3BTUA 5DBGA 4BMVA 3W4IA 5CDUA 1E1MA 1PJCA 1GCOA 2GNAA 4N54A 4RJTA 2J6IA 2YW9A 4J1QA 3QVOA 2VYND 3DTYA 3GUYA 3UUWA 3RUHA 1XEAA 5MDHA 3NGXA 1X14A 1XELA 5KVQA 2FR1A 4H15A 5DF1A 1LQUA 4OL9A 3PGXA 5JMPA 3OJ0A 4EJ0A 3QY9A 4GPD1 1JKJA 1PJ3A 4ILKA 2Q50A 3AK4A 5IFLA 5TT0A 3T7EA 1R4MA 3QSGA 1E5QA 1E7WA 1HDXA 2A92A 1EVZA 2E37A 4XQEA 4BO5A 3F4LA 1ENYA 2G5CA 1ZMOA 3MTGA 5JC1A 1DAOA 1PGPA 3ZHZA 3FN4A 3W8EA 2AHRA 1A4IA 2C59A 4RF2A 4OSPA 4OXKA 3HUDA 1EVIA 3H2SA 5L4LA 3LT1A 3RFVA 3BTVA 1P0CA 1UJMA 3BMNB 4W82A 2A94A 1Z74A 1YKFA 2DUUA 3E5RA 1SBYA 2ZB4A 3NAQA 4UEJA 3HDQA 3RVDA 4BKUA 2BLLA 4LCJA 1U9JA 4IPTA 4JGBA 3WICA 3LYLA 4CM3A 5TS3A 1BDBA 2VTDA 2Q46A 1DB3A 4W9NC 3NJ4A 2G17A 3PK0A 3JYOA 4UVHA 1FXSA 3CE6A 3K9QO 4Z6KA 5KJCA 2DBZA 4IXWA 1N2SA 2WE7A 3UXYA 2EJVA 2HMWA 3GPIA 3JQBC 4ZQHA 1K6XA 4ZQFA 2WYWA 1EFLA 2C54A 4ZRMA 2J5RA 3OH8A 4JIGA 2DFDA 3P7MA
chains in the Genus database with same CATH superfamily
1E6MA 1KI2A 1MH1A 3HA7A 3LKZA 1ZGJA 3AKCA 4CM9D 4C30A 1QWOA 2AZDA 2O2GA 4RPJA 4QAQA 1RQ2A 2R2AA 3D4LA 2WUGA 3LXMA 3PNKA 2PT6A 3PXEA 4ERXA 1E32A 2AA3A 3PTZA 3WBFA 1PJ8A 2B69A 4DYDA 4WK0B 3STTA 3DVAA 2FB9A 2Q3DA 2Y1KA 4A8JA 3GD5A 4PPFA 3U7RA 1B8PA 4F3YA 1FXWF 4XEHA 3CLRD 2FUG6 4P93A 4HRXA 1GZ4A 2L0XA 4M60A 5FTMA 3LVRE 3FMPB 5BPFA 4PZZA 2FJUA 3C3MA 1KDVA 3ND7A 3WIBA 3ZDFA 2EHJA 4P3NA 1MABA 2O6LA 3KBBA 3BSFA 1ZZEA 4HEHA 1W2HA 4EHNA 1AD2A 1CDEA 2KJQA 4DTCA 2W2KB 1L5FA 5KHAA 1U1DA 1S8AA 1XD9A 2QV7A 4MZXA 5AYVA 2PQMA 2R25B 4JJ8A 3RS3A 1FX0A 2CXQA 3WGYA 1VXOA 3VO2A 2XB4A 2F55A 3RTCA 4GL2A 2Q9AA 3OTGA 4QHSA 2HIHA 1NG9A 3JQAA 2DETA 1W5AA 1RAGA 3LCRA 1P1HA 2YWEA 1JFSA 1QKJA 3EOBI 1SQFA 2ES4A 1Z39A 3A1TA 3B53X 3I9NA 4FOPA 4PWYA 4WESB 4X1YA 4KPFC 1A95A 4RGYA 3SKXA 2WUDA 4KE9A 3SHFA 5I6DA 3UC5A 4J03A 3ZIAA 1MP0A 4IF4A 4CM1A 4CMHA 3JD3A 2CDCA 1XOIA 3VI4B 1ETUA 1BC5A 5FX2A 1YZGA 4JEIA 4NZMA 2CDNA 3BRQA 4G0ZA 2C77A 3TW4A 2GNOA 5A4JA 5IYZA 3GIDA 5K0TA 2XHZA 3U1BA 3WK6A 3WO1A 5HPYB 2MR6A 1RZRD 4HGZA 1XLWA 2EFDB 4INPA 4QXRA 5CYOA 3G1UA 1U0EA 3QPAA 1WHTB 1CWUA 3BICA 4DWJA 3IIIA 3TZQA 1WPGA 4FNMA 3FROA 3U44A 2LIVA 1GZDA 3NT2A 4HNGA 5B2ZA 1RCUA 5DYTA 2WJHA 2JGNA 2W70A 3IVGA 5ALGA 4GYKA 3EVDA 1IIBA 1DX4A 1GWNA 4AUMA 3O5AA 4B43A 1GL7A 3EZ6A 5SY4A 1FBNA 2NVWA 3F67A 2DX7A 3DTTA 3DLTA 3OKPA 5D8DA 4N48A 1OYVA 1B0ZA 2RCNA 3JWGA 2XY4A 3ABOB 2JASA 9LDBA 1DE0A 1JX6A 3L1VA 1T9HA 1ODCA 1XZQA 4FQ5A 1KDRA 4K9PA 2XVMA 3DW3X 4OOFA 4WDRA 5CA1F 2QTBA 4QOFA 4XDYA 1LS6A 4R3NA 2WE8A 3ADBA 1OI4A 1EFCA 3BQMB 1I14A 1RT9A 4M9CA 1HNZB 1SG0A 1WLYA 3CLTD 2Q6VA 3B1WA 2A58A 3F6BX 1G9SA 4FFOA 2XUIA 3R7WA 1PLLA 3R7NA 1UM8A 2IUFA 3BGIA 1VMIA 3AYXB 2BMFA 3OCXA 4U7JA 3PBKA 3OE4A 2QF7A 3VTFA 1IBSA 4X92A 5JY1A 5KYYA 2XV1A 2D1YA 3ELBA 1BN7A 1U98A 2P78A 4R5MA 3RVRA 3VDRA 4HPJB 2VNAA 2M6KA 3RIHA 3H9UA 2GBFA 2QOEA 4NE9A 2BRUC 4GI1A 5JCJD 2V7BA 2BL4A 4UBOA 5E3JA 4UCWA 3ED5A 2IPOA 5IAGA 1OXMA 5KO2A 1CP2A 1Z0FA 2HZBA 2L69A 3OQPA 4JP3A 3H2IA 4UCXA 5F76A 3R5XA 3EDQA 2C8LA 3R6GA 4LAFA 4LXIA 4RHCA 3UMGA 1MZPA 3IP8A 1U9CA 1N5LA 4RPIA 1YZKA 3C16C 3JATB 2AG8A 1UKAA 2C2ZA 3MCUA 3AHGA 2NXCA 4MA4A 3DKRA 4EHKA 2BKVA 1CR4A 3CNBA 4K6GA 2QB5A 1NJGA 4L28A 4ZICA 2GSWA 2IUSA 3EC7A 1NX9A 4KQ9A 3FNBA 5AM1A 4Y2SA 3NOVA 1C1DB 3FOCA 2WWFA 4IIEA 1KKLA 3K8OE 3EXFA 1RYEA 1VE5A 4D8VA 1HGXA 1PKEA 1ZEMA 2C2BA 3QHQA 4WXYB 1NIPA 4DCSA 4OHOA 4M1EA 3TJMA 2BKAA 2P3LA 1CV2A 4CM9A 3SXPA 1Q16A 1KZ7B 4F4HA 1QHNA 1RI3A 3EB9A 1XZGA 3X1YA 2W6NA 1FTQA 4D9MA 5K05A 1PNVA 4RLFA 3ZHSA 2O59A 3PDUA 5EC8A 5B1DA 1K6EA 4GBMA 1DUIA 4IQ4A 1UPBA 2J0UA 2QW1A 3L82B 2QX7A 3OEYA 1IMOA 3IL2A 3BMQB 1VL5A 4DZRA 4YUYA 1HZZC 3IP3A 4OEHA 4EG5A 1SKMA 4MWGA 1M8KA 3REQB 1XMVA 2Q2VA 2V6BA 3ON5A 4PBRA 2NXEA 3GG2A 2H2WA 1AVTA 3OLCX 1Q3HA 5DMXA 1HQDA 4IILA 1A5TA 3H4VA 3T7SA 1MABB 3GFPA 5AXBA 2OHHA 1GNRA 3W8RA 2VJQA 3KPJA 4Z8YA 1XFDA 2BWJA 3PUYA 2QDKA 1TVMA 1J24A 2ZJZA 1R0SA 3DMYA 3UJBA 2F9MA 2D0OB 2JLXA 4OTZA 1P1RA 5FTWA 5HFAA 4AG5A 5L4NA 2XWQA 2H1IA 2RH5A 3VC2A 2K4MA 4DLXA 4G2NA 1PV4A 1NJ6A 1M74A 1N92A 2DT5A 3LGSA 2GZ3A 3O4RA 3O8LA 3HM2A 4JI4B 4HDRA 4B45A 1FP7A 1UDXA 4C01A 3G1TA 3MAGA 2O8DB 3FMOB 5FWXA 1QPBA 3BIWA 4OQXA 5AOCA 3RFUA 1KMHA 1QGDA 1KFKB 1S89A 1ZO8A 3E2MA 4XYBA 3I76A 4QYIB 1D2EA 1SBHA 3L01A 3KOOA 5AO9A 4QU8A 4BKOA 1K5DA 3W78A 1KI6B 1LB1B 2JAOA 4AM8A 3N0RA 1RHUA 5G2OA 5CGQB 3BGOS 2XAUA 3EVTA 1BOOA 4PU0A 1C1YA 2BGKA 3NBMA 1FFXA 1Q22A 4HDOB 4LBVA 4R1SA 1QF7A 4KE7A 2NZYA 4XLZA 3ZOKA 2YWBA 2ADOA 2HU8A 1WIWA 1NW4A 3AJAA 1QO7A 5BURA 1WP4A 4KR0A 2W83A 2HBYA 3F7TA 2VP9A 3H5NA 1QVAA 4UAVA 2AUMA 3SG0A 2Q8NA 2D8AA 3EH1A 3WGTA 1YFKA 3PQ4A 3G49A 1XSEA 5A7FA 3DAOA 1ADYA 2C07A 2BZSA 3GGOA 3EXHB 1JEDA 1TCCA 3L7IA 1QAOA 1QYVA 4P4SB 5FO1A 4BNIA 1Y89A 2Q6IA 5AHRA 5EIBD 1C50A 1P62B 4FBLA 3A2NA 3QOFA 5JCOA 4EY5A 2GXAA 3SE0A 1U81A 1Z73A 4URUR 2EIHA 3LQ1A 4MUAA 4O8ZA 4ARVA 5IS2A 3TNYA 2VZ8A 4FJ1A 3SQWA 4PZPA 2HUPA 4Q1DA 4UM9D 5HDBB 3SZGA 2BGGA 4MNTA 3THOA 3THXB 1JN0A 3BRWD 5FPTA 2EZ9A 1TZKA 1EBUA 3IVAA 1E4EB 4E5MA 4WINA 5JDIC 1DIRA 2A8YA 3MWEB 3V7YA 3GP8A 1GQSA 4BNFA 4P92A 3NT5A 5AK0A 1V7ZA 3FJYA 1CVLA 4HADA 1VE3A 5JH7F 1PFKA 3TL3A 2GR9A 2YJ5A 4G5SA 4JB8A 5CB4B 3ICQB 2O52A 4ZO9A 2BEVB 5IWCA 4TQ9A 3T4PA 2P8JA 3GLFE 3AIIA 3K9WA 5I9BA 3EASA 1CQZA 3QWHA 2XWSA 3O4IA 3GRKA 3QMVA 4U9IS 4QOJA 2WK1A 1R12A 3MD9A 1ZD2P 2DF8A 2OV4A 3PT9A 4C4YA 1HSZA 1D5WA 1Y9JA 2FQYA 1T9CA 1UK7A 2QTGA 3UMMA 3C3EA 1YC2A 1ZD8A 2WOOA 2VHZA 4MI3A 1L7OA 1EK1A 1GGKA 3D2AA 2C8VA 2J87A 3FIUA 1HE1C 3NU1A 4TTVA 3RE1A 1Y5NA 2J31A 1PYGA 1XCOA 2PUVA 2YHIA 3B1JA 3ZCQA 2F3TA 4XRGA 4IVRA 5AJHA 1I6KA 2H52A 2R97A 1HTWA 1ND5A 3A6HA 3CZMA 1FP6A 4IHJB 4JROA 1NT4A 2FWNA 3OLZA 2QQ0A 4B6JA 2XUOA 4HAIA 3IPCA 1CJVC 1K7EB 3L7CA 2Q8PA 5EPOA 4A82A 4NAHA 4P6VF 1AF7A 3JQFC 3FPLA 3GA7A 4XAQA 2IBTA 1EA5A 4Z8XA 3FGPA 4PC7A 4EAQA 1ZCBA 1C8BA 3EIOA 1AKUA 1KO5A 1H8EA 4WJZA 2JHGA 4JWTA 5IT5A 4B40A 1J21A 2J3DA 2WNSA 2H6EA 1KAGA 4QARA 1YONA 3T3EA 2DTXA 5KOHB 1XRRA 2RAFA 4DSOA 2H1VA 4UASA 4MWDA 3RRYA 2Z9BA 2X0IA 4DIDA 4BXOB 1TZBA 3IUBA 4J0EA 2JLUA 5MGNA 4DLPA 2OBYA 5J4HA 2X77A 4GP6A 4B6GA 4CEIB 4B81A 3PUZA 1QK5A 1NFQA 4R1QA 1HQKA 3CB4A 1TCBA 4MJXA 4HD8A 4MIOA 4A0RA 3PVCA 2ISSD 1UXGA 5TR9A 5TMPA 5EKDA 3P5SA 2OOKA 3ACCA 5B7GA 4WXRA 4MQ4A 4V2IA 1D04A 4MGZR 4XASA 4D74A 1RRFA 1C9JA 1RQRA 1G6Q1 4TYYA 2WMNB 5LLTA 4GUDA 5LUAA 1I6MA 2JL1A 5J2TF 4CBVA 4Q3KA 4FNOA 4FZ5A 4IL5A 4YJ3F 3EXEA 3GP5A 1DO8A 1E8MA 2ZSJA 3AZPA 1ACLA 1P17A 1OWPA 3VH3A 2JIPA 4I4TA 2VCEA 2JJYA 2A9OA 1ZHFA 4G5HA 3H83A 5CK5A 2IX9A 1WW2A 2GK7A 3KPUA 3GHYA 2WWHA 3CR7A 5FWXB 1NSFA 3FYCA 1PTJC 4FK8A 1VIDA 3ESXA 2NO7A 4EM6A 1KAMA 3ZWVA 1ZR2A 1HDYA 4C4TA 3B7PA 4Q3OA 4ZHQB 3WDKA 3IIEA 2VNKA 3D0QA 3R3UA 4GZMA 3RYIA 1Y5LA 3K1AA 3STXA 3FZYA 4OY3A 3W6PA 4AULA 5FOQA 1F0PA 3MILA 3FMIA 5MN4A 4YXWA 2DEUA 1RYYA 1WF3A 1CERA 1F6DA 5BQXA 3A0UA 2AI1A 2AKAB 4JC4A 3KQQA 4KLRA 5EINA 5NULA 5SZIA 3U0VA 3WNDA 3RPEA 2WBLC 1XKXA 2EFGA 5I45A 3RVPA 5CX4A 4GR4A 1P45A 2QPAA 1KPHA 3K6RA 3AERA 3NAGA 1K3FA 2FXVA 4FN4A 2R68A 4YRRA 1CJMA 5FBLB 5M34A 2O2JA 4ZTBA 4LZZA 1K86A 2ZPUA 3EGEA 2ZVQX 2PL9A 4UU7A 3BRSA 3RVBA 4AWXA 3U9TA 4Z49A 4JX8A 5HDQA 1G8GA 5F2EA 1B16A 1MJHA 2UYHA 2P3QA 4N6GA 3U7GA 2XCIA 3U39A 1IQUA 1FRQA 4AMZA 4YGYA 4RQBA 2VBIA 3WRYA 4FFBB 3QV2A 1OQAA 3ZTTA 2QY6A 3QX8A 4Z9XA 1M34E 3CEJA 4IF6A 1ULTA 4GZ3A 1JU4A 4Q3LA 3X44A 4PCLA 4WDQA 2V8OA 3ZBTA 5BR8B 2ZATA 3OEHD 2BFCB 5C37A 2B35A 4U2KA 2W6JA 4Q82A 2FPOA 1EM6A 1HKHA 2W00A 3RV4A 4TYNA 2JJMA 4TZ0A 3QEKA 3LCCA 2JPDA 2XYRA 4FOSA 4FMDB 4RKFA 3K6SB 4NCBA 4NNJA 4TVOA 4M8NE 3OZWA 3N2LA 4WXMA 5HTOA 1IJEA 1BCSA 3WRXC 4MJLA 2JRLA 3IAFA 1P5HA 3OETA 2ZTVA 1DZ3A 4JU9A 1GAQA 3TLAA 4HL6A 3C1OA 4H3SA 1O2DA 3HR4A 4QUKA 4Z51A 2W2NA 3FPKA 2P68A 1VPVA 3V8BA 2O2IA 4RPGA 2YC4C 3GUZA 3FDZA 4HFNA 3SXUA 3EUEA 3TNDA 2ORED 2BE9A 4Q3NA 4DJAA 2VCYA 3HJBA 1A9TA 1KGDA 1JMVA 1QOPB 2P9YA 1BMTA 2PCLA 2GLUA 3NETA 3CSSA 3QXJA 4JNCA 4D6PA 5COQA 4F3RA 1DCFA 4HWGA 4U5QA 3V2HA 4C7OB 3QBTA 4FCTA 1M2HA 4KN9S 2GPAA 9LDTA 5CLQA 2DYKA 2R6FA 3ENNA 4QOEA 3RC9A 3W9UA 3ZDDA 3BGDA 2WMDA 2KLHA 1CFJA 4TTPA 3MUEA 1GLNA 4LF7B 2PKQP 4IRUB 3Q87B 1ZESA 2AN5A 1QQTA 2EEZA 3HKBB 3VKVA 5GGXA 1ZR4A 1ONPA 4TT3D 3SY8A 1HMPA 3SQOA 3LE8A 1EFPB 1KJ9A 3G8DA 4Y2HA 2TSYB 1F2VA 2AFHE 4D43A 3OKAA 4P5PA 1HLFA 4YCDA 2QKYA 4C3UA 2H4HA 2QP9X 4GOND 2IYUA 5F52A 4G85A 3W5JA 1I7DA 2W0SA 2HPAA 5JMTA 3SQNA 4MDYA 5MN6A 3ICOA 3W1VA 5EWMA 5D00A 4GYWA 3TLZA 3HXMA 2ZRBA 1CJCA 3PFNA 4A7PA 3QG1A 2EL7A 5K2MA 1OD6A 2QPOA 2D59A 3LPLA 2YUIA 4FT4A 3S40A 3HVIA 1RQGA 2CLMB 3DEZA 3OICA 3FETA 5M2QA 2I9KA 1OHHA 2I62A 3RU9A 4JEHA 2OD2A 1W1UA 3AETA 4X54A 4X5OA 5IJ0B 3FPGA 3GFVA 4AKEA 2Z2IA 5K0JA 1V2GA 2OC9A 1L4NA 3H13A 1BGXT 2IZ1A 2OSBA 2FPRA 4ARZB 2IV2X 2VHUA 1C9NA 1NIJA 1OLUB 1W4CA 3I0ZA 4OIFA 4KZKA 4DA6A 3ZHOA 2V6MA 1PQUA 4YMHA 5C2JB 1SU4A 2LW7A 3EFBA 3SYNA 4DQKA 4N3GA 3LT4A 1V5FA 5AW3A 1EYZA 1LH0A 5EWLA 5H5JA 2JLZA 1H2XA 2BPOA 4O33A 1M8FA 2X4DA 4D0GA 2FOLA 1DOZA 3WL6A 4ZK2A 5AFSA 2EJUA 4PHHA 1U2PA 3ICEA 1I3MA 1TX4B 1KYXA 4MS3A 4RQAA 1JR3A 2B83A 4LF6B 3BF7A 2NMVA 1M2KA 1OT5A 3NIWA 3GR6A 2PXCA 2D2VA 4ZHQA 5B4TA 1QFSA 3DNFA 5CH8A 3FFTA 3MHPA 3KE9A 5KHLB 1DKLA 1IG3A 4YUAA 3H4MA 4XVUA 4MA5A 4AUKA 1P8JA 4D92A 1BMQA 4PCUA 5A4KA 3A6GA 3DGFC 5CNIA 3I45A 3EYWA 4JXXA 1USIA 1U9IC 2Z57A 1TECE 1SC3A 3CLVA 5KNDD 5ADUS 3LA8A 3BWBA 2FMFA 3UEOA 3UTCA 1GPWB 3DV9A 3IAM6 4YXWD 3IDSA 1RXWA 3ZPXA 3RBVA 2VPXA 3NYIA 1THMA 1I94B 3PFFA 3WLJA 2PXXA 1Z6AA 4R2HA 2F6RA 3NW9A 2EZ4A 3O4JA 3UXHA 4G84A 1B1CA 2F3UA 3F7OA 4WGFA 1UDCA 2DBVO 4NULA 5FT9A 3A4IA 3K0EA 3IAM1 1DWPA 1RKUA 2CKMA 4PFKA 4BO4A 3DFFA 4OHZA 4MYUA 3VPHA 5C0OE 2W5UA 4I6JA 1BHSA 1N9KA 2FW6A 2F00A 2PUTA 2X2PA 3O4VA 4NU6A 2AFIB 4LC1A 4X8OA 1CVIA 2IIVA 2W2PA 4QREA 5PNTA 3SLKA 3OQOA 1NFFA 4IMIB 1I51A 4NPAA 2CMGA 3U31A 1G18A 2QAIA 3JRWA 4PHGA 4M3NA 2D00A 3A36A 1UBTS 1ZIOA 2WIFA 2OD9A 1YIDA 4UFNA 3EQ7A 5E2IA 3ADOA 4OK6A 4RFSA 2C88A 2VN8A 2GILA 5UKDA 4W5HA 2H9AA 3M5WA 1TCVA 4KGVA 3I04M 4MR7A 4Q3AA 4C14A 4C6HA 2QMQA 3NANA 3WY9A 3KC2A 1RD4A 2Z30A 4WY2A 4E5KA 3ZY3A 3ZE8A 3IJEB 1QXSA 2H11A 2IP2A 4D97A 2PV7A 4YRBA 4Y0AA 3UY4A 3OM9A 1XPOA 1YRAA 2QORA 4D4MA 3PNYA 1J2JA 1EXWA 4MUEA 4ALIA 2QLNA 1MHTA 2A1IA 3VZSA 1GQQA 4FJ2A 3OJOA 5BQPA 2WIBA 1NSYA 5B1IA 1WCYA 5FP0A 3MQFA 5J59A 3O75A 3AUAA 5ISMA 1V8ZA 5AW0A 3Q9LA 2PCJA 4MKZA 3RT7A 3SNHA 1X1TA 3FDIA 1L4HA 4RD6A 4G07A 3UENA 1DX6A 1M73E 3PHHA 4NCHA 3CISA 5LN1A 3IQXA 1EFRD 4KAJA 4A0FA 1UEIA 2QUAA 1YQWA 3W2EA 4Q1AA 1VG9B 4JCOA 1BTOA 3FFAA 3WWOA 4BKPA 4IIFA 2JZOA 4ZZ1A 1EFKA 1S2OA 1O4WA 1TUBB 4Y0NA 3PHLA 4KB5A 3D6TB 5K3OA 2E4ZA 1NMEA 1U1IA 1S01A 3BSSA 4U7PB 3D59A 4EF6A 4PZAA 1MJGM 3KALA 2I54A 1RXVA 4B6FA 4C5CA 4EA6A 1E4VA 1RHRA 5IPFA 1ZUNB 1CRPA 3FJOA 5A4MS 1FDOA 1YFZA 3N2IA 1I5RA 4O2AF 1OWLA 3C1UA 5CGZA 4LV5B 3R7BA 2O0JA 1BDHA 2WM3A 2RDMA 3AETB 5JATA 1TOAA 1KYZA 5AW5A 1EP2B 3T12A 3N0VA 1F8GA 1LFDB 1DVRA 1ID8A 2P0EA 1G20E 2Q07A 1VL1A 3B3JA 3RUDA 4MIEA 2ACEA 1E2LA 2QLMA 1E1CA 4CTMA 1RS0A 1W0KA 4EENA 4W5NA 2EZ8A 2P2CA 1R0BA 3FB1A 3C5HA 3UOAB 2O7NA 4ZOCA 2WG2A 1V6SA 2R8PA 1P74A 3QX7A 4FYIA 5LWQA 5JTTA 1MFPA 4OXXA 1QTNA 1AKTA 1BHJA 4LJ7A 1FMFA 3CVUA 1V7QA 1GFZA 2RGBA 3H2GA 5E7QA 4OLHA 4Q0MA 4YCBA 1D2GA 4MLDA 1UC4B 3K72B 2FPIA 3RRNA 1N77A 2AFIE 1TK9A 1HC7A 1D2NA 3L9XA 2BLNA 3KLPX 4F5ZA 2AR9A 5FPSA 3VX4A 3T7IA 2VC2B 3O1IC 3AEUA 3BK7A 5B1EA 3RTDA 2N9UA 1E1LA 4QGAA 3C5WP 2XYQA 2J33A 1E9DA 1OKKA 3TS1A 1IZ8A 4LGMA 2BF4A 3NRCA 3ZJ5A 1ZM9A 3K1JA 1JKIA 3L04A 4G3XA 1GPBA 1ADCA 4I1YA 1M1YA 1ZJ6A 2PD6A 2DWUA 4QODA 3PFHA 5JC8A 2JVIA 5DF1A 2HDHA 4ND6A 3H3JA 2WY2D 1O1YA 2EEPA 2YWXA 1SXQA 5HX7A 4DMHA 3ITEA 2H7YA 3HN7A 3I61A 3ABRB 4CDNA 4G5GA 5KTOA 3CNLA 3HCRA 4OB7A 2FQWA 2NQ2C 2CE2X 1MNQA 3ESZA 3OIDA 1H05A 3I6ZA 2OECA 4CI9A 4L9WA 4PNEA 4AZ0A 3BMQA 3MBKA 3TZKA 1K75A 4JH0A 3VH1A 4ZREA 5F77A 3UMJA 1IM2A 1P9RA 2A3RA 2B6NA 3BD9A 4NF2A 2BONA 1E61A 1DAPA 4MMXB 1KXJA 5KYTA 1V4BA 3IBTA 1NJSA 4I4TF 5ITZA 5GIOE 1TF2A 3JTEA 4XA8A 3HZZA 4U5XA 3NOQA 1RTTA 4K86A 2AMJA 1T5BA 1JAXA 3GFTA 4U2FA 2R6HA 2OK7A 3U7HB 2DFNA 4YQZA 5A7HA 1TM1E 3ZWNA 2PPLA 5AKIA 3KQLA 1JAZA 4QA9A 4MJ7A 5FTJA 3BEOA 3SQMA 2OUKA 3W5SA 3VM6A 5IBCA 4DBVO 5TF0A 2OK8A 1T0PA 1UBCA 1GNQA 3BZUA 3A6JA 2BKUA 2K6GA 3EBPA 5GJCA 1C2TA 2A0YA 4MGHA 4RSGA 2UXBB 3GLGA 5EKUA 1C0IA 1XCLA 1AUPA 2YS7A 3C5EA 4HDCA 4G56A 4Z7NB 3DPUA 1Z2PX 3QKRB 1P1BA 4QULA 1SUIA 4DR2B 1R0WA 3U3MA 4X64B 1V3QE 2OSVA 3CV3A 4MV8A 3OQJA 3TD6A 1KS9A 1G2QA 2A9KA 1RAHA 5BSKA 5KWSA 1H5NA 3RUFA 1UKBA 4L6CA 4B3MB 2PUJA 3PD0A 2CMHA 1TEXA 2WSLA 5TEWA 3CTPA 2ACWA 5JSZA 1Y1QA 4LHSA 1DIAA 2FZ5A 5B2EA 4O5OA 4F1WA 8LDHA 2JATA 4JLMA 5CA1B 4YR9A 5KX5F 5JAHA 4AYXA 1ZRHA 4QTYA 2VT6A 1Q91A 4NBSA 1R64A 4X84A 4BDTA 4LOJA 3CGGA 2SKCA 3FHLA 3LECA 3THYA 5EQDA 1A9OA 1DRWA 1BVYF 4NE7A 1E3MA 1CU1A 4DCCA 2XUZA 1SB8A 3M6WA 5HF5A 5TPWA 4CF6A 2ZSKA 3WISA 3O90A 4TYPA 1GPYA 1TM7E 3B36A 1KJIA 4EY6A 1WM1A 2PUHA 2CDBA 3IDQA 3V4PB 5HK9A 3N53A 2Z4RA 5JR3A 1GOTA 1ESMA 1SCKA 1NVMB 3HQ4O 2CL6X 3T38A 5LBTA 5BMVB 1N78A 4JN6B 3UV7A 3MB8A 1AV7A 2PS1A 3AVOA 3P19A 4CNQA 4MCAA 1GKUB 3VSDA 1I0ZA 3P9RA 4R1TA 5IAEA 1E5LA 4BP3A 4U9UA 2O2XA 5G40A 1A5BB 1D6NA 3GAAA 4FILA 2M1XA 2DMRA 3G89A 2N0SA 4Y3UA 3QVLA 1ECBA 3Q7TA 2J5KA 4GP7A 1VXRA 4C08A 1TTTA 5KYGA 2V7PA 3EFOB 3RIEA 3SSNA 5JIBA 3HUEA 4YUXA 1P0FA 1E2HA 1FMJA 4NFLA 4H0NA 4OVKA 4W5JA 2NZ2A 4H4CA 1I24A 4MMZB 2HQOA 2ASVA 4RC9A 4CM8B 4CETA 2IP1A 1BU8A 2XYHA 3Q6MA 1S2DA 3Q8XB 5ETJA 3OT5A 3ZDQA 1XAIA 2IYZA 1WCXA 1A96A 1V11B 2W2LA 2WDPA 5EPEA 1NKVA 3JVEA 3T6KA 3K9NA 3W1EA 2I4OA 3LPCA 3C0KA 2FKAA 1APBA 4RS4A 1X1QA 2DUMA 4MGIR 1CSEE 2FPIB 3NNSA 1L1FA 3W2HA 2IH4A 5EVJA 1H4VB 1P4HA 3ETHA 4BJ3A 7REQB 4RHTA 2V1UA 1JJIA 1HR0B 1VL6A 1JP7A 5DTMA 1FSSA 1QVZA 2WG1A 2YOHA 4OUDB 4AW9A 2VXBA 3T1VA 5LMNB 3VU1A 1JA9A 2X2FA 2ZBQA 2JLWA 3TL6A 3COZA 3BCSA 4FSHA 2DY1A 2XNDD 3NAMA 1SUDA 3VPDA 1M76A 3L93A 5IDVA 2PMWB 3RHZA 2WOJA 3SF0A 2BGUA 3STVA 2XQIA 5HS6A 3V4RA 2XAAA 2ZWPA 3UPUA 3U9LA 4WAUA 5BN5A 1X13A 4WX2B 1MJNA 3QKSA 3AHCA 1PGJA 4QL3A 4U7HA 1AKRA 1EWTA 1L5KA 5KNCD 5LPNA 4IXNA 2GH1A 3CH6A 4ZEWA 1HFJA 1HZJA 1YJBA 2VHVA 4L3VA 2CNKA 1BGVA 4C1NA 3E82A 4LTNA 1J8YF 1P3Y1 3C4QA 3KKLA 4GVPA 3L40A 1COWD 1HH4A 2YV5A 3B12A 5BNIA 4Y2GA 1L8XA 4V24A 4KL8S 2NU9A 4TVKA 4A8JC 2HMAA 3G2LA 5B5SA 1KQFA 2PX3A 4ZV7A 4WUVA 1O6FA 3ETJA 2ZYUX 2GFHA 4B46A 3P9QA 1O96A 1KNQA 3KVNA 3L6BA 4HQFA 1PNRA 4HWOA 3TEJA 4AKGA 3H6HA 5FEMA 3MEQA 3IXQA 4C4ZA 1W6RA 2AXEA 2PWZA 3GJRA 4I7EA 5DZSA 3SE7A 3F3KA 2NV0A 4XB6B 3BKWA 1O6GA 4UUMA 4K6MA 4DQUA 1T2EA 3WNCA 3OLXA 1T25A 1A97A 2XXBA 4PQGA 4ZO7A 2WV9A 2BGRA 3IB3A 3LUKA 3M2PA 3Q3JB 3UK1A 4B47A 4RULA 3G2QA 1E0DA 3WOHA 3ZCRA 3W04A 4YROA 1Q19A 5CEEA 4MI6A 2NO1A 4BO9A 4EHDA 4LFBB 3EGWA 2DPYA 3DB2A 1BXKA 1K88A 1U1GA 4KYTA 5DXAA 4MP8A 3I2HA 2R6CA 1CNEA 2AOUB 2RI1A 1KYWA 2NYRA 3NUQA 1GFSA 2NQTA 2C7GA 3M6IA 3AJ8A 1WKVA 3PI6A 3ZH2A 3UA4A 4BNZA 3GJXC 2FH5B 4FGLA 3IJ5A 4UUBA 5KSYA 1F0NA 1JKFA 1NR5A 2OLEA 3KUUA 2AR7A 1R27A 3OE7D 4GE0A 4KXFB 3PQ3A 2J7PA 2VNSA 2GVZC 1Z16A 4OUDA 1U31A 1SHKA 3JQCA 4S12A 4WOCA 1E1QA 1PRYA 3F49S 2QD1A 4JC5A 4DV2B 2J9YB 4E4RA 3AESB 5CFQA 1ECCA 1QAMA 4EGQA 1ZK3A 2XI4A 2HSEA 3W6UA 4HXYA 3CIOA 7YASA 2YQZA 3WLHA 4EGJA 4AQDA 4DMKA 4DMMA 1PR2A 4CKZA 5T5QA 2JLCA 4L8FA 1XTPA 4TKUA 4AJIA 4JT9A 5JZOA 2G5PA 4D8UA 3B60A 1XHFA 1E1DA 3FLBA 3O26A 4L50A 4XD2A 1XEXA 2Z95A 3ORSA 5EIFA 3E6AA 1QTQA 3RYTC 4X1OA 3UB2A 1FPQA 2CUKA 2X0EA 4FYYA 4BIIA 2PL5A 4H1VA 2OTCA 3M89A 2VPQA 4GO1A 2O8BA 1EBBA 1ONNA 1VKZA 2PSSA 1RYHA 1U8EA 3NI2A 1NYQA 2NT3A 2WZBA 1FFEA 4BKRA 3MTEA 2QN8A 4W1SA 3T1YB 5JAMA 3R5TA 3LBHA 4HRYA 5KTKA 2C1EA 1QGUA 3PNSA 4G5YA 3W3AA 1OREA 4D7AA 2BR4A 1E89A 1ZYUA 2HXYA 1WU7A 1IONA 2PMDA 2RHMA 5EJ7A 4J29A 3RK4A 1KDOA 3VVBA 3A1FA 3CT4A 4LHZA 4ZAXA 4UOEA 4YYZA 2YIDA 4P98A 4CEJA 2QXYA 4FMCB 4EVQA 1TEVA 2Y8EA 2FUKA 5DGXA 2FWRA 4IOKA 4WFIA 2FWIA 1G7CA 1SZPA 2IJGX 2ZSHA 4NEHB 3FLEA 3ROEA 2CL5A 5CK4A 3C8ZA 3N2EA 1OZGA 2WKQA 4R9UC 3RH0A 3Q0IA 4BYGA 2A5JA 3DO8A 3G0GA 4Q9HA 5KQSA 2CYAA 3SIPA 4HNUA 3A1WA 1EGMB 2P6PA 1WB4A 5A3SA 3U17A 3QEAZ 3FR7A 1W5SA 1XZDA 5B58C 3G0HA 4X63A 5D3KA 3LCVB 3Q7IA 3B6JA 4M1KA 4DBLE 5BSGA 3INNA 3UB4A 1ADFA 4H6WA 3VNUA 2QVBA 3GLFA 3TDMA 3WXBA 1FP1D 1TC1A 2DWPA 2WUFA 3LCMA 2DFTA 4KXLA 3WGMA 3WGLA 5IN4A 1D0IA 2JIRA 3ZDBA 4M7PA 2GZSA 4IIGA 4H6PA 5J40A 1VCNA 1USGA 1JGTA 2GPWA 4OQ4A 4QOGA 3ROTA 3SS7X 1XRNA 4L15A 3RYHB 4KITB 2FW8A 1E2NA 5D3MB 1L5GB 3EEOA 2CV1A 2CZCA 3GVIA 3H65A 1ILEA 2QRZA 3DNPA 2XRFA 3UATA 1E2JA 1LZLA 4DR3B 2OZEA 1C2YA 4GD3Q 3DULA 2XMZA 5D5PA 2Q29A 1BCSB 3KSDO 4RJJA 3QELA 2RMKA 3KJIA 2UVDA 1ENOA 1JU9A 2OENG 3M6UA 2YDXA 1EVKA 1S1MA 4LMRA 5KJEA 2IHJA 5E2AA 2HPZA 1XRLA 2VUUA 1XAJA 2COEA 3NOXA 3RK0A 2YJ6A 2C9ZA 3UJCA 3H1EA 4ZIRA 2EV9A 1KI6A 3VRHA 5SYMA 2P9QA 1BWPA 4LN1A 3OMLA 5DBEX 3TG8A 3NJ8A 5I7RA 4QUBA 4FT2A 1WHSB 2VUHB 2SECE 5AI8A 4ZYZA 3TFOA 4K81B 2GWRA 1GSIA 1ZNXA 4X8MA 4EUEA 2WF8A 2Q6KA 3DL0A 4L9AA 4YMIA 5AHXA 4B3IA 5JYEA 3F6RA 1H1TA 2O5EA 4HYQA 1CPYA 3T0GA 1LPOA 4R9RA 2AKEA 3GCGA 1PUJA 2PGAA 2PX2A 1UZAA 3FX2A 2GBLC 1VG0B 1L4MA 3GW8A 3PQ6A 4JUFA 4I9NA 5DOVA 1PT6A 3K6KA 2HMTA 3O4HA 2H4JA 2B78A 5BW8A 5FA5A 5KKCA 1MRSA 2X86A 5E8JA 7ADHA 1LS1A 5COAA 5JZBA 1QJ4A 4R3WA 1K4MA 3NYRA 3MT8A 5FTKA 3ISTA 4PN7A 2JLSA 2R3SA 4GW3A 1GDDA 3E27A 5BWNA 3CEHA 3D8RA 4UTNA 2B2CA 1Y7IA 1EVYA 1KTIA 1ZUHA 3BWYA 2HM7A 3BXZA 1CJKC 2Z4TA 4ZXFA 1LZKA 2OGTA 2ZSAA 3F9RA 2WSSA 3R7WB 5I7OA 2UUOA 3O0TA 4EJSC 1FEZA 3HYLA 3AIMA 3J81k 2V3CC 3NS7A 5M7EA 1FDSA 2WVAA 2GEVA 3IGFA 3PFKA 3GVHA 4M0UA 4MIKA 3HJUA 2OXIA 2J3HA 3TKAA 1SVIA 2PNFA 3GNQA 4EB0A 1RQPA 2J48A 4UQLA 2OHJA 4P0PB 4B3GA 2Q99A 5DHSA 2VDKB 5LU8A 4XCXA 4E94A 3GEHA 1EZ1A 1WZNA 3AESA 3WMFA 3H5WA 5CAEA 1QIKA 5H02A 2PD4A 2A0WA 2FU5C 1K7CA 2I2CA 3EVGA 1K8ZB 2QL5A 3RREA 1JDNA 3RS7A 1W93A 2Q5QA 1RLJA 1QVRA 4KQMA 3P2IA 5FBWB 4DR4B 1OWOA 2JJ1D 1YVEI 2H92A 3D31A 1GVNB 2O7RA 1IXKA 2OWDA 2YWFA 2GZMA 4EKGA 3QYPA 4DR1B 2VR1A 3FM9A 4BRWA 1UAGA 1RC0A 1JDPA 2GF0A 1DRVA 3OU7A 2FW7A 4GOMD 3RB8A 4YO7A 4WK2B 4DF3A 5J47A 1XXLA 2WVJA 1MVNA 1NE2A 3R40A 3QVKA 2H00A 3FA2A 1WY5A 4EZIA 1KYYA 3RJTA 1YQEA 1WU8A 1E7RA 4AG6A 1MB3A 3AXSA 3HNRA 1YXMA 3RD5A 2G1UA 4I2VA 3E5HA 1M1YE 1JEQB 4P7GA 4ZOBA 2VSYA 4F9EA 3HKEB 3LI2A 4DCTA 1ESEA 4Y67A 4IIXA 4B85A 5KWVA 2JIZA 4F91B 5BNTA 2O14A 5AIAA 4MV3A 1UK9A 1E7SA 3DM9B 5BSUA 1IPFA 5IN5A 2AQKA 3T1QA 5BORA 1S2GA 2HLNA 3BCRA 4TMWA 2C7QA 5GZ6A 4HAZA 3L8GA 2B7BA 2HWWA 1HEYA 1ZMBA 5JAPA 1GCAA 1QNLA 4ZQGA 4FYHA 2X4IA 2VJMB 2FEMA 4LY3A 2M6LA 3VR1A 4F9TA 5KOJB 1ZMTA 1WZEA 4PSKA 3K5PA 4KU4A 3VI3B 1QM5A 2P9EA 3H4TA 5TGDA 4CE6A 2XNHA 1UMBB 2UZ3A 1IRXA 1LBQA 1ZFNA 3BA1A 4DUGD 1ZM7A 3LKVA 5JD6A 2PGJA 2CJFA 1C0KA 2HK7A 2O4CA 4FZRA 1SRQA 2YWHA 3FCXA 5HXAA 1X86B 3HYCA 2C5FA 4KQXA 1KOGA 3VSAA 4E5DA 2XMQA 3O8RA 2HJVA 5GJVC 3MPUA 4BMYA 4JQZA 3EIEA 3ENWA 1R9MA 2VHQA 2WF6A 5A62A 5C1DA 3V48A 1E0KA 2DFKB 1IVYA 3U49A 2P4QA 4C3OB 3HCNA 5G4LA 3TIFA 1K2WA 3KJZA 2JDID 4JX9A 1ZUNA 3LUFA 4MKGA 2R00A 3CVYA 4HDMB 3B38A 4EBBA 1Z4JA 4C20A 3HXQA 3NONA 4MR8A 1DC3A 1XDWA 2O9JA 2V7XA 2AVDA 4B7ZA 4YY3B 5SY6A 2ZP1A 2HQ1A 1LGYA 5CLLA 4FGKA 1OF1A 1VLVA 2PRKA 3QYFA 4GC5A 4BGEA 1C3VA 4M1SA 3GQBA 1T13A 2CBZA 3BUSA 4PZEA 4TYWA 4ZRNA 4Z1MA 4IQ8A 3H2JA 5LBUA 1JFFB 2GYUA 3NVAA 1V35A 3QP9A 4Q93A 5DSZA 5P21A 4AF7A 5A4AA 3AEKB 3F4BA 1ONBA 1SAYA 3BZWA 3O3OB 2JI8A 1VKOA 1PS9A 2W2MA 3EVEA 4CIWA 5ADVA 2FRDA 4P4SA 4H31A 1JEQA 3DP9A 4ZOEA 5ARCA 3D7MA 1DKPA 3T9BA 4XW2A 1WNTA 2IELA 2IHVA 1IG0A 2Q5OA 4GM1A 4B84A 1ULZA 1HXHA 4MDEA 2YXPX 4BNXA 2ST1A 1RM5A 1V45E 2L19A 3BMOA 2GN1A 5FYDA 2UZ4A 5IFKA 3CLSC 3CWQA 4I1VA 4AJOA 1KKUA 5ECGC 3UWMA 3G5LA 1GNTA 3T7AA 2DGDA 1BJKA 1V26A 2NU7A 5CLHA 3RG8A 4DQ0A 1ZGAA 5KX5B 1KO1A 1WB6A 4BNDB 2VQFB 2A67A 2JVJA 4R2KA 1PSZA 5DHPA 4HVLA 3HO6A 3IDAA 4JUIA 4OBXA 5KYNA 4U2GA 5K0NA 2P9TA 2ICAA 3Q6IA 2BEWA 4KGXA 3X2EA 3PZRA 1YA6A 3IELA 1X8JA 3LUHA 3TXXA 2IVZA 2JGAA 1Y4AE 3L7MA 3R0ZA 3CM0A 3WE7A 4E08A 1R3DA 3BAFA 4OK5A 4LXUA 5K6AA 1ZUD1 4RA6A 2OGSA 1JEOA 3ICPA 2A4MA 3PUIA 5G41A 1EEHA 4LBYA 4NCNA 3HEMA 4JUAA 3SR0A 3SVZA 2PL1A 3O3CA 4EG0A 1DTWA 4P58A 1BH6A 4HQOA 3OZGA 4NG4A 3AR7A 5JEEA 2H2GA 3SXUB 3S81A 1EWKA 3SPXA 3DEAA 2OVFA 5BSMA 4OSEA 3SQXA