3OIFA

Crystal structure of enoyl-acp reductases i (fabi) from b. subtilis (complex with nad and tcl)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
258
structure length
258
Chain Sequence
b'MNFSLEGRNIVVMGVANKRSIAWGIARSLHEAGARLIFTYAGERLEKSVHELAGTLDRNDSIILPCDVTNDAEIETCFASIKEQVGVIHGIAHCIAFANKEELVGEYLNTNRDGFLLAHNISSYSLTAVVKAARPMMTEGGSIVTLTYLGGELVMPNYNVMGVAKASLDASVKYLAADLGKENIRVNSISAGPIRTLSAKGISDFNSILKDIEERAPLRRTTTPEEVGDTAAFLFSDMSRGITGENLHVDSGFHITAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Crystal Structures of Enoyl-ACP Reductases I (FabI) and III (FabL) from B. subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 89
structure length 258
sequence length 258
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2010-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3oifA00
2HMVA 1JDJA 3TL3A 4BMNA 1MLDA 2VZ0A 3ANNA 3B1KA 2YHUA 2W98A 5JE8A 1NYTA 2C07A 3DC2A 1DJQA 1KEVA 5AYVA 4EBFA 3SEFA 4CV1A 3CZRA 4IPTA 1W73A 3O38A 5CDSA 3GHHA 3HDYA 1X1TA 4FFPA 4UVIA 4JIGA 2J3JA 4CUKA 4KP7A 1GAEO 3O4RA 1HYHA 2PD3A 2OUIA 3ZHXA 4GI2A 2Q99A 4BNJA 1ZCJA 2X5JO 3KLMX 4WLFA 4MJLA 2NSDA 1TT7A 1I3MA 2J5KA 1N7GA 4F6LA 3RFXA 4RVUA 1JN0A 1C1XB 3WIEA 1YJ8A 4GLOA 4RF2A 1X13A 3E9QA 2VOJA 3LT4A 3OJLA 1B16A 2NLOA 4PLZA 3I4FA 5IN4A 2VWHA 4MIOA 4PVCA 2HMWA 2X5OA 4RVHA 3WJAA 4CMAA 5IZCC 3U49A 5L4SA 1RM3A 2C20A 3AU8A 1OZAA 3GGOA 4O59O 5AVOA 5B4UA 1N1GA 1NR7A 3SVTA 4EEZA 4R69A 1M2WA 1YE3A 5BQFA 3QW2A 4E0BA 1HDCA 2D3TA 1DLJA 1Z6ZA 2B37A 1RJWA 1LTHR 4GVXA 1WAMA 4CQLA 4PG6A 1LQUA 4NJMB 2YY7A 4CV0A 3I23A 3WB9A 1DRUA 4EUHA 2OO5A 1A4UA 1GV1A 1HZZA 1FDTA 1GEGA 1NP3A 3RQSA 1XSEA 2PD4A 2AQIA 2Y1FA 2DAPA 3I9NA 4N5MA 3I6QA 5EERA 2VYVD 2YUTA 3GGPA 4R1UA 5CDUA 4WK6A 5TX7A 3DZFA 3WBBA 1EUCA 2ZB7A 2YDYA 3FTPA 1F12A 1GQQA 1D7OA 2TMDA 3AFMA 5C5IA 4R3WA 4CODB 3VH4A 3AUSA 1Q1NA 2UUOA 3IAHA 2BD0A 3C7DB 3DOOA 4HFMA 1PJSA 4J4TA 1SPXA 2P91A 1I32A 3F4BA 4GSLA 1HT0A 3U4CA 1T4BA 2ZK7A 4CM4A 4GX0A 5H82A 4J1SA 5JCXA 1XQ1A 3UXYA 4ALKA 4BQRA 4HV4A 1I3KA 3KXDA 2ZTUA 2Q1TA 4GKBA 5JPIA 2PK3A 3NUGA 5I7SA 1OAAA 4QO7A 1EVYA 5DCYA 4MP8A 4AL4A 3GK3A 1O9BA 2PGJA 3DMTC 3DBLA 1ZW1A 5HWSA 1DIBA 1H6BA 2IEDA 4L4RA 4DC0A 2R00A 2EKLA 5BNFA 1E0DA 1J4AA 3CMMA 5I7FA 3PQDA 2AEMA 1H6AA 1ZUD1 5CDYA 4OQYA 3PGXA 2NM0A 1SCUA 3AUTA 3LZ6A 3GEMA 5JCJD 3DBVO 3DOJA 4Q3NA 4BNMA 4EJ6A 3E9MA 5GMOA 3PQEA 3K6JA 4K9DA 2NU9A 1LXCA 3KSZO 3JQCA 4YCAA 5JAQA 3WLFA 4RV9A 1LDMA 1VC2A 2B0JA 4UVHA 4XRGA 3HSKA 3ZWWA 3BTVA 1UP6A 1X7GA 3HUDA 1DHRA 4XYEA 3EYWA 1EVIA 1G6KA 2GF2A 4HP8A 1PS8A 2HJRA 1R6DA 1PJLA 3NT4A 2ZQZA 1NHGA 2H63A 3AWDA 2GN9A 4UUPA 4BOYA 4M86A 5ADHA 4PLGA 4W7HA 3D1LA 4PFJA 3WR5A 1FF9A 5IZCA 1KS9A 1U5CA 5A06A 1BDMA 4L4XA 3JQ8B 1ULUA 4L9RA 4BUCA 1TB4A 4YJGB 4YAJA 4NJOA 4HWKA 1UUFA 2NU8A 1CEQA 7MDHA 3DBRA 3WGYA 2PTGA 3PIIA 1VSVA 5G4KA 3RBXA 1VPDA 1GQ2A 3GZ4A 3KRTA 3VPSA 2P9CA 2J5QA 1DDOA 3E18A 1B3RA 1VLLA 4C7JA 2E48A 1YL5A 3OJEA 4E13A 4W99A 2EERA 1P9LA 1ADBA 2X0RA 4WGGA 4Y6PA 3Q1LA 2ZKLA 5JC1A 1YJQA 1MC5A 5JSFA 4CLRB 3D4OA 1LEHA 3FWZA 4YR9A 2YQ5A 3ON5A 2DUUA 2FZWA 4B79A 2Y1DA 3P2OA 3BTUA 2X0NA 4XYMA 4Y8VA 3ONFA 3UOGA 3KHUA 1Z73A 1JKJA 2HUNA 1EFLA 1GCUA 1O89A 4QQRA 4B8ZA 3FR8A 3L07A 3N58A 2X58A 4XGNA 3I6IA 3QY9A 4J1TA 4CM1A 3JQ6A 3IKTA 4DBVO 4KQWA 5A03A 2C0CA 2UDPA 1ZXBA 2YV1A 4ZA2A 6ADHA 5THQA 1RM0A 1TA4A 4KUGA 4J43A 2PD6A 1RM5A 2ZCUA 3QWAA 2C7VA 4E6PA 3ZHZA 1T1RA 1IYZA 1U8XX 4FC7A 3F3SA 1ENOA 3HADA 4UREA 1KBZA 4P4LA 3RUAA 3FPCA 4AJJA 4AJPA 2W2LD 4YVFA 2O3SA 1X0XA 3HG7A 4HKTA 3JQ7B 4GX2A 5IXYA 3BHMA 1QYWA 2CFCA 4U7WA 1TT5B 2Q3EA 1LDNA 3GNSA 1DB3A 4F6CA 1GADO 3T4XA 4Q3EA 1O94A 3RUCA 3BTOA 3Q2IA 1K5HA 3SLKA 4PCVA 5CEFA 4OH1A 5L7WA 3FNHA 1A7AA 2NTVA 4BO0A 3GAFA 1Y8RB 4FC6A 1QR6A 2O3TA 3MOIA 3LVFO 1E92A 5TT1A 1WPQA 3VPGA 3DFZA 5ENVA 1TI7A 5DBIA 4CM8A 1I5RA 1UDBA 2G0TA 4JQCA 1XGKA 4LMPA 5U9CA 2HK9A 3OQBA 1M76A 4CUJA 4QFCA 5MGBA 3QVSA 5IDYA 2BFOA 2CSUA 4H3VA 2NNLD 2BLLA 1NQAO 3ROPA 4DQUA 5JYEA 1P1IA 4H16A 1WMBA 3RAJA 3N74A 2FPIA 4WPGA 3A4VA 3OIFA 5CDTA 2O3QA 1LA2A 1EMDA 1H5QA 3A1NA 2YV3A 3ZWNA 5A04A 1PJ2A 3N7UA 5A9RA 5EJ2A 1LC0A 1YOVA 2AE1A 4FJ2A 1V6AA 4E2ZA 3GNQA 2C59A 2I76A 2DC1A 2XXBA 3S2IA 4YT5A 5CAEA 3DOCA 3JQAD 5KWEA 2EW2A 3WS7A 3INGA 4IQ0A 1P1RA 2Y0DA 3RJ9A 3CSDA 3DZKA 3WGTA 5JDIC 3E03A 4RPJA 1C0KA 3BMOB 1XG5A 2PZJA 2HMTA 4Z3DA 3K8ZA 1DIGA 1U3UA 3QWBA 4CLOB 3LQFA 2J3IA 5HM8A 4DPLA 5DULA 1B14A 4HX5A 3RUEA 3OICA 1H9AA 2C5EA 1E1KA 3TZKA 3ONDA 1I36A 3DZIA 1SBYA 3KYDB 1SAYA 1LLCA 1IE3A 4J3FA 1P74A 1EUZA 4BIIA 2O48X 1K2WA 2JD0A 3ROKA 1FDVA 1WZIA 2YHIA 4HFNA 3ROQA 4R16A 3TN7A 1XKQA 3ASVA 3D3EA 5L7TA 1SMKA 4UEKA 1HLPA 3C8MA 3SC4A 4MP3A 2UYYA 4LN1A 3VH2A 1LJ8A 2AEFA 1ORRA 3I83A 1EFKA 1P3DA 4PZEA 1NFFA 1T25A 1DFGA 3W1VA 3ONEA 5G0WA 3L4BA 3JV7A 3QWHA 3V1YA 3AY3A 4FB5A 3RFTA 1AUPA 4BNVA 1KYQA 3D3WA 5G4LA 3NV9A 5JNLA 2QHXA 3GRPA 1ADCA 4FGSA 1GCOA 3H9UA 4NR0A 3PJFA 4GWGA 4J90A 1L1FA 4WCFA 4YRBA 5ICMA 5KVSA 1VKNA 2P5YA 4XIYA 2QQ5A 3VVCA 5B12A 1DO8A 4MP6A 4YDRA 3ZNOA 3QA9A 4WOJA 2NVUB 3A9WA 3UGKA 4YRAA 4OGWA 2CZCA 4YACA 4EITA 3Q9NA 3R3SA 3NYWA 1DIRA 2PGLA 4N5NA 3RD5A 2O4UX 2PV7A 3R6DA 3LDHA 4NU5A 1Z82A 2HJSA 3VH3A 1NWCA 2VZ9A 5C7IO 3CXRA 2P68A 3PHJA 3EDMA 3EUWA 1EBUA 3W4KA 3WGHA 5AXAA 3ADPA 3PYXA 5G2OA 3GR6A 5JDCC 1U3TA 1A4IA 3AI1A 3PLNA 1HDGO 1KIFA 1HE3A 3OIGA 4E12A 4GWKA 4DYDA 1ISHA 2ZCVA 4ND2A 1F06A 1PJQA 5THKA 3K31A 4MPDA 3RBVA 4QSMA 3WYEA 4LW8A 1QYDA 2JAPA 1YONA 3BMCB 5JY1A 3VVBA 4RJTA 3AM5A 1BXKA 1YRLA 3OQ1A 1SEPA 3BYZA 3PHGA 3DONA 1E3WA 4CM7A 4ZGWA 9LDBA 2OL4A 3WQSB 2O50A 3G1UA 1Y5MA 2VHVA 3IUPA 2VHWA 1UXJA 2V65A 3UF0A 1EDZA 4G5HA 1ZNQO 4J2OA 4HXYA 5JCJA 3FD8A 2VHZA 1B3BA 4JROA 4RVDA 3CEAA 5L51A 1MG5A 1JVSA 3OIDA 2IEBA 4NBWA 4OSOA 4EEXA 4UUOA 1PGPA 2Q4EA 4PZDA 3SXPA 1Z74A 1HDYA 3MTJA 3B6ZA 3H3JA 4OKNA 4BNHA 1MXHA 3EGOA 1PEDA 4L8VA 5JDIA 1JU9A 3H9EO 4OJNA 4UEJA 5A9SB 2QRKA 3JD0A 1PX0A 1ZKMA 3QP9A 1L7DA 3PJDA 2FY8A 1KETA 2GASA 4KTTE 3MZ0A 3RJ5A 3SX2A 2VTDA 3IL2A 2Z1NA 3IDSA 2EEZA 2PLAA 2ILTA 2ZTLA 2FSVA 1E3JA 5L9AA 4M8SA 3M2TA 1PWZA 3DHEA 1I24A 1O0SA 2O7SA 2WD7B 5K0ZA 2DPGA 3TRIA 1I3NA 3JYNA 4QFDA 1Z45A 3UCXA 4MVJI 1BW9B 4ZU3A 3GDGA 4IS3A 1GZ6A 1PZEA 4S3MA 3ZW8A 1ARZA 1I8TA 1Q2XA 4KZPA 2PH3A 3ENNA 1FMCA 3BHJA 2Y1OA 1ENZA 1QP8A 4KWHA 4BNLA 4XA8A 3ANMA 2O3JA 4DQVA 3G49A 4UULA 5TT0A 1PIWA 3AI2A 2B5VA 3WQRA 4RORA 1Z7BA 5KJ1A 4EJ0A 2HRBA 1LDBA 1YS4A 4QXMA 4AJHA 2BGKA 3WG9A 3BAZA 3OEYA 3ZWPA 2I6TA 5ITVA 2I3GA 3GN1A 2WYVA 1E7QA 1ZJYA 2C29D 2GGSA 4IMRA 4EJMA 2VNAA 3LC7O 4M54A 3HQ4O 3DHNA 2JFHA 5I7EA 3KEOA 4PRKA 2DBQA 2BI8A 3F4LA 4ZQHA 1ULSA 3DO5A 4XQEA 2GN6A 1JWBB 4B4VA 3CKYA 1PTJA 1LUAA 3GDFA 5BSEA 1ENPA 4CV2A 1BG6A 3OSUA 3R1IA 3NGLA 4Y67A 4K26A 3L77A 1XWFA 4F46A 2EP7A 2HRZA 2Y99A 4B3JA 1F8FA 4CMEA 1O5IA 1AGNA 3L4SO 3PPIA 4C7KA 2J8ZA 3TPCA 4RQTA 3O8QA 1JLLA 1N8KA 4CLEA 4RZIA 3QIVA 3SJ7A 4O63O 3C7CB 2X6TA 5G0UA 5HA5A 1K0UA 3U4IA 4Z0HO 3EW7A 5COQA 3VOSA 1QG6A 3WGIA 3GEGA 4I9UA 3H3FA 3UN1A 2GUGA 5AXCA 1C0PA 2W2KA 4RF4A 1E1LA 3Q6IA 4ZQEA 4YT2A 2NU6A 3VHRA 1XU7A 4RLSA 4FOSA 4YAGA 2I66A 1DC3A 4RF5A 3VPFA 4BNIA 3JQDA 3NJ8A 3EK2A 4O1MA 3PQFA 2DFDA 1BSVA 1E7WA 1XYGA 2VHYA 2B69A 2GPTA 4JXKA 3G3EA 4GL4A 4QO8A 4Q3AA 4J4HA 4AJKA 3H7AA 4OO3A 1EEHA 3V2UA 4BGUA 4IDBA 4BHTA 5BR7A 2W90A 1SC6A 1YB1A 1CQIA 2EP5A 2I65A 4ZRNA 5T5QA 3WMXA 2QZZA 4EI2A 3PYMA 5IDWA 5CFZA 1R12A 3PZRA 3KYCA 4JBIA 3HHPA 3JQAB 1C1DB 4ZICA 4CQMB 4MVJA 2P2SA 1DPGA 2ZATA 1O6ZA 3PP8A 4FN4A 1MC4A 3EVNA 2E6UX 2X4GA 4I9NA 4CMHA 2BKAA 3VH1A 2VQ3A 3DBHB 1U3VA 4DLAA 4MINA 2RHCA 2O2SA 4J7CA 4YYZA 3GRKA 1HYEA 4B3HA 3E8XA 4Q9NA 4DQXA 1YL6A 2HK8A 4GGPA 1DLIA 1DIAA 2RCYA 4WLUA 5A3JA 4CMIB 3HDQA 4GPD1 1HE5A 1YQGA 2R00C 3NDJA 2AA3A 4XZ3A 5FI5A 4J1QA 4TKLA 2DVMA 4UEOA 5G0VA 4FS3A 1NX6A 4L75A 2ZQYA 4DC1A 3IJRA 3QVOA 1W8DA 3NKLA 4BGIA 4PIVA 4LK3A 3I52A 3AUUA 1QRRA 1ZZEA 1YVEI 1ZEJA 3F47A 3LK7A 1A72A 4FQ8A 3W4IA 4WEOA 1JAYA 1RYEA 2BMAA 2IDZA 4GVLA 3A06A 3ZWBA 2FHSA 1WWKA 1QV6A 2XOXA 3QVXA 4AJEA 3LU1A 4JP3A 1CDOA 3AU9A 1PQUA 2Q1SA 3VKUA 4FD3A 2E82A 3AM3A 5IFLA 1BVRA 2H9IA 1H2BA 3FSRA 2B36A 4XQGA 2VWQA 5JY6A 3DFUA 1MFZA 4P8RA 4U0JA 5TGDA 7ADHA 3D4PA 4K6FA 3S55A 1F0YA 4B7XA 1PZGA 3HFSA 3UHAA 4KUHA 5L4LA 4BO9A 1ZEMA 1N9GB 1P1JA 5T57A 3ZU4A 4BKOA 5I7VA 2WWRA 5EL0A 1YGYA 3DHYA 3T7EA 2GZ1A 3WWZA 3AK4A 1OC2A 4BO3A 2FSSA 1IHYA 4YJDA 3C1TA 3G17A 3TZQA 3PYLA 2X5KO 3GZNB 1BXGB 4CM9D 3H5AA 3EVTA 3GVCA 3NTOA 1F14A 1KEUA 4IDGA 4JN6B 4NH4A 1P33A 4E21A 1YB5A 3I9OA 4KTVE 2CVOA 4E30A 3OMLA 1ZO8A 4LSWA 1UZLA 4GMGA 3OJ0A 4L4SA 4FFMA 1UZMA 4NJMA 4D3SA 4BNXA 1YBMA 2YW9A 3CE6A 2DPHA 4BB5A 5B37A 3WGZA 3BZUA 1QXSA 4BNTA 2EF1A 3RBZA 4R9SA 1YO6A 4FPXA 4R1SA 2YFQA 1E1NA 1KEPA 1LRLA 2NACA 1ZK2A 4WASA 3V2HA 8ADHA 4MVJF 2OZPA 2POQX 5I8ZA 3HN7A 4JJGA 5U1PA 3ZHYA 3GAZA 4I5DA 1JAXA 1Y1PA 2HAEA 3W8FA 1XR3A 1BMDA 1QV7A 5KJEA 4D3DA 5BSHA 1NBOA 4J16A 3CINA 4E5NA 3TL2A 1ISIA 3AJRA 1EK5A 1UDCA 1X1EA 3FRJA 1E7RA 4YPOA 5AQ1A 1M6HA 1J6UA 1GDHA 2PZLA 1CRWG 2Y66A 4MIEA 1P0CA 4IDEA 3D4NA 1HXHA 3B70A 1ISFA 2PZKA 1UR5A 1U4OA 4NHEA 2XF8A 1T4DA 1LSUA 2I5PO 3K92A 5FYDA 1LQTA 2PNFA 3NJ4A 3VDRA 5KCZA 5KJCA 3F9IA 4XGIA 2NTNA 4Y9DA 4DIFA 1PL8A 3UAGA 5FFFA 3TNLA 1ZIDA 4WE3A 1GQYA 5KOIA 1ONPA 4A73A 5L7YA 2G76A 4IUYA 2D5AA 1U28A 2VT3A 1U8FO 1ZK4A 3ZWMA 1PL6A 3OA0A 1XELA 3D5QA 4ID9A 3HNPA 4FFNA 5LDGA 4GGOA 1WNTA 5DOZA 1KY4A 1M66A 2VWPA 4XCVA 4MVJG 4D45A 4NMHA 3ZWXA 3ZWVA 3TSCA 5L95A 4XDYA 2HLPA 2VNSA 3JD3A 3LT1A 1ZSYA 1VM6A 5HTOA 5ICSA 4IDAA 1ISMA 3DDNA 3OM9A 3I4CA 2YZ7A 2WM3A 5KVVA 3S1LA 2CVZA 4BNWA 4J4BA 2EKPA 3ZWAA 1IHXA 3W8EA 1YWGO 1Q7GA 3ZU2A 4E5YA 3SLGA 1Q0HA 5COAA 4D42A 1V0JA 2Q50A 3H4VA 2WD8A 1RWBA 3GF4A 3NDRA 4FSHA 4NBVA 4GH5A 2IODA 4D0RA 5I9NA 2DFVA 3HE3A 2OBYA 3MOGA 1H0KA 1IOLA 5AOVA 4YWJA 3WFIA 4RPKA 2XPCA 1NNUA 3PFFA 4AJ2A 2H5LA 3JTMA 4Z3KA 1OMOA 4R1TA 1Q0LA 2FWMX 3JQ8A 4DLLA 1A9ZA 1RKXA 1HSOA 1MP0A 2GO1A 3GFGA 4YJGA 1GY8A 1WDLA 1VJ0A 4CMCA 5EPOA 1U1IA 4RF3A 4I1IA 1JTVA 1BRMA 1WW8A 3FCOA 1N7HA 3PWKA 4IQGA 4EZBA 3ICCA 3MWDB 3RUDA 3NTQA 4J49A 1KVUA 4BKUA 1FK8A 3OH8A 4LRSB 3ITDA 2BH9A 4GX5A 4IZIA 2OMEA 1GR0A 1KEWA 4DGSA 3K2BA 3OQ6A 4HFRA 3WXBA 5K6AC 2Y1CA 5AXDA 1L7EA 2PZMA 1ZMOA 3PEFA 1Y5RA 3E82A 3JCZA 3PHIA 4RQUA 4DREA 1D1SA 5BNTA 4J7UA 3LYLA 1LX6A 3E9NA 1ZSVA 4CLRA 3QV1A 2PWZA 2EV9A 4J91A 1SO8A 3C24A 1YDWA 3TFOA 3CTMA 2AQKA 4A5OA 2X0IA 1OOEA 3DTYA 3GOHA 5DBGA 3I9JA 4BNFA 4FJ1A 3RUHA 4PG8A 1C0LA 2HMUA 3L4BC 5F21A 2AHRA 1KC1A 4Y6SA 3UVEA 2FN7A 4BL5A 3ADOA 4OYRA 4RVFA 1HWYA 1UH5A 2NVBA 2QW8A 1BVUA 1X15A 4XR9A 3BTSA 4TMFA 4WCFC 4A27A 4BV9A 3JYLA 3ZV6A 1NHWA 4NPCA 1ZFNA 2DBRA 3QWFA 4N7RA 4WKGA 4BGEA 3QE3A 5F1PA 3WBFA 1TEHA 3B1JA 5G0TA 4ALMA 4MO2A 3ETGA 1Y9AA 2IXBA 4FGWA 5KKCA 2O3RA 1H6CA 3UCFA 3ZWYA 4AFNA 3ITKA 3JQ7A 3KEQA 1ZVMA 1NTOA 2W8ZA 4I08A 2OORA 3ETEA 4EGFA 4KDFA 2UAGA 2B4TO 1PZHA 3H9GA 4XYBA 4HFJA 1TT5A 4GAEA 3HB4X 1E3IA 1QSGA 1YXMA 1CYDA 1I30A 4ALIA 2QYSA 1VL8A 1R4NA 4BNUA 4UAGA 1VKOA 3UCEA 2VT2A 1ZMTA 2GR9A 3DZHA 4IDFA 4NFHA 1HTBA 4PRLA 3K5PA 3FNFA 3TFQA 1EQUA 1UXGA 3QJ5A 1G0OA 4W6ZA 2QRJA 4Z0PA 2VOEA 4NG5A 2DTEA 4DYVA 4Q3DA 2P9EA 4IDCA 4ZRMA 5F5LA 3KM0A 2VYND 4H7PA 4J9UE 4N18A 3FF4A 4YJHB 5HS6A 4FFRA 9LDTA 2P4QA 1N92A 2WTBA 4JK3A 3OEWA 4K28A 1K3TA 4ZN6A 3C1AA 3M6IA 3RROA 5JO0A 1FDUA 1R4MB 1NQTA 4E31A 1B0AA 1NAIA 4WEQA 2EG9A 3JD1A 4DTIA 1GYQA 3U4HA 4CQMD 1GUZA 1ZK3A 3I9MA 1T26A 3D64A 5T67A 3ABIA 3QVWA 2X0JA 1ID1A 4NDNE 2I99A 4TRMA 2GDZA 3A28A 4ITUA 1Y8QB 3VKVA 1J0XO 3BMNB 4XKJA 1HDRA 1LNQA 3T4EA 4BQPA 2VN8A 2NADA 5GZ3A 3UICA 2ZTVA 2Y93A 1EK6A 3HDJA 3FPLA 3MTGA 2JHFA 3OHSX 3BMOA 2C5AA 5K6AA 2F1KA 4RDHA 2JAHA 2CMDA 1XLTA 2YFHA 3PJGA 4CR8A 4CLOA 3JD2A 5CPFA 1Z75A 5LDHA 2W4QA 3EZYA 3WYCA 3GY0A 4LRTB 2O4CA 4EW6A 3FTNA 1CF2O 2H1SA 2YHIB 3E6AA 1WDKA 5EESA 5H83A 1GV0A 4PLHA 4KDEA 1KY5A 3KYDA 3IUSA 1IPEA 2RBEA 5F5NA 4D46A 3IC5A 3PZBA 2B83A 4CM9A 1R0LA 4DWVA 2XAAA 1PU2A 4GBJA 1LSSA 3GNTA 2P9GA 5L40A 1H93A 2QG4A 4MVJP 3WQQA 3Q9UA 2VYVA 3PDJA 2Q45A 3H2SA 1GUYA 4OQZA 3VZRA 3WNVA 4B4OA 2TMGA 3O26A 3ZV5A 1ISJA 1I2CA 1YDEA 3K2EA 4QTZA 4EYEA 1HL3A 3DL2A 3KOUA 3NAQA 4XQ9A 5TS3A 4K1LA 2DBZA 1ZBQA 3PRJA 5CEJA 3ZN2A 2EIHA 5TRTA 3RU9A 4MKXA 1E6UA 1PS9A 4YAKA 1DOHA 2BI7A 3FBTA 3LT2A 2PA3A 2GZ2A 1ZH8A 2CDCA 3K30A 3L6EA 4OM8A 4WLNA 1XIVA 4E33A 3JSAA 4XJTA 4WECA 1LDYA 2DKNA 3DTTA 3RUIA 4CMEC 4RVSA 2NVUA 3PWZA 1PJTA 4J6FA 4D41A 4JLWA 1R66A 4CR6A 4YTEA 4W7IA 2NWQA 1JVBA 3DAFA 2Q46A 1ISGA 3LC1O 1X0VA 3S2FA 1S6YA 4E5PA 3ZNNA 5C3MA 1JA9A 4DMMA 1ZXLA 3GLQA 4YJFB 1BDBA 2AEJA 4NK5A 1IZ9A 4R5MA 1D4FA 4AJIA 4DPKA 4DXHA 1Y7TA 3MJEA 4C4OA 3E1KA 1UDAA 1PGJA 2YDXA 1SNYA 2X22A 2EWMA 3U0BA 4OOFA 3W6ZA 1Q7CA 2NUAA 2OXIA 5DCWA 3F1KA 4OHUA 5BSGA 4D7AA 2OGUA 1ZJZA 3BMCA 3W6UA 4CLXA 3HJAA 4FBGA 4NNJA 1EVJA 4CV3A 3X2FA 4BO2A 3GUYA 3I1JA 3ZNQA 5KTKA 1WVGA 1B8VA 2C54A 2E4AA 4XWYA 2CY0A 3KVOA 5DCUA 3IP3A 3H65A 3NRCA 3LF2A 3DXFA 4BNKA 4YEDA 1HEUA 4R4JA 5T64A 1DC4A 4U5QA 4YA6A 1NPTO 2GCGA 5DNAA 5TF4A 4YXFA 3PK0A 4TVBA 1C0IA 1HYGA 1HDOA 5FF9A 2BHLA 1VL6A 3GC6A 4XX0A 2RH4A 4DMLA 4ND1A 4IY1A 4CLHA 5B4VA 4WOKA 5KVCA 5TSDA 5A9SA 2WEKA 2A92A 4H15A 1EZ4A 4X54A 4JNKA 3PHHA 4IMPA 5ENDA 1E3SA 1NVMB 2WE8A 1OI7A 1HSZA 1M75A 3WNQA 3C3XA 1LDGA 3LC2O 1PSDA 1K6JA 5EQFA 5GY7A 4ONEA 2WD7A 3QRWA 3GVPA 2O2YA 3TJRA 3G1TA 1BW9A 1I33A 1EUDA 1OC4A 2SCUA 3ROMA 4XDZA 3ZU5A 3M1AA 2WJPA 4A2CA 4R01A 5EINA 3EMKA 3BMQB 4CUZA 4L73A 2IZ0A 3V5NA 1W0CA 1R16A 1LSOA 1B26A 1E7SA 3HWRA 3IMFA 5HBRA 3V1TC 4O0LA 1J5PA 1BTOA 1Q7BA 4BNNA 2VCYA 1PJBA 1MA0A 2BFPA 4II2A 1U2GA 1Y9EA 2IZZA 4OXYA 2VHXA 1WMAA 1AHIA 3OJFA 4R1NA 3DR3A 4XD2A 3L9WA 3VZPA 1FDWA 3H6KA 4AJNA 4E2WA 1I01A 4HUJA 1KVTA 2WDZA 2Y0CA 5JAIA 3AY6A 4GMFA 3WX0A 2JCXA 1KERA 3NT5A 1SB8A 2D0IA 2NV6A 3FWNA 3PIDA 4Z0TA 1IY8A 3ANLA 2W2LA 1HETA 1LBEA 1T2FA 3C1OA 3JQ9A 3TZ6A 4LSMA 2FOIA 5T8KA 1H94A 3GDOA 3ZCXA 3WOHA 2GN4A 3PI7A 3G79A 3MJ4A 4DLBA 5J23A 2D5CA 1B8UA 3CMCO 2DTXA 4UVEA 5FWNA 4RLHA 1HZJA 1CETA 6LDHA 4OAQA 4A10A 3MJVA 1U3WA 1WDMA 4YQYA 4PN3A 1R0KA 1XCBA 2JCVA 4ALJA 4B4UA 3U09A 2EHDA 3RKRA 1ONNA 4B7UA 2VRBA 2E49A 3RVDA 2D59A 3KETA 5KIAA 5FI3A 1E3EA 5CDGA 5L53A 3BIOA 4P4NA 4BMSA 3VC7A 4IBOA 3UKOA 1XDWA 1QMGA 4GX1A 4QUKA 3KLPX 3KBOA 4TSKA 4M1QA 2ET6A 3JQGB 2VUUA 1DRVA 3TQHA 3PWSA 5BNIA 3L9XA 4UVGA 1T2CA 1R0SA 3GH3A 4N54A 4HADA 3RCBA 4I9HA 1EQ2A 1V3VA 1YKFA 3KV3O 4FDAA 5C7OO 3HN2A 1PWXA 3T7CA 2X7HA 4W82A 4IZHA 1BHSA 1Y6JA 3ZHBA 1FXSA 2YV2A 1P1FA 3ULKA 1GPDG 1A27A 4QEDA 1MV8A 1MFPA 1H9BA 3OBBA 4ND3A 2JL1A 3GPIA 1HRDA 3JQAA 3W8DA 1C1DA 4CMJA 4DPMA 4CQMA 2GNAA 3EY4A 5KKAA 1DRWA 3EHEA 4XIJA 3V1UA 4OIMA 1GFSA 2GRAA 1MB4A 4TWRA 3DBHA 1LU9A 3WIDA 3MJTA 5CHEA 3KO8A 4F45A 3GVHA 1LRJA 4ILKA 4KUEA 1T2EA 5KJ6A 5TIIA 1A9YA 2ZB8A 4CL3A 3IOYA 3OA2A 3AOEC 4XR4A 2EGGA 1VJTA 4R51A 1OBFO 3ZH2A 4ND4A 4CMIA 4RL6A 3K96A 3DZBA 2I67A 4IJWA 3WFJA 4RO0A 2NU7A 2X9GA 2JD2A 4Y98A 1P0FA 4OSPA 4PLWA 3PFWO 3LT0A 1U5AA 3SC6A 3L6OO 5EQDA 4XB1A 1YB4A 1SOWA 3DWFA 2FMUA 4P4GA 3LSYA 1YL7A 5DP2A 1NQOA 2Y05A 1DFIA 3QQPA 1P31A 3GPDG 1B7GO 3IS3A 5HS4A 1YBAA 3BA1A 2YYYA 3TZCA 2VZ8A 5A4DA 3ST7A 1GZ3A 4KWIA 1YQDA 1UXHA 3Q11A 4U8GA 3WTCA 5CP8A 1P1HA 2I9PA 3ASUA 5TJHA 1I10A 4ALNA 4DL9A 4BB6A 1EE9A 4NU6A 5JMWA 4IJVA 4DRYA 2J3HA 1JKIA 4YRDA 1C1XA 2NTJA 1NR1A 1IULA 2AE2A 2ZB3A 1NVTA 3ZI0A 1IL0A 2IZ1A 5GZ6A 4KQXA 3DAGA 3OETA 1E77A 2PR2A 2V6BA 4CQLB 1PR3A 4EDFA 2RAFA 4NQZA 4TKMA 4WJZA 1N9GA 3B1FA 1K89A 1AXGA 2J5RA 2JCYA 4BV8A 3UFXA 1V8BA 3H5NA 3RIHA 2ZJ1A 3TWOA 5AXBA 4NZ9A 1GYPA 3OP4A 3RC9A 1P45A 4LVCA 3QSGA 2Z95A 3GVIA 5C37A 3GUCA 4BMVA 1NFRA 2B4RO 4LCEA 3GZNA 1VRWA 4JX8A 3QHAA 5IJZA 5ILOA 4IXTA 1BXGA 4HNGA 1Z7EA 1NQ5A 2JD1A 5FEUA 1JKFA 2NVWA 2IYOA 4QECA 3PJEA 5MDHA 2IXAA 3GT0A 5C7LO 4FJ0A 4KMSA 1DSSG 4XJSA 4B4WA 2VUSA 2DU8A 4J0EA 3S8MA 2AG8A 4I5EA 2OHXA 1T24A 4WUVA 2X23A 2GD1O 3H5RA 3ZV4A 2LDBA 1U7TA 4CM4B 1EE2A 3BHIA 4CM5A 4LMRA 3W4JA 3WLEA 5IN5A 4J1NA 2WSBA 5EIOA 1HF3A 1LRKA 1S7CA 4TRRA 5K9ZA 2B4QA 1WP4A 4D79A 5H81A 1LLDA 3DBLB 4M55A 1DAPA 4NK4A 4R41A 1PJCA 5DF1A 4XB2A 1HE2A 4IJUA 1NPYA 3JYOA 2EJWA 4ESOA 3EAGA 3IQDB 3AOEA 1X14A 4HBGA 1NAHA 2IYPA 3SBOA 1V3UA 4A0SA 4NFYA 1K6XA 2VTEA 4CLDA 2G1UA 1K6IA 2CVQA 2QZ9A 1D3AA 3NEPX 3U62A 4Z9YA 2OBNA 4E2YA 3IJPA 1IZ0A 1IUKA 1I3LA 4P22A 3D7LA 2Q1UA 5A02A 1GZ4A 1WLYA 2Q49A 2ZIZA 3GEDA 3U9LA 4II3A 3GFBA 1XA0A 5DP1A 1V35A 4YT8A 3U3XA 2VWGA 5A5FA 1SOVA 5JW6A 2CDBA 3ZWCA 3X2EA 2Y1EA 4BO6A 1N5DA 3TDKA 1QKIA 2P5UA 4PLPA 4E5MA 4ALLA 1B15A 3UH1A 3VTFA 2DTDA 4J2HA 4O6VA 5JC8A 3I9KA 4TRNA 1XEAA 1M67A 4NI5A 5F1KA 4IIUA 3WJ7A 4PLFA 3HDHA 2HCTA 4QX6A 1NPDA 2GLXA 2OP1A 4BNYA 3DBRB 5G4KB 1PGQA 2C7GA 4ND5A 3VTZA 3K73O 1E6EA 2C2XA 3HZZA 4E2XA 5L45A 1D1TA 2Y67A 4Q3BA 1NXQA 1MX3A 4JJFA 2ZTMA 4D0SA 1HE4A 3M1LA 3AI3A 3CUKA 1PJ4A 3RUFA 2VRCD 1HDXA 1VE9A 4MOWA 2BF7A 2FR8A 1NASA 1ADGA 1UAGA 5TJ9A 1W4ZA 3MWEB 4PG5A 1IB6A 3RC7A 2V6FA 2BELA 3H2ZA 3FBGA 4OMUA 4G65A 1OFGA 2EJVA 3KSDO 4XYGA 2ZJ0A 5A05A 4FOOA 4IXWA 1N1EA 3TOXA 4JBGA 5JLAA 1UP7A 1D8AA 2PKQP 1AXEA 5ILGA 2NQ8A 4RVGA 4IDDA 3HFGA 3RC1A 1G0NA 5A1TA 1E5LA 4WCDA 5TC4A 2X8LA 4P38A 5A5EA 4KOAA 1LLUA 5IDQA 1CJCA 4IJKA 1AHHA 4YAEA 5ITWA 1ZK0A 2CNBA 2Q2WA 2CD9A 2Z5LA 4RCVA 4BO7A 1E7MA 2B35A 5ER6A 4D43A 3ZDFA 4PLYA 3E5RA 3KB6A 5CEEA 1TVEA 2EW8A 3S2EA 3WTBA 3G0OA 1V9LA 3L0DA 4YB8A 2RH8A 3VZQA 4DA9A 4DIOA 1QYVA 2H6EA 3ZU3A 1E6WA 3ZV3A 1KVQA 2ZYDA 4PG4A 4WNIA 1GEEA 1JQBA 2X86A 4IGFA 4ZVVA 2AXQA 2Q2VA 5ES3A 2FR0A 1AN9A 2ZYAA 4U6QA 3P19A 3DZJA 4BNZA 4NBTA 4PLTA 3OFSA 3GMSA 3OECA 4IS2A 3WSVA 1PS0A 1FJHA 4TZKA 2WE7A 4MDHA 1DXYA 4EUEA 4L0QA 3MEQA 4YAIA 4ZQGA 5L4NA 1UJMA 4R9RA 2R2GA 4MKZA 3DMTA 3RU7A 3JQFC 4FW8A 5T6BA 4ZJUA 2EGHA 3RC2A 4NBRA 4EUFA 4ROSA 3LF1A 1U9JA 5DDIP 5IAAA 2A9FA 3AY7A 2DM6A 4DIBA 2FP4A 2PKQO 1R37A 4WLEA 2GSDA 4CM8B 4B8WA 1VJ1A 4BNGA 3DMYA 4URFA 1Y8RA 1CERA 1R4NB 4L74A 1SZJG 2QYTA 3IKVA 1M6WA 1CWUA 1MXFA 5CG1A 2I3AA 1HLDA 1UXKA 4AICA 1PR9A 2AW5A 5F1OA 5B1YA 1E1MA 4RZHA 3GGGA 5KVQA 4M87A 1AE1A 2J6IA 3INTA 2CUKA 2Q1WA 2JKVA 2UUPA 3WICA 1IPFA 4FCCA 3BXXA 3ORFA 1PZFA 5JMPA 5JYDA 1CQJA 4TZTA 3VZSA 1EBFA 4FFLA 3ZW9A 4BO5A 5DBFA 2HQ1A 1YOVB 1MGOA 3NX4A 5G0SA 4JGBA 4YJHA 3PLRA 2FPPA 2VUTA 4E3ZA 1SEVA 1QLJA 3ICPA 2BFMA 5ER9A 4MVJD 2FRDA 2QIOA 3F1LA 4MVJM 2DQ4A 2JJYA 2PKRA 2CDAA 1R4MA 3DQPA 3GQVA 4OOEA 4RPLA 5CG2A 1QLHA 3JYQA 1EVZA 1U2DA 4CR7A 3QLJA 1ZSNA 3EC7A 5CPBA 3GN2A 4CM6A 1QYCA 2HK7A 2C82A 1Y8QA 3E5MA 4B3IA 1QORA 2FR1A 5BT9A 1P44A 1YBVA 3BMNA 3MJSA 4LISA 5EMHA 3RFVA 5HRUA 2G82A 2HKIA 4I5GA 1A71A 2D2IA 4Z9FA 1LSJA 3WGOA 3TZHA 5TQVA 3RKUA 3AUAA 2AQ8A 2O7QA 3LLVA 2UV8A 4GQAA 1X7DA 1NWHA 2WYWA 1YQXA 1HKUA 2A4KA 4O5OA 2FZEA 4YQZA 2JHGA 2LDXA 4ZQFA 2AQHA 1LI4A 4DBZA 3GG2A 3D3WB 4AJLA 2YJZA 2EXXA 4BVAA 1RM4A 2IE0A 4XEHA 3KUXA 1PJ3A 3ETDA 4JJIA 2QX7A 3AOGA 4WCFB 1DBVO 1I0ZA 5IDXA 2AMFA 2BGMA 4ZHSA 5B4TA 1DFHA 2OOSA 2V6GA 4RGBA 1E5QA 1V3TA 3RSHA 2G17A 4LCJA 3DZGA 3CH6A 1GD1O 3GVXA 5I9MA 1P1KA 3JQFA 2NQTA 4I8XA 1DEHA 3U4DA 4U0KA 5BSFA 1UXIA 3PTZA 3U5TA 4IQ8A 5JFOA 3NT2A 1NVGA 3O9ZA 1U4SA 1F17A 5A3VA 2RIRA 4MIYA 2RHRA 1J49A 3QVTA 5U4QA 1PGOA 3M2PA 1X7HA 1GL3A 3B20A 5IG2A 1UP4A 4MVJE 1XQ6A 1YH3A 3PXXA 1T2DA 3ZWOA 1ML3A 3JQ9C 1LLQA 4CL8A 5T8KC 4A03A 1KOLA 2PFGA 4UVDA 2D8AA 4TRJA 1Q0QA 3I5MA 4B7CA 1BWSA 1PGNA 2J3KA 3RI3A 1VSUA 1C3VA 3ZNPA 1E3WB 2CF6A 3VPHA 1T1SA 1G1AA 2X9NA 4GLLA 1DAOA 3GHYA 3RASA 4PZCA 4G81A 1DC5A 5A9TA 1H2HA 1ADFA 1O8CA 4YJFA 1I2ZA 2V6MA 3WGQA 4BKQA 1VL0A 3NDIA 5IZ4A 4BGVA 1QYXA 2D1YA 2R6JA 4CMBA 4LGVA 2YQ4A 2O3UA 2A94A 4OXNA 2Y0EA 2JFGA 4CMKA 3Q3CA 1WZEA 4UUMA 3H9QA 1JWAB 2GZ3A 3STHA 3TF5A 2DLDA 3VAZA 4BO1A 4RDIA 2UVDA 4S1VA 3DAPA 4U6SA 3IIEA 4D3FA 4F3YA 4PLVA 3NTRA 3E48A 1UZNA 2DUWA 3K9QO 4DUPA 3Q2KA 2DBVO 4XQCA 2HU2A 2PH5A 3HB5X 2XXJA 1I2BA 4JP2A 1CIVA 3FHLA 4JBHA 4INAA 4AVYA 3KYBA 3ZZNA 5IXSA 1T2AA 1KVRA 2PGDA 1SB9A 1DIHA 2QRLA 3ZGYA 5EN4A 3P2YA 1GYRA 1N2SA 3AM4A 4J0FA 4Y6RA 3I9LA 4LVUA 3COSA 3KSUA 4HY3A 1C14A 3R0IA 1DJNA 3IP1A 4GKVA 3NGXA 3R3JA 1A7KA 3OJOA 4M49A 4E4YA 4MVJH 3VDQA 2Q4BA 4R5HA 3PHLA 4CJXA 2BRUA 4NFSA 4AJOA 4JCOA 2ZYGA 4K6CA 4M89A 2VRCA 2OFPA 5TNXA 2JFFA 4OKIA 4W9NC 3JYPA 4IINA 1ZK1A 3S2GA 5KJFA 1E7YA 3KTDA 2O23A 4WLOA 1EDOA 4YT4A 3SJUA 1WXDA 3WGGA 2V7PA 1KVSA 3VPXA 4AJ1A 2HSDA 1MUUA 3INRA 5DOVA 4WNCA 3H8VA 1B2LA 3PDUA 2X9VA 1TXGA 4R54A 3BMQA 4CM3A 2Z1MA 3JQBC 4BKPA 1NFQA 2X1HA 5COBA 3CPSA 3C85A 4E5KA 4L76A 4MKRA 3P7MA 1RYDA 3UW3A 4D44A 4Q3CA 8LDHA 3JQEA 3AW9A 1FDSA 3KZVA 2P4HX 1UAYA 1VI2A 2WMDA 4QT0A 3Q0EA 4TQGA 4W4TA 4BO4A 4Z6KA 3O8QB 4TROA 5DN9A 2Y1GA 4FIZA 5IF3A 3CZMA 1BXZA 4UUNA 3F6YA 3TOZA 4E32A 5JAMA 5LCXA 3L6DA 2GERA 4FFOA 1BGVA 4PLCA 3GG9A 4HNHA 2OP0A 2HMSA 5JDCA 3UUWA 5I8WA 2W2KB 5I9LA 1E3LA 4XRRA 3D0OA 3WWYA 4WLVA 3F46A 1JW9B 1ONOA 1PL7A 1NM5A 3WMWA 5TLSA 1F8GA 4A26A 3WYBA 4IM7A 1H6DA 1KC3A 5GZ1A 1TLTA 2GYYA 4PVDA 5JAZA 4AG3A 3CIFA 3V8BA 2CF5A 4Z9XA 3AFNA 4TVOA 4BKRA 4I5FA 1GTMA 3GMDA 2BGLA 3H9JA 1U7HA 4NBUA 4IGEA 3WSWA 2GN8A 4PG7A 1B8PA 2ZB4A 3PGJA 1ENYA 5DT9A 4R3NA 4BS9A 4CMGA 3ENKA 3DEYX 1PQWA 3OF2A 2FPGA 1MG0A 3F5QA 2VYNA 3QWIA 3EZLA 4G2NA 4J9VA 4OXKA 3KYCB 3MCVA 1DC6A 3F5SA 1R15A 3FNGA 4R68A 4ZQBA 2HDHA 2D4AA 1DHTA 1GU7A 3JQGA 2A35A 4YBZA 3D5TA 2F00A 2Y68A 3A14A 1XU9A 4NIMA 4J7XA 5LC1A 4A7PA 5JO9A 4ZD6A 1LC3A 3RWBA 4RPGA 1GUFA 1O95A 3LLSA 3DB2A 2EKQA 4FR5A 4IIVA 3WDSA 5JS6A 1HDZA 1Y81A 2Q2QA 3GA0A 4BO8A 3FI9A 5L3ZA 1A5ZA 3C7AA 4Q39A 1GPJA 3O03A 5KNLA 4AJ4A 4XGKA 3PVZA 4RPHA 3FN4A 3MJCA 1LDEA 2E37A 4OL9A 5F3RA 3I3OA 3V2GA 4W9NA 2HO5A 1W6UA 4PGFA 1XHLA 4CPDA 2DT5A 3FNEA 2PY6A 2BFAA 5DZSA 3JD4A 2AG5A 5JBIA 4GSKA 2C2YA 4DVJA 1RPNA 5JXWA 4N5LA 3FR7A 2B5WA 1PQPA 3JQBA 2IRWA 3P5SA 2G5CA 1P77A 4XYLA 2WYUA
chains in the Genus database with same CATH superfamily
1VBFA 1P0QA 1Z0JA 3C3DA 4BMNA 1MLDA 3GP3A 1SXJB 3HZHA 3QGMA 4HH3C 4DV3B 2IYFA 2FK8A 5CB4F 1G7CA 3ES9A 3NBYC 4I50F 4RZ2A 2C07A 1DJQA 1XZAA 1ZZGA 2JGAA 4EBFA 2QL9A 2WJWA 3SEFA 3PKJA 4G07A 1GGFA 2NO7A 3AM1A 2GPJA 2JAUA 3GOQA 3HDYA 4RLFA 3C98A 3VYUB 4N41A 1FFWA 2Q8NA 2XSZD 1HYHA 3M8KA 2PD3A 1NW4A 2AXNA 2RGNA 3G9ZA 2REBA 3PQ7A 4HQNA 4U7FA 1XMIA 4ZU6X 4EW1A 2X5JO 5AUOB 3KLMX 4M1OA 4MJLA 2OG1A 2NSDA 2VP9A 3KV1A 1TT7A 2BBWA 3EUAA 3F74A 1Z5ZA 3QKUA 3QLTA 4MPPA 1H8EA 5I9SA 4TT3A 1GNLA 3B1XA 3IV6A 3L7NA 2NV2B 4UUBA 1JHAA 4XVQA 3WBJA 2ON6A 2OXFA 1C1XB 1QHFA 3T5AA 1J0AA 2ECKA 3QTLA 1GQSA 1LK0A 4G4SP 4N8SA 5I5GA 2ZAMA 3HXOA 1B16A 3I2KA 3M82A 3TOCA 1MOPA 2HV8A 4CMAA 2X5OA 5IZCC 1ZNYA 4IX1A 3U80A 1SZCA 3J80A 1E4OA 1TD9A 1YIOA 1R0XA 2XECA 3U49A 1DL5A 4O59O 1N3YA 4HNUA 3K0FB 1F0NA 3LCRA 1OGIA 3OZFA 1VHLA 2AJCA 5AK0A 2JLQA 5BQFA 4YPFA 1CQXA 2ECOA 3OEED 5DK6A 1DKMA 1FW8A 3QNUA 2BT4A 3V4FA 2B37A 2P7HA 5C8YF 4CQLA 1XALA 4JFAA 2D1QA 2IOHA 2JJMA 3VC3A 4R1PA 2JIZA 2P67A 4M37A 4QUBA 4UHBA 3HJUA 4CV0A 3I23A 4PHHA 2FWPA 4PZUA 4H59A 4EUHA 1VYVA 3KOOA 1GV1A 1HZZA 1BKSB 1NP3A 3QXHA 4OUDA 1JZQA 1L8LA 3PB3A 4XM2A 1YF3A 1JH9A 3RQSA 1VKJA 1DRKA 4FONA 1AGYA 3TLKA 5L8VA 2OV4A 1MB0A 1ZN2A 2NZYA 3I6QA 4B4KA 4JLPA 3ACDA 2R1TA 4R1UA 2YUTA 3GGPA 3I64A 1UEXC 5TX7A 3WBBA 2A33A 5JJBA 1EUCA 3GJTA 4H7EA 5AK4A 3DLIA 3CRW1 4R2HA 4TM8A 3EA5A 4ZZIA 4DLZA 1Y8ZA 4RD2A 3BL6A 3AFMA 3R7NA 4CODB 4ZALA 5HUQA 1GPWB 4OQQA 2O8FB 1ZBDA 4FU0A 3V2IA 3VH4A 4CCYB 5DIZA 3I53A 2O0HA 1TVCA 1JSXA 3DOOA 3FMPB 1I0LA 4HFMA 4XGRA 3TJMA 3AEZA 4F12A 4J4TA 4QLOA 1QIFA 1SPXA 2P91A 4D81A 3FYTA 3KAQA 2QX8A 3CF6R 4EB8A 1R10A 2PH1A 2JLWA 4HMOA 5EWMA 4GSLA 1GQRA 2IZOA 3G2HA 1MTOA 3QVMA 1G8FA 5BUQA 3KQQA 3ADDA 1EGAA 2ZK7A 4PSAA 1TMYA 1AHNA 3HB0A 2QY6A 3TNYA 1AO0A 4CU2A 4M99A 5GJBA 2WM9B 1SG9A 5HIJA 3UXYA 4ALKA 1WMSA 4S2UA 4HV4A 5EJ4A 4H3SA 2JFBA 4OU5A 2VAVA 3KR1A 4ZVRA 2PK3A 3ZXSA 5I7SA 3T7RA 2OHIA 1CUCA 1EVYA 1JALA 1KDTA 1QX4A 1PO7A 1P61B 2XIJA 3PGA1 4DZZA 4FB4A 2QUKA 1Z62A 3DD5A 1ZW1A 4FKZA 4A9AA 3DZ8A 3KNZA 4B6GA 2AFIA 1RI5A 4HDRB 4OXQA 1E63A 5BYAA 1CTQA 3FM9A 5A1JA 4YH1A 3MT7A 4YRFA 4D8TA 2EKDA 4L6CA 3L7LA 1N0UA 3L1UA 4YASA 2ZIWB 4JELA 2Y0PA 3OKCA 4LS3A 1J8DA 4WXEA 2NIPA 4RGQA 4OQYA 1PN3A 4RM2A 4OHCA 3U31A 3WNBA 5CDYA 4U1RA 1YS2X 4JGIA 1R6VA 3S29A 3GEMA 1VYUA 1ESCA 2PXXA 3K70C 2OLEA 4XTRA 3WIUA 4FDLA 4EJ6A 5GMOA 3PQEA 1HM5A 2O6LA 3K6JA 2ZQ5A 4L02A 4TWAA 2ZDQA 3H87A 5AVXA 1QWOA 3IRUA 1N9ZA 1Q44A 5ESRA 5KOJB 3U4MA 1VC2A 1ZCBA 5LMUB 1E0SA 4JLVA 5DSZA 2YZNA 4Z4HA 3ZWWA 1OX6A 2CXUA 4DHEA 1T3GA 2EEPA 3CX6A 2YS7A 5BQ3A 4JJ8A 4G01B 1WNFA 4JUIA 2XTAA 3CX4A 1PJLA 3NT4A 2ZWOA 3AWDA 1KIAA 1NF3A 1J2RA 1JXQA 4UUPA 3FLBA 5J4KA 5D5PA 5ADHA 4P84A 2GXAA 1N2JA 2A2ZA 4HH4A 2Y4OA 1BMTA 4PFJA 3WR5A 4ZI2A 1BCRB 3BH0A 4GOLD 2DR2A 2AYXA 3B6MA 4MS1A 2FUG6 1YK0A 4BLVA 4RTOA 3DZDA 3LCVB 2JLYA 2R8EA 4JEUA 2LUOA 1U5CA 1UBSB 3I4LA 1ULUA 5H70A 4ZAFA 1NBMA 5ALNA 5C46F 1TB4A 2DWUA 2GFIA 2ZUSA 4NJOA 4YAJA 2NU8A 4DS3A 1RQRA 4MW7A 7MDHA 4QQNA 2PTGA 4WESA 1VSVA 3H4IA 4ZCSA 1VPDA 1GQ2A 3KJEA 1CZRA 4QHTA 3R0XA 3U16A 4ARIA 1RI1A 2PWPA 2OXTA 1B3RA 1UQRA 1RJDA 4ZGGA 1S3IA 2CEAA 5FYQA 2DXIA 3GFRA 3UY4A 3OJEA 4E13A 1A5SB 2XNSA 2B8WA 4X1YB 3BQMB 1ADBA 1W5FA 1A9QA 3TKAA 1THZA 2F9FA 4WGGA 2BUAA 5I47A 1OBOA 1YD7A 4CG2A 3E5HA 4OB6A 4RAOA 4R9NA 4Y18A 3EEQA 4DSOA 4ER3A 1LKZA 2W58A 1LEHA 3PVSA 4O1HA 4X7MA 4EMTA 1KSHA 4EW2A 4YR9A 2NSLA 1GXSB 4IV5A 1ECGA 2IW3A 2H8KA 2NVOA 3KWFA 1OLUB 1S01A 2DUUA 4R1QA 5BSUA 1IN8A 3NASA 2EDAA 3BTUA 3L84A 1WA5A 2XQJA 4CCWA 4XYMA 4Y8VA 1QGZA 3EBOA 2H7CA 4GI5A 3NBMA 3W1EA 5AD1A 4UNIA 5AUNB 1EFLA 1WPGA 3UT6A 4QQRA 3CLUD 3WIVA 1XMQB 3AF4A 3FR8A 3L07A 3N58A 2OHOA 4DCTA 3AKCA 3GWZA 4B76A 3R9XB 1DKNA 3FFTA 1AUVA 4J1TA 3R6WA 3JQ6A 4JS0A 5LQAA 5IWAB 2JGMA 2YJ5A 3CVWA 4PHTA 2NO0A 5DV9A 1FP2A 1ZXBA 4ZGBA 5A0TA 1WR8A 3OTHA 1TA4A 4EM6A 3JR7A 1AOXA 1RM5A 1YR3A 4W8OA 2CNLA 4E6PA 3S40A 5H3CA 3DCNA 2JGDB 4HQRA 3RUAA 1ZGAA 1ULZA 3RU3A 4AJJA 1YQQA 1IB0A 1G3UA 4AJPA 4ZK2A 4YVFA 1IONA 1X0XA 1CU1A 1X8XA 4HKTA 1G7RA 3KD3A 4V0OA 4JA2A 1U3FA 3QKIA 2IS6A 1OPXA 1A9SA 4G1UC 4KQCA 4AUNA 1GTJ1 2QV7A 3GNSA 3AVYA 1U8CB 2W6JA 2PA0A 3T9CA 3OOJA 1VKZA 1GU1A 4MB6A 4TWIA 4IL5A 2GT1A 4CGYA 3C15C 3Q2IA 3GJ5A 5T4BA 4OH1A 1Y34E 3H83A 4H6WA 3OFJA 3LYAA 2NTVA 4F84A 3GAFA 4YRNA 4W5RA 2WKSA 1XYVA 3DE4X 1LPMA 5DHUA 5EIEA 1F2TA 3MOIA 4EVIA 1B00A 1CR4A 1IWOA 3O4HA 3S28A 2J30A 2JFOA 3Q3IA 3DDZX 1ODKA 2BJHA 3DVAA 4R1OA 5FBVB 5CVVA 2A9RA 2G0TA 4JQCA 1XGKA 4UZFA 3FMGA 1FTWA 4QJ5A 5KC9A 2GJ9A 5E0KB 4ENVA 3EXFB 4ER0A 3NHBA 4G9GA 3DA8A 4CUJA 1DKUA 2QT9A 5JAHA 1TM4E 4B6QA 4Q19A 1WUJS 3TSZA 1YHZA 4JEHA 4H3VA 4IOLA 4KO8A 2NNLD 3QX3A 3N39C 1TCCA 2JZNA 4IXNA 4WJKB 3AINA 3DHVA 2M32A 4DQUA 4UFPA 1P1IA 5IVHA 4C05A 1TD1A 3OUUA 2Q3CA 3R8FA 1R5BA 4WPGA 1PYGA 1WX1A 16PKA 3A4VA 4ENSA 2C2BA 5CDTA 1EMDA 1XXHB 2OY0A 3A1NA 4INZA 3UT5B 2YV3A 3UXMA 1J5EB 2WLTA 3HTXA 1K6MA 3N7UA 1OBCA 2ZBEA 3OZUA 5A9RA 2FQXA 4TLBA 1A9PA 4GGMX 1OFUX 3ZIDA 1W93A 4RH1A 1ZU4A 3OE1A 4A6DA 3F6CA 1Y1QA 1NC1A 1V6AA 5CJJA 1H0SA 2E2WA 3LS2A 3LKBA 2C59A 3W2FA 4DAOA 1K68A 3TBHA 1GL7A 5CAEA 3ABZA 1TUBB 3JQRA 4BCCA 1Y7PA 3PUWA 4RHCA 3RVJA 3T7TA 4CEJA 2Y0DA 2ZVJA 4ABYA 3GLFA 4RPJA 2Z5VA 4Q1EA 2PZJA 2XTMA 2CYAA 4NBKA 4TXHA 1QQ6A 1QVZA 5GV8A 2A3RA 1X2EA 1DIGA 5ALIA 3QWBA 2NO5A 3LQFA 1F1JA 2J3IA 3QPCA 3EF3A 4OY3A 6NULA 5HM8A 3E7XA 1OWPA 1NBHA 4K6MA 1WXFA 4G37A 1F2UA 1O54A 4DDHA 4HX5A 5LZ5A 3OICA 2NNWB 1JBEA 3AF2A 1SQGA 1O03A 3PR2B 1I36A 1XQVA 3KYDB 3CZQA 3TLGA 2FVXA 1LLCA 4FZVA 5D5HA 3W34A 3K0CC 1EUZA 3M89A 4BIIA 5JQGF 3ROKA 1WZIA 3B6JA 4EGJA 4YJ2F 1JI0A 3Q1KA 5FKJA 4GXTA 4FEGA 4JB8A 4R16A 3Q5GA 4YXWD 1SMKA 4UEQA 4B46A 3C8MA 2JFWA 1HRKA 1IIBA 4HLDA 2UYYA 3TRKA 5JFTA 5BYKA 4EA7A 1V96A 5CT5A 5CXXA 4YRTA 2PKYX 4MDFA 4IHJA 2YVAA 2GZDA 3B9QA 4H7DA 1HFEL 1Z6TA 1YKSA 5KYYA 4KXYA 1X9GA 3L04A 3V1YA 3T9AA 2VP3A 3ZLVA 1AUPA 4NVRA 4BLRA 3HCOA 2RHHA 4GRDA 2RCNA 4KBGA 3TAHA 1HGXA 1H2RS 1NLFA 2ZDHA 4FGSA 1GCOA 3H9UA 4QATA 3DZCA 4F4JA 4PAWA 3PNOA 4GWGA 2ZYUX 4J90A 4YRBA 3I58A 4WXYB 1LLFA 2GD6A 4I4LA 4YDRA 1JPJA 2A3NA 4OHZA 2NVUB 4F91B 2QUIA 2XMBA 2WZQA 5LZ7A 4OGWA 1IY1A 2PUJA 4YACA 3GJZA 3Q9NA 4JUDX 1ANKA 4QELA 4KG7A 5ALKA 5GOTA 1B1CA 1EA7A 1R50A 2X3YA 1PTJC 3DV2A 3R6DA 3LDHA 1W19A 4NU5A 4PO9A 1C50A 2HJSA 3JU3A 1NWCA 2RKOA 4DV7B 2P68A 2XVXA 2XYQA 2XY4A 5ALZA 3O1JC 5AVVA 3TUZC 3SEAA 3PX7A 4N3BA 3MCAA 4EL0A 2F1RA 1U3TA 1GNQA 3AI1A 2IYEA 1KYZA 1JE0A 2BM9A 1HDGO 2ZWMA 3GT3A 1XAIA 3M9XA 3N8NA 3N9IA 2XBMA 4QRHA 1RCFA 2HIAA 4YHBA 4OA5A 4IIJA 4E12A 2V45A 2RGDA 1ISHA 2O8DA 3DE5X 1VLZA 1EXMA 1XLUA 3EUFA 5THKA 2OM2A 5TGZA 2YNMA 2OESA 4MPDA 4MVYA 1JSRA 2IYWA 1NM5C 1CNMA 5IWCA 1QYDA 2JAPA 2V9PA 4KSBA 4NPHA 6PFKA 3T3OA 1BVYF 3LC0A 3PHGA 2JHAA 4IEEA 1E3WA 3PEUA 4CM7A 1QYRA 3C5CA 1TZ2A 3R74A 9LDBA 2B6HA 3WP0A 3IUPA 3H5VA 5FLKA 4PEVA 3ZXYA 4AN1A 2VQEB 1VCIA 2UYOA 4MXDA 4LDRA 2J7PA 3GMIA 5HUJA 1SUSA 1XC7A 1XK6A 2R65A 1Z39A 4MYSA 4QDOA 2VHZA 4QBIA 1B3BA 1QUFA 2VNKA 5FBQB 1MG5A 4PBSA 2ZPTX 5CXSA 4B0OA 2SECE 2QU8A 1GPNA 4M8IA 4NBWA 2FPMA 5EIBD 3BG5A 4EHIA 1EIWA 3CU5A 4X90A 2ZSIA 5C2JB 3HN6A 3MTJA 1A3CA 4I3FA 1MMFB 3PA6A 1WD5A 3IUQA 2FXIA 1ZNXA 4L22A 5JDIA 1JU9A 3WNDA 1E4EA 2VKTA 2PRIA 3LCUA 2QTNA 1KK2A 5A9SB 1ZKMA 2F1JA 1L2TA 2JAWA 4TL8A 4PNEA 3QP9A 1L7DA 4C3ZA 2FY8A 1NUSA 1U8TA 4LNHA 3RJ5A 3PRYA 2VTDA 3IL2A 3IDSA 2JHCA 2EEZA 1YVPA 1IQUA 3GLUA 5F5XA 2WJHA 1U0RA 1VHWA 1E3JA 1XTRA 3C3CA 4JZKA 4YLEA 5L9AA 2ZM6B 3IAAA 3OKFA 3DHEA 3VX4A 3I2IA 3I2JA 2WD7B 5CJPA 2H85A 2MMCA 3TRIA 2VDMB 3JYNA 1PL0A 4EZIA 4QFDA 2I7TA 2ZRJA 3UCXA 3GLVA 2B61A 3GRCA 1EK0A 1EUDB 2OYCA 1GZ6A 1PZEA 2SCUB 3OPYI 4IEIA 1S96A 1XMPA 2EZUA 4CG0A 2WU8A 3RFFA 3H1BA 1E79A 3ENNA 4QWWA 5LB4A 2IOFK 3CJQA 1YMUA 4XA8A 2BE9A 3MGCA 3ANMA 2O59A 1PFVA 1H9CA 4QGBA 1G41A 4GM4A 5H0IA 3A3NA 3G49A 3GW8A 3DV0B 1RLJA 1TM5E 3GROA 5C81A 4MYCA 1ZRHA 2H9AA 1RCUA 3T12A 3A1WA 1BE6A 5F2NA 4EJ0A 3JWIA 1LDBA 1OF1A 1YS4A 1NDHA 4J0IA 4AJHA 3KHSA 5M2QA 1E20A 4TMXA 3ZWPA 2I6TA 1W0JA 2ID7A 3QKSA 4D0LB 1AURA 4EI9A 4IIEA 3MGGA 4I55F 3KDPA 4OXIA 2VNAA 4M54A 2WP8J 3CUTA 2F7SA 3DHNA 4TUYF 5I7EA 3DAYA 3KEOA 3GLGB 3SNHA 2FWIA 4DZRA 2AOVA 5FFMA 3GI1A 3DO5A 2QI9F 2GN6A 1JWBB 2YYZA 1UT8A 3CKYA 5DYTA 1LUAA 3IQEA 2OBMA 5AW7A 5KREA 1YJ5A 5C4IA 5AW0A 1Z2PX 2PBLA 3A26A 4TWZA 1BG6A 1L3IA 2OLKA 2C95A 5IFKA 3FX2A 2PKXA 2UZ0A 4GG1A 4DLRA 2H11A 4O4LF 4F46A 3EVFA 2Y99A 1Q3KA 3G82C 2CJWA 3QPDA 2JI8A 3KR2A 1KAOA 1HURA 1XTUA 3PL5A 1O5IA 4IAOA 4M9XA 3TOVA 1IXZA 3PPIA 2EX0A 1ONSA 1C9DB 4JJZA 3C5EA 1JLLA 1TM2A 3VBEA 4CLEA 4QQKA 3OCYA 2JFZA 4HDQB 4DA7A 4DILA 2FPOA 1G5TA 5HA5A 1BNCA 1K0UA 4JLUA 2QUAA 3U4IA 1TU4A 2FHPA 5COQA 4TLCA 3WGIA 4JASB 1L5QA 3UN1A 5K0NA 5CA0A 2W2KA 1T3HA 3O8LA 3EPJA 2BR3A 4N0PA 4ZQEA 1OLSB 4RKEA 2XUFA 4AZ3B 2FEPA 2ZS9A 3NHPA 3DDWA 3RARA 2OGZA 2QGFA 1RQLA 1V37A 2WV7A 3DP9A 5FNVF 2AFIE 2GKOA 4FOSA 1AQYA 3Q7QA 5MN6A 4A15A 1HE1C 2JGEA 1Z37A 4FMCF 1FVOA 2I71A 1SOAA 2ZI5A 3P9PA 4KXLA 4RF5A 3VPFA 4D8WA 1NMQA 2QQFA 3NOOA 3Q2OA 4BNIA 3JQDA 3R9IA 5CB0A 5LIPA 3FWHA 4O1MA 3PQFA 2DFDA 3IT2A 2I6QA 1SKYB 1TE2A 4X1IA 1XYGA 3VVLA 3W2GA 1IN7A 2V59A 2B69A 3AUFA 3P4YA 4PPNA 4GL4A 4BQNA 3ROFA 2FUKA 5IM5A 2CHGA 4EBBA 3VYRB 3ZVKA 1WMFA 2F2TA 3QPUA 4AJKA 1E0KA 2P0EA 1B42A 3G2NA 4OO3A 4M1MA 1EEHA 3IEXA 5B2ZA 4IDBA 3RIXA 2QTVB 5BR7A 5I4CA 4G23A 2W6ID 5AJXA 2BZGA 2QRUA 3ZLBA 2KHZA 2I65A 3V1NA 3ASYA 2QZZA 4N0MA 5EI5A 4LZJA 4B7AA 3A3PA 2XCIA 3O7WA 5CBPA 1IN4A 5E8JA 2O2XA 1W9HA 3G7NA 4G4JA 1R12A 4K86A 5HCNA 5IDVA 3RI3A 4CFSA 3KYCA 4Q7EA 2D62A 3MK31 2IV3A 4E15A 5GAJA 1FRQA 3NEJA 4EUNA 1C1DB 4ZICA 1G5QA 1JQJC 2H54A 3IDAA 1CUDA 3KYIB 3PP8A 4MH0R 2VYQA 3FMOB 3H86A 3O9VA 4FN4A 3EVNA 2MIIA 4JBWA 2Q6TA 3H2HA 4WZAB 2XX3A 1SC1A 3GZTB 1LV7A 5F9HA 1U3VA 4Y0VA 4DLAA 1RZRA 4M9UA 5C4GB 1F4VA 1VYHA 4ZO4A 4GD3Q 1HYEA 4Q9NA 2PSHA 1YL6A 2ONKA 4WKBA 4WY5A 3SM9A 3D4BA 4Q7LA 1DV1A 1IDN1 1XZJA 3NALA 3GT4A 3LRTA 4ENPA 4AKGA 2P9QA 1NI5A 4JL6A 3UMGA 4KPYA 3CLSD 4H6VA 2G25A 1PJAA 1NBME 2WHXA 4WLUA 1BROA 1QG2A 4C43A 4QKQA 2R00C 2K5UA 3NDJA 4Y98A 1UBUS 2AA3A 5G3ZA 1EFRA 2H4ZA 4TKLA 4MS4B 5TQ0B 3RK4A 4B87A 4FS3A 2IWRA 3EVCA 3G0IA 3QVOA 2NU7B 2JGFA 4IIBA 4PIVA 5DFAA 3TTTA 3UA4A 3I52A 1AK1A 3QX7A 4BX8A 4EJSC 3AUUA 4X1KA 2LNDA 1H8HD 3M5PA 1YVEI 3SKVA 3EOBI 3K2QA 3KZCA 4P33A 3W5IA 3ZIAD 3ADCA 1OIWA 1JEDA 1JAYA 1MPTA 2NPIA 1S4MA 3COZA 3KZMA 3N2ZB 2IDZA 1U28C 2G28A 1C7ZA 2NSYA 3AONB 5FOSA 4IWNA 3WSTA 5FBHA 3AHIA 1STOA 4IQ4A 3U17A 3ZWBA 3AVVA 3BJMA 1G64A 3C87A 1QV6A 4OHMA 5FOWA 3HI4A 1EGQA 4YXWA 4OHFA 3AEQB 2XOXA 3B1VA 3EZ9A 3KLBA 1Z15A 4AJEA 4AB1A 4JP3A 1CEEA 3LK6A 1TZKA 4D3ZA 1PQUA 1EHCA 5KDLA 3VKUA 2PV0A 2ZSAA 4Y9RA 3E1SA 4XVCA 2DZDA 5CD9A 3A11A 2IPOA 4NSNA 5IFLA 1EX1A 4GR9A 2RK6A 5B3AA 3Q0TA 4N5HX 3Q5DA 3DMNA 1QBKC 3C3EA 3O9MA 5JY6A 5IJ0A 4JQSA 1E2BA 1V7PC 1F0YA 3E3AA 3CT6A 4O4JF 4PS0A 5K2MA 4B47A 3HHEA 3BXEA 1G5HA 3LQQA 1G4AE 1JLKA 3HZOA 3L0BA 3UHAA 3ZY3A 3U6KA 3MUOA 1QQBA 4ZHQB 4A36A 3CNBA 3GJ7A 1ZEMA 5DNUA 1EFAA 3OLXA 5DN6D 3CLVA 1A9XA 4MW9A 3MBKA 3QTBA 3FF1A 3NNNA 1DBSA 4WUTA 4P3KA 4O4IF 3AK4A 4C5BA 1WSDA 3KR0A 3TLYA 4R2WA 1QX3A 2PUTA 4V24A 4BO3A 1R0WA 1RWXA 3DO8A 3LIIA 4TS3A 3TVYA 2ZT6A 3FZYA 3OZBA 3R40A 5HKKA 3G17A 4QXPA 4HS9A 1IN5A 4O2AA 2X5KO 1NMZA 3TZQA 3WISA 4B7ZA 3KUCA 3R3WA 2H48A 1BXGB 1M73E 2BR5A 3KFVA 2Q0QA 4X3OA 5H3LA 1XTBA 3K1YA 4BJHB 1D5WA 4IDGA 4RV5A 4JN6B 1KEUA 1ZRSA 3ZCPA 5HIAA 3NYQA 2O5EA 3VZBA 4M7PA 4FILA 4E30A 4LSWA 1L8QA 5LQNA 1N57A 4L4SA 4FYIA 4FFMA 4LRYA 3K9BA 3AH8A 4NJMA 4D3SA 4BNXA 1YBMA 1YFKA 4GEKA 2YW9A 1E9VA 4YP0A 1KEEB 4U9IS 4BB5A 5JH7A 2OB2A 3NV7A 5B37A 3BWCA 4X6XA 2M6RA 2VDJA 3BGVA 1PR4A 3BZUA 3WGZA 3DYVA 2A58A 3BWEA 4BNTA 1GPUA 1SUCA 4AURA 2R1VB 3QX9A 3A9TA 3BH6A 3HKEA 1WETA 1LFDB 2GETA 2QPLA 2VJYA 3V2HA 2PZBA 3E9CA 5F2OA 4ZT2A 4V2IA 3ZDEA 2ZYSA 4EF6A 8ADHA 4U00A 5H4GA 1T0PA 3J81k 2OZPA 1Y37A 5IC6A 2V7QD 3MWJA 2PUCA 1KK1A 2YY6A 2X4IA 1Q14A 4KGZA 2UKDA 4D3DA 5BSHA 4J16A 1EI9A 4RKWA 1UDCA 1X1EA 3A37A 1MO3A 3LRPA 3SYLA 3SJBA 2ISSD 4WMLA 2QDXA 4BFCA 1CX9B 1ZYUA 4CTOA 3FLEA 1P0CA 2WPDD 4K9SA 4N4AA 2DPXA 1RJFA 4NZNA 2ZE5A 1II9A 1WB6A 1UR5A 3WLPA 3T61A 1KIMA 2YXLA 3SXUA 3W3AH 5FULA 4FMDF 4NHEA 2UYHA 1T4DA 2GXSA 5B6IA 5LBTA 2F64A 4Y1RB 1HORA 1L5ZA 1LQTA 2PNFA 2PX6A 5CB8A 1U8YA 4DADA 3ROZA 3F9IA 4XGIA 1I2MA 4DGQA 4CDGA 4BZZA 1E1RA 1O94C 1D7AA 5DGHA 3O90A 1I1OA 1W1WA 3TNLA 3UAGA 4AP6A 1D2RA 2FWRA 4WE3A 1QCZA 4GPTA 1CIJA 1NXVA 1ONPA 4OBXA 4Y2SA 3V7YA 3FROA 1RWOA 2Z5FA 5IHXA 2OORC 4AO7A 3MWFA 2VT3A 4UHCA 1U8FO 1ZK4A 4FLMA 1UJ2A 3ITNA 3OA0A 3OJCA 3ZWMA 5EMLA 4AQYB 4KXWA 4ID9A 4FFNA 1ZJ6A 5LDGA 3IT3A 4A4DA 4CN9A 1WNTA 4DHWA 2GZSA 1C2TA 1C8KA 4TOIA 3P26A 5DOZA 3OCXA 1KJYA 3TPFA 3O47A 4D45A 3D0RA 1LNSA 2I8CA 4ZVKA 2OAP1 1EM8B 1O2DA 1PNTA 2WJZB 1IBSA 3C3JA 3PQ5A 2HLPA 2G9ZA 1QDEA 2VNSA 5AKXA 1HUQA 3BE6A 4IDAA 1UMCA 3I5YA 3OM9A 2RGXA 3LKVA 4C4TA 3LGXA 1V8PA 2ZREA 3DFIA 4M21A 5KU1A 3L79A 2WSYB 5KVVA 1JMYA 1V9SA 5AKZA 2EKPA 3U39A 3QXCA 5KB3A 1YWGO 1JECA 1NLZA 2PT7A 4BJ6A 3EIUA 2HF9A 5DX1A 2DUNA 1ILEA 1Q0HA 1XU4A 3CM0A 3N0TA 2O05A 4KE8A 3EXIB 1Z22A 2I2XB 2W6MA 1V26A 2QVYX 3NDRA 4R2LA 2I91A 3BGIA 4D0RA 3SQXA 3MIZA 1A50B 4LQDA 3HE3A 5JRZA 1ORVA 3SYNA 3A1FA 4GOXA 4TL7A 1BMQA 2HDNB 4KAFA 2BGUA 2H5LA 3JTMA 4OHOA 5GJCA 2ONJA 4IV0A 4DMKA 4Z3KA 2FWMX 3JQ8A 2FOLA 2GO1A 1ATIA 2VTKA 3GA7A 4YJGA 1GY8A 4D8XA 1CY1A 1FYEA 2BFCB 4U7TB 1JTVA 4EZBA 5IJ9B 1EHYA 1L4EA 1QGDA 3ICCA 3QNWA 4OQMA 5E7IA 4J49A 4RXTA 4UOQA 2QPOA 2FSFA 4BFYA 4BKUA 3NTLA 2M1ZA 2OHGA 1S3FA 2AN4A 2WWGA 4KGXA 3KT8A 2PFSA 2XMQA 4GX5A 4IZIA 3FOCA 1KEWA 1WD7A 2MSNA 1BD3A 1O9GA 3OQ6A 1OHHA 4OB8A 4DYHA 4LYJA 3NBZC 2BOVA 4PGMA 1CIPA 1XK7A 1O3YA 2BISA 2BPOA 3EQ8A 3E82A 1JLRA 2E4YA 3JCZA 4DREA 4RX1A 1QV9A 2N1BA 4J7UA 4LG1A 3CCBA 4G5XA 4BLWA 2V55B 3E9NA 5BNTA 3AKYA 2ZR9A 4CLRA 4LOKA 1K9SA 3N2EA 4IDHA 4QU8A 2ZT7A 2F1HA 4Q24A 2AQKA 1AA9A 4A5OA 2PUHA 2VAMA 2X0IA 1OOEA 2SBTA 5DBGA 2HMUA 3DFKA 5F21A 2JK0A 4DR1B 1KC1A 3K1AB 4NRDA 5CX1A 4L50A 2VS1A 3DTVA 4RA9A 3N8IA 5J47A 3ADOA 4RVFA 2IL1A 3EWAA 1UH5A 2CMHA 2O2JA 3K4QA 3U9SA 3KPJA 4D4JA 1XRLA 5EWJB 4J0GA 1N8TA 1XXLA 3KT3A 3UMRA 3JVDA 1Z5WA 2IKSA 3EQ2A 4WCFC 3FTEA 4LOAA 3KKNA 3ZV6A 4FYPA 1T29A 1L7OA 1V5FA 1HQDA 4JT4A 4URUR 1G21E 3QWFA 2LV8A 3LBIA 3SQNA 3GWGA 3IQIX 2QTFA 3QE3A 3WWPA 1H4TA 1P7PA 1SXGA 2DCUA 3MUNA 3PC2A 4I4IA 3ETGA 4KLZA 3U7JA 3MINA 2IXBA 3L46A 4FGWA 3H4TA 2O3RA 4LSZA 4KJZA 4CKEA 3BD9A 4ZC8A 4MZDA 3U4QA 3AR4A 3KEQA 3W90A 4KDFA 3GARA 5BVGB 3IAM6 3PFGA 4P5EA 4Y2YA 3H9GA 4HFJA 4GAEA 3ORSA 3G89A 1EFDN 4W5OA 1E3IA 1KSJA 4XFDA 3W2IA 2A14A 5BMVB 3VUFA 5IEJA 3NORA 1CYDA 3AFIA 5BQPA 5AKGA 4CIYA 5TVGA 3KAJA 4E88A 5A0VA 2ADOA 3HJNA 4P36A 3UCEA 2VT2A 3DZHA 4YGXB 4PRLA 3Q0IA 1HTBA 4R8MA 4WNAB 3UAZA 2J9FA 3K5PA 4FEEA 4NMWA 4IVRA 3QJ5A 1G0OA 4HLCA 4Z0PA 4Y0AA 4DCJA 4P7KA 2E5FA 1JA1A 4OVKA 4YONB 1UOEA 4KXQA 5AVJA 1P5FA 5HKOA 4MS3B 4M1KA 3IQXA 3M4XA 4N18A 4C9BA 2XGOA 1M1YB 2GXUA 3FF4A 2E55A 1DAIA 821PA 3P96A 1N92A 2WTBA 4JK3A 4BZWA 1A8UA 3L0OA 1OWNA 1RPAA 1T6BY 4K28A 4EG5A 2WWIA 1V5IA 2PDAA 4R2KA 3DH0A 3RROA 2OCDA 1YMVA 2CFTA 3SDZA 2GEUA 1IQPA 1FDUA 3JW8A 2IV2X 1JEYB 1FDOA 3P2EA 3K5WA 4JP5A 3GFPA 1FBNA 3QW4B 5DYWA 2ZZKA 4U63A 5LZ8A 1B0AA 1NAIA 2X0EA 4D9MA 5JC8A 2XKAA 4MWDA 1PTKA 3C4QA 2BFFB 4WXHA 1BFDA 3MQ4A 3I9MA 1T26A 2ERCA 4WH0A 3SKXA 4NXNB 1ID1A 3U60B 3P20A 1TTHA 4GZ6A 1DBWA 1TKBA 2D3WA 4DOMA 4KVAA 4Y30A 1J2YA 1L1QA 2IP1A 4UTOA 5FX2A 1IZ7A 4ZYWA 3WOVA 1Y8QB 3RREA 4XKJA 3BMNB 3IV7A 1OLOA 1DTEA 1X8LA 2VN8A 1RLIA 2NADA 3CCCA 1RWVA 1Z4OA 1RVV1 1FUYB 2XCLA 1S2LA 3HDJA 5LQJA 2XGSA 4MJXA 3ZK8A 5JCPA 3BMOA 2N3ZA 1WQ1R 3CLTC 4JLJA 2H1CA 3VSAA 1Z7YA 4RM3A 1M7GA 1W44A 1XLTA 3KXLA 3TTSA 1NJSA 3VTAA 4AP9A 4C87A 1JHQA 2W4QA 3EZYA 1P7VA 4DM3A 1Y1SA 3GY0A 4CIDA 4F4CA 2AOXA 1QRDA 2CKDA 3F2VA 4Q9LA 1GKUB 2YHIB 5EESA 1FYVA 2CMGA 1JHYA 4HYTA 4A0RA 5CLIA 3IUSA 1IPEA 2RBEA 2ZIVB 4D46A 4YCMA 3IC5A 2BSAA 5JH7F 2B83A 3OFVA 5JBQA 1HG1A 1R0LA 4DWVA 2IHNA 2N75A 3OT1A 2VK1A 3HU3A 1A98A 1PU2A 2X76A 2VPQA 1TPZA 2ZJBA 1EESA 1H93A 5LP6A 3Q9UA 2I03A 2VYVA 2Q45A 4RXMA 1EVKA 1DS6A 4JUBA 2PJDA 1I2CA 1YDEA 3ZV5A 2W0SA 3K2EA 3DL2A 1T6NA 4HDNB 4XQ9A 2PPLA 3UOWA 3FB4A 5H9WA 5LU9A 1CUGA 5HBGA 1TEZA 5HILA 1N34B 3AERB 3VR0A 4JWTA 3ZN2A 2PRYA 2R3SA 5CEJA 4F4FA 5KQPA 4NV1A 5AVUA 2JG3A 2AI2A 2IBTA 1XAJA 2PWYA 2QL6A 1FS4A 1ORDA 1BQ4A 4Y2VA 2ZR0A 2WWWA 3MXTA 2FZGA 2CDCA 3IP9A 3K30A 3B36A 3LRXA 4E51A 3EQ7A 1XIVA 1M34E 2E89A 2MYNA 2V7QA 1PAUA 1MO5A 4Q18A 4XW2A 3V8EA 4XJTA 4B6RA 1G4UR 3MT0A 4ADSG 2DKNA 2XNDD 3DTTA 4UQPA 5TR9A 5LQKA 4V0NA 3GFSA 3OCVA 2BI4A 1BA3A 1PJTA 3PWZA 3ZCQA 2FI1A 1VECA 4J6FA 3TXYA 1MT0A 4BWGA 5BT8A 3RJTA 2XRMA 3OZIA 1RRGA 4GR5A 3TOSA 2QQGA 1NLUA 5DGIA 4EFNA 4Y2XA 4YTEA 1UIRA 1PF7E 4W7IA 4F2HA 2QLTA 2RHJA 1PLKA 2VDWA 3A4YA 3DAFA 3KXKA 1BRTA 3EXAA 3MCWA 4J03A 3RIMA 4YJKA 1T5IA 4RJJA 1YQTA 3VU3A 4P83A 3EFBA 3ZNNA 3EVDA 3GT7A 1VZ2A 3SLRA 2Y77A 2AW3A 4RCYA 1BDBA 2QNBA 4NK5A 2JIBA 4GI7A 3ZOZA 3DLCA 4AJIA 3A9VA 4LYAA 1Y7TA 2W6NA 2P4SA 5T3UA 3MJEA 3T3HA 3UUFA 4DPKA 1PGJA 1TCUA 2E1RA 4KKVA 3EMVA 5DYNA 4BECA 4XB6B 4F2DA 2X22A 5F3DA 3T1TA 3CF4A 4FLFA 3VR3D 4D99A 1TZMA 2A9QA 3SZLA 3GLHE 4DT1B 3FSGA 4CF7A 4OHUA 5BSGA 4D7AA 2XCRB 5DHPA 4E5DA 4CLXA 1CJMA 1NP7A 4NNJA 2WSMA 4WI1A 3X2FA 3D2LA 4BO2A 5CIQA 2I87A 4EHKA 3H2GA 1YIAA 3H1TA 5KTKA 3ZHUA 2YBDA 1B8VA 2C54A 2E4AA 4JI0B 1JYEA 2ZIEA 3UTDA 3R3HA 2XRZA 1KH2A 1XDBA 2YINC 3LF2A 4LOJA 4ZO6A 5FPPA 3SQMA 4BNKA 2HA4A 4R4JA 3R9KA 2ZUUA 3JQPA 1DC4A 4MW4A 5T64A 3RYIA 5IPFA 5DNAA 3BJZA 5TF4A 1AM4D 4Y0NA 1OX5A 3W6PA 1KARA 3PITA 3EWNA 4F5ZA 1HE8B 4LQ4A 2EIXA 4LXQA 1L6RA 1AU9A 2Q3MA 3I1YA 5LJIA 1B41A 1DKPA 3RVKA 1LPAB 2NTYC 1A8IA 4IY1A 4G0MA 4UTXA 4BAUA 4WOKA 4CLHA 5B4VA 5KVCA 5LOVF 2WEKA 3VR6A 3DWEX 1U0BB 2WZCA 2JJQA 3PHHA 4ZEVA 3QELB 4MV6A 4QL3A 1RP7A 4UU0A 3H1FA 2VDLB 4QARA 3H05A 2JKYA 1DNPA 3PC4A 1HTWA 1J9ZA 4IILA 1EE1A 3LC2O 1K6JA 1Y4SA 3P2IA 1ULAA 2BN4A 4LPKA 5JNRA 5J2TF 3QRWA 3EIXA 2YIVX 4B5KA 3GVPA 1NKTA 1U31A 4GO1A 3BSYA 3L1JA 1OC4A 2E87A 2WOJA 3M6MD 3VJMA 3ZU5A 4MUBA 2ZPAA 3JARB 2QB5A 1E69A 2WJPA 2XMPA 4FE3A 4FNOA 5ESWA 4WBNA 4LI3X 4R01A 2AR0A 4IH9A 1Q1AA 3ZQUA 1T36B 1U80A 1NF2A 1J8VA 2P6UA 5AOBA 4FSXA 1Z0IA 4RTRA 1BMFA 4S2EA 3WLSA 3T35A 2GYVA 3MJHA 1N5MA 3W5CA 2C77A 5K6RA 1R16A 3G5TA 4WN9A 1Z8HA 1E61A 1T13A 3V1TC 3VM6A 1GG9A 3IUEA 1Z4LA 2IELA 3UV6A 1PJBA 1IM8A 2C4NA 2GXQA 2ZU0C 3OTWA 5GGYA 3R5JA 1U2GA 2IZZA 4I0WB 3QOYA 1NVWQ 3DR3A 4HK4A 1K7SN 1PLJA 2O2DA 4YI3A 1T3LA 4PR0A 2RB5A 3CNQS 3CCFA 5IANA 5JSZB 3ZKWB 1Y89A 2XUZA 3CZPA 2GHIA 1GTSA 4FK8A 2QT0A 4QSHA 4E2WA 4RK7A 2VQDA 4DIKA 1I01A 1L7NA 1P5JA 1KVTA 2MINA 2WDZA 2ZRQA 3DMRA 4HUJA 3DW3X 3HU5A 4RXUA 5EE5B 1CUZA 1X7XB 3N6XA 2DR3A 4LA4A 1RABA 3D2BA 4QDUA 4ZEOA 4F56A 4QGSA 4KXXA 2HRDA 3DNPA 3V1LA 3W5JA 3B2EA 5GONB 4B4DA 2QBYB 4BBAA 1KDOA 3H6HA 2NV6A 5IUJC 4P2GA 2VK2A 1BE8A 2QVZX 3TZ6A 3C1OA 3PFKA 4Q1FA 1XMXA 1ZIXA 2EFDB 4LSMA 4YX9A 1NLYA 1R6TA 1TYBE 2FOIA 4L15A 2GOYA 1CY2A 1Z26A 2VK8A 3WOHA 3ZCXA 3TMKA 2FUEA 3PI7A 2VHQA 5GGXA 4BC0A 3O8DA 2HWKA 3N6VA 5J4LA 2FFAA 3G79A 2ZI3A 4I9GA 3NHRA 4AF7A 2FRXA 1T8UA 4G5OA 3N53A 4BDSA 5AVZA 5IYZF 3EIFA 4UVEA 5BOSB 1JDNA 4LC9A 5EHIA 1VCHA 2O2GA 2FFJA 3DEAA 4RLHA 3NWBA