3OIRA

Crystal structure of sulfate transporter family protein from wolinella succinogenes
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
122
structure length
122
Chain Sequence
DDPDATSKKVVPLGVEIYEINGPFFFGVADRLKGVLDVIEETPKVFILRMRRVPVIDATGMHALWEFQESCEKRGTILLLSGVSDRLYGALNRFGFIEALGEERVFDHIDKALAYAKLLVET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SULFATE TRANSPORTER SULFATE TRANSPORTER FAMILY PROTEIN
publication title Crystal structure of sulfate transporter family protein from Wolinella succinogenes
rcsb
source organism Wolinella succinogenes
molecule tags Transport protein
total genus 37
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01740 STAS STAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.24 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA STAS domain 3oirA00
1BUZA 3AGEA 4QTPA 1TILB 2KA5A 2VY9A 2KLNA 1TH8B 3IH8A 1THNB 5EUZA 1TIDB 3AGDA 3NY7A 3OIZA 3LKLA 3LLOA 4XS5A 5EUSA 4DGHA 3IHAA 4DGFA 3OIRA 1H4XA 1SBOA 1AUZA 3IF5A 5EZBA 5EUXA 3MGLA 3IH9A 3ZXNA 4HYLA 3ZTBA 1H4YA 3F43A 1VC1A 3IHBA 5EUUA 5EUWA 1H4ZA 1T6RA 3T6OA
chains in the Genus database with same CATH superfamily
3V97A 1N6EA 3AGEA 3OIZA 2DXLA 4XS5A 3GHFA 4DGHA 4DGFA 4HIZA 3VSEA 3MOGA 3V8VA 3C0KA 2CWWA 3IH9A 4HYLA 1V0FA 2DXNA 3F43A 1VC1A 5EUUA 2ZOAA 1FC7A 1H4ZA 1V0EA 1T6RA 2RRLA 1WXWA 1BUZA 2AS0A 3IH8A 1TH8B 5EUZA 3GVKA 3NY7A 3LKLA 4L1CA 5EUSA 1FCFA 2OASA 1SBOA 5EZBA 4JC0A 3ZTBA 2ZO9B 1FC9A 5EUWA 1HF2A 4QTPA 2VY9A 3D03A 3AGDA 2B78A 3EH7A 1N6FA 3IHAA 3D3UA 1H4XA 4GHNA 1WXXA 1K32A 3LDFA 1N6DA 3K50A 4DMGA 1H4YA 3GMFA 1TILB 2KA5A 2KLNA 1THNB 3DUPA 3QDQA 1TIDB 4AEJA 3LLOA 1FC6A 3OIRA 1AUZA 3GVLA 3IF5A 4L8KA 3JU4A 5EUXA 1J7XA 3DJAA 1BPLA 3GVJA 3MGLA 3ZXNA 4AE2A 3IHBA 3DORA 3GK7A 3T6OA
chains in the Genus database with same CATH topology
1BUZA 3AGEA 4QTPA 1TILB 2KA5A 2VY9A 2KLNA 1TH8B 3IH8A 1THNB 5EUZA 1TIDB 3AGDA 3NY7A 3OIZA 3LKLA 3LLOA 4XS5A 5EUSA 4DGHA 3IHAA 4DGFA 3OIRA 1H4XA 1SBOA 1AUZA 3IF5A 5EZBA 5EUXA 3MGLA 3IH9A 3ZXNA 4HYLA 3ZTBA 1H4YA 3F43A 1VC1A 3IHBA 5EUUA 5EUWA 1H4ZA 1T6RA 3T6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BUZ A;  3AGE A;  4QTP A;  1TIL B;  2KA5 A;  2VY9 A;  2KLN A;  1TH8 B;  3IH8 A;  1THN B;  5EUZ A;  1TID B;  3AGD A;  3NY7 A;  3OIZ A;  3LKL A;  3LLO A;  4XS5 A;  5EUS A;  4DGH A;  3IHA A;  4DGF A;  3OIR A;  1H4X A;  1SBO A;  1AUZ A;  3IF5 A;  5EZB A;  5EUX A;  3MGL A;  3IH9 A;  3ZXN A;  4HYL A;  3ZTB A;  1H4Y A;  3F43 A;  1VC1 A;  3IHB A;  5EUU A;  5EUW A;  1H4Z A;  1T6R A;  3T6O A; 
#chains in the Genus database with same CATH topology
 3V97 A;  1N6E A;  3AGE A;  3OIZ A;  2DXL A;  4XS5 A;  3GHF A;  4DGH A;  4DGF A;  4HIZ A;  3VSE A;  3MOG A;  3V8V A;  3C0K A;  2CWW A;  3IH9 A;  4HYL A;  1V0F A;  2DXN A;  3F43 A;  1VC1 A;  5EUU A;  2ZOA A;  1FC7 A;  1H4Z A;  1V0E A;  1T6R A;  2RRL A;  1WXW A;  1BUZ A;  2AS0 A;  3IH8 A;  1TH8 B;  5EUZ A;  3GVK A;  3NY7 A;  3LKL A;  4L1C A;  5EUS A;  1FCF A;  2OAS A;  1SBO A;  5EZB A;  4JC0 A;  3ZTB A;  2ZO9 B;  1FC9 A;  5EUW A;  1HF2 A;  4QTP A;  2VY9 A;  3D03 A;  3AGD A;  2B78 A;  3EH7 A;  1N6F A;  3IHA A;  3D3U A;  1H4X A;  4GHN A;  1WXX A;  1K32 A;  3LDF A;  1N6D A;  3K50 A;  4DMG A;  1H4Y A;  3GMF A;  1TIL B;  2KA5 A;  2KLN A;  1THN B;  3DUP A;  3QDQ A;  1TID B;  4AEJ A;  3LLO A;  1FC6 A;  3OIR A;  1AUZ A;  3GVL A;  3IF5 A;  4L8K A;  3JU4 A;  5EUX A;  1J7X A;  3DJA A;  1BPL A;  3GVJ A;  3MGL A;  3ZXN A;  4AE2 A;  3IHB A;  3DOR A;  3GK7 A;  3T6O A; 
#chains in the Genus database with same CATH homology
 1BUZ A;  3AGE A;  4QTP A;  1TIL B;  2KA5 A;  2VY9 A;  2KLN A;  1TH8 B;  3IH8 A;  1THN B;  5EUZ A;  1TID B;  3AGD A;  3NY7 A;  3OIZ A;  3LKL A;  3LLO A;  4XS5 A;  5EUS A;  4DGH A;  3IHA A;  4DGF A;  3OIR A;  1H4X A;  1SBO A;  1AUZ A;  3IF5 A;  5EZB A;  5EUX A;  3MGL A;  3IH9 A;  3ZXN A;  4HYL A;  3ZTB A;  1H4Y A;  3F43 A;  1VC1 A;  3IHB A;  5EUU A;  5EUW A;  1H4Z A;  1T6R A;  3T6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...