3OIVA

H-rasg12v with allosteric switch in the "off" state
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
160
Chain Sequence
b'MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Allosteric Modulation of Ras-GTP Is Linked to Signal Transduction through RAF Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 59
structure length 160
sequence length 166
ec nomenclature
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3oivA00
3LLMA 4LDJA 1XCPA 2K5UA 4KV9A 5FOWA 2O8DA 3OFND 1DARA 4JVLA 2GEDA 5F2EA 1D9ZA 2QEQA 4RFSB 5HR5A 3PEVA 1MKYA 1R7RA 4B35A 4H9GA 2ZJ5A 2VHQA 5E3HA 5D3MA 4BFSA 3W9YA 4LHZA 1RYHA 5FTMA 4ZPXA 1G21E 1IXRC 4DHEA 2QPTA 4XOIA 1G3IA 2YC2C 1WXQA 3O8DA 2IUUA 3CW2A 2IYUA 4EPWA 4U5XA 2BM1A 4QGGA 4EDHA 1CIPA 5IHPA 2CXXA 3VAAA 1H8HA 1II8A 3PEWA 1E9BA 5KYKA 1XNJA 2FNAA 5FBQB 3B85A 1NIPA 4P31A 1U2RA 4DSUA 4NYMR 2R6CA 5GJWC 4DCTA 3HP1A 5IRCD 1UADA 3KJGA 1SKYE 1SKYB 4LC0A 3B1VA 3AF0A 1JAIA 1SGWA 2VP4A 1ZM7A 2QNRA 3C14C 2VTKA 1S1MA 4PPQA 4DT1A 1H8HD 1ZC3A 2QU8A 1U0LA 3MMPA 1NF3A 3FKSA 4JLOA 4D6PA 2BJVA 1W36B 1P2SA 3U3RA 4Q9JA 1GKUB 4LUCA 4E07A 2ZRAA 2BIFA 3FMFA 1VYVA 5EXXA 1G5PA 2VLIA 3O8CA 1YRBA 2YKGA 2GEUA 3CR7A 3THOA 1AQYA 3KKPA 4JLAA 2XTMA 1LV7A 3OIWA 2CEAA 2GZHA 3UMFA 1NVXQ 1SVWA 2MMCA 3LLUA 4FCVA 3FKSD 3W8RA 2HYDA 4B3BA 2IK8A 2RMKA 2I4IA 3L0OA 1KO5A 3SNHA 1YZNA 4B3GA 4URUR 4HLDA 3O47A 2EVWX 3UWKA 1P7CA 1II9A 2WBLC 3OIYA 2IYWA 5F9FA 4L9SA 5A4JA 4QBHA 4ZCIA 4UJ5A 3QXHA 1CJMA 4WAUA 3OE7D 5DNYB 2QA5A 1XZQA 2FGJA 1OFUX 4DVGA 2RKOA 1IJEA 5B64A 3ZS8A 3B13B 2FPKA 1Z2AA 4JZKA 1KI1A 2GA8A 3VU9A 3C5CA 1WMSA 4LPSA 1SVMA 4QJ5A 3RRZA 6Q21A 5E7MA 4V0KA 3EIQA 3AGQA 1XJQA 3DKPA 2RAPA 2FSGA 3QVVA 4RD6A 1EX6A 1P62B 1V5WA 3TSWA 2BBTA 3E70C 3X1WA 3BFXA 2OBLA 4OJKA 2RHMA 4CEIB 2A5GA 2ZYVX 4LYHA 1GOTA 1QG2A 3AKCA 3ZVNA 1YZGA 1VDZA 4LJAA 2Z43A 2EYQA 1IN6A 4D4MA 3MD0A 2IS6A 2ZRFA 1K8RA 1E0JA 2BMEA 2ZREA 3L0IB 3IPXA 2ZROA 5FI1B 5FOSA 1DO2A 5EZ5A 2ZRBA 3DOEA 1W2GA 2ORWA 2P6NA 2WWHA 3MJRA 4D82A 1ZP6A 4KFSA 2J87A 2WPDA 1WDTA 4XIGS 1W4CA 4KFTA 4BQSA 4W7SA 2OE2A 5C18A 1SHZA 3K09C 1RIFA 3ZD7A 3CBQA 4ARZA 1OXSC 4JLDA 1P5ZB 4IHQA 1BOFA 1VHTA 2CLCX 3AKEA 1E94E 1GL6A 1Z5ZA 1OH7A 2BMDA 1DAFA 1TEVA 3VNUA 4MYUA 3WYFA 4V0NA 1NG1A 1TL7C 4LHXA 2WPDD 2QMUA 1KK2A 2F1JA 3MLEA 4OJQA 4TQAA 1CP2A 2ZS8A 4JBXA 1OIWA 1CR1A 3EZ9A 2C9YA 3LRPA 3WNCA 1OXUA 1R5NA 4YQFA 1JPNA 1ZAKA 1DE0A 4PHTA 3K0SA 4TMKA 2RGGA 1WE2A 4ON9A 4A8JB 4QGAA 2VSXA 2BMFA 2GAAA 4WXRA 4CT5A 3IKJA 1ZVQA 4LK2A 4IVRA 4A2PA 4QFMA 1OFIA 4PZLA 4S35A 1KNXA 3TBKA 2J45A 3RC3A 5AWFC 1MABA 4KJZA 2WAYA 4NCNA 3IHLA 4M1TA 3RVBA 2FMXA 2REBA 1NP6A 4B74A 2EFGA 4PFSA 2P2LA 1FW6A 2ZAMA 4GOKA 2X77A 2Z0MA 3AEZA 1KJWA 1GDDA 1P4SA 2WOOA 4LI0A 2XNSA 4ACAA 3V4FA 5KU1A 2XTZA 1EX7A 4WXPA 3QKSA 2IYQA 2ZRHA 3K53A 2YHSA 2B7CA 1CBUA 2FZLA 2KJQA 3CM0A 2XZLA 1MO6A 2PT7A 1Z6GA 2IS1A 3T1OA 2JLYA 5CDFE 2JLVA 3D3QA 1E96A 2ECKA 2V7QA 4TL8A 4HZIA 3A4LA 1VIAA 2IEZA 4CIDA 4PX9A 1G20E 1Q44A 3QG1A 3EZ7A 2A78A 4LJ7A 1KO4A 4RZUA 3WY9A 2GBLA 1Q3HA 1HURA 1AS2A 4AC9A 1MO5A 2JLSA 1TPZA 1XTQA 3GEHA 5DI3B 1E9AA 2V7QD 2NGRA 4TMVA 2HF8A 3S1AA 5JI3E 1T3LA 2R9VA 1YR9A 4LSGA 1QDEA 1I4TD 2VP2A 2VEDA 3SYLA 1XU4A 3NH9A 4LHWA 4OHYA 1UBFA 5JSZA 4CVNA 4DZZA 3VHLB 3IIJA 2DR3A 3UXMA 3THWB 3VX4A 2WICA 1TMKA 3I4LA 1Z06A 5FPKA 3U60B 2D3WA 3DKVA 4IRUB 4C0JA 2WWFA 2WMOB 3LBHA 5EXSA 2E9SA 3K9GA 1TF2A 4EJSC 5LPNA 2YWEA 1D5CA 2AL7A 2C78A 2VF8A 4B48A 3GP8A 2VP6A 3WRXC 4M22A 5AUPB 1VG8A 2O0JA 5CYPA 3AKDA 4AKHA 2ZU6A 1A1VA 2LWIA 3PUXA 2JIZA 1UKYA 3BWDD 2ZIAA 1AKYA 2WSMA 1E2PA 4R7ZA 4TYWA 4Q9IA 1KJYA 4B2PA 2DWQA 4MGKR 1TTTA 3LW7A 3KKQA 1B0UA 2YVUA 3SI7A 1JAHA 4LBYA 1XEXA 2JASA 4XSHA 4M4SA 3IBGA 4HAYA 4KSBA 4JBWA 1XEFA 2JIZD 2ZRJA 3PG5A 3R7WB 5JECA 2AFIE 5FBWB 2ZJYA 5EJEA 3A36A 2YNMA 3SS8A 2TMKA 5FPHA 3EZFA 2CJWB 4PHHA 2WWWA 5FL3A 4HUQB 2V6JA 2BHRA 1VYTA 4W5JA 2J0UA 1U0HC 1R5BA 3N2EA 3ZJYA 1YVDA 2ZJBA 4DLWA 1KDTA 5JZVA 1DEKA 1HUQA 4Q18A 5SZIA 4NP6A 3TAUA 1FMJA 2QTFA 1F2TB 2XXAB 5HCIA 4PPFA 4I1OA 5AJWA 4RKFA 3LBIA 1Z6XA 3KXLA 3V00A 2IUSA 3QXCA 3RS3A 1ZCBA 1AGRA 3U7EB 1Z6AA 4JYCA 4KI0A 4BFYA 1XX6A 1GRNA 4URVR 4PPNA 4YMWA 1XF9A 2FOLA 4RD2A 1GSIA 1XPRA 3T34A 4FMCB 1G19A 2NQ2C 4IVPA 5DN6A 1JJ7A 3KB1A 1M7HA 1W4RA 2REXB 1Z0DA 1BH2A 1Z8FA 4A36A 5D3MB 2QBYA 1CTQA 3FVQA 4L15A 4M53A 3AVVA 3TAHA 1VKJA 5EE1A 1DAMA 1W1WA 4QXAA 3W6OA 1CF4A 1SKQA 4JKYA 2Q9CA 4ZKDA 1II8B 2RGBA 2IYZA 3EZ6A 3FDIA 1KJZA 3NHBA 5EE5B 3WBKA 1G3QA 5DN6D 2RGAA 3BB1A 3BERA 3RS0A 2DB3A 1EGAA 2FH5B 5FOUA 4ESVA 4EPVA 3EXAA 3TK1A 5JBQA 1A7JA 3FPAA 5FOXA 2V55B 3GD7A 3TVDA 5CJ2A 5EE9A 4CF7A 4QG7A 3LBNA 4TLCA 1YZTA 4Q7KA 1E9DA 5IK2A 1KY3A 1R0YA 4DT1B 2GEVA 4V03A 3B78A 3K70C 4BECA 3BE4A 4JVMA 4UXIA 2DFKB 3AVWA 3QKRA 2CVHA 2EFDB 1ZNXA 3L0SA 4BFWA 1J99A 4KLNA 4B2IA 1R5OA 3WNDA 1T4GA 1XTKA 2GKSA 1JPJA 2ZRGA 4IFEA 3EW9A 3DZDA 2JJ1A 2ZRKA 4Q1DA 3WP1B 4ZCMA 3LXXA 4QM7A 3KJEA 4NPHA 2OBMA 2BCJQ 2YOGA 4FWIB 5IK2D 1X6VA 4GBMA 3GLGA 4KO8A 4XSGA 3GLIA 5J40A 1FQKA 2V3CC 1S1CA 2CHGA 2P65A 4PO9A 5LD2C 1FTSA 1E9EA 4EPRA 1W5SA 4UNSA 1UF9A 2VHTA 3WHLA 1OJLA 2GHIA 1C9KA 2JJ1D 1YQTA 1EWQA 4DXAA 1US8A 4L16A 1GL7A 1ZRHA 2RH5A 4TL9A 3BH6A 2PZFA 1AZTA 4XVQA 2IXFA 4TMWA 1KHTA 1V43A 1M7BA 4A4DA 4DLRA 3EASA 1KKMA 4HLCA 4HAUA 3VFDA 3B7GA 3BH7A 3CWQA 2XOKA 3TSOA 3VU9B 5C2JB 3RNLA 3ADDA 1KYIA 3IIKA 1W2HA 3M1IA 1PLJA 1VECA 2NO9A 1XTRA 1NNEA 2I3BA 1YRAA 2ZRLA 1XZPA 2ZSDA 4LPKA 2H57A 1IQPA 4XWKA 4RD4A 3U7HB 2W2VA 2ZSBA 2NIPA 4NYIQ 3NBZC 4OHWA 2W2TA 2X8AA 4N0DA 1MO3A 5DLQC 3T12A 5P21A 3T15A 4DSOA 2D2FA 2XOKD 1G7RA 4Z1MA 1N6RA 3QXXA 1HT1E 4TSFA 2R2AA 5JWOA 2QAJA 5JJLA 2ODBA 3RANA 5SZJA 2V54A 3NWJA 3FWYA 2D62A 3VKHA 2IEYA 1Q12A 5JEEA 3NDPA 4L8GA 2IX3A 2D74A 5KSZA 4MUAA 4YMTA 3FB4A 3PUWA 2WSSA 1R0WA 4RVCA 1E9SA 3AB3A 2BDTA 2QT1A 1M7GA 4ARZB 1QHGA 4YDHB 4Z1MD 5C46F 4TSFD 3VR1A 4HSEA 3A1UA 3IQXA 2F1IA 3DO6A 3KDSE 3LV8A 4M9QA 4C0SA 3PUZA 5UKDA 4WIAA 1KTVA 3AKYA 1T6NA 4Q1BA 1QHYA 2A2ZA 1QF9A 3B8HA 2N42A 3AP3A 3DEFA 1Q1BA 2NZJA 3CF2A 2OCAA 2C9OA 3QXSA 1YJ5A 2ATXA 3I1FA 2IYXA 3N70A 2J0VA 2WSSD 1Z6TA 1YU9A 1YZKA 1E2HA 1QHHA 2CL7X 2OV2A 4KVGA 1E2IA 2QMOA 3PENA 5C1BA 3CO5A 3QG5A 4JBYA 4BLRA 4LHVA 2WVJA 3X2SA 1VYUA 1ZM3A 2PLRA 3ASZA 3Q5EA 4TYQA 2BJWA 2B7BA 4QGFA 4GMDA 1S8FA 1RZ3A 3QEOA 1LFDB 5JRJA 1L7VC 1MV5A 4QL3A 4WZBE 4PC6A 1N3BA 4OQLA 5DE3A 4E22A 2PX0A 2RGCA 1S96A 1MABB 2F7SA 1XMJA 4RKEA 4PSKA 4MRSA 4A0FA 4C0HA 4C0LA 3DL0A 4TZ0A 4QJ3A 4LJ5A 1XD2A 2PEYA 5JCPA 1AS3A 1OXXK 1ZM9A 4TQ9A 1IHUA 3B1YA 2IT1A 2QAGC 2ZYWX 4BZXA 3ZVLA 4KYUA 1JALA 2VL7A 4Q1CA 1II0A 3QXJA 3LX5A 3MAAC 3M0EA 2PZEA 4X8LA 4KBGA 5LDDC 4WZ6A 5L3SA 2PH1A 3EARA 4Q7MB 1XMSA 5DSZA 3GFPA 2OO7A 5JS8A 1OB2A 2A3RA 1CJVC 3L0PA 1Z0JA 3KFXA 3NBFA 4CW7A 1QHIA 4EJSA 1PUJA 1DBSA 3E5HA 3T35A 4CDGA 4CYMA 5J4LA 4C2UA 3U3JA 2KB0A 4A2QA 5L3RA 2GRJA 3RRMA 4IDQA 4BFZA 2IF0A 1XEWY 2VBCA 1U8AA 4DLXA 3NC0C 4Q4AA 1T3HA 2VSFA 1IN5A 2EFHB 2ZJ8A 3S1AB 1AA9A 2D7CA 3KQLA 3VHXA 2ZRPA 2VQSA 2GESA 4OI2A 2WIAA 2IYSA 5JSZB 1DOAA 1KSFX 2ZXUA 2DYKA 1X8LA 1IXSB 1H65A 2CE2X 2F1RA 2ZRIA 3IUYA 2DFTA 3U7GA 1UFQA 3SBEA 5KSPA 3ZQ6A 1NKTA 3CNOA 2C96A 3Q8XB 1W0KA 2G0NA 3HYTA 3T06B 4TTQA 2F3TA 2BM0A 3NTUA 2FWRA 1U9IA 5E7IA 1KY2A 3NVAA 4PC2A 4QBFA 2C98A 4DCSA 4ZIRA 1U94A 1N6IA 4KCGA 1N6HA 4MRRA 3CX8A 4G3XA 1E4VA 4D4KA 3P27A 1CXZA 4PC1A 3ZYCA 1N6OA 1BKDR 3Q85A 4C9BA 2ZVPX 2IC5A 1EG7A 1ZU5A 5B30A 4ZDWA 2XJ4A 3GJ3A 4LJ6A 4NCIA 3A4MA 1F6BA 2R6FA 1W0KD 1XEXB 2XNDA 3K9LA 2Q21A 1WRBA 5KNDA 4PQFA 5JJKA 2HXYA 3DM9B 4PTLA 1XRJA 4A6XA 2QG6A 1T5IA 3AF4A 3R9WA 1G64A 2KBFA 4V0MA 5TVKA 4Q9HA 4NYJQ 4TN1A 2V9PA 4LV6A 2Q6TA 2QZ4A 3RS7A 3UG7A 2LCFA 1FPMA 5EXTA 1GRQA 1E0SA 2J0UB 2O5VA 2XNDD 3AUYA 1EXMA 3B2EA 3FFBA 2HT6A 1OPXA 3OHMA 3ZZ0A 5K8LA 2PEZA 4D26A 5JHGB 4B3DA 4F91B 3WBJA 2Z4RA 2A9KA 3BBPA 5G3YA 3B9QA 2R65A 2OAP1 3QY0A 1G6OA 1KI8A 1Q57A 2KWIA 4CRWB 4B76A 2CBZA 2GAOA 3KUCA 1HE8B 1T9HA 3CLVA 3H86A 2ERXA 3K0AA 3ZVRA 5GJCA 1OSNA 3SDZA 3RABA 2W58A 1QG4A 4B6FA 1KI6A 1F3OA 1MO4A 2HDNB 4EPXA 4D0NA 2GJKA 2C2HA 4JT4A 3MFYA 2VH5R 1WF3A 2LKDA 4DRZA 4YXWD 5E7JA 1KSHA 3TW8B 4DCNA 2GJ8A 2ZSFA 3HDTA 2VP5A 3K1JA 1X1RA 2QBYB 4M1SA 5FTLA 4AKIA 4M0LA 3BRWD 3RYTC 1P61B 2HJVA 1YR8A 2NOAA 2YWFA 4NCJA 1E1QA 1E79A 1D6JA 2W2XA 2ONKA 4GI7A 3C8UA 3N5CA 5EP1A 5J4YA 5SZHB 2Q3FA 1ZNWA 1E9FA 3IIMA 3KUDA 1ZC4A 3IEUA 4V0LA 2AHOA 4QRHA 3WNBA 3RDPA 5CM9C 4IDOA 2ERYA 5DO9A 3F8TA 4JLBA 3LA6A 4Q66C 5JS7A 3AP2A 2XB4A 3BORA 2WWXA 1GM5A 4P0TA 3K70D 1G3RA 3QE0A 3EG5A 3OE7A 1E1QD 1E79D 1Y3AA 2P5TB 2RGDA 5BN4A 4HAZA 4LJ9A 4Q7LA 3TUIC 2IS2A 1FMLA 2P5SA 3QKRB 3W6PA 1Z0KA 1S9HA 3A1VA 4QKQA 4KSCA 4HEJA 4AG5A 5K8TA 5B57C 5H68A 1S2MA 2GJ9A 1KK1A 3LFUA 1ZCAA 2XX3A 3MGCA 4ITRC 3KTAA 1EFTA 4TL7A 1R8QA 2ZJOA 3RS4A 4AD8A 2ORVA 4EPTA 3X1DA 4UNRA 3F0TA 1GUAA 3IO5A 5JWRA 2CCGA 2XGJA 2BOVA 3C4JA 4HAWA 2FFBA 4W5HA 4IVQA 3OIUA 4UNPA 4BFTA 2O8EB 5CYOA 4F93B 1IN4A 1G3MA 2QE7D 3GLGE 2YZ2A 3GLGB 3GLIE 4PAQA 4OL0A 2GXQA 4IKEA 2QROA 4B43A 3UPUA 2C5LA 2AR7A 3VR4A 5TMPA 1ZINA 5H8WA 3LQRA 2FV8A 3LNCA 1TF7A 4NKRA 1G8YA 1CRQA 1XMVA 1E2GA 5TV2A 4HUTA 5EUQB 1NVWQ 3PQCA 1U8YA 2FFHA 4BASA 5B2ZA 1VCOA 1AM4D 4M8NE 1XPOA 1NY5A 2P3SA 2XEXA 3K8YA 2OAQ1 1ZM4A 2ZE8A 4KFRA 4IOLA 1UM8A 4TYNA 2BEKA 4TLBA 4B44A 2DCUA 2Z5FA 2VIIA 1FZQA 2DFNA 3EA5A 1A82A 4MKFA 4PO8A 2MSEB 5AJXA 1PUIA 4I99A 2OXCA 4X8OA 4FCTA 1PJRA 1HQCA 1Q1QA 5HZKA 2ZSEA 4G5GA 3W5JA 3H1TA 5CITA 1NMXA 4QNRA 3T5DA 3RLFA 1NVVQ 2ZR0A 3QPWA 1IM2A 2NO0A 4Z54A 1KAGA 4MITA 4KODA 2OFXA 1ESNA 5TB5A 4O3MA 3P32A 1S4QA 1W7AA 4FWTA 4FN5A 4F4JA 2QQEA 1CULC 2YOHA 1GG2A 1UKEA 2V8OA 5KO2A 2HYIC 1PZNA 3FFAA 2CLDX 3QUSA 4JLMA 2V6IA 1T8TA 5DISB 4MYCA 4WVFA 5FBVB 2C04A 4NYJR 1NBMA 1NRJB 2HT1A 4A15A 2HUPA 1Y63A 1G7CA 1ZD1A 2QSYA 5FPYA 2OLJA 4DIDA 1Z0AA 2X2FA 4I1SA 2W6IA 4YMSA 1N5KA 3U61B 4OI0A 2EYUA 1P75A 1X3SA 1KO1A 1QHHB 2V1UA 1OB5A 2GJSA 4XH9B 3HJNA 1DS6A 3ZS9A 2VHJA 2ZETA 3GLFA 1NBMD 2QAGA 4HLUC 4JMPA 1G8FA 4GRAA 3LWNA 1KDOA 2ZR7A 1MH1A 1KMQA 3AVYA 2IYRA 2GVDC 3AVOA 1W47A 4PZZA 1U81A 2ANBA 2W6ID 1AK2A 1GFIA 2ORIA 2QP3A 3LXRA 1QHXA 3AUXA 4ZI2A 4BEBA 4DEXA 1E6CA 1FP6A 4V0OA 1XXHA 2CE7A 3BXZA 4QGHA 3QOFA 2OG2A 4LBWA 1HT2E 1T3SA 4UKDA 1DAHA 3K0FB 1KSJA 1RJ9B 2XJ9A 2C77A 2WM9B 1JQJC 1Q1ZA 1NL3A 1L8QA 4XD7A 4DLTA 1OFHA 1XD2B 3IGFA 1E3MA 2IWHA 4AWXA 4P4TA 5FI0B 4JYBA 5C4GB 3LAWA 1G7SA 2D4HA 1ETUA 3GPLA 3QEJA 2OILA 4HATA 1WBBA 1UBCA 4Q4HA 4RZXA 3SBDA 4HB4A 3RSLA 1E2EA 3QF4A 2JLWA 1LVGA 5L3SB 2WJHA 2ZI3A 2A5YB 4XD7D 3MJHA 4B33A 1VTKA 1ZIOA 1TQ2A 4AYTA 4RCYA 2YWGA 5FL7A 1FUKA 4EJSB 1OKKD 2OCYC 1OF1A 3GCGA 1E2LA 3NIBA 1S0UA 4BE7B 1JI0A 1N2CE 2C03A 3I8SA 3SFVA 2VA8A 2NZ8A 2KI5A 1PV4A 3EPLA 3AV0B 1DTSA 3FOZA 2AD1A 4Q4AB 3QSYA 1ZD8A 1TQ6A 4Q4LA 4LX0A 1G17A 1VCNA 5H1YA 2AWOA 1JECA 2ZYUX 3CWZA 5DYGA 1KI3A 1ZYUA 4IW3B 4MH0R 2WAXA 4CEJA 3LX8A 2MMGA 3GFOA 2JLQA 5FL7D 3SZRA 1LS1A 4EIWA 1VPLA 3FE2A 4GZMA 3B5JA 3GFTA 3SN6A 2V1XA 5KUTA 5KPJA 3ZLJA 4Q21A 5L8VA 4RY2A 1Q0UA 4TMTA 2ATVA 5G53C 2DPXA 4G5SA 1YZUA 3K9HA 2JLZA 2RGNC 3R9XA 2C9CA 3OF5A 1KI9A 1ZW6A 3KQHA 3OZXA 3TMKA 5CM8B 4D0LB 4MGIR 4R98A 4UXJA 2OEPA 4LWZA 4LY6A 4BLPA 4A92A 4RJLA 1WA5A 2ZS7A 4QHYA 4CT4B 1FTNA 1P9WA 3LD9A 4FMDB 4O25A 1TU4A 2G6BA 1OYYA 1E9CA 5AK0A 3BGWA 3GEEA 3W34A 1RE0A 3CX6A 5CB8A 3KQNA 1N25A 2W0SA 3ETLA 2O8CA 1ESMA 4MRNA 3KB2A 4TMZA 5F98A 3L82B 1A5TA 4UNNA 1AKEA 1Z07A 5CB6A 2BMJA 2ZJAA 2ODWA 4XTRA 3EIHA 4DSTA 2NTYC 1LTQA 1E2KA 3UIEA 3LVQE 3THYA 5L3VA 1NN1A 4V0ME 4GDFA 1VMAA 3F5FA 1GKYA 2A5DA 4H1UA 2ODNA 2DY1A 4C7OA 5BN3A 2G3YA 3TUJC 1NMZA 2D7DA 2ANCA 3A58B 3BD9A 1E2FA 4C4PA 4LHYA 2GILA 1IY0A 3U3MA 3FHCB 4NBSA 1XWIA 5FPSA 4PHGA 4NZYA 1WCV1 4DLSA 2MSDB 3NXSA 4D25A 2O8DB 3PUVA 1IY1A 1M6NA 3B82A 4Q01A 4LJ4A 1P3JA 1IJFA 1OH6A 2UVQA 3HPRA 2BEJA 2G88A 1ONBA 1QVAA 1XEWX 2ZE7A 4PC3A 2C8VA 2J3EA 2OT3B 3SJAA 3PUYA 3RS5A 1TQDA 3FTQA 1P2VA 5JEDA 3RS2A 1N6NA 4D4LA 5EP4A 2MSCB 5IF9A 3C41J 1G9XA 3HR8A 2YYZA 1UPTA 1M1YE 5A0FA 1KI6B 3PV0A 1KO8A 4IOKA 5E95A 3FHTA 2O8BA 4QHTA 4Q4JA 1SVIA 4EKDA 4B75A 3KXKA 3SU8A 2OFWA 1RC8A 8OHMA 2F6RA 2OHFA 1YE8A 3CIOA 3H84A 5IT5A 1ZBDA 3ZIAA 3K70B 5J5CA 2G9NA 2R44A 4XJXA 4UXHA 4FD2A 3GJ4A 5FUXA 3EX7C 2X19A 1IXZA 2QGZA 3ZZTA 3HYRA 1R0XA 2QM7A 4URYR 1J7KA 1E98A 2UKDA 5KNBA 3AGPA 5JWHA 3ICEA 4ASUA 4ZKEA 2EU8A 4URXR 1T0JB 2ZJZA 3I73A 1DELA 4NCHA 1GTVA 5FUVA 1P2TA 3TIFA 3BH0A 3W90A 3PR1A 4FMCF 4DEYA 1E2MA 3DDCA 3I32A 3ZIAD 1JB1A 1SHKA 3DVLA 3SJCA 2IYTA 5LD2B 3HU1A 3RC8A 4PPGA 1GKIA 3SJBA 3A8TA 4EFMA 3QPUA 3CNLA 2CMKA 2PL3A 4XWAA 4B73A 3H0KA 4HZUA 4AK9A 1Q22A 1TUIA 3WRYC 2W00A 3IPYA 4ASUD 3ZQJA 4LV8B 3P26A 4L5BA 4RZ3A 1G4UR 2A5JA 3UWOA 3KTAB 4DCUA 4CEHA 3NKVA 3TSZA 5GVSA 521PA 1F5NA 4OQFA 2QQ0A 3Q5DA 5M04A 5FUYA 1E4YA 2NO6A 2O0HA 4G5QA 3DPUA 1E69A 1ELOA 1NLFA 3WYAA 1R0ZA 4RSGA 1ZMXA 4JLKA 4BWYA 4E03A 1E2JA 1I4DD 1RRPA 2J59A 5BQ5A 2ZTSA 2BBSA 2FN4A 2CLSA 3I5XA 4IXMA 3KL4A 2BCGY 4M1MA 3K09A 4GOJA 4B47A 1TU3A 2F43A 2ZE6A 4ZCLA 1KO7A 4X8HA 3K9NA 1XMIA 1VG9B 5ANRB 4C0BA 1N0UA 1JXOA 1R4AA 1XFAA 3NC1C 2L0XA 3JVUA 4YLGA 4JL8A 2WWYA 3D6TB 4WZAE 2CL0X 4OK6A 4PSAA 1UKVY 2JAQA 1JR3A 4H1VA 2O8FA 4DDUA 1OHHA 1YHNA 4EQ6A 2W6JA 4QBIA 1BYIA 2UZ3A 2FSIA 1GAJA 1U98A 2IYLD 1FNMA 2X2EA 2Q9BA 3MWLA 4C0KA 1WQ1R 4Z8YA 1E2NA 3JZMA 4Q5IA 1OV4A 2J5XA 3PITA 3CH4B 1AQUA 5FFMA 4R9UC 2AK2A 1CRPA 1CJTC 1JR3D 4RFVA 1U0JA 4L9WA 1G4AE 1OHHD 2ZAOA 2W6JD 2R6DA 1ZD9A 4DCVA 4LYJA 2FSHA 2ZUCA 1TNDA 2J46A 3HR7A 4TLAA 3HU2A 1FP7A 4IDHA 1GZSA 3B9PA 3CPHA 1G8GA 3OEHA 4GL2A 4HLUA 1CR2A 3BAFA 4GP7A 3RAPR 2CHVA 3AF1A 5BYJA 2ZS9A 2JDIA 2RGXA 4JJKA 1S9DA 4MRVA 2WKRA 3GQBA 3MRSA 1J2JA 1NBME 2OBNA 3FGNA 4HLQB 4I1UA 4XTCS 2GNOA 4GFDA 5KDOA 3EAQA 4Y0VA 4DLYA 4ZV4A 4D0GA 1CLUA 3U2QA 4BGDA 1F2UA 5L3QA 2Q0HA 4NYMQ 4NE2A 1ZUIA 1CJUC 3BB4A 3IDQA 4C2TA 2XITA 4F4IA 1UBGA 2B92A 2ZI4A 3OEHD 5CK5A 4PXAA 4K81B 1ZJ6A 621PA 5AUQA 2IA5A 2JDID 1G291 3R20A 1CKEA 1KNQA 2AKYA 5KHOC 3GLFE 1OYWA 2QAGB 3GLFB 4M1KA 2W83A 5DH9A 3KXIA 1FNNA 4TYYA 1TEXA 1KSGA 2E87A 4URZR 3GJXC 3C15C 5JCZA 3QKSB 3SHFA 1NMYA 2GTPA 4XWOA 2FGKA 3ICQB 2QP9X 1U90A 2GCNA 4O2LA 2NPFA 1BO6A 3M6AA 2ZPTX 4DDWA 4TQUS 1CEEA 2FEOA 3B1ZA 1AGPA 1XXHE 1XXHB 5JI2E 2JCSA 4G5RA 2ASEA 4Q9LA 4BEJA 1Z0FA 1GRRA 4LGMA 4OI1A 3TJZA 1W5TA 5C4MA 4BRWA 2JATA 2H18A 5D3QA 4FW9A 3Q7PA 2ZM5A 2OCBA 2DHRA 1Z63A 2XSZD 4GNKA 4DB2A 1COWA 1IBRA 4LYFA 4OK3A 2BC9A 3ND9A 3NBXX 4KVAA 5KDDA 5DI3A 5LBIA 3KJIA 1X1SA 1IONA 4Q4HB 1U99A 3SQXA 5G3ZA 2CVFA 3QF4B 4UJ3A 1E99A 1Q1EA 1SULA 2PBRA 1NN3A 4DDTA 2ONJA 1EK0A 4AKEA 1TF5A 3AVUA 3CRQA 1HTWA 3AF3A 5GADl 2FPLA 3BK7A 2QPAA 4PAOA 2YOFA 5F9HA 1KKLA 1COWD 3ADKA 1FX0A 1HV8A 2N1BA 4WBSA 2IXGA 3L8ZA 3LH5A 2FA9A 1LF0A 2RGNA 3FMOB 5KOYA 1DO0A 1P9RA 2ZRNA 3FMIA 1ZNYA 4QBGB 2QGNA 4YMVA 5GJBA 1W48A 3RRNA 1IAQA 2QY9A 3D8BA 4IJMA 1XP8A 3FKQA 1E2QA 3J81k 2VPPA 5FOVA 3WYGA 1J8MF 1Z28A 3CONA 4CEJB 1FOEB 2AWNA 3CPEA 4A9AA 3NG1A 1M8PA 4NU0A 3VKWA 3D31A 1N5JA 3JVVA 3EPHA 3GEIA 4MDEA 3EIEA 1WBDA 4B3FX 3EA0A 3PIRA 1DAIA 3N2IA 2GJAA 1G41A 1EWRA 4YDSA 4PZYA 3PEUA 3CF6R 2WTUA 4AYWA 4M9ZA 1OH8A 1DAEA 3WP0A 3C7KA 3R7WA 1JNYA 5TXGA 4KFUA 4DLZA 5JHHB 2H16A 3EPJA 3OEEA 2F3RA 3MCAA 4NDZA 1SXJC 2WJGA 4NYIR 1UKZA 4BZQA 1ZUNB 2VSOA 3QI2A 3QKUA 4JLNA 4KXFB 1P2UA 4KBFA 4OQMA 4OYHA 2GCPA 2ZJ2A 5CLQA 3RSOA 5KSYA 2EWWA 4MKGA 4YONB 1KK3A 4AG6A 4DIEA 3VKGA 1GWNA 1GNQA 2WKQA 1C1YA 1KMHA 2OUKA 1LB1B 1CR4A 1XJCA 3QNUA 1AN0A 2AKAB 3QKTA 3REFA 3OEED 3THYB 2JEOA 4YXWA 4POAA 1JR6A 4C7OB 4PQYA 4EPYA 2CDNA 2NG1A 1N0VC 5EZ6B 4X8MA 2ZE5A 3I72A 4P4SA 2BVNA 3A1TA 4XVUA 1RPZA 2ZRDA 4JVNA 1E1RA 1VHLA 5FBRB 2ODEA 2VP9A 1NI3A 2G77B 3F3YA 4OHXA 2C95A 4GPTA 2GDJA 5EXPA 5AJZA 1JJVA 4GP6A 3V4RA 2HV8A 2ZUBA 5HE8A 3Q7QA 2RB4A 4AI6A 3MG9A 3A1SA 4DC9A 2BBWA 4JL5A 3W6NA 3SE0A 4FMBB 1E9RA 4II7A 4K8OA 2F9MA 3GJ7A 1E1RD 1Z22A 2AD5A 2FSFA 4AURA 4G01B 1G18A 4DJTA 1LS6A 1UAAA 421PA 1BYUA 4PC7A 4B3CA 4Q1AA 4M2LA 2O8BB 4Q4JB 4RD3A 2ZR9A 4ACBA 3THXA 4LOAA 3QF7A 3OESA 5EUMA 2EFEB 2FE4A 4PR0A 4U00A 3NEJA 5BYKA 2H7VA 2YINC 1N5IA 4Z51A 1U8ZA 1SVOA 2QE7A 4W5WA 1VCMA 2OM2A 1JXMA 1TUEA 3IO3A 3GJ0A 4LJYA 2DWOA 1G5RA 3IHWA 1CR0A 1VCIA 3ZD6A 1W36C 3T61A 3ADBA 5JMTA 2PCJA 5FUWA 5AUNB 2NO7A 2F55A 5BXQC 3CF0A 1T5LA 1QHNA 2CCJA 4DUGA 4M1OA 2ZU0C 4M9XA 4OHZA 3AM1A 3O8RA 1UDXA 3CKLA 3QBVA 4MYTA 3GLIB 2EW1A 3EWSA 1RRFA 4HZUB 3DZ8A 1W4BA 3UATA 3G0HA 1KAOA 3FMPB 4P32A 4G5OA 1LNZA 2Z4SA 3SR0A 1M2OB 4CGZA 3BFKA 3HU3A 3KJHA 1I2MA 4RCZA 5KPDA 1DG3A 1RVDA 1US8B 1P72A 2GK6A 4CEHB 2A5FA 4BLTA 4I1VA 3AF2A 121PA 4DUGD 1QRAA 2BKEA 1K5GA 3SFZA 4AY2A 3KKNA 1NKSA 3FHOA 4B3XA 3IILA 3D7MA 4L4UA 5HPYB 2PZGA 4MDFA 3NHAA 4UNQA 1G7TA 2HF9A 2Z6VA 3KZ1E 3X1YA 1W49A 2D06A 4F7WA 4WW0A 1OE0A 3GLHA 2FX3A 2OFOA 3DMNA 2GXUA 4LBVA 4NCKA 3TR5A 4DSNA 3B6EA 2ZANA 1YR7A 2LKCA 5HZHA 1Z0IA 2F43B 2BV3A 3ND8A 4TT3A 1OIXA 4KU4A 3AVTA 1VG0B 4IOMA 4QOSA 4BZPA 2PMDA 4MQBA 3TVTA 1KIMA 3U44A 3P20A 3A1WA 1MRNA 2AFHE 2XTNA 2FFAA 2JLUA 5EP3A 1ZNZA 4AYXA 2Q3MA 2KBEA 1JR3E 2VRWA 5DHAA 4DB4A 4F38A 2O8FB 4E5UA 4ESHA 2P67A 4EQ6B 4IDNA 4ILEA 1F48A 4MKHA 5CIQA 2BKUA 2PX3A 2R6GA 4P4UA 4PAMA 4TT3D 2GZAA 3C5HA 1UEIA 3CX7A 4D80A 1YZLA 2I1VB 2SHKA 3ZDQA 1Z6YA 1VIYA 2DFLA 3SOPA 1J8YF 4M21A 4PQRA 1N6LA 2QP4A 2QL6A 5HE9A 2GXAA 2GCOA 1TADA 4HDQB 1I4LD 3SQWA 3NDBB 4JS0A 5H70A 3HWSA 1KI7A 1S3GA 3AVXA 1AZSC 3PVSA 4QHSA 1EFHA 3Q3JB 3TNFA 4Z8XA 4N3NA 5SZKB 4MGZR 3UG6A 3DMDA 1BS1A 4ZDIA 4HB3A 4KITB 4Y0AA 1CU1A 1FUUA 1ODFA 3PCRB 4UQOA 1NY6A 2QN6A 5CK4A 1X8KA 4HB0A 1F2UB 2CNWA 5L3QB 1NIJA 2XZOA 5AUOB 4A8JC 2IL1A 3P4YA 5FTNA 3GJ6A 4PSVA 4NH0A 5BN5A 1D9XA 5AJVB 1UBEA 3SHWA 3RWMB 5EE0A 1M34E 1O3YA 2CL6X 1KDRA 1KI2A 4G1UC 4KAXA 3A37A 3AQ4A 1ZM2A 3WXMA 3LW8A 1YKSA 5HTKA 3TR0A 5FOTA 1ZU4A 3Q9LA 1L2TA 1OKKA 4TMXA 3SC3A 2CNWD 2WHXA 4HYYA 4O0MA 4HB2A 2HCBA 4EUNA 3PXGA 2KE5A 1MOZA 3L8YA 3I5YA 1P9NA 2JGNA 4P3YA 3TH5A 3CRMA 4Q19A 1W4AA 4MGYR 2CK3A 3OAAA 4BFVA 1FL9A 1GL9B 1XPUA 3JZAA 4DLVA 3KQKA 3QBTA 4TTPA 4V02A 2WZQA 4NMMA 2YV5A 2VYFA 3L2OB 5J47A 1RRGA 4R2IA 4US2R 2PJRA 4BLQA 3CB4A 2GK7A 4RD1A 2D2EA 1O87A 3RHFA 1AJEA 4QM6A 2BWJA 3KKMA 3I62A 4AKGA 1KZ7B 1HEIA 4US0R 4LZZA 3I92A 2CK3D 3OAAD 1Q20A 4LC1A 3SEAA 1MT0A 1QVRA 4A2WA 4OQNA 1Z47A 2NPIA 4MYHA 4JIMA 4MUBA 2FF7A 2IW3A 4GMXA 3CR8A 4FI3C 2ZEJA 3ECCA 4C0QC 3U7FB 2AXPA 1FX0B 3U4QA 3ZH9B 3E1SA 1N6KA 2GVZC 4Q02A 1I2DA 4J0QA 1GITA 3HPQA 4QJ4A 3R8CA 2GXSA 4BLOA 2ZVQX 3KX2A 4CZ2A 3CUEF 1SXJA 2A30A 2J7PA 1G16A 4D2IA 1RFLA 4F92B 3KFVA 4ZIRB 3CPJB 5FBLB 1HA3A 1RKBA 4LV5B 3K0CC 2ZRMA 1DPFA 4FCWA 1D2MA 1IN7A 4ZDJA 2R8RA 2EFCB 2NO1A 4ZI3A 1SXJD 2J7PD 4IXNA 2R62A 1Z83A 1WB9A 1QHSA 3X1XA 4LCBA 2UZIR 4HAVA 3MWJA 2QMEA 4LBZA 3TRFA 1D2NA 3U6BA 1U9IC 1T91A 1KDPA 3IQWA 5A5GA 2OESA 1R10A 3UMRA 3Q72A 1W44A 1S3SA 2B6HA 1NVVR 5FTKA 4WA7A 1KMHB 3BOSA 4DBLC 1PVOA 3ADCA 3C16C 3IBYA 5LB2A 5BW8A 4DLUA 2ZQ5A 1Q3TA 4RFSA 1B23P 2ZSAA 2ZITA 5IDVA 4ERNA 2HLDA 1G8HA 4JSYA 4FIDA 5KNCA 2E1RA 1JEEA 2IF2A 3ONWA 2ZI7A 1TAGA 3PEYA 5E4FA 3ZVMA 2FJUA 1HQYE 1XTSA 4FXPA 721PA 1JEDA 4M1WA 4P4SB 4BUJA 1K5DA 1A2BA 1AIPA 3DOFA 3H4MA 3K0AB 4BFXA 2OLKA 1E32A 2HCJB 4FMDF 4JKIA 4BRUA 4R71A 3A4NA 2N46A 4OHVA 3W5IA 5FTJA 1EFRA 4F4CA 4TTRA 1H8EA 1NN0A 5KDLA 2HLDD 2W0MA 3VQTA 2OZEA 1NG9A 5KTYA 4A0RA 2A7QA 1HYQA 3MWKA 2DBYA 4JVSB 1L4YA 2H92A 3I3SR 2NMVA 1D2EA 1XTJA 1P60A 1RW4A 1JQLB 3WMEA 1NSTA 5TDHA 3MSXA 3BB3A 3BC1A 4PHFA 1C4OA 2WKPA 3B1WA 3PFIA 2H5EA 3LQQA 1XCMA 3LVRE 4ABYA 2WJYA 1LY1A 5J4HA 3MWYW 1EFRD 2H8KA 1DAKA 4A1FA 1FQJA 3QENA 1WP9A 2PLFA 3ZGXA 1H8ED 1PLKA 1T0HB 5FR2A 3UK6A 1E0AA 4A6PA 3QPVA 3THXB 1HE1C 2AX4A 2QTHA 2WOJA 2QUZA 3PJRA 1LF5A 1KGDA 2XAUA 3WMGA 5DIFA 4ZDKA 2B21A 3WHKA 5F3WB 4A82A 3TE6A 4LYAA 4B2LA 3GJ5A 3B60A 1BMFA 2HJGA 3LDAA 3DHWC 4S2EA 3UMSA 4AIIA 4C0AC 1W36D 3TQFA 821PA 5AR1A 2FDCA 2ZYTX 1XD9A 4I81A 1R2QA 1GIAA 1GNPA 2KSQA 5DHFA 1AS0A 1HY3A 3GJ8A 3L43A 4DKXA 4MRPA 3EZ2A 3CH5A 2CHQA 3QJYA 3TGPA 4P33A 1TX4B 1OW3B 2G1JA 4NONA 4TL6A 5KSOA 2O8EA 1QBKC 5CIWA 3R9IA 3SYNA 1KZGB 4URWR 2VHCA 5CLLA 4EAQA 4JT2A 1BMFD 1SVSA 5G41A 2JJ8A 1N5LA 1F60A 5TY0A 1QZXA 4MKIA 2VHUA 3EC2A 3K0EA 3V9PA 2ZUDA 1OH5A 2JA1A 5DYIA 3KQUA 2J1LA 2WIBA 1IY2A 1CJKC 2HXSA 4U02A 4BFUA 1CS4C 4QNMA 5K8IA 3CZPA 2Z83A 2G0TA 3P4XA 4IEEA 1UDWA 4JJZA 2V4ZA 2JLXA 2XB2A 1KOFA 1XB2A 3T1QA 2GZDA 4M9SA 4NTZA 4CEIA 3KKOA 3LO5A 1KI4A 1KK0A 2WMNB 3AH8A 4QC2A 1R8SA 2P6UA 1ANKA 2PJZA 5TARA 2X1VA 3AVPA 1RRCA 1E2DA 2QMHA 5GJVC 1P6XA 1A2KC 3GLHE 1W0JA 3GLHB 1D8TA 4HAXA 3VR2A 4B32A 3BIFA 2FEMA 1EFUA 2DWPA 2QT0A 4M1YA 3ZZUA 1XJ0A 4RZ2A 2QTVB 2IXEA 2AN9A 1YZQA 3U44B 3TQCA 2WJJA 1EESA 1Z29A 2JJ2A 4TWZA 1FFHA 1JBKA 1W0JD 2GF9A 1SVKA 4Q47A 1XBTA 4US1R 4C3ZA 4EFLA 2F9LA 5JFGA 4B6EA 1E0KA 3QVUA 4D81A 3A6PC 5GVRA 2O0KA 3I8XA 1SVLA 4K46A 2J41A 3U3OA 3VNVA 4JLJA 4BLSA 3SJZA 1N0WA 4XVRA 2FFQA 4JLPA 1ZUHA 1G5TA 2FG5A 2IWRA 4C30A 2BBOA 4NHOA 1Z3IX 2VF7A 4NL4H 2JJ2D 4Q48A 4OI4A 5G40A 3T1VA 4OKSA 1ZIPA 4IEIA 2IHBA 2R6AA 4A8JA 3T1TA 4BPBA 2Y8EA 2WWIA 2GCOB 4OBEA 2OCPA 4Q1EA 4B71A 3M4YA 221PA 2WJVA 5FPTA 1G8PA 2F1HA 2ZRCA 2G1KA 2B8WA 2G83A 4TLEA 4OK5A 1RYFA 1T8UA 1OT3A 2IS4A 2ZI9A 4KLZA 5BWMA 1X8JA 5JRZA 2IYYA 3O8BA 5JJIA 1NJGA 4OQXA 5FH9A 1P73A 2QORA 2IHYA 5HKKA 3EPKA 1OIVA 4E09A 5JLJA 3NBYC 2J0QA 2QENA 1OFTA 2WV9A 1Q21A 2OSBA 2QRZA 2Q9AA 4HDOB 1NVUQ 2P6RA 2XSZA 2JLRA 2GF0A 1NN5A 3RWOA 4JL6A 1X86B 1EFCA 1OLOA 1NLZA 5EP2A 5K8UA 5CDFA 4A0HA 4KHZA 5LB4A 1NLYA 1SZPA 1Z2CA 4U7DA 1GVNB 2PT5A 4N1AA 3K0FA 3VTKA 4A0GA 1RJ9A 4DWJA 3QQ5A 3TW4A 3VR6A 5HKKD 2IUTA 4TLDA 5DGXA 5FR1A 2ZI6A 2EWVA 1YR6A 4B34A 3REGA 1VG1A 4I4LA 1K6MA 3VR5A 1DADA 2EQBA 4LRWA 1XCGB 1GP2A 3LY5A 4GZLA 3U5ZB 5HCNA 3R8FA 1G3UA 3TUZC 1GILA 2IBMA 3TLXA 4Q00A 2QSZA 1L4UA 4WOPA 2FZ4A 1G1MA 2AK3A 4TYPA 1SQ5A 3FYHA 3SYKA 2YWHA 3CRRA 1R6BX 3AP1A 4Q7JB 4TZ6A 2H1LA 2RGEA 1W46A 4Q1FA 3TKLA 3MUFA 1OXVA 3BJIC 1BIFA 4PO1A 5B58C 2PCLA 3DM5A 2REOA 1MRSA 1UJ2A 4GSYA 5J4KA 3THWA 2HEIA 3QIAA 3VMFA 3I61A 1G6HA 3X1ZA 3CNNA 2ZI5A 2O52A 2J9RA 3U3KA 3VR3A 5EE3A 2GETA 2GBLC 3NEYA 5CJPA 3WMFA 2WJIA 5ELXA 3VX3A 4IDPA 5DI9A 2PMKA 2WWGA 3K0CA 2C99A 3E2IA 3EC1A 2QI9C 2B8TA 1NJFA 2GWHA 2QRNA 4HI0E 3UKDA 3W3ZB 2QPOA 3AVQA 2I1QA 4PANA 1MR3F 4R2HA 3NH6A 4KYIB 3U4QB 4IFBA 2XZPA 4RD0A 1HH4A 2VP0A 3CZQA 3H2YA 3IEVA 1PLLA 4HDCA 3ASYA 3BFVA 3OIVA 1TQ4A 2IYVA 1GNRA 3BS4A 1SXJE 1SXJB 4MA4A 2J7KA 1LW7A 1NSFA 5J4VA 4O2RA 3T5GA 4W9MC 1IN8A 2RCNA 3B1XA 3GMTA 3W3AA 1XTIA 4JSTA 2CJWA 2OXRA 1DVRA 3W8NA 2CCKA 4HUQA 4EFNA 4IOJA 4G0NA 3CRVA 1J90A 2QM8A 2O8CB 1A4RA 3G5UA 1XD8A 3UANA 4Q9KA 1OXTA 2FPMA 3EWAA 1UEJA 2J0SA 3G82C 3OFNA 4Q03A 1XDBA 4ZO4A 4YMUA 4N0EA 2YC4C 5EQTA 2H17A 1F2TA 2XXAA 1M74A 2RHDA 4DDVA 4GT1A 2YJTD 1J70A 4JLVA 1DG1G 5AJYA 1DAGA 2AXNA 2VO1A 3P1JA 1Z08A 3CRW1 4GOXA 4LJ8A 3RRYA 3U6KA 2P0EA 2FU5C 4D4JA 4FINA 1IOZA 4YC7A 2Q3HA 1N6PA
chains in the Genus database with same CATH superfamily
4WPGA 1T36B 5J59A 1P0QA 1QIKA 2E5WA 2VXOA 3PE6A 1PFWA 4I8XA 2MYUA 4IAOA 5DN9A 2BPOA 2O8DA 1UXIA 3PHHA 4KQKA 2IEIA 7ADHA 1SOUA 2X5JO 2VPTA 1D9ZA 2G63A 2BE7A 2QQGA 1JYSA 1VOTA 3OKPA 4LZNA 4Q6WA 4Z7OB 5HR5A 4HDKB 5LNK6 4JA2A 4G37A 2FMFA 3QHAA 1N7JA 1HDCA 2XY4A 5E3HA 3KOXA 4ZPXA 1EP2B 1G21E 1G21B 3GJZA 1AHNA 2QPTA 4ID9A 4YP7A 4F8JA 1P74A 4EPWA 4U5XA 2BM1A 2HBZA 3EOBI 3K5WA 4HVTA 4QGGA 3UMBA 4EDHA 3A2NA 3VAAA 1NV9A 4IV8A 5DHSA 1X1CA 3M81A 5F3RA 1TYZA 2YRFA 3PNOA 2REQB 5BR1A 5BNZA 4Q9AA 1ZJYA 3D3WB 1SU7A 4ZO7A 3URKA 1ZJJA 4B0PA 4KREA 1YQQA 3K1TA 4MTLA 2FXVA 4KXQA 2MIIA 4JB0A 5IRCD 3KJGA 2WT4A 2NSYA 5C8VA 3F1LA 3N2ZB 4BGEA 4K03A 4WECA 5BP7A 2R11A 1TA9A 5C4IA 3PDCA 3OP1A 3I2IA 3OZ7A 1E6EA 2BI4A 1YJ8A 4N7RA 3GMIA 1S1MA 2C31A 2Y71A 3JQRA 3L93A 4KI7A 1U0LA 3MMPA 1YFZA 1NF3A 3VM6A 4C6HA 3FKSA 3G1UA 2G7ZA 2BJVA 1P2SA 1YAHA 4I5IA 4Q9JA 7YASA 4EW1A 4LUCA 2ZSHA 1EXVA 4WK0B 1BX3A 4E07A 4MVJA 2ZRAA 2R87A 3FMFA 1G5PA 2VLIA 1JFVA 3DBHB 1YRBA 3LIIA 4TS9A 4NS1A 3AR2A 2YKGA 2NTVA 1JKJA 4QTYA 1ZO8A 3O8QB 4HRVA 3ZHVA 3K3PA 4RA9B 1PT8A 2GZHA 4OQEA 5K6TA 1NVXQ 3W2EA 5LSAA 2WU3A 1Y8QA 1UPXA 3TKAA 3WB0A 1E0DA 1KPHA 1RWMA 2TSYB 2VDPB 4B3BA 2IK8A 1TTPB 4UULA 2HBQA 3HWRA 4HTAA 3L1JA 4C06A 4LVCA 4URUR 4HLDA 4XQGA 3O47A 3QE2A 1ZJWA 1YJCA 3RFVA 1HDXA 2VCEA 3OIYA 2IYWA 2BI7A 4L9SA 4S05A 5F9FA 1RLJA 4ZCIA 3ED1A 3FGOA 3KALA 3QXHA 4WKOA 4ZI7B 2ZFUA 4RTJA 3OE7D 2QA5A 4G0WA 2IP4A 1IJEA 1JG2A 4UUBA 5IAJA 4HHEA 1BC5A 1E3TA 2LUOA 1PR0A 5GQSA 1LZKA 1Z2AA 4JZKA 4QVGA 2Q6VA 4XIJA 4DV3B 3RGWS 3C5CA 5IAAA 5IANA 1Y4DE 6Q21A 4FW8A 3RRZA 2XE6A 4AB1A 4GE0A 1SU6A 3AGQA 3EIQA 4LQ4A 2RAPA 2FSGA 3RKSA 3SIRA 1EX6A 1P62B 3TLGB 3B2NA 3BQ9A 3E70C 3L92A 4GPD1 1OWMA 3DYBA 3JVIA 3CLTD 3DE6X 4Y2PA 1NJ5A 3LKBA 4OJKA 2RHMA 1D1QA 4UD2A 5BPFA 4DQVA 3A6FA 4RE5A 1O94A 5EWJA 2GFHA 4KAAA 2W90A 4MVYA 2QT9A 2I3GA 1EQUA 3MW8A 1YZGA 3LPNA 1VDZA 3D1JA 1HT3A 2BM8A 4PO3X 3C45A 3SQDA 4A5SA 2ARKA 2EP5A 3VR4D 3MD0A 5AQEA 2IS6A 2ZRFA 1J5PA 3ZHRA 1T8RA 3HQ4O 2DX7A 1D5WA 3TQHA 1TZJA 3ZWKA 2WRZA 3PKJA 4CR6A 3RVQA 3IPXA 1K1EA 3G2MA 5U9CA 1DO2A 1XJ5A 3I9OA 3LQ1A 1QSGA 2P6NA 1KVTA 3MJRA 4D82A 4H7JA 4OU4A 2WPDA 4X84A 3MPUA 1PDWA 1Y4UA 2ECPA 3K1AB 4GLJA 1Z7EA 2JEYA 2E4AA 3UPDA 5C18A 4B7CA 5IWAB 1M33A 1XRLA 3E4CA 4R1PA 4JLDA 3RIGA 2P4UA 2I62A 4MV6A 1KOJA 2V45A 5E3JA 1GZ4A 1YE3A 1BDMA 2YXEA 2BZ0A 3AKEA 1B3RA 2B2CA 1Y7PA 3TVYA 4JB8A 1CVRA 1WETA 2H7YA 4YAKA 4NMXB 2PYIA 4KQIA 4OHBA 1MW8X 2WG0A 2HJWA 2G36A 2LTAA 2QMUA 4YJHB 3MLEA 5ITVA 3NDJA 1CP2A 5HKOA 1PWYE 3WNCA 3JR3A 3BG5A 1OXUA 1MC5A 4PHTA 1ZAKA 2NVUA 2PGJA 3VU3A 3IKTA 1E1NA 1I36A 1ZSNA 1Z16A 3C8HA 4RIIA 2M6KA 1VE5A 4RSMA 1FS4A 1UKBA 2OBBA 3N6VA 5L3ZA 4ZGBA 3S40A 1WZEA 2VSXA 3PPYA 2JFQA 2GAAA 4ND3A 3TXXA 1XK7A 3THRA 3JTEA 5HQTA 5CNMA 1QQ5A 3L49A 3OZVA 3IKJA 1ADCA 1VBNA 1F0PA 5I9LA 2Q4RA 2OV4A 4WZBA 1CNMA 4JP2A 1KNXA 3TBKA 3FZNA 3RC3A 5MFPA 2BDUA 2CUKA 5AWFC 3U1VA 4B87A 1B41A 2R4QA 2WAYA 4HNVA 4JQZA 3RVBA 1UJBA 1BHO1 1NP6A 4I4CA 2EEZA 4QO7A 4B74A 3L6UA 1R6VA 2TRSB 4IGKA 4UVEA 3SBOA 2Z0MA 4MZDA 4PTYA 2NZUG 2YDYA 3KB8A 4ACAA 2WOOA 4LI0A 2XNSA 3UQZA 4IP0A 3N8GA 1QQ6A 5F7OA 4TM8A 3UBTA 2QVZX 3U4CA 2DFPA 4WXPA 4R0NA 1JA0A 1VSVA 3BXHA 1CFJA 2ZRHA 3K53A 2YHSA 3ZX4A 2Q62A 4JYMA 2J5KA 1XWWA 5LJIA 3TECE 3INTA 3MN1A 3FLBA 4PYOA 4GLLA 4ZVVA 5I8WA 3V2GA 3DGEC 1VPDA 4M8LA 5CDFE 2JLYA 2JLVA 3Q98A 4QUKA 2G04A 4TL8A 2XA9A 2VUHB 4INJA 1VIAA 1ZKMA 5A71A 2ODPA 4W8HA 1O0CA 3JSXA 5K3EA 1V16A 1FDSA 2XOEA 4UAGA 5I5GA 3EHDA 3ZE1B 3ICVA 3CISA 3HZRA 3EZ7A 2A78A 3G0OA 4LJ7A 1NP3A 4RZUA 4B2YA 2P91A 4GL4A 4G81A 2GBLA 3KLOA 1X2BA 2JFGA 4KQXA 3QKIA 2AMJA 2FLKA 1PWXA 1LJUA 4MAMA 2X7HA 1XDUA 2JLSA 1TPZA 2P2GA 5DI3B 2O5EA 3AESB 1ZD4A 4GBJA 2V7QD 4PLVA 4TXJA 4FT2A 1BNCA 1KEWA 1MN6A 2C42A 2NGRA 2X8LA 4J90A 3DXYA 1EEXB 1QFYA 4PS0A 2ZSJA 1I32A 1Y5NA 1I4TD 1ZJ5A 3SYLA 4IJ5A 3KOZA 2B98A 4OHYA 1UBFA 3E5MA 3KEMA 1X8XA 2NUAA 5DM0A 3OU7A 3VHLB 4DZZA 2DR3A 1RKVA 1ZGJA 2D4AA 3OTHA 3JSAA 3THWB 1CERA 3I4LA 5I3ZA 3FSEA 1TC1A 2D3WA 3AM3A 5B12A 5ARDA 2XCLA 1USVA 2M98A 3RTCA 1JW9B 2GBPA 3JXEA 3S7TA 4B7UA 1BCRB 1R9JA 3O9VA 2YWEA 2HCFA 2A9OA 1T9GS 1UPCA 2GASA 2VHZA 3VTFA 1C4XA 2WHPA 1XKTA 1QLWA 4M22A 4G23A 3WRXC 5AUPB 4D43A 1J8QA 1NXSA 1VG8A 4HFJA 2IU6A 4R01A 5CNIA 5IFLA 1UBSB 2G7MC 4DYHA 4OQZA 3ZNPA 1U8UA 1UKCA 4L8VA 3B9BA 2LWIA 3RI3A 3TWOA 5JPIA 1SURA 3PUXA 4JASB 1UANA 3EF3A 1UC8A 1UKYA 1LLDA 3PRHA 5HGXA 5KOHA 2ZIAA 1AKYA 4MGHA 1VKNA 4R7ZA 3SEQA 5KVAA 4TYWA 1V96A 2EG9A 2Q6IA 4R81A 4KO1S 5CUQA 4C5AA 5J43A 3BREA 1KJYA 3EXIB 2VDUE 4JNKA 5CFMA 2VTBA 3R3HA 1B0UA 2BFNA 2R1TB 4Q6BA 4QT4A 5AXDA 1DRVA 2YFHA 1ISJA 1Z88A 3OIDA 1RKQA 1ADGA 1XQ1A 5HNKA 2AQKA 1XNRB 4JU9A 5ALUA 4J3NA 3P9KA 1XEFA 2AHRA 3FCXA 1ZMRA 3OPXA 3PG5A 1V1MB 3A26A 4JBWA 4LDNA 4JYAB 3HC7A 4Z5XA 4P3KA 2H31A 2O1EA 4QYTA 1UQTA 3MOGA 5EJEA 2FY8A 2OCDA 4IIUA 1Y4ZA 2AC2A 5LZ4A 4BX3A 2CJWB 2FZCA 4C6RA 2HV9A 1ZUNA 2WWWA 4TWJA 3EVTA 2BHRA 3HA7A 4MHSA 2GEFA 1J8FA 1T0PA 5HBRA 3N2EA 3ZJYA 3FAKA 2CLFB 1KOGA 2QW8A 4N5NA 4OJMX 4DLWA 2WTXA 1J2EA 4HFMA 1JBQA 2JH3A 4P4GA 5SZIA 1X0VA 1E6MA 3R4VA 3A1CA 3LUAA 5ENVA 5CCDA 3WGHA 4QUJA 5ENZA 3E0QA 2QTFA 4FHGA 5HCIA 5KTNA 4DY4A 4PPFA 3F8SA 2FUNB 3OQIB 3PJEA 5AJWA 1E18A 1M9NA 2IHVA 2XUDA 3AUJB 2VF2A 1Z6XA 3BMCA 4MQFB 1YI8A 3I2GA 3LUHA 3KXLA 4OGFA 3DT6A 4MWBA 3SZLA 4UZFA 4P7KA 3HCAA 1BN6A 1GJRA 2C92A 2YBDA 3U7QB 1G8MA 3PIIA 4OUDA 1AGRA 3KAQA 2A35A 2PKQO 4BFYA 5JH7A 1JQBA 3FF1A 4URVR 2JHFA 4MB0A 1EVLA 1QH8A 3ANLA 4MS3A 4D8WA 3TE7A 3T34A 5FFNA 1QCZA 2OZLA 2VAXA 1V7ZA 4EHDA 3IH5A 3T7KA 4N12A 2OGTA 1ZEMA 3EQ8A 3TW8A 2C57A 4BQIA 5BQPA 5T4HA 5AI6A 1VSTA 4EG4A 1AUVA 3O4GA 4L15A 1QQTA 1G66A 3JV7A 4IO1A 4M53A 5C8YA 3TAHA 4DS3A 2CHUA 1EFPB 3DV2A 5FNZA 4DMGA 3S0JA 1YVPA 3O4FA 5B7GA 4O6VA 2W2LA 1SB8A 3F7TA 1II8B 3WGYA 2IYZA 1UIRA 1G3QA 2PL9A 3A6EA 2RGAA 4OXIA 2ZSKA 5REQB 3W5AA 1EGAA 3MCZA 2R6R1 3O38A 2YV4A 3WGKA 1GAXA 4EPVA 3EXAA 4ZT4A 3FPAA 4NJEB 3KOYA 1G8JA 3TVDA 3H2IA 2DKOA 4IIBA 9LDBA 1IK4A 4CF7A 4EW3A 3E03A 3IDZA 5JVDA 2FE1A 2EZTA 3HNRA 3KXDA 5LQCA 3CY6A 3PUIA 1WAMA 5BNWA 5IK2A 3QV2A 5GIOE 1R0YA 2BSAA 4DT1B 2AMLA 5I45A 1AURA 3SJUA 2GYYA 4BECA 3K70C 1A9RA 1SVNA 2DFKB 1EM8B 2CVHA 5ECGC 3KYDB 4ZU3A 4K9DA 3L0SA 3TW0A 4OP1A 2C07A 3WNDA 2G5TA 2PZAA 2GKSA 2H1FA 5CH5A 2JPDA 2ZRGA 4W8OA 2QTGA 1QRUA 2JJ1A 1AXEA 3OQBA 2C2KA 1SRQA 3BIXA 4IMPA 1HZZC 2FWAA 4B6OA 1GAQA 3KJEA 2C3MA 1BE8A 1C3JA 2PFSA 4V2IA 4ENVA 1A9XA 1AGXA 2BCJQ 2SCUA 2DUUA 1MBZA 2R5WA 4FWIB 4RK5A 4A1OA 4WSOA 4M8IA 3VZPA 3H99A 5K0TA 5F78A 3W1VA 2V4UA 5J40A 1K98A 4GUAA 3OP4A 3KTDA 2O7QA 2P65A 3BULA 4E15A 4F2GA 4JOQA 4ND8B 2X8WA 3L6BA 4YRCA 5LWHA 1E9EA 4MB2A 4UNSA 1A9YA 5ALXA 1GZ3A 3PF8A 1OJLA 1B6RA 2W43A 3CNHA 4QAJA 5DEIA 1C9KA 1F8YA 1EWQA 4AMVA 2UZ1B 1NXVA 3BE5A 4O5OA 4KXYA 3IERA 2V0CA 1ZRHA 2W37A 1J1UA 3HBJA 2C4VA 1AZTA 1VJ5A 3B1KA 3H65A 4XVQA 4YCMA 1OXBB 1REQA 4YRFA 1RI4A 2IXFA 1KHTA 1V43A 2AMFA 2YTZA 3HN7A 3EASA 4BUCA 5BR8B 2CVQA 4LYGA 4RQUA 5G4KB 3S5JA 1SUWA 4BU0A 1VMEA 1TLTA 5TVGA 1B2RA 3VU9B 1SCIA 4IJQA 2JKYA 1TIBA 1E66A 3E2PA 1P6QA 2C2OA 2DQKA 3OSZA 2NO9A 1E3SA 4R8SA 4EUKA 4R9SA 3AJ8A 4RZSA 2MCFA 3BHNA 4XD2A 1YONA 5CHEA 4QG3A 1AT1A 4HN2A 4XGNA 1WBJB 3M6MD 3U7HB 5K8JB 2ZSBA 5ARCA 2NIPA 1RTKA 3LX4A 4AULA 1R6XA 2Z30A 2W2TA 1UPBA 2AN1A 2ZWAA 1NUAA 4KX3A 4N0DA 5C3UA 5LCXA 3T15A 4DSOA 1WSDA 3ODPA 2XOKD 4YUAA 4O4IB 3GEDA 1Y6RA 4DMCA 3TNJA 5JWOA 3SZ3A 5B3AA 2QVGA 3SAJA 5JJLA 4C89A 5TR9A 3V7FA 3PBKA 3ANYB 3G2QA 5HDQA 3VYWA 2IIPA 2FK8A 4IX1A 3BPSA 4LZWA 5EPUA 1XR3A 4RVUA 3UA4A 3VZBA 2H4HA 2IYOA 3ZKAA 1SJ9A 1SCQA 5ALFA 5LVAA 3K6SB 2QYTA 5IJWA 3H05A 2XIJA 2X9NA 2NZWA 1R0WA 4AUKA 3IOEA 1UJMA 4ES6A 1TW2A 4CHTA 1UODA 4Z1MD 5C46F 4M60A 4RLQA 1TQ8A 3IQXA 3KDSE 1Q14A 1T9AA 1NVAA 3MTEA 4ZVNA 4WIAA 4O2BB 5THQA 3EXHB 1KTVA 2IH5A 1JFFB 1T6NA 2HA3A 2C4KA 3ODGA 4J1TC 3GX1A 1QF9A 1J23A 4U0JA 2N42A 5EXDA 1TC2A 1B4DA 4BO1A 1VBMA 3KWFA 3CF2A 4OMCA 1LU9A 3EPRA 3T7DA 1OI3A 4UCWA 4UTVA 5BSGA 4M7RA 4H7EA 2J0VA 2EW8A 1KQFA 1MJ5A 5BT9A 1XN4A 2HNBA 3AUFA 3HN2A 1DIGA 3X3HA 2NYUA 4XQ0A 1QHHA 4AZWA 4CKZA 1E3WB 1KP3A 3DVAB 2D1YA 4L3OA 5I9MA 5FP0A 5KYUB 1U1GA 3O2NA 3UAOA 5JU6A 3IS3A 3QG5A 1CIVA 2VZ0A 4PXYA 4RANA 3TIIA 1IQRA 1TJ4A 4A03A 3MMNA 4L4XA 3ASZA 3MJTA 3NWBA 4TYQA 5JRJA 3OQNA 1V7PC 4JX9A 1UDBA 1RZ3A 1QFJA 1LFDB 1A50B 3GBPA 3QEOA 1FYXA 5EHQA 4ZGWA 1N3BA 5JPDA 1YS7A 3ZK8A 1N75A 2F7SA 3DFFA 4NBVA 3SR4A 2I3AA 1NZDA 1TFRA 3B1FA 1I30A 3A1FA 4FIZA 5AJTA 4A0FA 4GM1A 1KBQA 4FUTA 2X5OA 1ISSA 2IQIA 2AOTA 2OOSA 2XUQA 2R66A 4RE6A 5JCPA 1OXXK 3EK2A 2VWGA 1VPTA 1C9JA 4UEJA 5A5VA 5CG1A 1IHUA 2AOUA 4JZYA 3RREA 3GVPA 1Z18A 2CFCA 4BZXA 3ZVLA 4LNHA 3BZWA 1Q16A 4KDCA 4TWRA 1WNFA 2VL7A 3LX5A 1KYYA 3UAVA 3M0EA 1GQFA 4JI5B 2CD9A 4X8LA 3M6FA 4Y6SA 3QA9A 3E3LA 2IHJA 5C1PA 1I5EA 3GEBA 3MCVA 4NK4A 3F67A 4WLFA 1TW3A 2C7PA 1OB2A 2A3RA 2IZ1A 3CMMA 1CJVC 3G0BA 1XUOA 1J97A 3LUKA 3NBFA 2VBGA 4E33A 1PUJA 3RSHA 4XDYA 1BCSB 2YL2A 3E5HA 4QLAA 3T35A 3WRXA 4CF5A 3TKYA 2TMGA 4C2UA 3AR3A 3CV3A 2QRMA 3NUQA 4IDQA 1Y5IA 4CKWA 5IKXA 2B25A 1GPKA 1DXQA 2QX7A 2VSFA 3S2YA 2EFHB 1BGVA 2EJBA 3WO1A 2IOFK 3VHXA 4PEVA 1FIUA 3VR0A 3T7TA 3FNQA 2VQSA 4OY3A 3WMXA 1PL0A 1ZN8A 5NLLA 3WB2A 2IYSA 1PZEA 3INRA 3KUUA 1DOAA 3ANTA 2CVPA 2GI4A 4X9XA 5AKIA 3TOZA 3X1MA 4ZICA 5KMGA 2PX2A 1G42A 1IHXA 4B6JA 1EJ2A 1H65A 3IUYA 3NHPA 4N5LA 1ARZA 2HMTA 1UFQA 3AYZB 4FOOA 4HPWA 2GD1O 3EEIA 1V4BA 1VA4A 3G3EA 2WT9A 3ZQ6A 4AMUA 4D9BA 9MHTA 1VPVA 1NKTA 1DUSA 3CNOA 1HC7A 4LISA 5HF5A 4BQEA 1W0KA 4Z86A 2BGUA 1EAYA 1MENA 3GP3A 2BM0A 3MM4A 1J1ZA 1KY2A 3DDZX 4PC2A 3Q15C 3ENKA 4YAGA 1CY6A 2Y66A 4ZIRA 1U94A 3DL4A 4MRRA 1N6HA 4W9RA 4R9RA 5FOQA 2BR3A 3BICA 1N9GA 5LQNA 4UNIA 2RK3A 4B45A 3ZYCA 3GA7A 3CUVA 4J94A 5EWMB 3UJBA 3V80A 4C9BA 1PYDA 2BFFA 4X7PA 2ZVPX 4F3CA 1HKUA 1P44A 2G9VA 2PPVA 1ZU5A 2LNDA 3OT4A 4LJ6A 4NCIA 2VJMA 3A4MA 5BUCA 1P7PA 3KAPA 2Q21A 4TTVA 2HSWA 4OJTA 1RQ2A 4G9EA 5FJJA 5HOQA 2P1RA 4PYRA 2TS1A 1JTEA 4RVHA 1XRJA 1OV6A 2O2CA 4JP8A 3DZBA 3DQPA 6YASA 1OU4A 4IO0A 5JC8A 1G64A 2WIJA 2H6EA 3G9QA 2JB9A 4Y9TA 4TN1A 3ZQKA 3IALA 3TFQA 2FTKE 2QZ4A 4XRRA 1PU2A 2LCFA 4MA0A 5LA6A 3UG7A 4EI8A 4F71A 3D3JA 2WTNA 3R2JA 3K2BA 3S4YA 1WSAA 4EA8A 3NIFB 1OLSA 5CVCA 3SXJA 1OPXA 2H2HA 2FFRA 1TO1E 1WDMA 2J5BA 3OHMA 4LCEA 1TCVA 1YQDA 5DMXA 3RJZA 1ZCJA 3ZZ0A 1GFSA 3FLEA 4Y6PA 5DPMA 4B3DA 4F91B 3NTLA 3WBJA 2A9KA 1WVIA 3IAUA 2R65A 3BEDA 3R44A 4A73A 1Q57A 3GA0A 4WNYA 1Z5PA 2DC1A 2IZ6A 2PA3A 1TM4E 3QU4A 2ERCA 5H80A 4DNQA 4WERA 2PU7A 3IV7A 1SWVA 2CBZA 4UM8B 2DG2A 2PX5A 3FETA 3KUCA 3CLVA 5JASA 1BD4A 2IW1A 1XRMA 3DAGA 3QBDA 2O59A 1UBJS 3DEJA 4DCPA 3A3YA 5LP6F 2ERXA 1FUIA 3K0AA 3EMVA 4LHEA 2F3QA 2OAEA 3BMNA 1OAKA 2J07A 3T0GA 1ECFA 3SF0A 4D3DA 1F3OA 4QLOA 4OLBA 2AR9A 3CGWA 3TQRA 1DPGA 1SUCA 2C2HA 4JT4A 4C04A 2D8AA 2FZKA 3ZWNA 1ORRA 1KSHA 5F73A 5FI3A 1SNYA 3UJCA 5KTRA 1T3ZA 3HG7A 2GJ8A 1BVUA 2QBYB 5LIPA 4M1SA 3INYA 4AKIA 1R0LA 1GG8A 1V39A 3PXBA 2AVDA 3BRWD 3ITKA 4GG1A 5JBNA 1YR8A 1M6WA 4NCJA 5EP1A 3ROKA 4KN9S 1AQIA 5AXCA 4N5HX 1L7MA 5BWNA 4B9AA 5EHNA 2I4OA 4EY7A 1IG0A 3NKFA 4M89A 3G8DA 1HZZA 4L72A 5C9ZA 4FFLA 1WCWA 1QH1B 4NBKA 4GSLA 2X1HA 4IDOA 4R2JA 2NADA 3STXA 1DNPA 2HPVA 3C3EA 3H5VA 3M3HA 2IELA 4TKLA 2GZRA 3IP7A 2ZT8A 3V33A 2ZYGA 5DW3A 3R5JA 2BJHA 2ONCA 1M5TA 3QE0A 4BVJA 5H3CA 3OE7A 1TM7E 1Y3AA 2IP1A 3WAJA 4R8KA 1X3LA 3Q12A 4IVNA 4Z99A 4ZZ0A 2ZVJA 5C1OA 3WGVA 1FMLA 2VDKB 3KQSA 4E46A 4JJIA 1YNSA 3RJTA 3TSYA 2PUGA 5K8TA 2AN5A 4MK4A 1H93A 4DGQA 2YMQA 4PNEA 5B57C 2GJ9A 1ZCAA 1N5RA 2XX3A 4XB2A 3KTAA 1HZJA 4CM8B 1R8QA 3EMKA 2ORVA 2ZXEA 5KKNB 3F0TA 1YL7A 4KGZA 3SXUA 2CCGA 2IBSA 1FVFA 3WLEA 3ZU6A 1WO8A 1JR4A 4N9QA 2VBFA 6PFKA 4BFTA 3NBKA 5C3MA 2ZJ7A 5CYOA 3DLBA 3ELDA 3UWDA 2EC5A 2WR8A 4KL8S 5A7FA 1U1CA 4OL0A 5HJ7A 1PT9A 1XLWA 4BO0A 3P8ZA 4MVJI 3VR4A 3LQRA 4IZHA 4YGYA 4HQLA 3TINA 5AVRA 4JI3B 4GICA 3JQ7A 3B1JA 1GZ6A 2A4KA 3AMVA 4BTVA 1W4ZA 2JHPA 4TUYF 2YW9A 1XMVA 1E2GA 2Q5JA 3O83A 5HIIA 5TV2A 4HAVA 1HDYA 3PQCA 3VKFA 1YBFA 4KQGA 4BASA 1F0NA 3IB6A 4BY9E 4HQOA 3ER8A 1NY5A 2VJNA 1YE5A 1CUVA 2XEXA 3AHHA 1R4ZA 1R4MA 2GN8A 1SMKA 1Y9DA 3B3AA 1ZM4A 2ZE8A 2VAMA 3K8YA 4M1EA 3AR8A 4R2MA 5DM4A 4CCYA 4GVXA 3THSA 2D5IA 1LQUA 1QYDA 2VIIA 2Z5FA 3EA5A 4XZ3A 4ZO9A 3RK0A 4DY6A 1PL8A 3L4BC 1EGHA 3ETGA 2WUEA 4PO8A 1X7GA 2E4ZA 2MSEB 3WL5A 1QANA 2Q8NA 5AJXA 5M29A 3DB2A 1R1DA 2YMLA 3RR2A 2PZLA 1E3IA 2VJLA 2OXCA 4TLLB 4V0QA 1A2QA 5T67A 3ZU4A 4YPVA 1HQCA 1H2FA 1I2AA 2ZSEA 3CE6A 4BIIA 5HZKA 4UUNA 3TLMA 1A9QA 4MJ3A 1NMXA 4J1TA 1ZUWA 3M6UA 4QNRA 2FW6A 3NWPA 5JAUA 2G4VA 1IM2A 2BGIA 3NM4A 4D3YA 1SIBE 3INGA 4Z54A 3FPKA 1YDMA 4MITA 4N7BA 2SNIE 1FZTA 1EE9A 3OJLA 3VO1A 2ZIXB 2WIGA 3DD1A 3GF4A 3I9FA 4MKZA 5TB5A 3VSAA 1NT2A 2QV0A 2DRIA 5FO1A 3SQOA 3W7AA 1TAUA 4P92A 3AR7A 4HNUA 3K6KA 3ORFA 1D4OA 2RARA 4MIOA 2C0PA 4FOSA 1E1CA 1TRHA 2UYOA 2PUHA 3ZZMA 2V8OA 4KIUA 5D6NA 1PZNA 5BSWA 8AT1A 2HYIC 2AJCA 2V6IA 2GN1A 5CA1B 5FBVB 2C04A 2CYAA 4U7DA 4DR7B 4C3VA 3GZTB 1OYVA 4QYXA 3OQ6A 2HUPA 3UAWA 2HJRA 4C78A 4D3ZA 1XDSA 5FPYA 2WQZA 1FYDA 3P0FA 2ZDGA 3BWVA 2W6IA 2AOXA 1N5KA 1PEAA 3MELA 4JB3A 3HNOA 5JQWA 5EIXA 1O9BA 3O95A 4L51A 1DFGA 4WI1A 4EJFA 1KVQA 2IDKA 3PNVA 4NOLA 1SM4A 3C1OA 1KO1A 2O50A 4B7ZA 1HRDA 1R4NB 2V1UA 4S2UA 1Z34A 4XH9B 1NX6A 1ZLYA 2WNIA 3C39A 1T4DA 2PT9A 1CUIA 4JVOA 3GLFA 1EUQA 5K3BA 4AMZA 4Q16A 1CUJA 2ZR7A 3WGUA 1MH1A 1XZ8A 2M6LA 3LF2A 1QIHA 3M82A 4JFAA 3HKBA 3PPIA 3L77A 2RI6A 4KE6A 1W6UA 3JWHA 1U81A 3ANXA 4PZZA 1H2YA 1IHYA 2RKWA 1RJGA 1V1RA 1P1HA 1ZRSA 4TRNA 4Q82A 4BEBA 1ZESA 2UVPA 2OCKA 3B3QA 3LOUA 1B73A 1JHXA 3DLCA 4V0OA 5FKJA 2V9CA 1DRJA 3HUEA 1MX5A 4LBWA 1T3SA 4IQ0A 1DAHA 3KEQA 2UYQA 1PWZA 4L74A 2GZ3A 4WLOA 3UAZA 3OQMA 3KLPX 1JQJC 1Q1ZA 2ZIGA 5EESA 2DR0A 2OK8A 3EIOA 2GD2A 3K92A 1XD2B 4EMBA 5JATA 3PKZA 1ZGBA 4TXHA 4NS4A 3BL5A 4P4TA 3FUXA 5FI0B 5LOVA 1NVKA 3LAWA 1N2HA 1A04A 3E9DA 4Q4DA 2GSWA 2OMEA 3QEJA 3BXEA 4HATA 1FSGA 3LWDA 4RWZA 2Z1MA 1AHIA 2Y1OA 2CBXA 2DFDA 3NP9A 5EMKA 1LSOA 2R68A 2W4IA 1C1XB 4FZJA 4E7PA 1JT2A 1U63A 3HA3A 5HUHA 1VRVA 1FS6A 1HOXA 2O3RA 1KU6A 2B6NA 1ZOPA 3P9IA 4XD7D 3OWHA 2V7XA 1RWVA 1SY7A 3R6TA 3KETA 5CT4A 3DFUA 2W2OA 1OKKD 4RHYA 3GCGA 4Q4CA 1U0NA 1N2XA 2AI1A 2ATEA 3NIBA 1S0UA 4BE7B 1BH6A 3I8SA 1VRWA 1A77A 4K0RA 1I24A 2VA8A 2MINB 2ZTVA 4KJXA 1EB8A 2H51A 3LSTA 4CV0A 4YR7A 3FOZA 1ZD8A 3EWNA 5EJ4A 5DZSA 5J2UB 4PZEA 3LKZA 3T4EA 1NAIA 5H1YA 3Q8KA 1XCBA 5CDTA 3CWZA 4D9EA 3IP1A 4NFSA 5BW6B 3WHIA 2MMGA 5FL7D 1O96A 3LC7O 3M70A 5EEHA 1LS1A 3JRWA 5AKGA 4BKQA 3UPTA 3W7VA 4GZMA 3EH1A 1M66A 1UBUS 2G72A 3GFTA 2O20A 3VTAA 4HDSB 4KHPB 3MGKA 1XMQB 3L8FA 5L8VA 4DA6A 1IAVA 2WWTA 4AUMA 3VSDA 4Q3OA 4TMTA 3HEAA 5G53C 1C1HA 4G5SA 1YZUA 3ULKA 4OSPA 1MB2A 5KWSA 3R9XA 2RAUA 3OF5A 3UY4A 1JQEA 1UBTS 3HKCA 4NBTA 4BBAA 3HJGA 4X7MA 3TNDA 4XE5A 2WYWA 4BHTA 2NP6A 2QJFA 4P2BA 4R98A 5I4KA 5IDXA 3LP5A 3VPXA 1YMUA 1KDVA 1N4AA 4RJLA 2ALJA 1ZCZA 3FPCA 3QP9A 3DTVA 4QHYA 1FTNA 1P9WA 3AETA 4FMDB 5C0OE 1OYYA 3AONB 2O48X 4M37A 4YH1A 3CX6A 4AZ3A 4DBLE 5CB8A 1SK9A 4DA4A 1N25A 3IUSA 2W0SA 5CCXA 1O6BA 1R5JA 1UM9A 3VSEA 1ESMA 5BNFA 4WLEA 1QRDA 4TMZA 1DWQA 1RJDA 1SA0B 4UNNA 3A28A 1AKEA 1Z07A 4AJ4A 1V8FA 1VL0A 1NQOA 4DSTA 2XLBA 3EUAA 3IAAA 3UIEA 1L8AA 4GDFA 1NN1A 3T99A 1IL0A 3H97A 1RXIA 3F5FA 1GKYA 4E4RA 1Z5WA 2O1SA 2A5DA 1G98A 3A6KA 4CM4A 1PAUA 4EUHA 3EISA 2D7DA 3ZOZA 3JQBC 2ANCA 4IIGA 3BD9A 1SC9A 3FW1A 4HMPA 3N0RA 1YHYA 4XX0A 1M5RA 2GILA 1IY0A 1M73E 1Z4MA 3FHCB 1VI6A 3GLKA 1DCKA 1XWIA 3AEUA 3JQ9A 2AXEA 4I5DA 3F6BX 3FFTA 5IYZA 1IY1A 4MS4B 4GM0A 4LJ4A 2HQOA 5EWLA 1AZLA 4EG6A 1OH6A 2UVQA 3SP1A 1GHTA 2BEJA 1M10A 1SZDA 4FGLA 2G88A 4X95A 1ONBA 2XCTB 2J3EA 2OT3B 5DGCA 1W19A 3LUJA 1TQDA 3IKMB 1P2VA 1KZ9A 1N2ZA 2G71A 4DLTA 2WMYA 3JYNA 3Q3IA 1XQYA 5AOAA 4G2TA 5IF9A 1UXHA 2HK9A 4HNRA 5DNAA 1Y3HA 3G2PA 3RQIA 3WB1A 3PHBE 4KV7A 2P35A 1CRWG 3JQQA 4NWIA 3IIEA 3CEPB 1TECE 1KO8A 5CYFA 5E95A 2FP4B 3N8IA 4ZZ3A 3FHTA 2ECFA 1QO0D 2WB4A 3D6FA 3N76A 5TF4A 3S99A 3DLAA 1LVUA 4EA7A 2W71A 3AR9A 1J2RA 1DJQA 1OC2A 2OHFA 4M46A 3I58A 3H84A 1A96A 2FWMX 4KMRA 2V7BA 3ZIAA 5JS1A 4ENWA 5EIFA 4S12A 4H7FA 1FLAA 1QRSA 3KSRA 4UXHA 3HRIA 3N3BC 3KBOA 3ZHSA 1H9AA 2X19A 4HUJA 4I9FA 1JHAA 2EV9A 3Q8WA 1EUDB 1ESDA 3AFNA 5TGZA 1LK0A 5JTUA 4LRUA 1TMGE 1WUJS 3RTBA 3C24A 3HY6A 4G1FA 2R8YA 1SO8A 2NV6A 3C1UA 3GR6A 3NEAA 4URXR 2JF0A 3RK4A 1DELA 4DQXA 1GTVA 3TIFA 3F5QA 1QYRA 3BH0A 3PR1A 3DBHA 3VV2A 1IN1A 4E6PA 1T6BY 2X41A 3KPUA 5E6RA 1U9YA 1T2DA 2WFAA 3KTFA 1UAYA 3FUUA 2IYTA 3QMWA 2ZZKA 3WA6A 4KDEA 5LD2B 2OB2A 3AEYA 3WYDA 1GKIA 3KUKA 4H17A 3GIDA 3OU6A 4ISCA 3JD2A 4EHNA 1OLUB 3H0KA 1EBBA 1ODTC 3CLUC 1Q22A 3WRYC 2J67A 2W00A 3RKUA 4ASUD 4ZRMA 4LV8B 3P26A 4L5BA 3ZQJA 1CUEA 3A31A 4IJVA 3KT8A 4P6VF 2A5JA 3NLLA 4IXDA 1THMA 4ESEA 5BXYA 5A2QA 3MYRA 2HGSA 3PNBA 4UUMA 4WH0A 5JXGA 5AO9A 3VOSA 2HPAA 3C1AA 4CEHA 1R9MA 3WYEA 1N7GA 5ALPA 4L8LA 4RTNA 1CNEA 3K8QA 1TK3A 2PQ2A 5IJ9A 1F5NA 1TZKA 3QE3A 5FYDA 2FQYA 4CODB 2UZ4A 5M04A 1YQUA 1Z5UA 3MXTA 1E4YA 1ULUA 1PK7A 2O0HA 2VDQB 3L46A 3EEOA 5COQA 1K6EA 3DF9A 4FYIA 1E69A 1ELOA 3PI7A 1DJPA 2OGWA 3OJCA 4KKXB 4RSGA 3WYAA 3IEMA 3A9WA 1E2JA 1BDIA 4KRXA 1RRPA 1KJNA 1U7TA 2J59A 2WWRA 2Y1XA 1K5HA 3QEMB 1UC4B 4LE0A 2CLSA 5BQ5A 4YY3B 1ZSVA 3DXFA 3EWIA 1C30A 1RLUA 3K09A 5FADA 5K0CA 4B47A 4F72A 1ZICA 1TU3A 4PG6A 4FPXA 4ZCLA 3S8EA 1KO7A 4QU8A 1NAHA 4MQUA 3AJRA 4ZVUA 3RSQA 3K9NA 1IZ7A 4RORA 4YQYA 2JIQA 1ZK2A 1N0UA 1NVBA 1FW8A 2AFHA 1RHMA 1WSBA 2CFSA 1JLLA 3Q4GA 4WZAE 4WZAB 4ALNA 4OK6A 4DM3A 1I3LA 3E27A 4FK8A 1PTKA 1KBOA 2CFOA 4AS1A 4DXHA 1YHNA 2F67A 1PJQA 1ZA1A 3F47A 1BYIA 2FUG1 1PFVA 3TLBA 1NSYA 2IYLD 1S2GA 1MTZA 1I10A 3EHEA 3BXOA 3MWLA 3TD6A 3L0YA 1GGHA 1FYFA 1OX4B 4MJXA 1DEAA 2A9RA 3CTPA 1I0IA 2BMWA 4Z8YA 1R0CA 4ENTA 1YFLA 3NVKI 4RACA 2Q6KA 4FGSA 3ZC3A 4PBSA 5KTSA 5EHIA 2J5XA 3PITA 3RIYA 1UQUA 2QAIA 3CH4B 3N39C 4M0DA 4E1BA 1MO2A 5FFMA 1U7XA 4PG7A 3H6KA