3OIVA

H-rasg12v with allosteric switch in the "off" state
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
160
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Allosteric Modulation of Ras-GTP Is Linked to Signal Transduction through RAF Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 59
structure length 160
sequence length 166
ec nomenclature
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3oivA00
5KSPA 4IVQA 1G3MA 1G5TA 2QGNA 3QEOA 5JFGA 2Z43A 4DKXA 3REFA 3TK1A 4JLMA 4CVNA 1EWRA 2F1RA 1E2LA 1NLYA 1P9NA 3BXZA 3OESA 3GLIA 2IUUA 1RPZA 3UG6A 3K9HA 5FUVA 4QHTA 2Z5FA 1ODFA 2ZITA 2CL6X 1W1WA 1YZLA 4GT1A 1KI9A 4Q01A 2ZETA 1COWD 4JLVA 1GNPA 1KDTA 2PLRA 4CEJB 2HJGA 3C5CA 1TF7A 4QHSA 4DLUA 1DG3A 1T8TA 2FH5B 1M7HA 1U94A 2ZR0A 4B74A 2CJWA 1RZ3A 1SVWA 4C0QC 3TUZC 3H0KA 1KMQA 4FMDB 3A8TA 4LJ7A 3H1TA 3X1YA 2B92A 4C0SA 4DCVA 3ZS9A 4HDCA 4BFSA 2CEAA 4HDOB 4R7ZA 1K5GA 2JJ1D 3FKSA 4Q02A 3RVBA 3ZD7A 4U02A 1NBMD 2IYRA 3AF0A 1G19A 2JIZA 2ODEA 2WOOA 3QKSB 4L4UA 5F9FA 5JECA 2BBTA 1RW4A 4QKQA 2CBZA 1D9XA 3HDTA 4G5RA 2IXFA 1ZINA 4G5GA 2NZ8A 2IUSA 2AXPA 5CJ2A 2RMKA 3AKDA 3GQBA 3OF5A 3CKLA 3W8NA 2VP2A 5L3QA 2XTNA 2ZUDA 1YQTA 2HYIC 1N6IA 3NDBB 3C14C 1L4UA 3QXJA 2J1LA 1RRPA 3A6PC 2OEPA 1XPOA 2OCAA 3B85A 5FBVB 1N25A 3KQHA 2H1LA 3CB4A 1UFQA 1D9ZA 1E9CA 3FKQA 3UIEA 121PA 4BZPA 2IS1A 1SXJC 4TYNA 1AJEA 5TXGA 3GLHB 5FTNA 5SZHB 3CZQA 3ASYA 3K1JA 3KQLA 4C0LA 3LNCA 5HCNA 3IBYA 5AJWA 3ZJYA 2QTFA 1LS6A 5LDDC 1KHTA 2GBLC 2G3YA 1N6KA 2QROA 1E9SA 3LQQA 2ZTSA 1Q1EA 1TQDA 2QP3A 3W90A 4DUGA 1E1RA 3UMSA 1NI3A 1OXXK 2ANBA 1MABA 3KFXA 1VPLA 1RYHA 3CRMA 1G1MA 1H8EA 1A2BA 1T0JB 5IK2A 4V0ME 2R8RA 2YZ2A 1Z0DA 3OEHD 4AIIA 1JQLB 1KZGB 3B60A 4ON9A 4ASUA 1A2KC 1JECA 1MRNA 2DYKA 5P21A 2BJWA 1XP8A 4ESHA 3G82C 4A1FA 2NG1A 5AJVB 1GKIA 4Q7KA 2OFXA 1UAAA 1TX4B 3WMFA 3VX4A 2W2VA 3A4MA 4NYIQ 5EE9A 4M9SA 4BRWA 2VP9A 3LBHA 4KJZA 4Q4AB 1BYUA 1GP2A 3PXGA 1G3QA 3ZLJA 4CEHB 2A7QA 5J5CA 2OT3B 4NCIA 1YZTA 3HP1A 4ZO4A 1YVDA 1NG9A 4MRNA 2KE5A 2PH1A 1Q21A 5EUMA 5BQ5A 3CNLA 2OO7A 1XXHA 1C9KA 4MKHA 2X19A 4PZLA 2YC2C 3DDCA 1ZC4A 1NLFA 1TTTA 2AR7A 2ONKA 1EG7A 1KI1A 2WJVA 4EPVA 1OLOA 1UPTA 3I1FA 2AXNA 2CDNA 2VSXA 4FCVA 2G9NA 4CEJA 2WWXA 1T91A 3PIRA 4TMZA 3ADCA 1OXUA 4F4CA 3K0CA 4O3MA 4NH0A 2XX3A 1N3BA 3A1UA 3CRQA 5KNDA 1EX7A 1Y63A 4R98A 4TL6A 5C1BA 3KKNA 2FMXA 3PEUA 4B75A 3NXSA 4A8JC 5LBIA 4Q1FA 2QRZA 2PMKA 2YV5A 1EFCA 3QKSA 3VR2A 5EJEA 1KI3A 1N6RA 3C15C 3P1JA 1DE0A 1GAJA 3ZZUA 4LHZA 4Q9JA 1LFDB 2FFQA 4GP7A 4DLRA 1FX0B 5EE3A 2OXCA 3SYNA 2PZFA 1P4SA 4DSOA 1GL7A 2QMHA 4NP6A 4MKGA 3DZ8A 2XZPA 4ZI3A 2R44A 2IYTA 4LYJA 1R5BA 1N6HA 1NMZA 3WHKA 1G8FA 4W5WA 2GXUA 3TQFA 1ZUNB 4JBXA 1DPFA 2N42A 1WA5A 3AVQA 4M22A 2E87A 1J8YF 1OPXA 3AVXA 5J4VA 5J4HA 3AVUA 3GLHA 2JAQA 3A58B 4A0RA 5EP3A 4TYPA 1QZXA 3V4RA 2ZIAA 1W44A 5FI1B 2RGXA 2QPAA 2G77B 4HI0E 4NKRA 1UKEA 2R2AA 5DIFA 1TF2A 3D3QA 5JI3E 1YZNA 3DHWC 2PT7A 1HYQA 5IK2D 2GZAA 4LYFA 1OH7A 2ZREA 4URXR 4B47A 3ZZTA 3UMRA 3P4XA 1BKDR 1ZNZA 1Z0FA 2FNAA 3AQ4A 4JLBA 3GLFE 1N0UA 3JZAA 3THYB 4MYCA 1XU4A 3I61A 3EC1A 2ZI4A 4CT4B 2HJVA 3UKDA 2ORVA 2WKQA 3WYGA 1Z0KA 4GDFA 2WAYA 2IBMA 4TSFD 2WWWA 4HB2A 2ZYTX 1KK0A 4HLQB 3M1IA 3T15A 4NYMR 1P6XA 1TQ4A 1UEJA 3GEEA 1IN5A 1SQ5A 4DIEA 4MRVA 3QBTA 1Z22A 3Q9LA 1LTQA 3HPQA 3T5DA 2QP9X 2O0KA 3K0FB 2AFIE 3BGWA 3K09A 2VSFA 4Q4AA 1MKYA 2DFTA 4Q1EA 4CEHA 3ZYCA 2WWYA 2ZU0C 4IDOA 4XIGS 2J0SA 3G0HA 3R20A 2OFWA 3A1SA 2QSYA 1SKQA 5JMTA 1OSNA 2NZJA 2ZS9A 1KZ7B 4RZ2A 1E79D 4OL0A 4JVLA 1A4RA 1W36D 3B2EA 2ZRGA 2H8KA 3M0EA 1IY2A 4RJLA 2AX4A 1Z6YA 4B71A 3HU2A 2ZVPX 3U7GA 3SOPA 1JR3D 2G0NA 3NWJA 4TMXA 2EQBA 4P4UA 4LC0A 4M21A 1CR1A 2XB2A 2IX3A 2RCNA 3RRYA 3QF7A 1KDRA 3CBQA 4ITRC 2YOHA 1X8LA 3VU9B 2MSCB 1GG2A 1R4AA 4CYMA 4B44A 1Z6GA 5CM9C 1UJ2A 4PPQA 2J7PA 5KTYA 1WF3A 2V9PA 3EPJA 3MD0A 1CF4A 1XJQA 4PHGA 2VHCA 2A78A 2FG5A 1LY1A 3PUWA 4TLEA 2P5SA 2DFNA 2ZI5A 3CF2A 4LJ6A 1NVUQ 1XZQA 5FL7A 4G5OA 5E3HA 3RC8A 2NMVA 2P6RA 1AK2A 3SE0A 5GVSA 1OB5A 3KKMA 4NCJA 1FX0A 1NVWQ 3RS7A 5L3SA 2R6DA 2BJVA 2OUKA 1DO0A 3U3MA 3OE7D 5CLLA 4Z1MA 2W83A 4MGYR 4WZAE 2JDIA 1P61B 3W6NA 5C18A 3EPHA 2FJUA 4JVNA 2FWRA 2P65A 4LY6A 4M1WA 1EXMA 3QPWA 1XX6A 5FL3A 2WKRA 4DSTA 1HY3A 2HYDA 4IDNA 1SXJB 4G3XA 3U7FB 1XPRA 4JLNA 1DAMA 5KU1A 3ZVRA 1S4QA 4JT2A 2RGDA 3KB1A 1HV8A 3EC2A 3L0PA 3FMOB 1OV4A 3RSOA 5CB6A 1U0HC 1ZNXA 3THOA 1E9AA 1GUAA 4PSVA 4TT3A 4LHVA 2BDTA 4I1VA 4RY2A 5FTLA 3LFUA 3PV0A 4E09A 2O0JA 4QBGB 2FA9A 4TLAA 1TAGA 4V0OA 2NO1A 3SHFA 4EPYA 1YR8A 2A5JA 521PA 1AZSC 5BYJA 4L15A 1IN6A 1OIXA 3OFNA 3THYA 1LF0A 3CPJB 3N2EA 4D0LB 2FN4A 1OW3B 1XCGB 3PQCA 1EWQA 4UJ3A 3A37A 2R62A 4P4SB 3RS4A 3GLGE 2WBLC 1L7VC 1Q1BA 1IM2A 4DB2A 1FZQA 1VCMA 1KO5A 1E2JA 3IHLA 4PFSA 5FBWB 4F38A 3CZPA 4W9MC 3HYRA 3S1AB 2A30A 2CL7X 1SVMA 4WXRA 2YVUA 4US0R 2H57A 1OFIA 1Q57A 1RFLA 2OM2A 2CK3A 4HLUC 1ZM9A 5IT5A 1BO6A 4JZKA 4UXHA 5FTMA 2ZI9A 5IRCD 3EA0A 3IILA 2IS2A 2PJRA 2H92A 4LCBA 1IOZA 4TQUS 4MDFA 4Q4JB 5TY0A 3LBIA 4DDWA 2JLRA 2PZEA 4PC7A 1U81A 3GJ0A 2XGJA 4IXNA 2IYXA 2ZEJA 3TW8B 2IL1A 3DKVA 3ICQB 4Q9KA 1PVOA 2O8DB 1OB2A 2C04A 3GJXC 1LS1A 2CNWA 1W36C 3CM0A 1JNYA 1VECA 3CIOA 4OHYA 5A4JA 1P72A 4GMDA 1E0AA 1QHIA 2QTVB 1DELA 4C0JA 4MUAA 1QVAA 4BRUA 1GTVA 5KO2A 1VCOA 2BKUA 2GXSA 1OYWA 3PVSA 4A8JB 3OIVA 1DO2A 1T3HA 1KK3A 3VU9A 3P26A 4KXFB 1EFTA 2OBLA 1DOAA 5LPNA 3R9WA 2GEDA 2PX0A 2O8FB 1U9IA 2KB0A 4NZYA 2Z6VA 1T5IA 2CCKA 2FV8A 2VIIA 2NO9A 3I73A 3L8ZA 4XOIA 4BLQA 2WZQA 1G18A 5SZJA 2NPFA 2IUTA 5DE3A 1G8YA 1T3SA 1W47A 1ZYUA 4LI0A 3PUVA 2ZSDA 1N0WA 3FHOA 1R5OA 5EP4A 5JHHB 2ZJ2A 1OYYA 4PAQA 1E2FA 4EAQA 5HPYB 4LV8B 4ARZB 4OQMA 5AJZA 1JR6A 2J7KA 2QGZA 1RC8A 3LX5A 4HAUA 1KJWA 4ZCIA 4QGFA 1S1CA 3GCGA 1ZM7A 4XWAA 1WBDA 4R9UC 2IHBA 4QXAA 5FR1A 3TVTA 1ZC3A 4HYYA 1AKYA 4JVSB 4UXJA 5J4LA 1SXJA 1XEFA 1TEXA 1K8RA 1ZD1A 1KI2A 3NBYC 3DO6A 1G3IA 2W6JD 3ZGXA 5J47A 1KMHB 3QKTA 1XEXB 1ZM2A 5KSYA 2WOJA 3BIFA 1YR6A 2OCPA 2LKCA 2PMDA 1XJ0A 5FOUA 1G16A 2ECKA 4A0HA 1KO7A 1VIYA 1UADA 1VHLA 2P6UA 1AM4D 2IYVA 2GA8A 2IK8A 3SQXA 1GVNB 1HQCA 4TL9A 3LDAA 4NE2A 1XD2B 2VTKA 2ASEA 3EG5A 5J4YA 1Q3HA 1P60A 2WICA 3P32A 4D25A 4KV9A 4Y0VA 3OIYA 3T61A 3RDPA 3AF1A 3QG1A 5FTJA 5JS8A 2ZRKA 5B58C 1E0JA 4Z8YA 3A4LA 5JJLA 1N5LA 5CB8A 4DEXA 1JXMA 2FPMA 2A3RA 3DEFA 3MMPA 4V0KA 3ZVMA 1Z6TA 3DM5A 4PSKA 4P4SA 4IDQA 3NIBA 1G7RA 2OBNA 1E9BA 4OHVA 2IW3A 3R8FA 4I1UA 3B1XA 1CEEA 1YRAA 3S1AA 3W9YA 3WY9A 2X2FA 3THWB 1NKSA 2TMKA 2QQ0A 5EUQB 3Q5EA 3RRZA 4KBFA 1ZUIA 2X8AA 4Q19A 3RLFA 1Q3TA 1AS3A 4PHFA 1H8HD 3ZH9B 1QHGA 1UF9A 2F3TA 4ZDJA 1E4VA 4GOJA 4BE7B 3CPHA 3ZDQA 2DB3A 1ZMXA 2HXSA 5ANRB 5GVRA 5EP1A 3FVQA 5EXSA 1OKKD 4Q4JA 5HKKD 1E2KA 1G5RA 2W0MA 2FGKA 1GRNA 4BUJA 2O8DA 4HSEA 1JB1A 1W4CA 3U6KA 2C96A 3QF4B 3VMFA 4XWKA 1FNNA 4JIMA 2ZRFA 3MAAC 2J87A 1GILA 1YHNA 3AP2A 5E95A 3WBJA 2DFKB 2ZUBA 2O52A 4O2LA 4QGGA 4H9GA 4D4JA 3C41J 1DAKA 2C98A 3FMPB 4PANA 1COWA 2KWIA 3CRVA 4HATA 4YMUA 1MH1A 1M8PA 2XEXA 5F2EA 1IJEA 4JLAA 4URWR 5BN3A 5KNBA 3C4JA 4JKYA 1CR4A 4A8JA 1DAHA 4KI0A 1GSIA 4P32A 3GEIA 4EFLA 1Z0IA 3KTAB 3BC1A 3TUJC 2BCGY 4DT1B 1FL9A 2O8FA 4GZLA 3HPRA 1BYIA 1GL6A 4MRRA 4TL8A 2I1VB 2H7VA 4HUQB 1MO4A 3L0IB 4NU0A 5FOVA 1XFAA 4LRWA 1J2JA 4XJXA 1YR7A 4UXIA 3SBEA 2BBOA 1YKSA 1GKUB 1E94E 1P73A 1KAOA 2VQSA 3IBGA 5BW8A 4QG7A 2WSSD 2YINC 4IVRA 2H17A 4ARZA 5SZIA 5TDHA 3P4YA 3QXXA 4EIWA 1WE2A 1VCNA 2QSZA 4ABYA 3NBZC 2RB4A 4LGMA 2XXAB 5JWRA 2EFCB 5F98A 1F5NA 2DPXA 4KCGA 3SZRA 1OHHD 1L2TA 1DEKA 2UZ3A 4JLKA 4KFUA 2QT1A 2B21A 3N70A 1W46A 4QRHA 2CCGA 3MFYA 1KMHA 2J9RA 1XEXA 1A1VA 2ZI3A 2XZOA 2F43B 2OAQ1 5HTKA 1R5NA 3B7GA 1BS1A 3IIMA 2J59A 2JLYA 1DAFA 1KDOA 2ZE6A 2OZEA 3SBDA 4N3NA 3QENA 5FUWA 2W58A 4NYJR 3X2SA 2QY9A 2QZ4A 3RC3A 4TZ6A 4XSGA 4B3DA 1CTQA 3VKGA 4AYWA 2Z4SA 3I8SA 3ZIAA 2XNDA 1Z29A 5TVKA 1G64A 3LX8A 3OEHA 3GMTA 1JJ7A 4PQFA 1KO8A 3LBNA 3W5IA 1YZGA 1P2TA 1I4DD 4MYUA 4BFYA 2CCJA 1KSGA 4JLPA 4LYAA 1NF3A 2BCJQ 4PC1A 1TNDA 3IO5A 1G4UR 4B76A 4ZCLA 4DIDA 1J7KA 5D3QA 3AVTA 2R6FA 4URVR 3R9XA 1OFHA 1XEWX 2ZRLA 4HB0A 1X8KA 2ZRCA 1IXZA 3KKOA 4AKIA 4IKEA 2J0QA 3B1WA 3GJ7A 2F6RA 2RKOA 1KK1A 3U2QA 3P27A 3GFPA 4S2EA 4YMSA 5K8UA 2AD1A 4WVFA 3FYHA 2VRWA 3RANA 4DB4A 2V7QA 3U3KA 2ZE8A 2IF0A 4ZKEA 1W36B 3AB3A 1I2DA 2GJ8A 3QF4A 4GPTA 5BXQC 4NMMA 4LJ8A 1DAIA 1ZIOA 2BVNA 4Q1BA 4KFTA 4YXWD 3AF4A 4M1YA 2EWWA 2WSMA 3SN6A 3EW9A 4N0EA 4JVMA 4KO8A 2W2TA 4DJTA 3THXB 1UKVY 4OJQA 4LBZA 1HUQA 2P0EA 2QPTA 3A4NA 2FSGA 3KTAA 4URZR 4F93B 2PBRA 2DWQA 3BAFA 5CDFA 4DT1A 1UKYA 3GJ4A 1AS0A 3WNBA 2EFGA 2V4ZA 1SVOA 1ZUHA 2C5LA 4B3FX 4NDZA 2BEJA 4HUQA 1ZRHA 3CX7A 2VA8A 4I1OA 3PUYA 4D0GA 2A9KA 4ZIRB 4JJZA 3MLEA 1E32A 1SZPA 2WWFA 2EWVA 2KBFA 2O5VA 4G5QA 2NIPA 1EK0A 2ZRIA 4UQOA 2GXAA 1S0UA 3K53A 2ODNA 2XNSA 4X8OA 4B33A 4U00A 1KYIA 2JLVA 1S9HA 2D4HA 4JMPA 1AIPA 3NC0C 2XXAA 1B23P 3DZDA 4XVRA 4R2IA 1JEDA 1TU3A 2MSEB 2WTUA 4O25A 2PJZA 4YMVA 3RRNA 2OG2A 821PA 1KI8A 1ZIPA 4MA4A 3F0TA 1KJZA 1C1YA 4JBWA 4RD4A 1KTVA 1QHHB 2GETA 2QORA 3AEZA 5A5GA 1D2NA 1M1YE 3DMNA 1IBRA 2DCUA 3H86A 4RZUA 4NL4H 4K8OA 3BD9A 4CEIB 3U60B 5G3YA 4B34A 4EPXA 2OLJA 2GZDA 2WMOB 1FP6A 3ADKA 1G6HA 1Q44A 3EA5A 1XD9A 3IKJA 4PO8A 1R8SA 2XNDD 5SZKB 2RGAA 3ZIAD 3LAWA 1OF1A 4IDPA 4JBYA 2ZXUA 1YRBA 2ZRMA 2GTPA 1F60A 3QOFA 2A5FA 2ZS8A 4RSGA 1CU1A 3RS3A 1G3RA 3QPVA 3VFDA 2A5DA 2FZLA 2BMDA 1O3YA 4RD2A 1R6BX 5EP2A 1CXZA 1NBME 3QY0A 4A2PA 3TQCA 4BEBA 4TSFA 1AGRA 3BOSA 4P3YA 3H84A 5CIWA 4HLUA 5EZ5A 4XVUA 2IYSA 3LXRA 4RKFA 2QPOA 2QA5A 1IXSB 1FFHA 1XF9A 4OK3A 3IEVA 1TMKA 2GJKA 2V7QD 4AKEA 3IEUA 1GIAA 2YKGA 4OHWA 1Z06A 3NHBA 3SYKA 2VLIA 1HURA 5JBQA 5FOTA 1I4TD 1D8TA 1S8FA 1MOZA 2GHIA 1E96A 3QXSA 3C7KA 3RAPR 3K70C 1G291 1Q20A 1E79A 2JCSA 1XMVA 2KJQA 1QDEA 3WNCA 3ICEA 4I4LA 4RD0A 4A2WA 2Z0MA 1YJ5A 3NG1A 4FWIB 5ELXA 2FSIA 1DG1G 2H18A 2RGGA 2J5XA 4ZPXA 2D62A 1JR3A 2A5GA 5GJCA 5FR2A 2WHXA 3THXA 1JI0A 4KBGA 1R7RA 4KFSA 2GK6A 1VYUA 3K0AB 4HEJA 4AG6A 5DGXA 2JLUA 4WXPA 3U7HB 4BFTA 4KAXA 1X86B 1N6NA 2HCJB 1ETUA 4P4TA 4TTQA 2IT1A 3HJNA 2FEMA 3OEED 1RKBA 3UPUA 1PV4A 3Q7QA 1T3LA 2GWHA 1QHYA 2G6BA 4KYUA 1Z83A 1XPUA 2IS4A 4EKDA 2J0VA 3LVQE 4M1MA 4IRUB 1SGWA 2Q9CA 3BBPA 4RFVA 4ZIRA 2ZI7A 1N5JA 1U90A 2VHUA 3JZMA 2CXXA 3LO5A 1KSFX 1T4GA 1X1SA 2W00A 4CW7A 3TUIC 2AD5A 3SC3A 1Z2CA 3I4LA 4R71A 3NH9A 2WWIA 2QM7A 5KDLA 3GLIE 3OE7A 2YWGA 3EWSA 2ZYUX 3MWJA 1VIAA 1DS6A 2ZRPA 4EFMA 2WIBA 4FI3C 4JL8A 4EUNA 3PEYA 4D80A 4KVAA 3FDIA 2IYZA 2ZJYA 4DCTA 2RHMA 2R6GA 5CK4A 4KITB 5M04A 2BEKA 2A5YB 4WZBE 4U5XA 1QHHA 4E22A 4US1R 1G41A 4PC3A 3VAAA 1EFRD 1P3JA 2EYQA 2NQ2C 4Q9HA 5DHFA 1NP6A 1G8GA 2R65A 5CITA 1QHXA 1GDDA 4CEIA 2PCLA 4Z51A 5H1YA 2FFHA 3A1VA 4LPSA 1DTSA 4NCKA 1KSJA 5AJYA 1N0VC 1CRPA 4BFVA 1SVKA 2QRNA 3KJEA 4NYIR 4TTPA 4Z54A 1KNQA 3K8YA 2LKDA 3SDZA 3E1SA 1NMYA 1VHTA 4D6PA 3B1YA 4ERNA 2ZRJA 3F5FA 4KLNA 4Q5IA 1XNJA 3RABA 2YWEA 3HYTA 3ETLA 1T0HB 221PA 2GESA 4LV5B 3SQWA 1NNEA 1ZJ6A 3QKUA 5EXXA 3KXLA 2ATXA 4M2LA 4RFSB 3KQNA 2OXRA 2ZM5A 2C9CA 1W48A 3KJGA 4TLCA 1TU4A 4AKGA 2CVHA 4TQ9A 1PLLA 3W5JA 4HAYA 3F3YA 2VPPA 3NEJA 4BZXA 1SKYB 1OH8A 4QGHA 4GNKA 2VBCA 4MGIR 1S2MA 3B1VA 1N6LA 3L0SA 3BE4A 1AN0A 1DADA 2XOKD 1S9DA 4QJ5A 3NBFA 5EE0A 1NSFA 5GJBA 1XEWY 1OXVA 4F92B 1NN0A 3AUYA 2FE4A 3AF3A 3CF6R 5FPSA 3T12A 5HE8A 3WMEA 1TUEA 3HU1A 4D4LA 4DLWA 3HU3A 1TPZA 4KVGA 4QBFA 1U2RA 2HXYA 1E9FA 2VP4A 2VO1A 1M34E 3KQKA 3RHFA 2VL7A 1W4BA 2I3BA 2F55A 1JEEA 4E03A 4C2TA 3KXKA 2VH5R 1GL9B 2ERXA 2Z4RA 4AKHA 3ZS8A 2QQEA 3LWNA 3VTKA 1WBBA 4EFNA 1XTQA 1M2OB 2KBEA 2AFHE 1I4LD 2ZJOA 2PEZA 3K0AA 3KKQA 4LWZA 5JEDA 4BLSA 4QNMA 2ZRDA 4B3BA 3LH5A 1PLKA 1ESMA 1GFIA 1JBKA 2ZRHA 2C03A 2P5TB 1SVLA 4IFBA 4G5SA 3VX3A 3AKEA 2OFOA 4B3CA 2FX3A 1E2DA 4N1AA 4PPFA 1Z3IX 4BWYA 1ZD9A 3TKLA 1XCMA 5EXPA 1RIFA 4TLDA 3AF2A 1YE8A 2ZJZA 4K81B 4Q21A 4DLXA 1DARA 2EVWX 2GNOA 4KYIB 2REOA 1HEIA 2J0UB 2AKYA 1XXHE 2BM0A 4JSTA 3DL0A 3UATA 4FN5A 2BV3A 2IEYA 721PA 2BC9A 1ZVQA 3VR4A 4DLSA 2O8BB 4WIAA 1F2TB 2VP6A 1BMFD 1AGPA 1N6PA 2GJSA 3TR0A 1VYTA 4V02A 2V1UA 2W6JA 3QEJA 3IQXA 1S96A 2QE7A 4PSAA 3PJRA 1F6BA 3AVYA 4KHZA 3BH7A 4TMTA 3UG7A 3W8RA 4XVQA 4ZKDA 3T1TA 5FBQB 1U98A 4BLRA 4WZ6A 3GJ6A 1KO1A 3DM9B 3T06B 3Q3JB 4XSHA 4MDEA 4Q1AA 4WA7A 3LQRA 1W0JA 3LA6A 2JLZA 2MSDB 4B3GA 3OIWA 2O8EB 1J70A 4TMKA 4YDSA 4LHXA 3RS2A 1S3SA 4B43A 3DPUA 2OLKA 3K0FA 4RFSA 1PLJA 4TQAA 3NBXX 1HT1E 5C2JB 1I2MA 1TF5A 2XTMA 4FIDA 4HB3A 4CIDA 1Z6AA 1UDXA 4LDJA 5GJVC 3V00A 3I5YA 5EQTA 2GEVA 2GXQA 1NLZA 2HLDA 4PR0A 1Z07A 3LY5A 1NY6A 1H8HA 4OI1A 4LZZA 4AI6A 3GLHE 1II8B 2XJ4A 3K70B 2VHTA 1E9DA 4HZIA 4DCNA 4CGZA 4GBMA 4OKSA 3SFVA 2FFBA 1Q0UA 5JZVA 3R8CA 1OKKA 4WAUA 2QP4A 5HKKA 4TTRA 2Q9AA 2E1RA 4KFRA 2GAAA 3O8RA 1U8YA 1BH2A 1KNXA 2GVDC 1NVVQ 3VQTA 4JLDA 5FOWA 3VKWA 4LYHA 3IIKA 4UNQA 1L4YA 1KAGA 1MV5A 1NMXA 4UKDA 1CBUA 2VHQA 2HT1A 1OFTA 2OILA 1ESNA 2HF9A 3B6EA 4H1VA 4OJKA 4B48A 4A2QA 4A9AA 4MQBA 1LV7A 1ZM4A 1EESA 3VHLB 1P7CA 1S3GA 2ZR9A 3I62A 1Z63A 1YU9A 5E7MA 4BEJA 1Q1QA 2FGJA 3ND8A 5E7IA 1N6OA 3FGNA 1X3SA 3LRPA 1AKEA 4OHXA 3SHWA 1R0YA 3L8YA 4P0TA 3O8DA 2WVJA 2XAUA 2H5EA 4W7SA 3PENA 3SI7A 4GOKA 1QHSA 2OE2A 2D7CA 3UANA 1FUKA 3ADDA 4KSCA 3TW4A 5GJWC 4ZI2A 1WQ1R 4X8MA 1E0KA 3CX6A 4AYXA 4OYHA 1IXRC 3M4YA 4D2IA 3K9GA 1NN1A 2J0UA 2WSSA 2ZAOA 2JJ2D 4OQNA 3UXMA 4LUCA 3AGQA 5BN5A 2GCNA 5CM8B 5L3VA 3FB4A 5TB5A 1X6VA 4QL3A 4A92A 1CKEA 2O8BA 2DR3A 1F2TA 2IYWA 3BFXA 4HLDA 3TVDA 1OT3A 2QE7D 2BHRA 2GBLA 1OHHA 3HR8A 2WV9A 3CONA 4E5UA 1W5SA 2IA5A 5DI9A 1HE8B 1A82A 3IDQA 3UK6A 2J46A 4DDTA 3V9PA 4H1UA 5JJIA 3VKHA 3REGA 1TL7C 4Q7LA 2ZYWX 5FH9A 5IHPA 3KJIA 5CLQA 4BASA 2WWHA 5A0FA 1VG1A 2BBSA 3NDPA 1CP2A 1W0JD 3Q8XB 1B0UA 5AUOB 4A36A 3Q85A 4OI0A 5KPJA 3WXMA 2EFHB 4AWXA 3NVAA 4UJ5A 1T6NA 3HR7A 4ZV4A 1PZNA 2D3WA 2XSZD 3QI2A 4DC9A 2C78A 3NTUA 4IOLA 1XTIA 4CDGA 4DWJA 5H70A 2O8EA 4M9QA 1WDTA 1UBCA 4RD3A 4Q00A 1XBTA 3SJCA 2HLDD 5B2ZA 1V43A 2HF8A 1GZSA 4OQLA 4RCZA 2REBA 4IHQA 4LSGA 4PTLA 5AUPB 1FP7A 2I1QA 3E70C 2RHDA 4QOSA 3O8CA 3EX7C 4IOKA 3I8XA 1F48A 1ZP6A 2C95A 4GZMA 4NYJQ 2WKPA 5HZKA 2G1JA 1P2SA 2ZVQX 3LLUA 2ZR7A 3PR1A 3AGPA 3B9QA 2IXEA 3TE6A 3K9LA 4Q03A 2X2EA 4IDHA 3AVPA 3BJIC 4M8NE 1X1RA 2ATVA 3UWKA 2EW1A 1FMJA 1XTSA 3I92A 3LD9A 4GI7A 5DH9A 1PUJA 1ZU5A 3D6TB 1R0XA 3MRSA 2WIAA 1MO6A 2K5UA 2P6NA 4MYTA 3W34A 4JL6A 3L2OB 4YXWA 3AUXA 4DXAA 1R10A 2PZGA 1Z8FA 1UDWA 2C9YA 3QUSA 4MITA 1ELOA 5HE9A 2REXB 3GJ3A 3GJ5A 3WRYC 1CJUC 1RRFA 4LHWA 4KLZA 1KSHA 1D2MA 4NONA 3MG9A 3PEVA 4BLTA 2OV2A 4JYCA 1FQKA 2BKEA 1KY3A 2GZHA 4MKFA 5IDVA 5B30A 4GRAA 1QBKC 3GLFB 2JLXA 2IS6A 1AQUA 1R0ZA 1VYVA 2VF7A 3QE0A 4PPNA 1NJFA 2RGBA 1G9XA 5J4KA 4PO1A 5JJKA 3J81k 4V0MA 5KPDA 3KX2A 1AS2A 3Q72A 4FMBB 3SFZA 3CH4B 1E3MA 2GVZC 2FF7A 2ZSBA 3QXCA 1QVRA 4V0LA 3CR8A 1R8QA 4URUR 5K8TA 4XTCS 2UVQA 2DWPA 1CR0A 4JLOA 3TGPA 2H16A 1JJVA 5FTKA 3TH5A 5L3QB 2QT0A 2IWHA 3T1VA 5TV2A 2AKAB 1GM5A 2DBYA 2F9MA 1J90A 5JRZA 5DN6A 3TNFA 3K0SA 5KOYA 1P2UA 2YOGA 2Q3HA 1BOFA 1OJLA 2KSQA 4LOAA 1XD2A 1XMIA 1Z08A 4X8HA 3TBKA 5FBRB 1JXOA 1YZQA 3EARA 2XJ9A 2XTZA 3LV8A 3IHWA 4TMWA 6Q21A 2N46A 3B8HA 4QNRA 1YZUA 1VG8A 2NO0A 2CL0X 3WYFA 4DCUA 4CT5A 3FTQA 5HCIA 4GP6A 1E1QA 1W7AA 3E5HA 4EPRA 2WPDA 4OBEA 2GEUA 1VKJA 3THWA 4FCWA 4ACBA 1IAQA 2QEQA 4HZUB 2BOVA 2HT6A 2WWGA 5GADl 3ZVLA 1RRCA 2W6ID 4QC2A 3PEWA 2WJGA 1MO3A 2ZS7A 2D74A 1M74A 5FPKA 4B6FA 2V1XA 1GNRA 1KOFA 2MMCA 3K70D 3KL4A 3TLXA 2BWJA 4TYYA 3VR6A 4GSYA 3I32A 1SXJE 3CO5A 2J45A 3TR5A 1QF9A 3NC1C 2SHKA 2A2ZA 3R9IA 3VR3A 1GOTA 4G0NA 3OHMA 4EPWA 1M6NA 4FXPA 1WMSA 2QG6A 1YR9A 1XD8A 5EE1A 4YQFA 5AJXA 2QAGC 4BFXA 2ODWA 1MT0A 3Q7PA 4RVCA 4POAA 4RD1A 4WW0A 3KJHA 1JAHA 2Q3MA 4JLJA 2QL6A 2PL3A 3QBVA 1ZBDA 1UBEA 4QBHA 1XXHB 1EGAA 3RRMA 1LF5A 2XB4A 4NBSA 4BQSA 1XCPA 3RS5A 1G17A 2GCOB 3SS8A 3R7WB 2ZSFA 4BPBA 1T9HA 4B2PA 1Q12A 1N5KA 1GKYA 1NSTA 2BMFA 3BK7A 2AN9A 5FOXA 4NPHA 2CLCX 2HV8A 2C77A 2IYUA 1CLUA 3KUCA 3RYTC 3B5JA 4EJSC 3Q5DA 1D6JA 3AH8A 2E9SA 4PZYA 2QNRA 3MUFA 5J40A 1VG0B 4EPTA 2HDNB 4M9XA 1Z2AA 3X1DA 4BFUA 1LVGA 4QBIA 3FHTA 1UBFA 2IEZA 1HTWA 3OEEA 4LJ4A 4KU4A 2IYQA 2YWHA 3GLFA 1NKTA 5DLQC 1AZTA 1U0LA 4UNNA 5AUQA 4MKIA 1N2CE 2Q21A 1W2GA 5FUXA 3NKVA 1K5DA 4PXAA 3UMFA 3GLGB 2RGEA 5JI2E 1CJMA 3IUYA 2JLQA 3EPKA 1U9IC 3OAAA 4TL7A 2PLFA 1E0SA 1ZD8A 1U0JA 1Z28A 1IQPA 5DN6D 4Q4HB 3CX8A 1VMAA 2FEOA 4XD7D 2BIFA 2ZJ5A 2IXGA 4PPGA 4CF7A 2F43A 5G40A 2W0SA 2LCFA 1NIPA 5JEEA 5CIQA 3L0OA 4LJAA 2V8OA 3WP0A 3FFAA 4US2R 3JVUA 1P5ZB 3A1TA 2CE2X 4M0LA 1FOEB 1US8B 3FHCB 2ORWA 2C2HA 1EFRA 4D4MA 2BMEA 2Q6TA 2CHGA 1E1QD 3OZXA 2D7DA 2WPDD 3U61B 4G1UC 2ONJA 4M1KA 4QHYA 2CMKA 3OIUA 2O0HA 5K8LA 3E2IA 2AK3A 2QENA 3EZFA 1T5LA 4L8GA 3K0EA 1AQYA 3SJZA 2AHOA 1MR3F 3IIJA 2FZ4A 2ZE5A 2DWOA 4YMWA 3EIQA 4CZ2A 1G8PA 1W49A 8OHMA 2CHQA 4HZUA 3BWDD 2DFLA 1WXQA 1WCV1 3B82A 2IHYA 4X8LA 5B57C 3KUDA 1XDBA 2V3CC 4AK9A 1P75A 1SVSA 2CLSA 4TWZA 3AKCA 1H65A 5FUYA 3WRXC 2CHVA 2LWIA 2ZRAA 2OAP1 1RE0A 4HAVA 3BB3A 1ZCAA 4DSUA 1W0KD 3U3JA 1P9WA 1E2PA 3IO3A 5DO9A 1HQYE 5BWMA 3QQ5A 1KJYA 4RD6A 3U3RA 3UWOA 4ZDWA 3FOZA 4CRWB 3KQUA 4TMVA 4C4PA 3LLMA 4IOMA 1FUUA 4N0DA 2XOKA 3QVVA 1VDZA 2XITA 2AL7A 4M1TA 4NYMQ 3JVVA 4Q4LA 5C4GB 2RGNC 5EE5B 3U7EB 3QJYA 3SJAA 3A36A 4MUBA 3PG5A 5KHOC 2KI5A 3DKPA 5EZ6B 3NEYA 5BN4A 4OI2A 4PC6A 5AK0A 3LW7A 3U44B 3VNUA 1U8ZA 2YC4C 3M6AA 2ZRNA 2GCOA 4B2IA 3R7WA 4OK5A 4LBWA 1KIMA 4IOJA 5FPYA 1OE0A 1VCIA 1OIWA 3DMDA 3SYLA 1XTJA 2HEIA 4BECA 4A82A 5H68A 3EIEA 2ZPTX 3FKSD 3TAUA 1KI4A 1O87A 1PJRA 2QM8A 4XH9B 1KY2A 2JIZD 3FPAA 3GPLA 4NCHA 1KDPA 3T5GA 4BLOA 5KNCA 4XWOA 3OAAD 2QBYB 1Q1ZA 3KXIA 4A0FA 3U4QB 2GAOA 3U6BA 4A4DA 4MGKR 3HWSA 5HZHA 4Q1CA 3WNDA 3X1ZA 3GLGA 3RSLA 3DOEA 3X1WA 4TYQA 4PO9A 1WB9A 1VG9B 2GRJA 4M1OA 2D2EA 1Z47A 2ANCA 4PHTA 3WYAA 1NIJA 1SHKA 1GWNA 2VYFA 3VHXA 4GOXA 3QIAA 4QJ3A 5F9HA 2BBWA 3PITA 1G5PA 1T8UA 4Q4HA 4C9BA 4D81A 4LBYA 2YYZA 4C3ZA 4OI4A 2V55B 5L3SB 1G7CA 5HR5A 1KI6B 2C8VA 4DLYA 2CVFA 4LK2A 5JLJA 3CUEF 1HA3A 4O0MA 4NTZA 1JPJA 1E2IA 5L8VA 4B32A 1BMFA 4GL2A 3WHLA 3EAQA 5CYPA 3L82B 5DNYB 2ODBA 1W5TA 3CH5A 1E4YA 1XZPA 2WJJA 4DZZA 5FOSA 1US8A 1LW7A 2VP0A 3FMFA 1IONA 3EZ7A 3MWLA 4JT4A 3C8UA 3MWYW 3EIHA 2IWRA 4TYWA 3DOFA 4DDUA 2ZYVX 1W2HA 4G01B 1GRRA 3ECCA 3D31A 3T1OA 5CDFE 4FD2A 4D82A 5H8WA 4DUGD 1E1RD 2C99A 2F3RA 4TLBA 2OCYC 2AWNA 4UNPA 1H8ED 4Y0AA 2G88A 2JGNA 4ASUD 2NOAA 3ZQJA 1W4RA 2R6CA 5TARA 1NL3A 2EFDB 2JA1A 1TADA 3N5CA 2UKDA 2JJ8A 2DHRA 2QI9C 4HAXA 2F1IA 1TQ2A 2EYUA 2NO7A 4HAZA 4II7A 2HCBA 2YJTD 5K8IA 2G1KA 1KO4A 3EXAA 5L3RA 1G7TA 1VTKA 1XTRA 4RCYA 2GKSA 3GP8A 2WJIA 1Z0JA 4FMCF 5EXTA 1R0WA 3KZ1E 1JQJC 3SR0A 2GJ9A 4Q66C 1UBGA 3GD7A 2PCJA 2D06A 5D3MB 1ZW6A 2V54A 2QAGB 1IHUA 1X8JA 4OHZA 1G21E 1LB1B 2IYLD 3VR5A 1NVXQ 5FBLB 1D5CA 1XMJA 1OFUX 1A7JA 3ONWA 1G8HA 2ORIA 3BRWD 3V4FA 1E9RA 3KKPA 5F3WB 1ONBA 1OXSC 2F7SA 3RNLA 1LNZA 2QU8A 2NGRA 5IF9A 3U44A 3ZZ0A 1KKLA 2HUPA 2QN6A 3MSXA 4NCNA 1U99A 3T1QA 3NH6A 4YDHB 4DHEA 1L8QA 4EJSB 2R9VA 2BMJA 2RGCA 3I5XA 5C46F 2R6AA 3QPUA 4OQXA 2GCPA 3FFBA 4A15A 4B35A 2X1VA 3ZD6A 1QRAA 4S35A 3CLVA 1JALA 4JJKA 1CS4C 2JLWA 2QBYA 4FINA 2PX3A 4R2HA 5DYIA 4FWTA 2O8CB 2ZI6A 3AV0B 3U4QA 2G0TA 4J0QA 4PQYA 4BFZA 3I72A 5JHGB 2VP5A 2XZLA 5UKDA 5KUTA 1NJGA 3CRRA 3PUZA 4ZDKA 4MRSA 4C2UA 1E9EA 4AD8A 1UM8A 1CJVC 2JJ2A 5G41A 3SEAA 1SULA 3MJRA 4LV6A 1NG1A 4WOPA 1KI6A 1CR2A 3GFOA 4Q48A 2W2XA 4B3XA 2GJAA 3BB1A 3IPXA 3QVUA 4LX0A 1G6OA 4PHHA 3TJZA 4C0KA 3TRFA 1OIVA 3AVOA 3CPEA 1JR3E 1KK2A 1EX6A 1CULC 2PEYA 2ZJAA 3IGFA 4LBVA 4NHOA 3ZVNA 2F1JA 2P67A 2MMGA 5KYKA 2GF9A 2Y8EA 3B78A 4IFEA 3SU8A 5KSZA 1UKZA 4B2LA 3MWKA 4Z8XA 2UZIR 4U7DA 2CLDX 2ZSEA 4D26A 4URYR 3DVLA 5LD2C 1P9RA 1CIPA 2NPIA 5KDDA 1C4OA 1E6CA 3EZ6A 1WRBA 2B7BA 3W3AA 4EQ6B 4P33A 2XSZA 3LW8A 4HAWA 1ZCBA 3H4MA 2Q9BA 2AWOA 4PAMA 3T35A 4AURA 1GRQA 2NTYC 1IY1A 4W5JA 1TEVA 1G4AE 4A6XA 1RYFA 5AR1A 4DRZA 5JWOA 5FPTA 4D4KA 4C7OB 2N1BA 4M9ZA 4FMCB 3MGCA 4E07A 4DBLC 4QM6A 2D2FA 4AC9A 1GITA 1Y3AA 4YC7A 4M4SA 1WP9A 4JKIA 4OQFA 1II0A 5JRJA 2B8WA 1Z0AA 2YNMA 2WM9B 2F9LA 1EFUA 1S1MA 2JEOA 5D3MA 2QAGA 1XRJA 3T34A 4HUTA 2WAXA 5JS7A 4BLPA 3QSYA 2ZU6A 4I81A 4RZ3A 1E98A 4QFMA 5JSZB 1UEIA 2OCBA 4F4IA 2FSFA 1E69A 5LB2A 4GFDA 4DDVA 1ANKA 2ZJBA 4K46A 4C0BA 3ZQ6A 2Q0HA 2YHSA 4LC1A 5CK5A 1YZKA 1XJCA 3TSWA 2ZSAA 3GFTA 4Q9IA 1J99A 4F4JA 2OBMA 4M1SA 3AP1A 4L16A 4EJSA 1XMSA 3BS4A 2OSBA 1SVIA 3N2IA 4L9SA 3CW2A 5C4MA 3K0CC 4B73A 2J7PD 1E2QA 4KSBA 4LJ9A 4ESVA 1Z6XA 3CWZA 2J41A 4UNRA 2VHJA 3L43A 2O8CA 5FL7D 3GJ8A 1RJ9B 2RH5A 3AM1A 2FPKA 1K6MA 1NY5A 4LHYA 4KODA 1IY0A 2VEDA 3A1WA 2QTHA 3AP3A 2QUZA 4Q7MB 1ZU4A 2DY1A 4DCSA 4AYTA 4AG5A 4BFWA 4Z1MD 2JDID 1F2UB 4I99A 1CRQA 1E2NA 4HLCA 5JWHA 4L9WA 4Q18A 1R2QA 1E2EA 4I1SA 4Q47A 5TMPA 4IVPA 1CJTC 1QG2A 3I3SR 2VF8A 4RZXA 2OESA 4PC2A 3O47A 2IYYA 3LXXA 1JAIA 1IJFA 4IJMA 2ZROA 1PUIA 4PX9A 4TT3D 4Q1DA 3BERA 3TMKA 2GDJA 2GK7A 2YWFA 5DHAA 1DBSA 1RVDA 2FU5C 1RRGA 5DI3B 1KI7A 4C0HA 3QKRB 3OFND 1OH5A 1NN5A 3CR7A 1IN7A 3H2YA 3ASZA 4EQ6A 3WP1B 3ND9A 1G7SA 2EFEB 4YMTA 2OHFA 1N5IA 2L0XA 3ADBA 5G53C 2Z83A 2J3EA 4V0NA 5DSZA 1GNQA 1FMLA 3QG5A 3BH6A 4P31A 4C7OA 1CJKC 1DAGA 2W6IA 3EZ9A 1A5TA 4QGAA 2X77A 1XWIA 2P3SA 3QNUA 3RS0A 2CK3D 1NRJB 3W3ZB 1Q22A 1P62B 3B1ZA 1NVVR 2GILA 4B6EA 1ZAKA 4MRPA 3RWMB 3MCAA 1II8A 1DAEA 4LJ5A 3TIFA 2QMUA 1OH6A 2P2LA 3MJHA 1HH4A 621PA 1E2GA 1QHNA 4L5BA 3WMGA 5B64A 3K09C 4JSYA 1HE1C 3W6PA 3SNHA 1TQ6A 2V6JA 4O2RA 1D2EA 1F3OA 2RGNA 5CYOA 2ZJ8A 2ZAMA 5KSOA 5AUNB 3GLIB 1OXTA 5JSZA 3BFVA 2G83A 3TAHA 3VR1A 2CNWD 1BIFA 1DVRA 3AVWA 2C9OA 5CJPA 3D8BA 1QG4A 5DYGA 1II9A 3W6OA 4HB4A 1E99A 4ILEA 1W4AA 2FOLA 1M7GA 4MH0R 1IN8A 3PFIA 5AWFC 3EPLA 3FWYA 1MO5A 2BM1A 2I4IA 2B7CA 1G20E 3FMIA 4V03A 3BB4A 3SJBA 2ZUCA 3TSZA 2V6IA 4ZDIA 2CJWB 3G5UA 4F91B 2FDCA 2NO6A 5FFMA 4TN1A 4A6PA 3TSOA 4A0GA 3B13B 5LB4A 2ZANA 2JASA 1AA9A 3KDSE 3GEHA 3CF0A 2B6HA 1Z5ZA 3D7MA 4FMDF 2VSOA 4AY2A 1RJ9A 2ERYA 4IW3B 4JL5A 1HT2E 3U3OA 1SKYE 4PQRA 4ACAA 421PA 3P20A 2JJ1A 4QM7A 5DISB 4QJ4A 1JPNA 3QXHA 1TUIA 4DLVA 3CRW1 1KKMA 1NBMA 2WJHA 5JCZA 4IEIA 1J8MF 1F2UA 3IPYA 5KDOA 3CWQA 1IN4A 4C30A 5E7JA 3VNVA 3LVRE 4HDQB 1KGDA 2CE7A 3NHAA 2JATA 3RWOA 5BYKA 1FTSA 1SXJD 4W5HA 3K9NA 4XD7A 4BZQA 3BH0A 2WMNB 5G3ZA 3EZ2A 2QAJA 4DVGA 1FQJA 3FE2A 4MGZR 4XTRA 1MRSA 2Q3FA 2FPLA 3B9PA 2GF0A 3AVVA 2JLSA 4YONB 4F7WA 2F1HA 3PCRB 1E2MA 3IQWA 3KB2A 4DLZA 4ZCMA 3CNNA 4PZZA 2ZRBA 1V5WA 3F8TA 1U8AA 5E4FA 2YOFA 5DI3A 3C16C 3EWAA 5LD2B 2FFAA 2IC5A 3QKRA 4OK6A 4FCTA 4EDHA 4DSNA 4C0AC 4DLTA 1NN3A 4M53A 1MABB 1FNMA 1XTKA 2B8TA 4UNSA 4D0NA 3PUXA 1FW6A 4RKEA 3WBKA 1G3UA 3C5HA 2AK2A 5FI0B 3U5ZB 2EU8A 2FSHA 3CNOA 3KFVA 4DEYA 4BGDA 4YLGA 4LPKA 4FW9A 1ZM3A 1FPMA 5FPHA 1P2VA 2QMEA 2WJYA 2PT5A 4MYHA 1ZNWA 2ZQ5A 3AKYA 3O8BA 4Q9LA 5JCPA 1FTNA 4TZ0A 2ZE7A 4IXMA 4WBSA 4LJYA 1EFHA 3BORA 3X1XA 4GMXA 1E2HA 1XB2A 3EASA 1SHZA 1M7BA 3BFKA 4PAOA 2IF2A 1ZNYA 2QMOA 4IEEA 4Q7JB 2RAPA 4JS0A 1W0KA 4JYBA
chains in the Genus database with same CATH superfamily
4ZQBA 4IVQA 1G3MA 3QEOA 4DKXA 3LOPA 3TK1A 2AT1A 1EWRA 1Z2OX 2ST1A 1P9NA 2P5YA 4CVNA 3BXZA 4EA9A 4EQZA 1GGEA 4GI5A 5J2UA 1UFKA 5FUVA 4QE3A 1C9YA 2XNHA 3JZIA 4IHKA 4BV2A 2H07A 2Z5FA 5CD9A 5CDUA 3IXMA 2ZITA 3AW8A 4FYYA 4OMFG 2Q2WA 4U2DA 3PIIA 4BVLA 4YRIA 2Y1WA 2OKCA 2BHTA 2C92A 2PZBA 5SYNA 1A8PA 4I66A 4ES6A 1BC5A 5ULLA 1PZHA 2YBDA 4UVDA 1QCZA 3C5CA 1KBOA 4UUPA 2I80A 1JFRA 1ZGZA 5DRTA 2X41A 4J7AA 1M7HA 3ICPA 1DXOA 3DJFA 3TM5A 1QRDA 1RZ3A 2FB9A 2CN1A 1EJ6A 4FMDB 1JZQA 4C0SA 4ZJPA 1EFKA 4A2CA 4JJIA 1HDCA 1MENA 1ZK1A 5DM70 2CEAA 1D4ZA 4HDOB 1XFDA 2DC1A 3EF1A 2JIBA 1AHIA 5CB0A 2GJ4A 1D0IA 2Q5LA 2P9GA 4DA0A 1BX0A 1J8DA 3COZA 3CEJA 4U9IS 4U2KA 4UMEA 4ZRMA 2NACA 3R5XA 3RVKA 4FD3A 2WOOA 3D2AA 1MZVA 4Q24A 4WNIA 3ZNQA 1MBZA 1YA8A 1JQEA 3HDTA 1BCSB 1AQNA 2XDQA 3HYNA 4ETWA 1RPJA 4ZC1A 1YMQA 3OTIA 3OT4A 2NZ8A 2YQ5A 4GC9A 2G80A 2AXPA 3GUYA 2V03A 5CJ2A 3TVYA 3ZW9A 2DR2A 6ABPA 4Z4EA 3HZOA 1KP3A 3AKDA 4I5GA 3ZDZB 2D6FA 3W8NA 2EEZA 3SQDA 4QQ8A 1EK1A 3RS3A 2ZUDA 5JNTA 1N6IA 4G1CA 1OLSA 4MVJM 4CKWA 2GD2A 3OOSA 2OEPA 3R4CA 2OCAA 5K0EA 1H2XA 1N25A 5F64A 1H4VB 1PD1A 3CB4A 3GJTA 4B6GA 4CMCA 3ET4A 3UIEA 3RUAA 5IBQA 3O8OB 4BNKA 4BZPA 1LWOA 1NQXA 1QFSA 3PS9A 4TYNA 1AJEA 4PCAA 5TXGA 3GLHB 3SMQA 4MMXB 5AW9A 5B3KA 1EH5A 2D3TA 1URPA 3K1JA 5KYYA 2WYHA 2B37A 4ZVKA 1P31A 4PM4A 5AJWA 4PPYA 5HZMA 1KHTA 1N7IA 2ECPA 3GGCA 3MWDA 4B9AA 3LUPA 4BQNA 3CG4A 3N6RA 1N6KA 2RH8A 3LQQA 4ZYVA 1V35A 2DBRA 3SYRA 1U02A 1DU4A 2QP3A 4K6OA 4HRVA 5TE9A 4BNYA 3VO2A 3A3KA 1E1RA 2IU4A 1NXTA 3BQ9A 1OXXK 4RTQA 3KFXA 1MABA 4GDMA 1VPLA 1LD3A 3JQ6A 4FQ5A 2BDUA 2OHJA 3GQVA 5CH8A 1G1MA 1Y8ZA 1IZZA 1QGED 4MI3A 2R8RA 3V3KA 1JKMA 1MPXA 4AIIA 4ON9A 4GLFA 2Z57A 3MTAA 4CFZA 1A2KC 2AFHA 2I9PA 2R48A 3R6GA 3MFQA 4MQEA 1KEEB 1ZFNA 4YUVA 4ADSG 4IHJA 1FXUA 3WRVA 5CHEA 1TYCA 3RM3A 1D1SA 5AW7A 2OFXA 1WV0A 3T0FA 3D3NA 2I6SA 3DEHA 3P2EA 1CIJA 3HB4X 4P84A 1GZ3A 3FNEA 2EZ8A 2VF2A 2YJ3A 4M9SA 4OQZA 2VP9A 4GYYA 5IVDA 4RACA 3RYCA 4KJZA 2HI0A 4BBJA 2PWAA 4YI3A 2CMHA 3V7WA 3ZDEA 5BR8B 1YR3A 3PXGA 1G3QA 5LCXA 1QF6A 4FIZA 5CGZA 5JYBA 4P83A 2OT3B 5DGCA 2G9VA 3A1NA 3HP1A 4MVJP 4MRNA 4ZOQI 5KJFA 2R2GA 3OUTA 1ONNA 4L51A 1U3UA 2NQTA 3CNLA 2G9QA 1FJGB 2YC2C 1Q0QA 1DUSA 1EIWA 1TU0A 2WILA 3CT6A 3KSMA 4AO7A 1V16A 1DKMA 3HXQA 5TSDA 5KINB 2FMTA 1RM4A 2WJVA 3GT7A 3RU2A 1LRKA 1U2GC 2MR5A 5K4AA 4EKGA 2VSXA 3E5MA 1BE8A 3NOQA 4QFCA 3TTTA 2CLMB 2YQZA 3JY6A 1GPWB 1RYZA 1H23A 4G1EB 5I7SA 1T91A 4CEJA 1UDAA 4RJIA 5BNIA 1M6VA 3DTVA 2VJNA 3KPUA 1BKYA 2BAGA 4NBWA 3MT7A 4XB6B 1PW5A 2C5HA 2PUDA 3R3VA 2IODA 2RE8A 5KNDA 2MU1A 3KK0A 1EX7A 5LBUA 1EDOA 1W75A 2FSVA 4RIIA 3C5WP 4RL6A 4ZODA 4B3IA 3NXSA 4MS1B 5D1NA 3UAWA 4BLWA 3ODPA 4Q1FA 1IZ8A 2YV5A 8LDHA 1ZZEA 4HYEA 4AVYA 3QKSA 4K03A 3E9DA 4TKUB 1PR1A 2FK7A 2MHCA 3ZJ5A 1YACA 1DE0A 1GAJA 1KJNA 4LHZA 4RVUA 4XUEA 2TMGA 5J2TA 1PQ4A 1NP7A 4QARA 3FNQA 2PZFA 4U2BA 1M0SA 1EZ1A 5C8YA 5CVEA 2XZPA 3K35A 4ALKA 5A7FA 4NJOA 1M83A 5FLEX 1GGJA 1I2ZA 4PZ0A 1ADFA 4FOTA 1KS2A 5DTIA 3WHKA 4M1QA 4ERXA 2QRPA 3FJYA 1UJ6A 2GXUA 4JBXA 1MPTA 1DPFA 2H08A 4PHCA 4RPGA 4U8HA 1XZJA 4P2GA 5A05A 5ICMA 2ZTLA 3NNNA 5A6SA 1QAMA 2FSUA 3PHHA 5J4HA 3ROEA 3PDHA 4YRJA 2Q1YA 3OJOA 4BVGA 2LTAA 4QBTA 1U7DA 1QZXA 3V4RA 2W8BA 2JK0A 1SK8A 3KVNA 3VTFA 4K6MA 5BV7A 2OFPA 2FUNB 3HCNA 4HI0E 4PW0A 2AEEA 1NXVA 2VDJA 1POXA 5JI3E 4YWJA 3O31A 5TS2A 3I01A 1HYQA 5IK2D 4C07A 3F49S 1U7UA 3RAGA 2P2ZA 3ZCQA 2OG1A 3LK6A 4PAWA 4G0XA 2IXTA 1BDBA 1Z0FA 1QGYA 3HYSA 4OM8A 3GLFE 4GECA 1Q19A 2G09A 4MYCA 1XU4A 3ZTTA 4B7UA 4FOOA 4HQ0A 4BVEA 3HKCB 4ZK2A 3I61A 2IDKA 2ZI4A 2AYXA 1NJ8A 3UB3A 2HJVA 1ZEJA 3WYGA 5ILQA 3UMVA 2IBMA 4CLOA 2WWWA 1JLMA 2V7WA 2A67A 2O2JA 5C7IO 4WGFA 2O0MA 1E20A 2IGTA 1ZN2A 1S8AA 1WOMA 3Q9LA 5B4TA 2OZLA 3D54D 2JARA 4R16A 1JKIA 3FTEA 1HT3A 5L95A 1SUWA 1YJBA 2VSFA 4K26A 3OCZA 4IYJA 4Q4AA 1MKYA 2DFTA 3S8MA 1SELA 4CEHA 5KYUA 3TD9A 4X91A 3VPHA 4QPCA 1T0BA 3SIWA 3R20A 3ET5A 3DMGA 4FCCA 2WJ6A 1KF0A 3SIXA 4RZ2A 3DOCA 3ITKA 1KZ7B 3IUPA 4OL0A 1A4RA 3IMKA 3S81A 2X1LA 4QU8A 5LLTA 1CS0B 4Y30A 3RS9A 1Q77A 3M0EA 1IY2A 1BOOA 2HRCA 4RJLA 2V8BA 3FTFA 1KU6A 3FTNA 2AXEA 2H0QA 5EVCA 1DIOB 3QHPA 4Z7OB 4HX5A 2VCEA 4B71A 3RTCA 2QG9A 3ZKWB 2JFOA 4UMDA 4ZVVA 4A1OA 4P4UA 3ZBUA 1L3BA 2ZUWA 3C70A 4LNUB 4HNAA 1QMPA 3IOYA 1X7HA 2C2YA 1T34A 1ABFA 1U8TA 3GAFA 5AQEA 3ZC3A 5CT5A 3VR2D 1TCBA 2AC2A 1X8LA 3ZV4A 4DXHA 4MARA 5CURA 3QBDA 4BCDA 2XDWA 4TTTS 4B44A 2YZGA 2J7PA 3M6XA 1AHPA 3K8QA 4KTTE 4R9VA 4UFNA 3OEWA 2V9PA 3Q6MA 1CE8A 1XTPA 1ACJA 2HQ1A 3MD0A 1IEXA 4PHGA 3M1AA 1N34B 2PH5A 4D3SA 2ZI5A 3O82A 4QUJA 1NVUQ 5FL7A 4G5OA 1TVKA 1XDZA 2P6RA 3NM6B 3FAKA 1OB5A 3NRCA 4OB8A 1FX0A 2G06A 4AJKA 5L3SA 3U3MA 1XVIA 5F3RA 4Z1MA 5T4FA 4B0PA 2GTIA 5C18A 2DPHA 3F74A 3ZNNA 4JVNA 1PJSA 3WB0A 4B8YA 3QPWA 3ETEA 1EE2A 2G5TA 4DSTA 1ZJ5A 4DG9A 3T5MA 3V32A 3U7FB 1S2IA 3W4IA 3LLSA 5FI3A 3WRWA 5KU1A 2AR0A 3PNBA 5JD5A 3FPHA 3W5BA 1I3LA 2FPWA 3PC6A 2RGDA 2SKEA 3U4IA 5JFTA 2HAEA 3HXLA 2PKWA 3SY8A 5HW0A 1DGQA 3D5QA 1J4AA 2H00A 4CMEC 5CB6A 1ZNXA 3GH3A 3THOA 3A28A 4YBZA 4HWGA 1JR4A 2FDRA 4OHRA 3MCUA 2BDTA 2QLJA 4YJHB 5FTLA 2PS9A 3L1JA 4LE2A 3S2FA 4L76A 3PV0A 5BSUA 4JB3A 1GLNA 1YZHA 3V6LA 2O0JA 2FA9A 1U0BB 3SHFA 1IN1A 3A3OA 1AXRA 1Z6PA 2IYAA 2RHHA 521PA 1AZSC 5BYJA 4A3SA 3AEUB 4ZI5A 1LF0A 2NADA 3N2EA 3WA6A 4MI9A 1RKXA 2O50A 4D0LB 2DJ5A 2E7ZA 5TMBA 3RUIA 2QJRA 1EWQA 4Z0PA 3X1MA 4UJ3A 3A37A 4P4SB 3GLGE 2WBLC 1IM2A 2CVQA 4F85A 1FZQA 2NSDA 1E2JA 1QK4A 1ORVA 1Z7GA 2C59A 4PFSA 3CZPA 2EV9A 4L74A 4L5CA 4CKXA 4JJ6A 2PUEA 1GTMA 3EGWA 4ND8B 2A30A 3HDVA 1WB4A 4K9MA 3BIWA 3H0EA 4L6CA 4EVQA 3MMSA 3CGGA 1BWPA 1OREA 1P5FA 1RFLA 1U1EA 2CK3A 2QVCA 3EBPA 3OPMA 4GC5A 5TPZA 5FFFA 2CXSA 4J76A 1WS6A 2WB2A 4UXHA 1S89A 1KOJA 2G71A 2YDXA 3FUXA 5GIOE 1OI3A 4FGWA 3OZEA 3HYCA 3N7UA 2WU1A 2AOTA 4LQDA 4LCBA 3B51X 3WLHA 4MDFA 1TYBE 1TOAA 2NZUG 4HWSA 1U81A 3AJRA 3IOEA 4OOFA 2PX4A 1P4HA 2IYXA 4IXNA 2IL1A 2XGJA 3ICQB 1JS1X 1OWMA 1QGUB 4TYMA 1OB2A 3LI2A 4DC0A 2XCOA 3GJXC 4O0LA 1QLWA 3HY6A 2P79A 5KYXA 5DXJA 1L5GB 2X5OA 3VH3A 3RI3A 1UQRA 5I9NA 4GU5A 3NBUA 4UUAA 5FFNA 5E6RB 5EKDA 3CIOA 3PQ7A 3VPBA 1O1YA 3SXUA 1EGMB 1YBMA 2Y1OA 2ZOSA 3U13A 1E0AA 2X5XA 1XTZA 1GFWA 4D9GA 1Y9JA 2P2YA 1JQKA 1QX3A 1U2DC 1VCOA 2F8LA 3KPVA 4CQJA 2GXSA 7YASA 1AMNA 3I6ZA 4QYWA 2ZB8A 3IESA 2CSUA 4TKMA 3PYMA 2OBLA 3KBBA 1O5OA 3H1PA 4BMYA 3R9WA 4ZFNA 2Y93A 2DKOA 2BFAA 4WKCA 2O8FB 3PTAA 1ZONA 3TMAA 2Z6VA 1T5IA 2FV8A 4H4DA 1TIBA 2D1YA 2NO9A 2Q5FA 2VIIA 2BEWB 2AMJA 3OOHA 4K6GA 3SC6A 4BLQA 4DV0B 4IDDA 5SZJA 5BW5A 1E62A 4CG3A 3EHEA 1T3SA 4LDZA 4CLXA 1YAJA 4COKA 4ZWNA 4CQNA 3BXOA 1R5OA 2ZJ2A 1OJ7A 5BR7A 1Q0LA 4CKEA 3TF5A 5I9MA 3HCPA 2ATCA 2I6QA 2QN3A 3NVDA 4YP0A 4FB4A 1KJWA 2X9GA 3E9NA 2FUG1 2NU6B 2PSEA 3BGDA 1S1CA 3MSCA 3MTDA 3L4EA 3N8GA 4G86A 3TM4A 2IHBA 3WB9A 4IJQA 4NDNE 1ZC3A 3JRNA 3I6BA 2Y66A 1T1IA 3IKVA 1SXJA 1XEFA 3EC7A 1AQ6A 2ID8A 3AFIA 3LZ6A 4ZV9A 4RWZA 4C88A 3NBYC 4ED9A 3DO6A 1G3IA 2XKAA 1KMHB 1ZGCA 1XEXB 3QHAA 1N0HA 3RU3A 4BB0A 2GA9A 1LDMA 2PMDA 2CYAA 2WFMA 1NRWA 2B8JA 2ECKA 2WG2A 3K1YA 1KO7A 4M7OA 3EZXA 5LLSA 4A0QA 4A0HA 4RF5A 3J80A 2GA8A 3SQXA 1D5WA 1HQCA 2P30A 2AEMA 4KXYA 3TKAA 5LSAA 1CZKA 3FOEC 4Q15A 1OGYA 1C81A 3IP3A 2YJZA 3PC2A 2VTKA 4RYDA 3EG5A 4ME6A 4EB3A 2GN2A 2WICA 3P32A 1CFJA 4I3GA 4D25A 3T61A 3NOXA 3G8AA 5C3MA 2ZT8A 1WDLA 3NHFA 4WOKA 1Z4JA 1E0JA 2DUNA 2EP5A 5FTJA 4Z8YA 3A4LA 1HKHA 2BM8A 3RC9A 5HDQA 4EHBA 5G0VA 5JJLA 2AMFA 1FBTA 5CB8A 4BL5A 3OE4A 1RI3A 2Q5IA 3ZHBA 2HU5A 3GZ4A 3NIBA 4KB5A 4W7HA 5CBPB 3NOVA 4BMXA 4EKIA 4IM7A 1N2IA 4EYGA 5IF3A 3R8FA 1X77A 3TIGA 4KO3S 4I36A 3LUBA 3WY9A 3W9YA 4E3WA 2V6FA 5TLSA 2H1WA 5DGDA 3P2MA 2GN0A 3VZQA 2TMKA 5IVKA 1N3YA 1O4WA 3OFJA 3M3HA 3LWBA 1QWSA 1E8NA 3RRZA 1ZUIA 3GG9A 3R6DA 2X8AA 4EI8A 2R1VB 1U7HA 2AOXA 2NYAA 3OZDA 3R0JA 4GLJA 2FZWA 6REQB 4YJ2B 2B9VA 4YO7A 1AS3A 3SR3A 1H8HD 1NYQA 1SIOA 2IELA 5FOQA 1YKGA 3KEMA 1JJIA 1SKAA 4YS6A 3W1EA 1ZMXA 2RONA 5JAHA 1SD5A 2V5AA 3C45A 5EP1A 3FWPA 1OKKD 2Y1DA 4Q4JA 4XFJA 1E2KA 5AXBA 5T8KC 2DLCX 5FBZA 2OENG 1KMNA 1T9DA 2DSNA 3TW8A 4DVJA 1FLNA 1HRDA 2DE0X 4OB7A 5F1YA 4CF3A 3RIGA 3HHPA 4OSEA 4DDKA 4JB2A 3A1DA 5EFZA 5F52A 5J1SB 2VAXA 4ZCSA 3FWZA 3GX1A 5ECYA 3UJBA 1SBYA 2C3YA 3T0GA 5E95A 2ZUBA 2O52A 3HBMA 2JK1A 3T9BA 4O2LA 1EHIA 2FETA 3LECA 3PNSA 3IIIA 3C41J 1DAKA 2C98A 5DT2A 2FMUA 2JVJA 7AT1A 3L9WA 3BGOS 4YRAA 4HDRA 4HATA 4EMBA 4UM9B 1MH1A 2LPMA 2H1HA 2VPWA 2ZDQA 3FDJA 4TS3A 3GFFA 1LX6A 3AJAA 5K1ZA 3RKSA 4ARCA 1MJGA 1K92A 2NPOA 3OY7A 3C6QA 1GQ2A 4IEFB 1CNMA 5JS2A 3VJMA 4GNRA 4P32A 2XKJE 1E3EA 1KDYA 3I12A 4CKYA 1F7UA 1LLQA 5JXIA 2VDLB 1S8OA 2BCGY 1FL9A 3A7EA 5E9AA 1L3CA 4MROA 2B3TA 3VH1A 2LIVA 3HJTA 4P4NA 5GGYA 3U7IA 2PSDA 1DLJA 1H2YA 2PXAA 4R54A 2G4LA 2HA7A 3O73A 2PUBA 3NNSA 2PRIA 4UXIA 4LDPA 2BBOA 1DQNA 4R0NA 2X0RA 1GKUB 1RZRA 3Q9SA 4IGKA 1HE2A 4MV0A 5KYNA 3U19A 3C3WA 5AI8A 4IVRA 1NZFA 3EVZA 5JO9A 2Z6AA 1TD1A 3MJVA 4RESA 3SICE 1YOVA 3PQ6A 1T2EA 4KH0A 4EIWA 1W4ZA 1OWLA 2NV0A 2RB4A 3PWKA 5IJ9A 4LGMA 2EF0A 5JWRA 4B6JA 3E7FA 1CY0A 3FLBA 1F5NA 1PFUA 3LM8A 4KCGA 4LRSB 1YR2A 5BV1A 2DHQA 4PONA 4W63A 4UVIA 2O3SA 3DAHA 4Y2JA 2B21A 2GI4A 1W46A 5DTQA 5JALA 1AUVA 4RA6A 1HEYA 3ADPA 2X0FA 1KOGA 4DQLA 1Z75A 3ETJA 3AIIA 1VJ5A 1MX5A 1XRNA 4YQEA 2WSYB 2XHEA 2VAMA 3ESRA 3MCVA 3LUFA 1GYQA 2IVFA 1RI4A 3LCVB 4WVLA 2ZYGA 3NWPA 2PZAA 1UK8A 3CZ5A 3FYUB 2QTMA 3NJRA 1LLCA 1YE3A 1PR2A 3O91A 1V7CA 2OZEA 4ZAZA 1GYPA 1Q1GA 4H4CA 3QENA 5K4GA 1OASA 3VI3B 4BNNA 4NBUA 4NYJR 2Q50A 2X0NA 4D3YA 3RC3A 4AJ2A 1CT9A 3CNEA 4YJFB 4QUBA 3VGPA 5KZMB 3I8SA 3AIOA 4ZVPA 3GHHA 1XOIA 3UAZA 1IG0A 1I3OA 3AEQA 4PQFA 2LCQA 4RTMA 4OFZA 4BFYA 4JI0B 3JQFA 3D9QX 4QEDA 3D6UA 1P7YA 4J0EA 1YJAA 3AINA 3B38A 4LMBA 3Q0EA 5C1IA 2BKVA 5D3QA 1THGA 1XEWX 1YGYA 3GVIA 4NK5A 4L5JA 4XE5A 4MKZA 1YR1A 2JAOA 3KKOA 3SF8A 1IXZA 2A9FA 4EUEA 2VDOB 5ES3A 2J0QA 5EN4A 1Q7RA 1M72A 3GJ7A 2HJWA 1H3FA 1XZEA 2P4SA 4YGYA 1MIOB 2BUBA 2B4QA 2DR0A 4L27A 2EZTA 1YTLA 3DXFA 3NU1A 3R5SA 4DV4B 2DETA 2AD1A 2OGZA 4J3NA 4A6DA 3FYHA 2AXQA 3ENKA 3OPQA 2VRWA 4HDKA 4O4JF 4BVHA 4DB4A 1KXJA 2VJQA 4I9HA 3NBAA 3T4PA 3NI2A 1ZAYA 1FFAA 3U3KA 5CFOA 4Q37A 3LL4A 3R5KA 3QF4A 2QVLA 1FDIA 2R25B 3KSAC 1QGOA 4WK6A 1FE8A 3ENQA 1P9OA 3L1UA 4OATA 4R2KA 1A8QA 3TSCA 4M86A 1L4BA 3NYQA 4M1YA 3KKKA 4BNDB 3K6RA 1X15A 3OQPA 4MR7A 2WD9A 4YRSA 4OP3A 3O3OB 4MOWA 3CEAA 1GPAA 3OA2A 4RJ2A 3GF4A 3THXB 1UKVY 3MWGA 4OJQA 4C78A 2WHRA 3NQ41 3D1VA 4HRAA 3KTAA 2HWKA 2PBRA 4KZKA 4XEHA 5FUMA 3PGVA 1AS0A 3DV2A 3N3AC 3L4KA 1SVOA 1ZUHA 4JJ7A 4NDZA 4RSRA 5I7EA 2BEJA 3LKVA 4HUQA 3BF8A 3CX7A 3DLCA 1V8BA 4BKOA 3E3LA 2YN0A 3T7JA 3X3HA 3ENZA 4FEGA 4Z53A 3MLEA 4JQYA 5HTOA 1DMRA 4MV4A 1ABBA 5T5QA 3AESB 2NIPA 1WULS 3PC4A 1EK0A 3KKLA 1ZVVA 1GPDG 3D7RA 1TK3A 3HVHA 5ES4B 2FOIA 4DYVA 2R00A 3OQJA 3LYLA 1KYIA 3WGOA 2D4HA 2JLVA 1MXFA 3NC0C 2XXAA 1SMKA 2O48X 2VPQA 4GX2A 5KYWA 5E9JA 2VH2A 4REOA 2ZTUA 6CHYA 3ZY4A 4D7AA 2NN3C 3ETHA 2JI7A 5IC5A 1L8AA 3V4PB 3H5LA 1KI8A 2OKGA 4MA4A 4WNCA 4YUXA 2LXNA 3PUIA 5AVQA 5IPFA 2JVKA 2ZDGA 1FIUA 1KTVA 3VU0A 1QHHB 4O33A 4DMHA 1PK7A 3TOCA 5AICA 1G21A 1TIPA 2PMWB 1D2NA 4X6XA 5A5GA 2Q28A 1Z4NA 3H86A 3DLIA 4Q39A 1M33A 4BAGA 1HOTA 2ISCA 2QVBA 1RXYA 2BELA 3G2HA 3QU7A 4B34A 3HFJA 4MIYA 5DMHA 2OLJA 3KELA 1Q44A 2AW3A 3N0XA 4FDAA 4KQ2A 4YT2A 5JDCA 4LZLA 2NXEA 4QICA 3UAXA 2B4RO 3ZI7A 3F4BA 3GXBA 5TGDA 5C9ZA 4DJEC 2Z8ZA 3MMXA 2ZPUA 2ZRMA 1WZUA 3I2YX 5B3JA 3F96A 1KZ1A 2GTPA 3EVAA 2LDXA 1T10A 1G8AA 4RSGA 3QVGA 1B3BA 3A6DA 3LPNA 3VFDA 2FZLA 2BMDA 2IZOA 3WWYA 4B4WA 4PYQA 1KARA 4RD2A 4LK3A 1EQ2A 2EW2A 2WR8A 5DB4A 2VXOA 5HDBB 3ZHOA 1O9GA 3QY0A 4GI1A 1B1CA 4DDHA 2FP4B 3GFSA 1PP4A 3EXIB 4BJHB 2JJQA 2Q2VA 2JGFA 4HLUA 1KPHA 1SCUB 4TN5A 3VR6D 4RVOA 5G02A 2IYSA 1RJDA 3LXRA 1JWBB 2JLCA 1M2HA 2GQ0A 2WJZB 2V7BA 3GOHA 2NVBA 2QPOA 1VJDA 3GVCA 4IZ6A 4DRXB 5JRDS 4XDGA 1DOHA 3CKKA 3IP7A 2BEUB 3IEVA 3CLSD 4B81A 5LA6F 4IQ0A 4KXQA 4DBZA 2C2WA 5GONF 1ZNQO 4KFCA 4KE9A 2EXXA 3VVBA 4R83A 1Z06A 3DBHB 3PQ5A 4DSAA 2HHLA 4XOUA 1WXXA 4A10A 1Q1NA 3FNBA 1BDIA 3U40A 3E05A 2I03A 1EQAA 1Q20A 3FYCA 2B4TO 1FSFA 2E82A 2XQKA 1RC1A 4XWTA 3HB5X 5TGTA 2KJQA 5JASA 1ENYA 2P6PA 4A2WA 4DM4A 4DTIA 1GNVA 5EHGA 2Z0MA 1WCIA 3FZGA 4QO8A 2FW0A 4FWIB 2FSIA 1DG1G 1R4ZA 3BQMB 2J5XA 4WECA 3LYUA 4X00A 2D62A 2A5GA 5GJCA 1HZJA 2P4UA 4LEIA 1GUYA 4BNGA 2XIJA 1AE1A 2GK6A 1ATZA 7ADHA 1CUFA 3PNLA 2HA6A 4I4NA 4BAZA 4J4TA 5DGXA 4EKEA 1K08A 3HRHA 4ENQA 1X86B 4L7VA 3T7TA 4ABTA 1VMDA 1EFVB 3VA7A 1DC6A 5CEFA 3OEED 1F8FA 2HBYA 3HBLA 1T3LA 2GWHA 1ID1A 1Z83A 3D0KA 3KB6A 2IS4A 1IPHA 3N7TA 1G1AA 1AKTA 1DKPA 1SGWA 2Q9CA 3BBPA 4IRUB 3ZK8A 5AW6A 3BWXA 1NU6A 1S7CA 5CEJA 1D4FA 1U6JA 2EBWA 4M6WA 1WPRA 5E6UB 1N5JA 3JZMA 3WC4A 4X85A 3LX6A 4TTAA 4MUEA 4NZOA 3U26A 3W9SA 2I34A 4CW7A 3SC3A 2BGJA 3E35A 2WNIA 3C8MA 4Q3BA 2WEKA 1DSSG 5HK8A 2J6HA 5KDLA 1ZIYA 3OE7A 1XAGA 3ORFA 2AJTA 4JC5A 2RAVA 5K6AA 3PJGA 1RWOA 4FI3C 5J1TB 4QPPA 3RVJA 3ZXSA 4D80A 4EYQA 2C1EA 3HCDA 4MS3A 3QELA 5CK4A 1IZ0A 1H2HA 4YJGA 1CYEA 3MT9A 1NQVA 2BEKA 2A5YB 4WZBE 4E22A 4ARIA 2O2EA 2RI0A 1SURA 2HRQA 4US1R 3UKJA 4PC3A 3VAAA 1EFRD 3ZI4A 3EGIA 1H1LB 3E8XA 1XAHA 1QHXA 5IARA 3AWIA 2HRZA 3HDGA 1YXMA 4Z51A 3JAWA 1USUA 5A1TA 1DTSA 1NQTA 4F3CA 2Z58A 1N0VC 1L8OA 1V39A 1JSXA 2VYNA 4BFVA 1SVKA 4HH1A 4CMBA 4E4TA 3QP9A 1KNQA 3FYSA 3BIJA 3K8YA 4R8LA 5FNVB 3ESXA 4KXWA 6LDHA 2PUAA 3RJTA 4RH1A 2A7XA 4Q16A 4D6PA 1ZMBA 3GA5A 4ERNA 5LYYA 4Q5IA 3LBAA 3GGPA 1XNJA 4UBJA 4EZEA 3HVJA 3RABA 4CODB 5CVUA 3LOQA 4G26A 4LV5B 3ROTA 4YAFA 1HTTA 2JIQA 3QKUA 1NBIA 3ULKA 4QOJA 5EXXA 5HGXA 4KKVA 1OZAA 4CQLB 5DEIA 3TAXA 3RGGA 4NS4A 3KWJA 5BSEA 2OXRA 3QYPA 2ZM5A 2ECQA 4MJXA 3COVA 1H3NA 3DEAA 4TLCA 4P7JA 5KWJA 2XT6A 3IKLA 2C4HA 3WV5A 1OH8A 1ISRA 4FN4A 2VBCA 4O4JA 4E3ZA 3ZY6A 1GQQA 1ZESA 2AW5A 5DWQA 1QGAA 3LC2O 1DADA 5IMSA 3F1KA 3EQ9A 1R12A 4HJXA 1O8BA 3E18A 5EINA 1GGMA 4AZ3B 3H3JA 1XEWY 4BWVA 3CLHA 3G0BA 1FLVA 5FPSA 5F1KA 1KP9A 1TUEA 4K5QA 4D4LA 1I9CA 1TPZA 3HU3A 4KVGA 5JAUA 3U09A 3LZCA 4QBFA 4FFMA 1MC5A 1YB7A 5HQTA 3ABZA 1C3OB 2J9YB 2VP4A 3OIDA 3AR8A 1ZR2A 5TJ9A 2GERA 3DBRB 4Q3KA 3IDZA 4KGDA 2R6R1 2VH5R 4Y2GA 5KOHB 1GL9B 3SJ7A 5JNLA 1JDBC 2ZCUA 3N9IA 3VTKA 3OWHA 1CHNA 1FS6A 4FEYA 1A77A 5DASA 5EXEA 2C1XA 3H9EO 1CDEA 2FJPA 4MTCA 3SBOA 3KSBC 2VBFA 1TGYA 2WT9A 4HQFA 4BLSA 3IULA 4QNMA 4BN4A 3W06A 3DQPA 5K2MA 5IDQA 4AZWA 3RSSA 3WGNA 1JEQA 3PQ8A 1QC5B 2XR1A 3ZGOA 2C03A 2P5TB 4BP8A 4C6HA 3OQNA 1K0FA 2G1UA 1T1EA 3AKEA 3PB3A 3AHGA 2HK8A 1X0VA 1YCFA 1LFAA 3V2UA 4EJMA 1LJ8A 4EMUA 1EK5A 1LDYA 3TKLA 1JLKA 2XMCA 5IANA 1LI4A 1JDTA 1WTAA 5EXPA 3RFCA 2X13A 4L1KA 4TLDA 2MSKA 2ZJZA 4K81B 4YAJA 5JW6A 1QE5A 2J6BA 1VHJA 3CTPA 3KOUA 1P91A 2Y05A 2GNOA 2I3DA 1EPUA 1F12A 4B7XA 2GVNA 2REOA 3LF2A 3SFTA 1E7YA 1ZUNA 1PG5A 4EY5A 3LCRA 1MFPA 3ICCA 4FEEA 3QVLA 4O1HA 3STWA 1ZL2A 5SY6A 3ZVKA 4JA0A 1BHSA 5HILA 1SUPA 2IEYA 4KN6A 5EMMA 2JZNA 1ODIA 2BC9A 4MZDA 4AS2A 4U63A 5DRYA 1O0SA 3AYZB 4NV3A 1F2TB 4CKCB 5KIAA 1QZZA 1YB5A 4PYIA 3E8SA 4EY6A 2PGNA 4DNOA 5JDIA 4FDTA 1QAOA 1VYTA 2P5UA 5DFAA 1RC0A 3UW1A 2V1UA 5FWYA 3HB1A 3QEJA 1W9HA 3EZGA 4BMPB 4MVXA 4II3A 5EKSA 3JALB 3RVDA 1UWVA 1XWWA 1Z34A 5JH7B 4I1RA 4OHBA 1M8JA 4NCBA 5BW4A 3PFFA 3KZXA 2OO5C 2J9XB 1TLFA 3BH7A 1HEUA 4PQGA 3SC2B 3TQTA 2GT1A 2VT3A 5EHQA 4OGGA 3RUCA 2AR9A 3GJ6A 4BLRA 4IKPA 1C1HA 1MX9A 3DM9B 4ESOA 2JFFA 2YCLA 3E9ZA 1IL0A 3MF4A 1IK6A 1X14A 4E5YA 2R1UA 2G0AA 3HZRA 3KZKA 4Q1AA 4XSHA 2Q5EA 1VQ1A 2UYOA 4WA7A 3HY3A 1SQGA 4FONA 3IQHX 5CVDA 3WK5A 4YV7A 5PNTA 5C80A 1BXGB 1ULTA 1T9BA 2QLMA 2JLZA 3LP5A 1JHZA 2F64A 3LQYA 3OIWA 1PJ3A 2O8EB 3P0HA 4HH0A 4LHXA 1S3SA 3OKAA 4GOLD 3U62A 9GPBA 1PLJA 1C3VA 5C2JB 1TF5A 5LA6A 3SX0A 1EJ2A 1AZLA 1GKKA 2X7HA 4RZQA 5GONA 4FIDA 4D3FA 3JQQA 1Z73A 2LNDA 3L0YA 1JMYA 1WPGA 4LDJA 3MIZA 4Z3DA 4CIDA 4KRFA 2PL1A 3CINA 3V00A 3I5YA 3C3EA 3DOIA 2NP7A 2GXQA 1NLZA 5DN9A 4P22A 1N8NA 3MGKA 5LYJB 1G55A 1YQEA 1NY6A 2GFIA 2H9YA 4LSMA 4OI1A 4TWBA 3UO8B 4NF2A 5T41A 2DQYA 3GLHE 2GRAA 2UAGA 8AT1A 2VHTA 3NHYA 1E9DA 1QCCA 1U7OA 1NW9B 3PA8A 4HZIA 4K9SA 3PQEA 4GBMA 4XGIA 4C89A 1Q84A 4ZARA 1Q0UA 2ZCVA 4KNVA 5JZVA 3GFRA 4WAUA 4M55A 4TTRA 4JR1A 3HM2A 1EP2B 1B26A 2E85A 3KLNA 3OLVA 2E1RA 1QGZA 3O8RA 1A9RA 2BP7A 5BT8A 4EJ2A 1KNXA 1LBQA 1YGPA 3C6KA 2HCRA 3AM4A 3DL4A 4NBKA 5DP1A 3RAFC 4KPUB 2ZULA 3QLVC 4BQRA 1GJRA 3SHTA 2PJUA 4BX8A 3IIKA 2UVPB 2R1TA 1KYTA 1MVLA 1Y81A 2OBYA 2W98A 4UNQA 1MV5A 1NMXA 2R6HA 3WMWA 3P52A 3G8DA 2UUPA 1SQSA 3ORSA 5I3ZA 2VA9A 5JS6A 2ZZMA 1TJ5A 6AT1A 3B6EA 1RWWA 3QWHA 4OJKA 4LTMA 1FF9A 1F06A 1QKKA 4MQBA 4IFIA 1EESA 5B3AA 1PSZA 4Y2TA 3CZMA 2EX1A 3M6LA 3I62A 5DXFA 1QO9A 2ZQYA 3T4XA 3VZSA 4M87A 5EVJA 3LRPA 1SU6A 3GLSA 3CLUD 3R3XA 1R0YA 1C8KA 1Z4MA 4JC4A 3LY7A 2WVJA 4P0TA 4MCHA 4DWWA 5AK6A 1L8LA 2M6RA 1ZRNA 3MD9A 2XAUA 4FE7A 4OXKA 5IVPA 5K0TA 1GGNA 4RA9A 2WZBA 1M0WA 3SI7A 4OX9Y 2NUTA 3PRJA 4MP6A 4NEQA 3TW4A 3K32A 4KWEA 4YAOA 2HU8A 1BRTA 2GZ2A 4X8MA 4C6SA 3CX6A 1GAXA 1DDOA 1JIXA 1YAHA 3AB7A 1Y7PA 3K30A 5J58A 1IQRA 4D2IA 4WESA 2WLSA 2V6MA 1NUSA 2ZAOA 3UXMA 2UU9B 4J1TC 3NTXA 2C9DA 5CM8B 4L3WA 2IDMA 4G0OA 1RRMA 1T13A 3ILSA 2EX4A 2YRXA 4OKIA 2O8BA 4KO1S 3O84A 4HLDA 3BXPA 3LDFA 2BHRA 1NBHA 2CXQA 3PUKA 4R1MA 4PNEA 5AYVA 4WN3A 5GZ6A 1W5SA 5DI9A 1HE8B 2ON6A 3G0OA 4BJ5A 1UC8A 4PV7A 2I62A 2J46A 3R3SA 4OY3A 4BE9A 5H16A 4DDTA 4FK8A 4RKRA 1N77A 3LZDA 5DSXA 4ZA2A 1G8JA 5IAAA 3L84A 5IHPA 2YXNA 3D0OA 3F9CA 3KJIA 5EIBD 1PQWA 1J24A 3O03A 5SYMA 1RTTA 1W0JD 3BBLA 3KR0A 3SLKA 2O54A 1CR6A 2TS1A 4PTYA 5JC8A 1HNZB 5KPJA 2EFHB 4BXOA 3NVAA 4YLEA 1T6NA 4ZV4A 1KZ6A 3PNOA 3EH2A 1R0BA 2D3WA 2GZ3A 2AG8A 2H8GA 3LP6A 4BYGA 2SICE 4FNAA 4DPKA 4CL2A 1QH9A 2JRCA 1FSGA 3FVRA 2C78A 3C3MA 2GM3A 3NTUA 3VISA 2YUIA 4JUFA 2VPTA 4E33A 3ANLA 4EGAA 3K71B 3TZQA 4LRXA 4CL0A 4TZKA 3M34A 3TTSA 1QRTA 4M9QA 1FFDA 1HM5A 2PSSA 3I58A 1XCOA 4Q00A 1TFRA 3SJCA 2O1XA 4RQBA 4BO1A 3GC6A 4RCZA 2QLFA 1KEKA 2IV7A 4WCFC 4XARA 2IXAA 1BRMA 3AX6A 1YDEA 2