3OIVA

H-rasg12v with allosteric switch in the "off" state
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
160
Chain Sequence
b'MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
molecule tags Signaling protein
source organism Homo sapiens
publication title Allosteric Modulation of Ras-GTP Is Linked to Signal Transduction through RAF Kinase.
pubmed doi rcsb
total genus 59
structure length 160
sequence length 166
ec nomenclature
pdb deposition date 2010-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3oivA00
3BERA 4IKEA 4WAUA 3UMRA 5J5CA 5DNYB 3FMOB 2GXSA 2REOA 3E5HA 5FUYA 1F3OA 5G53C 5K8TA 2A3RA 1KDPA 1XD8A 2GZDA 1C1YA 1H8ED 1P4SA 4FXPA 1SVKA 4BECA 3PCRB 2JLYA 4Q21A 1E2KA 1JXMA 4FCVA 1E2MA 2CCJA 3T34A 2PCLA 1S9DA 1QHHB 2GF0A 2GKSA 2JCSA 3M1IA 4MQBA 4DWJA 3OEEA 1XU4A 2BIFA 3SJZA 1EFCA 3D3QA 4IDOA 3MCAA 1JR3D 2QM7A 1NLFA 2WMOB 2X2EA 3IBGA 3LX5A 4BZQA 3EWAA 3U4QB 1GKIA 1CF4A 5JECA 2FPLA 2CDNA 4JVLA 2VHTA 2H5EA 1D8TA 3AGQA 3V4RA 1A7JA 2FSGA 1XF9A 2IA5A 1Z08A 3RAPR 3I92A 4DCUA 3AVWA 3C5CA 5KSZA 4IFBA 1KIMA 3AVXA 2EWVA 4W5HA 1KKLA 3EIEA 2REXB 2NOAA 1IHUA 1M8PA 5BW8A 1GVNB 3K0FA 1E94E 3OE7D 4QM7A 1TUIA 4JLAA 3R7WA 4PR0A 5FBLB 4ZIRA 3GLGA 4GMXA 1S0UA 3Q72A 4HDCA 4F4CA 3Q85A 2F1IA 5CYPA 4Z1MD 1E1QD 4DCNA 3VKWA 1NN3A 3A4NA 4UXJA 2FZLA 3CNOA 2ECKA 3HPQA 3TE6A 3CH4B 3Q5DA 2BM0A 1IXRC 1IN4A 4IOKA 3B1ZA 1XD2A 3K70C 1XZQA 4GDFA 1GRQA 5H1YA 3ICQB 3U7FB 1SVMA 2BBSA 4DXAA 1KO7A 1A82A 4NCJA 3GJ6A 3OAAD 3K9HA 3BC1A 3QKUA 2I3BA 2ERYA 3B1VA 1DELA 2ZRAA 3GLGB 2CCKA 3HYTA 4XSHA 2N1BA 4EAQA 1EG7A 1Z3IX 3IO3A 8OHMA 2IYWA 5J4LA 2QZ4A 1AIPA 4LYFA 4NYMQ 1R2QA 2XZOA 1KI7A 1CJKC 3VKGA 2FJUA 5AUPB 2FFBA 1KAGA 3RSLA 4LJYA 2BVNA 2EFCB 4ESHA 5KSYA 3GCGA 4PZLA 1KDRA 5KOYA 3NTUA 5L3SB 1EX6A 2GCOB 2HJVA 2QPAA 1OKKA 5H68A 5IK2A 1W4CA 1SVOA 4PZZA 3BK7A 2ATXA 4ACBA 3THWB 3SS8A 1PLJA 1M6NA 4EDHA 2R6AA 2EFHB 3BB1A 1U2RA 2EVWX 3HU2A 4NE2A 3SZRA 5JMTA 4ASUA 2QMOA 1G19A 3U2QA 2ONJA 5FOSA 3UANA 2GF9A 3OIVA 3ZH9B 1CKEA 2Q3HA 4A4DA 2VIIA 1YRBA 2ZETA 3U3JA 3C5HA 3WNCA 3M0EA 2RGGA 4M4SA 1KK2A 4M1KA 1J90A 5FOXA 3THWA 5HCIA 2WJHA 1BKDR 3A4MA 1F48A 3KXIA 1TF2A 4EPWA 1DE0A 1AGPA 2AWNA 2ZE6A 2BBOA 2FSFA 2EWWA 4QL3A 1A1VA 3D7MA 1KI3A 4PANA 4IOJA 1W4BA 1X8JA 4D4KA 3VU9B 2HYIC 4P0TA 1N6KA 1I4DD 4BZPA 1YVDA 1TQ6A 1ZD9A 2VEDA 3RS2A 2BMEA 3RRNA 1E1RA 3ECCA 3G5UA 4MGIR 4DSNA 4Q48A 1KYIA 1I2MA 5L8VA 2A30A 3CKLA 4G5SA 1P72A 2RGNA 2XNSA 5EE9A 3UKDA 3X2SA 3C15C 2ZRGA 3LWNA 3REFA 4EPXA 1P9RA 2VYFA 2WWGA 1WBDA 2ZROA 5CYOA 3SQWA 2Z4SA 4FWTA 4L15A 4QNMA 4KFSA 4XVQA 3SFZA 1E2LA 3VU9A 1R5OA 4OL0A 4XWAA 5HKKA 4GOXA 3UMSA 4DLWA 1V43A 2IXEA 1R7RA 1Z29A 2FGJA 4R98A 1E2QA 4YDSA 5HTKA 2J7KA 3NBYC 1KNXA 1UF9A 1YZLA 2H1LA 3BGWA 3NDPA 3BIFA 2IS4A 2WKPA 4NYMR 1ZW6A 4LJ7A 5CB8A 3PUWA 1K5GA 1UJ2A 4GOKA 4A0GA 2FSIA 2IYRA 1N2CE 4CT5A 2I4IA 2MMGA 2Y8EA 3A6PC 3AM1A 2VP0A 4DIDA 2H18A 3QKTA 2XJ9A 4RD4A 1ESMA 1TNDA 5DO9A 5DI3B 5JJIA 3UG6A 2J0UA 2ZSDA 2HEIA 4UJ5A 1KO5A 4RCZA 5FOWA 1OFIA 3FHCB 1KI2A 3PQCA 5GJWC 4A92A 3THYB 2BCGY 4TQUS 3GLFA 4I1UA 2RMKA 2WJVA 5TVKA 4YMWA 2VTKA 2GK6A 1VIYA 2GCNA 5AJWA 4DUGA 4DEXA 1Q1QA 3HP1A 1G1MA 4OI0A 3ONWA 5FR1A 1Q20A 3DKVA 1E2FA 5C1BA 4LY6A 4TSFD 3RYTC 1E99A 4KJZA 4MITA 1KMHA 3OEHA 2IHBA 1XP8A 3FE2A 5EUQB 4L8GA 3PUXA 2P2LA 4IRUB 3UWKA 2OCBA 2EW1A 2O8BA 4HEJA 2V1UA 5EJEA 4JL5A 4AG6A 1X6VA 2IK8A 4UXHA 5AWFC 5JWRA 3OZXA 4MUAA 1G8HA 3OESA 2AK2A 3U6BA 3EA0A 1GL7A 2EYUA 1IN5A 4XD7D 4JSYA 1YE8A 4UNQA 2VHCA 3TJZA 1OFUX 4WZBE 2V3CC 2V6IA 2C96A 2FPMA 3MSXA 4LHZA 4MRRA 2YJTD 2A5YB 4RKFA 2G9NA 1LFDB 3P32A 4WIAA 1Q1ZA 1DPFA 2QAGB 2ZRLA 3B60A 1GKYA 4LBZA 3UIEA 2ZQ5A 1NBMD 2BM1A 2C9OA 4NKRA 2RGEA 4HAYA 4BZXA 4CEJA 3W6NA 3NWJA 4I99A 2ZJ8A 2QE7A 2CJWB 2AK3A 5DHFA 4RZUA 3W6PA 3WYAA 4HLUA 1GNPA 3H86A 4KFUA 4DSTA 2YVUA 3KUDA 1CRQA 4Q1BA 1QHSA 3TUJC 2ZU0C 3NBFA 2ZSBA 1IXSB 1KOFA 4D0LB 1GRNA 2ZRFA 1HUQA 1FNMA 3BS4A 4BLOA 1W4AA 2FN4A 1EX7A 4NCIA 2F1JA 2PT5A 4TTRA 5AR1A 4IDQA 3FKSA 4TL8A 5JRZA 4N3NA 3AVOA 1GP2A 3LVQE 4EPRA 2ZR9A 1OHHD 1QF9A 3FMIA 4BPBA 2V7QA 4P31A 4JT4A 2UKDA 3CRRA 3VR3A 2ZU6A 5DI3A 2AWOA 4JYBA 2ZYWX 2D4HA 1VHTA 2ORIA 1N5LA 4TYYA 4UNPA 2OESA 4Q4AB 4TL9A 1QDEA 3NH9A 4JVNA 3ZD7A 4RD2A 1E2NA 2PMDA 4TYWA 1IBRA 4AK9A 4LHWA 1COWA 4I1VA 3DZDA 2ZE7A 1CJTC 2GWHA 1PUIA 1NL3A 1R5BA 5BYJA 1GL9B 5BXQC 5A5GA 1HE1C 3WYFA 5AUOB 4Z8XA 1TEXA 5KSOA 4NYJR 1ZU4A 4BRUA 2B6HA 3KDSE 2CEAA 1EK0A 1GUAA 1KI9A 2FGKA 2ZYTX 4UQOA 2IUTA 1Z0AA 4Q66C 5FUXA 1EFUA 4C3ZA 4XVUA 4F91B 5H8WA 4IOLA 1BYIA 1HURA 4UXIA 3ZS9A 4A6PA 1XPRA 3RS5A 1G20E 4K8OA 1W49A 5A4JA 2CL0X 4BFZA 2QP9X 3QXJA 2QAJA 4DDWA 1E2JA 1N25A 3F5FA 2V8OA 2JJ1A 2WJGA 5FBQB 4RD6A 3B82A 1CEEA 1ANKA 1Z6YA 4R71A 1G5TA 1H65A 4OI2A 2GBLC 1KZGB 1MO3A 3G82C 1Z0JA 1EGAA 3ND8A 3QENA 1QRAA 2OO7A 3QKRA 2G83A 3GJXC 3TIFA 1UBFA 2J59A 2WTUA 4Z8YA 2CBZA 4Q1AA 5LPNA 4GSYA 4W7SA 4YC7A 3AVUA 5JWHA 2V55B 4AG5A 5HR5A 3CR7A 2QBYA 1SKYB 1T6NA 4FW9A 4QBGB 3EG5A 2O8CA 2WBLC 3CONA 2CVFA 4JIMA 5GVSA 1SVIA 2ZI6A 3MJRA 4XH9B 2FPKA 1UADA 3AF3A 2GCOA 3MRSA 221PA 2O8BB 3LW8A 5BN5A 3NKVA 4JLJA 4LHXA 1U0LA 4V03A 3QVUA 4RCYA 4BUJA 2DCUA 1QHYA 1LS6A 4OJKA 4EJSA 1ETUA 5F2EA 1BH2A 1YQTA 5H70A 1LV7A 5DGXA 2D62A 2KSQA 2D7CA 4Q19A 1KAOA 1UDWA 4ZI2A 4TT3A 3HPRA 3UPUA 2XTZA 4BFSA 1AK2A 1P2SA 1G64A 3B5JA 4KO8A 3TSWA 3AP2A 4EFNA 1N5IA 4QKQA 2GVZC 4TZ0A 1U9IA 4AKGA 3EIHA 1OSNA 4FN5A 4E5UA 2GTPA 2P6NA 4U02A 2HXYA 3EWSA 1P9WA 3OIUA 4BLPA 4AKIA 2OE2A 4Q1CA 4D0NA 2GJAA 3NH6A 3Q9LA 3QEJA 1QZXA 1J2JA 5TY0A 2J9RA 1FUKA 2VLIA 3QF4A 3VMFA 2OBLA 4ABYA 2R44A 3A1UA 4M9ZA 5E3HA 4DJTA 4E03A 3KKMA 1QVRA 1OF1A 1CJMA 3QG1A 4GRAA 2IS1A 1WCV1 4V0MA 5FTMA 4JT2A 2W2VA 4S2EA 3U61B 3KFXA 1SXJB 2VP5A 3MWJA 3M6AA 1K8RA 3KJGA 1KK1A 2HCJB 1M2OB 4GFDA 5J4HA 2XEXA 2DWQA 2IXGA 1R0ZA 4B32A 3AKCA 4HAVA 4J0QA 1KDTA 1SVWA 5E7IA 3B85A 2OAQ1 3KKQA 2VP4A 2MSCB 2RGAA 2A9KA 2F6RA 2AR7A 2LWIA 4TL7A 4XIGS 421PA 4B43A 3PUZA 2WWIA 4JL6A 1WF3A 1KDOA 5EE5B 3ZIAA 3CB4A 3RABA 4TTPA 3SOPA 1DS6A 1D9ZA 1N0VC 4MRSA 1N5JA 4UKDA 2P3SA 4E09A 2EQBA 4Q4JA 5KHOC 5DI9A 3EPLA 2BEKA 2X77A 5P21A 3QKSB 3CLVA 3T5DA 3WP1B 1W5TA 2NO6A 3RHFA 3TQFA 3RRZA 3ASYA 3IDQA 5JCZA 1OXSC 4DDUA 3OFND 2ZE8A 2R8RA 4CGZA 2ZS9A 3GP8A 2NZJA 1YR6A 3KJIA 4NH0A 2O8FB 1CP2A 1US8A 4PQYA 4PSVA 5E7MA 3RWMB 1T3LA 1W1WA 1EFHA 1H8HA 4JZKA 2KWIA 1IONA 1FP7A 1ZM4A 2GK7A 4NHOA 2O8CB 5DSZA 3IO5A 2V6JA 2FU5C 4QGFA 2OBMA 1VIAA 2GAOA 1P62B 5CIQA 2FFAA 4NZYA 2QY9A 4A8JA 3QI2A 4X8OA 2HUPA 1C9KA 2J87A 2YZ2A 4C0AC 2D74A 1RPZA 4DB4A 1W2GA 3NC1C 4AYXA 2W6ID 2HLDA 1PLKA 3BBPA 4QC2A 2CNWA 2R6FA 2D3WA 1MOZA 2WWFA 4OI1A 1G3UA 4XTCS 1TU4A 5HE9A 4M1OA 2VSFA 3CH5A 3CRVA 3KB2A 1YZUA 1ZYUA 1KNQA 1N6NA 1RRFA 2BCJQ 2GRJA 2YYZA 4JLBA 1ZM3A 4DT1B 1KJYA 3A1TA 3TGPA 2QEQA 1UEIA 2QT0A 2V1XA 4O2LA 1RW4A 4TLCA 4CF7A 3TH5A 3SJBA 4DHEA 4ASUD 3MUFA 4W9MC 4PC2A 5KNBA 3DOEA 2QN6A 1Z8FA 3U3OA 1AGRA 1GDDA 3CO5A 4RZXA 2WOJA 4R9UC 5DH9A 1YRAA 4NTZA 2GJKA 1TUEA 6Q21A 2OXRA 1W47A 4TZ6A 1E9RA 4QBIA 3IHWA 1Z22A 3FHTA 2QUZA 1W0JA 4RZ2A 2RB4A 1JJVA 1AS0A 1M34E 2WAYA 5C2JB 5D3MB 1VHLA 4Q01A 3W34A 1EFRD 1XTKA 3ZVNA 3CW2A 3LA6A 3BE4A 1CTQA 1OH5A 5JI2E 3SBDA 3SHFA 3GJ0A 3U7EB 4G01B 3X1XA 2J41A 3AP3A 1W0KD 1FL9A 3FGNA 4RFSB 5KO2A 4O3MA 1ZCAA 1E9CA 1Z07A 1VYUA 3IKJA 4MYUA 3THOA 2G0NA 2IHYA 3QKSA 1M7BA 2W83A 2JLXA 2ODWA 1XJCA 3EIQA 2CE7A 2RGXA 4FMDF 4LJ6A 4PC1A 1D2MA 1NVWQ 3EC2A 1HQYE 2OV2A 3SBEA 5JS8A 4OKSA 3B78A 1Q3TA 2BV3A 4NCNA 2VHJA 1KI6A 1D9XA 4KU4A 2YOHA 1JB1A 4TMVA 1X8LA 3HYRA 2YNMA 1P2UA 4A8JC 1GIAA 1OPXA 2YOFA 5CK5A 4E22A 5IRCD 1T3SA 4RVCA 3I5XA 4AI6A 1LB1B 3WMGA 4MA4A 1JAIA 3FWYA 3R9IA 4A15A 3K9GA 3N5CA 2FMXA 1Y3AA 4AWXA 3C14C 3SEAA 4ON9A 2A78A 2GJ8A 2J45A 4MKIA 2QMEA 2DFNA 3SJAA 3SNHA 4JJZA 4HYYA 1E98A 2FH5B 1XXHB 2IL1A 2JLQA 3K9NA 3ADCA 1YJ5A 2XGJA 2FX3A 5FPTA 3RS7A 4ARZB 2VSOA 2J1LA 2DFTA 3K9LA 5JJKA 2AXPA 1IN7A 1JBKA 2VHUA 2NIPA 4EFMA 3W3ZB 4PHFA 3TBKA 4OYHA 1RZ3A 4WZ6A 4D2IA 2ZSEA 1E4VA 4B75A 2FNAA 2J7PA 1CJUC 2B7BA 2VP6A 3K0CA 4PO1A 1TU3A 2JLWA 2QL6A 1OFHA 3BAFA 3KFVA 2NO7A 4LC0A 3FVQA 2XNDA 4KSCA 4GL2A 3EA5A 2ODEA 1YR9A 4P33A 4C0QC 5J4YA 3QPUA 2OHFA 3T1OA 2XB2A 2QAGC 1XX6A 1E2GA 1YZTA 4Q47A 3CNNA 1KHTA 1CR1A 3K0EA 4B3BA 4Q18A 4N1AA 1XTJA 2ZPTX 4LUCA 3CM0A 4A2WA 1G5PA 4PC6A 2CLCX 4DT1A 1Z5ZA 4XWKA 2AX4A 4D81A 3GLIB 4KCGA 1AKEA 3A8TA 1JECA 3E2IA 1XMVA 2YINC 4QBHA 1KMHB 4CRWB 2QPOA 1E9SA 1MO6A 2GXAA 3UMFA 3K09C 1R10A 4GP7A 1E2IA 2B8WA 4C0JA 1NN1A 4DRZA 3SQXA 4A8JB 1T9HA 2OILA 3LBNA 3QOFA 4URYR 4XD7A 5KDOA 3BOSA 2XSZD 4DKXA 2UZIR 821PA 3THXA 4A2PA 2ZI7A 4Y0VA 4HUTA 1GFIA 4TLEA 1KO4A 3TNFA 2IF2A 4I1SA 2FEOA 2GVDC 2JGNA 1SQ5A 1G18A 1P2TA 1EWRA 3AUYA 1NBMA 2A2ZA 2W0SA 2Q3MA 4B48A 2ZIAA 1LTQA 1UKEA 1VDZA 3BFVA 4FIDA 3T12A 3TVDA 2WPDD 3VKHA 4UNSA 1JQJC 721PA 3BJIC 1RRPA 1W5SA 2G1KA 2BBWA 3I8SA 3MLEA 1RVDA 3RVBA 4X8MA 2RCNA 3HWSA 3R9XA 2O5VA 1ZNWA 3PIRA 1C4OA 2LCFA 1NJGA 2WJYA 2WZQA 1JALA 5FPSA 3SHWA 1BMFA 1RFLA 1U8ZA 3VFDA 2PL3A 1G3QA 2DB3A 5BYKA 4I4LA 1ZMXA 1GKUB 4Q7LA 2H16A 2FWRA 5L3RA 1E9DA 3WNBA 1G7SA 1Z0KA 2DWOA 3HU1A 3AEZA 1E79D 4JLNA 4Q00A 1X8KA 3P4YA 4M2LA 1EWQA 2NG1A 3SN6A 1A5TA 4BEBA 2GCPA 1ZC4A 621PA 3AVTA 1KI1A 1VYVA 2ZJOA 4C2TA 1X3SA 5FPHA 5D3MA 2WV9A 2Q6TA 2W2TA 2JJ2A 2A5DA 3E1SA 1P73A 5HCNA 1NP6A 1XWIA 2ZRCA 2ZVPX 3EAQA 1S1CA 5KU1A 4LBWA 5CK4A 1UDXA 4ZCIA 1Q21A 4US1R 5DE3A 1VMAA 3IUYA 2FFQA 4YXWA 2ZRDA 4AC9A 1GNQA 1FX0A 1NKTA 1HQCA 3LXXA 4ZDWA 5JEDA 4LHVA 3EPJA 1NG9A 1GM5A 5TDHA 3W8NA 4Q4LA 4L5BA 3O47A 2MMCA 2G3YA 4BFTA 1U0HC 2QM8A 3LX8A 4KBFA 2AXNA 1OB2A 1D6JA 1OW3B 3N70A 1OXXK 3DMNA 3GFTA 4MKFA 3RS3A 3WMFA 5M04A 4D0GA 4US2R 1VCNA 5DN6A 3AB3A 3DDCA 2P5TB 1BYUA 4Q4JB 2OCPA 1X86B 1OV4A 1WXQA 4ZO4A 1MR3F 4NYIQ 3JZMA 5FBWB 1D5CA 3H0KA 1XD9A 3KQLA 5J4VA 2VH5R 3CWZA 1S9HA 4HUQB 4PC3A 4PHGA 5KSPA 2O52A 1DVRA 1Q57A 3NXSA 5A0FA 4IEIA 3EARA 4MRNA 4F4JA 4CYMA 3LLMA 3THXB 5KDDA 3NG1A 2O8DB 2IYLD 2PZEA 3AP1A 4OK5A 3TRFA 3VQTA 3GJ5A 1E2DA 1Z83A 5CB6A 3FPAA 3RNLA 3PG5A 1GG2A 1ZRHA 3B1WA 4FI3C 2IWHA 1OIVA 2PMKA 1Q22A 4PXAA 1ZD8A 4RD0A 4ZKDA 3PEUA 2R62A 4HLDA 4LJ4A 1MV5A 1YZNA 4MGYR 2WKRA 4CZ2A 4TMWA 4DZZA 4PSKA 2IXFA 1L2TA 1E2PA 4O25A 4LJ8A 5DHAA 3CX6A 5CDFE 4G1UC 5B2ZA 4Q1EA 4EUNA 1W36D 1X1RA 2WWHA 1M7GA 1U0JA 3ZS8A 1CR0A 1ZM7A 4G0NA 1Z2CA 1XEXB 1UEJA 3AKEA 3EZFA 2W6JD 2VA8A 4BRWA 2JA1A 2QI9C 2DPXA 1NF3A 4RKEA 2X8AA 2VP9A 5FL7A 4PQRA 521PA 3D31A 3B9PA 1TEVA 1JEDA 3VX3A 4PPNA 5KPDA 3EZ6A 4HZUB 2UVQA 2VHQA 2IBMA 3TKLA 1SVSA 3DM5A 3ADKA 1Z06A 1YHNA 4OQFA 5AJVB 1F5NA 3LQQA 3KZ1E 3A1WA 3FFBA 4DBLC 4OQNA 3VR1A 4YMTA 3KXKA 4RFVA 2RGDA 1W48A 4R2IA 3UG7A 4MUBA 3FYHA 5JHHB 2NO9A 3I32A 4EQ6B 1G41A 3QQ5A 1B23P 1JJ7A 1W44A 4KVGA 1KJWA 2ZS8A 3GEIA 4HSEA 3B8HA 3C41J 4B34A 4AYWA 3O8RA 2JJ8A 1G4UR 3R8CA 2EFDB 5SZHB 3WMEA 3ICEA 3W8RA 1CJVC 1DEKA 3CIOA 3QKRB 4MRVA 4YONB 4B3GA 1G8YA 1G5RA 4B3XA 1MO4A 2ZR7A 3LVRE 2OM2A 1W4RA 2GZAA 3KQNA 5B64A 2G1JA 1CRPA 1GILA 3PFIA 1DTSA 1AS2A 2J3EA 2MSEB 3QXXA 4WZAE 5TB5A 3TW8B 2BC9A 2PH1A 5HZHA 5JZVA 4YMUA 5KUTA 3W3AA 5FTJA 3EZ9A 1DAMA 1DO0A 4LGMA 1KKMA 1BIFA 5FI1B 4IFEA 3ZZUA 1BOFA 3LY5A 1HEIA 2J0SA 4HUQA 2F7SA 3GLGE 3VHLB 3AVVA 2QA5A 5JS7A 4MRPA 4TYPA 1G8PA 4JVMA 2WKQA 1E9AA 2CL6X 4BQSA 2WIBA 4Q7JB 3BRWD 4URVR 4RJLA 3P26A 2FSHA 3O8BA 3Q8XB 3ZQJA 3BB3A 2BJVA 2N42A 3L0PA 2JLZA 4ZI3A 4B73A 1KSFX 1S3GA 3OFNA 4L16A 3CX7A 2ZYVX 1IAQA 4BFWA 4BLRA 4D26A 1QVAA 2P6UA 1NMXA 4KV9A 2ZM5A 4QJ5A 3ZDQA 1II8A 2GDJA 3PJRA 3ASZA 2D2EA 3U6KA 4MH0R 2YKGA 3RRYA 1OIWA 2GHIA 3PXGA 2IYXA 1XZPA 3B1XA 1P60A 4I1OA 1WP9A 4W5WA 3U60B 3LD9A 4M9XA 4F4IA 1HT1E 3S1AA 4B6FA 4HB0A 1RRGA 4AIIA 2QENA 3I61A 4PZYA 5KNDA 4BLQA 2ZJZA 5DYGA 2XZLA 4KLZA 3VNUA 3QPVA 2WICA 2QP3A 4TL6A 4V02A 2QQEA 2YOGA 4UNRA 4WVFA 3GJ7A 4FD2A 2CNWD 1E2EA 2QTVB 4NONA 4EQ6A 5CJ2A 1R0WA 2WJJA 1FQKA 1KY3A 3AV0B 3DKPA 3I8XA 3LDAA 4NP6A 1N6HA 4OHXA 1B0UA 2ZUCA 5FPKA 1AQUA 3OE7A 2CJWA 2WSMA 2OSBA 2J0VA 2GETA 5E95A 1UAAA 2DFKB 4LPSA 2HT6A 2NPFA 4P4SA 3DVLA 4KLNA 4L4UA 4KFTA 4Q9IA 5TXGA 3AVQA 1HTWA 1VCIA 1ZNZA 3GLIE 5AUQA 2CLSA 4NCHA 3ZGXA 1HT2E 3LO5A 2W2XA 2VL7A 3FKQA 1TF5A 2RAPA 4POAA 2V54A 1M1YE 2QROA 1LW7A 3TSOA 3CF0A 4LJ9A 3I73A 3R9WA 3ZVRA 2P6RA 2X2FA 1W0JD 1ZAKA 1Z0DA 3QPWA 4Q9HA 1ZM2A 1OXVA 3QIAA 4G5RA 1PUJA 4C0LA 1EFRA 4YMSA 2OT3B 1OXUA 2XX3A 2A5FA 5K8UA 1XBTA 5CIWA 1GAJA 4XWOA 1RYFA 1SKYE 2BMDA 3F0TA 4K81B 2Q9AA 3T1QA 2BBTA 4EPTA 5FH9A 1XNJA 4HB4A 1FQJA 1VG1A 4JLDA 5HZKA 2QTFA 1BS1A 2XOKD 3KKOA 5LDDC 3LQRA 1E9BA 4PO8A 3KQKA 4AKHA 3JZAA 5DIFA 3TAHA 2ZI3A 1RRCA 4E07A 1Z2AA 2ZTSA 1II0A 5JRJA 4GT1A 1N5KA 2VSXA 1G9XA 3H4MA 5UKDA 1T8UA 2PCJA 4H1UA 4DLZA 4NMMA 1H8EA 2H17A 1G8FA 4CDGA 1XMIA 3KL4A 1OH6A 2F43B 4CVNA 2NQ2C 1HE8B 2NGRA 2AFIE 3DMDA 5SZIA 4C30A 2J46A 2F3RA 3P20A 4KAXA 5EP1A 1KI8A 4CEIB 2PT7A 2A5GA 1XPUA 1E0JA 3F8TA 1JR3A 4PPQA 1P75A 1XJQA 3LH5A 4V0NA 3UWOA 3BH7A 1OYWA 2REBA 2JLRA 2FF7A 1XJ0A 2FG5A 3CUEF 3MFYA 5FL3A 2LKCA 2R6DA 3PR1A 2OBNA 2PZGA 2ZYUX 4BFUA 2QPTA 3GLHE 1ZM9A 3RDPA 2GXUA 1XXHA 1E1RD 1ZIPA 3GJ8A 4DLSA 2QG6A 4CIDA 1M7HA 3J81k 2H7VA 4V0ME 4W5JA 1P6XA 1N0WA 3DEFA 2IYTA 5KDLA 5FTNA 2ZVQX 3Q3JB 1GTVA 2WSSA 1XRJA 1VKJA 2Z5FA 4B71A 2ATVA 2NMVA 3IPXA 1G17A 1PJRA 3QBTA 3T35A 2ZJ5A 4Z1MA 5TV2A 5GADl 4BLSA 5HKKD 3V4FA 4OHWA 1LVGA 4B2LA 4V0OA 1N6LA 2QGNA 1YKSA 2PLFA 4N0DA 1TX4B 2F9MA 5FTKA 2CLDX 1KJZA 1HV8A 4TMKA 1R0XA 2ODBA 4M53A 1D2NA 2XJ4A 3N2IA 4B47A 5B57C 4Q9KA 2QU8A 1U90A 1U94A 3OAAA 5G3YA 3TR0A 2QORA 4JLMA 4LV5B 2XSZA 4OHVA 4LK2A 3QF7A 5HPYB 4DCSA 3AF4A 3C16C 4JKYA 1P3JA 2IEYA 5J4KA 1AKYA 4B3FX 4A0HA 1XMJA 4GPTA 3SYNA 2EFGA 1DO2A 2FOLA 1XEFA 2Q9CA 5EZ5A 4HLCA 3KTAB 1N6OA 1AM4D 4EPVA 1E69A 4GP6A 4P32A 4JS0A 4ESVA 2C04A 2GJ9A 2DR3A 1OKKD 1QBKC 2OLKA 2RHMA 3GLHB 4H9GA 4TLAA 4DUGD 3SYKA 4F93B 3K70B 1CU1A 1G4AE 2VF7A 1GL6A 4II7A 1DG3A 1KI6B 5B58C 1MH1A 1E96A 4TSFA 1JPNA 1PLLA 3OEHD 2KBFA 1NNEA 4QJ4A 2KB0A 4DLYA 4DCTA 1CIPA 1NN0A 3HDTA 1Z63A 4DIEA 3U7GA 4KVAA 4TQ9A 4S35A 1TF7A 5EP4A 2I1QA 5EE3A 1W2HA 4LYAA 4B2PA 1HYQA 4PQFA 3EW9A 4RD3A 4QG7A 4LPKA 4F38A 1E0AA 4JLKA 2ONKA 4ZDJA 3PVSA 4AURA 1HY3A 1LF0A 5SZJA 3ZZ0A 4C7OA 2QQ0A 1GNRA 1NVUQ 2Z83A 1O87A 2OFXA 4QXAA 1G7RA 2ORVA 1YR7A 2GESA 1YU9A 4NL4H 2QRZA 4A9AA 4DDTA 5K8IA 4LHYA 4PTLA 1E9EA 1VG9B 2Q0HA 1ZD1A 4JLVA 3ZQ6A 2VRWA 1E9FA 1TQDA 4F92B 1IOZA 1V5WA 4BEJA 3BFKA 4D25A 2C2HA 5F3WB 3CR8A 4TTQA 2D7DA 1QG2A 3EPHA 1IM2A 4GNKA 2PX3A 2OG2A 2ZAOA 3D6TB 4MYHA 4P4TA 4TWZA 4XOIA 2IX3A 2HYDA 3B13B 1NSFA 3Q7PA 5DN6D 2P67A 4Q4AA 4XSGA 4D82A 3F3YA 4QHSA 2IYUA 1DAKA 4ZKEA 5AJYA 3K09A 3CPJB 1BO6A 3FTQA 4PHTA 1NLYA 4CEIA 1XFAA 2JLUA 2SHKA 2VP2A 3VR6A 2ZXUA 3VHXA 3A36A 3L43A 5FOVA 4L9SA 1G291 3AF1A 1VTKA 2WWWA 2OXCA 3VR5A 1DAHA 2XXAA 3C8UA 1NVVR 1KTVA 1OE0A 1OYYA 1OLOA 1XMSA 1UBEA 1Z0IA 4X8HA 3QBVA 1G3RA 2H57A 2HXSA 3JVUA 2B21A 2KE5A 3GFOA 1SULA 4QJ3A 1YZGA 1COWD 2AL7A 1EXMA 2AD5A 2Q9BA 5C18A 1NBME 2GBLA 3VAAA 3T1TA 3GJ3A 4FMBB 4GZLA 4C0KA 2ZRHA 1IJEA 3W90A 1P2VA 2OEPA 1LS1A 3QE0A 3MWLA 4DVGA 2DYKA 1UKZA 1F2UB 1WA5A 1NSTA 1X1SA 2PX0A 2JEOA 4KXFB 5G3ZA 1LY1A 2IF0A 1SXJD 3U4QA 3TMKA 2BWJA 2MSDB 3WHLA 5FL7D 4X8LA 3R8FA 4HAXA 4YDHB 3GPLA 1QHHA 4LYHA 2IUUA 2CVHA 3TQCA 4EKDA 3FMPB 5B30A 2QBYB 1FTSA 4HAUA 4US0R 4EIWA 4RSGA 1L7VC 3K0AB 5FI0B 2ZRPA 1IQPA 1R0YA 1FW6A 5DISB 4TQAA 1E0SA 3EASA 4N0EA 1T4GA 1XEWY 1ZBDA 3EC1A 2YWFA 3QUSA 4GI7A 5L3QA 1J8MF 2EYQA 1ZIOA 1XEWX 4DSUA 4LX0A 4F7WA 3L0OA 3K1JA 3O8DA 1ZCBA 2IYYA 1Q12A 2O0KA 4PSAA 4PO9A 3U7HB 3ZYCA 2X1VA 3PENA 3KQHA 2L0XA 1KSHA 1TPZA 2JASA 4NYIR 4PAQA 5CM8B 5JCPA 4U00A 1ZUNB 5F98A 4LI0A 4KSBA 4BGDA 4HAWA 2CK3D 3GLFE 2E1RA 2G6BA 3IQWA 5TARA 1G6OA 1NVVQ 4U7DA 3HR8A 5LD2B 4IVRA 1RE0A 4ZDKA 5LD2C 4FINA 4A6XA 1XDBA 5EXPA 1NY5A 4BFXA 3O8CA 2VO1A 1O3YA 2IYVA 5EXXA 4BASA 1OHHA 2Z0MA 3P27A 4V0KA 4C0HA 2V7QD 4A0RA 3DHWC 2VQSA 1IJFA 2R6GA 2ODNA 1U99A 5BN4A 4JLPA 3HR7A 1G7TA 3SFVA 2BHRA 4QFMA 4ACAA 1P9NA 2QT1A 5SZKB 1G6HA 2RGCA 3AUXA 2QMUA 3P4XA 1Z6GA 5KNCA 1NI3A 1E0KA 1VPLA 2C8VA 4QOSA 1I4LD 1T5IA 1YZQA 4O0MA 2OAP1 4M9QA 4IEEA 2XB4A 1G16A 5FFMA 2OCAA 2K5UA 1SGWA 3IBYA 3WRYC 2IUSA 4O2RA 1FMJA 4RZ3A 3I5YA 1MT0A 3IIMA 3IIJA 4JKIA 2WWXA 3GQBA 4TYNA 1QHIA 1F2TB 4UJ3A 4B74A 4JBXA 1P61B 1UBCA 1XCMA 2BKUA 3KB1A 5EXSA 1LF5A 3HJNA 4MYCA 3K0FB 4ILEA 2D06A 2GZHA 4G5QA 1R8SA 3E70C 3ZLJA 2KI5A 2O8FA 3RS4A 4FCWA 3K0AA 3R20A 4KFRA 1AA9A 4PPFA 5ANRB 3A4LA 3DL0A 1VG0B 4FWIB 4FMDB 4M1TA 2RGBA 3EZ7A 4C4PA 3ZIAD 3WBJA 3QXCA 1U81A 4H1VA 2QRNA 4GOJA 1J70A 4LSGA 2JJ1D 4LRWA 1W7AA 3KUCA 2ZRBA 3FHOA 4JMPA 3SI7A 4NYJQ 3KJEA 3C4JA 2AFHE 3BWDD 4LYJA 4C9BA 3AVPA 4EJSC 4GBMA 3CX8A 4TYQA 2JAQA 3AF0A 121PA 1AZTA 4YMVA 1F2UA 3LRPA 3WYGA 3VNVA 3W5IA 3H2YA 5LBIA 1FUUA 2KBEA 3CRW1 4HB2A 3RS0A 2YHSA 3TUZC 1DARA 2WAXA 2IS2A 3RRMA 2F9LA 5FUWA 3PEYA 3W6OA 4D4MA 2C03A 2C95A 4LCBA 1WDTA 2N46A 4AYTA 1CXZA 1SKQA 3CWQA 3VR2A 1ZP6A 5K8LA 3NIBA 4OI4A 4R7ZA 1LNZA 5L3SA 4TLBA 1U8YA 4JL8A 4MGKR 3X1WA 3WY9A 2XTNA 4LZZA 4B35A 1UPTA 2J0UB 2F3TA 2ZSFA 2QSZA 4B44A 4RD1A 1WMSA 4CW7A 4K46A 1JR3E 3JVVA 1NN5A 4TT3D 1IY1A 3BH0A 3GLFB 4Q4HA 3SU8A 3QSYA 3TR5A 4LC1A 5GJCA 1JQLB 2NZ8A 2OLJA 3K70D 4JVSB 1ELOA 2PJZA 1MABA 2RGNC 2XOKA 4Q9JA 2PEZA 2P65A 4WXRA 5DYIA 4PX9A 1XCPA 4JBWA 2R6CA 1OXTA 1Y63A 1NY6A 2QTHA 1J7KA 3EPKA 3MGCA 1XTRA 3HU3A 4KYUA 1FX0B 3IHLA 4IDHA 5EE0A 5J40A 1RIFA 5AK0A 2UZ3A 4MGZR 1EESA 4Q5IA 2P5SA 3SDZA 3QEOA 4D4JA 4JLOA 1CS4C 1F2TA 1S4QA 2O0JA 4DLUA 1QHNA 3CPHA 4P4SB 1FOEB 2CHGA 3QXSA 3U3KA 2GNOA 4BFYA 1N6RA 1Q3HA 2HV8A 3S1AB 2CL7X 3WXMA 1UBGA 4IOMA 2JDID 2C77A 3LW7A 3L0SA 2DBYA 2W58A 3QVVA 4FMCB 1SXJC 1S8FA 2ZUBA 4URZR 3U44B 1P5ZB 3I3SR 5KTYA 4C0SA 3UXMA 2FDCA 4OJQA 4WXPA 5LB4A 3NHBA 4A36A 4Q4HB 4DEYA 2BEJA 2ZSAA 3R7WB 4P4UA 1W0KA 3RSOA 3IGFA 3T06B 4LJAA 4A1FA 5FUVA 4QM6A 2YWEA 4HI0E 1E32A 4ZDIA 3GLIA 1ZJ6A 1U98A 1DAGA 2ZRMA 3T61A 2WSSD 2JIZA 5EZ6B 1T8TA 2ZJBA 3SYLA 3CNLA 4CEHA 5AUNB 2YC2C 2QAGA 1JR6A 5JLJA 2CXXA 4R2HA 2Z43A 3BB4A 3AKDA 2HF8A 3NEJA 5FBVB 2ZJAA 4CEJB 5GJBA 3KJHA 1Q1BA 2FA9A 3I72A 2YWHA 1H8HD 1NJFA 3A1SA 1WBBA 5AJXA 1CR2A 1QHXA 3OEED 3IQXA 3TLXA 1SHZA 1TL7C 2GEVA 5BWMA 4CEHB 4DLVA 4AKEA 3DPUA 1T3HA 2BOVA 2R65A 3EX7C 1II8B 4IW3B 2W6IA 2HLDD 3BXZA 1KI4A 4Q7MB 1FTNA 2BMJA 4KODA 1D2EA 1UKVY 3GEEA 1WB9A 2J7PD 1CBUA 2H8KA 2YV5A 2WMNB 3T5GA 4Q7KA 1QG4A 2A5JA 2Z6VA 3LNCA 1NIPA 4KITB 2B92A 3GFPA 3L0IB 1PZNA 1WRBA 1VECA 1XXHE 4URWR 2F1HA 1E6CA 2NO1A 1AQYA 4BE7B 1JI0A 4DSOA 2BDTA 1XD2B 4QHTA 1E1QA 4EPYA 2WJIA 3NBZC 4TLDA 5EP2A 1GSIA 3FB4A 4UNNA 4URXR 3PUVA 3TK1A 5JSZA 2RKOA 1L4UA 1RJ9A 1NMZA 4M0LA 1OB5A 5D3QA 2A7QA 3DO6A 5GJVC 1US8B 3WP0A 5ELXA 5KYKA 1IXZA 2OFWA 1Q1EA 2B8TA 4XTRA 3B9QA 4LOAA 3SC3A 3U3RA 1TTTA 4HATA 2FFHA 5G41A 1Z47A 4M1YA 5EQTA 3B1YA 3U44A 1RC8A 3OF5A 2QSYA 1JPJA 2AD1A 2GAAA 5BN3A 4NBSA 5KPJA 4Y0AA 3MWKA 4PAOA 4Q1DA 4QNRA 3EZ2A 3B7GA 1VCOA 4IVPA 2ORWA 4MDFA 2ZS7A 1QHGA 3Q5EA 5FTLA 1W36B 4QRHA 4HB3A 3M4YA 4G3XA 3THYA 1DG1G 3GJ4A 4QHYA 5IK2D 2ANCA 4B6EA 1W46A 4LV6A 2ZI5A 3T1VA 2ERXA 3PITA 3TW4A 4OQLA 3ZZTA 1XTQA 2QMHA 2O8EB 1NVXQ 2ZITA 1VCMA 3RLFA 5F9FA 2R9VA 2D2FA 3K8YA 4PPGA 2ZJ2A 2NPIA 3H1TA 1BMFD 2ZANA 3N2EA 4LBVA 3OIWA 2GXQA 3WRXC 1MRSA 4FCTA 4OQMA 1R8QA 3ADBA 2AHOA 1PV4A 4B76A 4DLXA 3DZ8A 5JFGA 1N6PA 2XZPA 3MJHA 4Z54A 2FZ4A 3K0CC 4KHZA 4RFSA 2ZI9A 3PV0A 2V4ZA 3SJCA 4LDJA 4OK6A 1ODFA 1RJ9B 1L4YA 3V9PA 1L8QA 3AH8A 5IHPA 3CRMA 2HJGA 3UK6A 2H92A 4PAMA 5CM9C 1ZUIA 4IVQA 4MKGA 2C98A 1E4YA 1SZPA 2GJSA 1IY0A 4D4LA 2IYQA 1F60A 1Z0FA 2ZRNA 1GITA 4LJ5A 4KBGA 2IYSA 3K0SA 2IW3A 4YXWD 4ZCMA 1VG8A 1JEEA 2FEMA 3GD7A 1WQ1R 5JBQA 1J99A 5DLQC 4IJMA 1FFHA 2CHQA 1KO1A 2WIAA 1II9A 1YR8A 4HDQB 4DB2A 2IC5A 1N3BA 4WW0A 1G21E 1W36C 1ZUHA 4DLRA 1E3MA 2XNDD 1Z6XA 2DHRA 3X1YA 2CMKA 4B33A 5CDFA 4QBFA 5JEEA 2HDNB 4XJXA 2F1RA 2QGZA 1DAFA 3AQ4A 2V9PA 5GVRA 4HLUC 5BQ5A 4TN1A 2J5XA 1TMKA 4OK3A 1SXJA 2QNRA 2WWYA 4EFLA 4IXNA 1UKYA 1ZC3A 1IY2A 1Z6TA 1T0JB 2WM9B 1HA3A 1TAGA 1FZQA 2BMFA 2C78A 3AGPA 1DOAA 2GILA 5J47A 5EE1A 1Z28A 2X19A 1KK3A 1YZKA 2W0MA 3H84A 4ERNA 2F55A 1XB2A 2WHXA 2XAUA 2EU8A 5FOTA 1F6BA 4TMTA 3TSZA 3AF2A 1GOTA 2O0HA 3D8BA 3I1FA 5C4GB 1CR4A 5HE8A 5E7JA 3QY0A 1G8GA 3A37A 3IILA 4M1SA 2C5LA 4Q02A 3MAAC 3LFUA 3NEYA 3G0HA 4ZV4A 1KSJA 2WPDA 1K6MA 4HZUA 2ASEA 3U3MA 2B7CA 3OIYA 3PEVA 1KO8A 4ARZA 4DDVA 5L3QB 5FBRB 4P3YA 3CBQA 3C7KA 3EXAA 3BFXA 2P0EA 1FPMA 4IXMA 1ZVQA 2PEYA 2ZJYA 3KKNA 3FMFA 2J0QA 1MABB 1KGDA 1N0UA 2CK3A 5AJZA 1G7CA 5JSZB 1KZ7B 2DWPA 1IN6A 1DBSA 1NRJB 1I4TD 4PFSA 4M1MA 4AY2A 2G88A 3OHMA 2HT1A 2WVJA 2Q21A 4NCKA 3ADDA 2F43A 1P7CA 1TADA 1E79A 4A2QA 2IEZA 2WOOA 2ZRIA 1CLUA 4KI0A 4A82A 5C46F 4BWYA 2W00A 1RYHA 2ANBA 2CCGA 2LKDA 3QF4B 1OH8A 3VR4A 5L3VA 5F9HA 2BKEA 2C9YA 3TAUA 3IEUA 2PJRA 1VYTA 1NMYA 2JJ2D 5EXTA 5TMPA 4JSTA 1A2KC 4WBSA 1E2HA 3PEWA 3AKYA 2XTMA 2IS6A 4M1WA 1A2BA 3CF2A 4JYCA 3LBIA 1XPOA 1KMQA 5C4MA 3NDBB 5G40A 4PHHA 4Q03A 1OT3A 2AKYA 2PLRA 3NBXX 1ZU5A 2IYZA 2VF8A 2XITA 5JHGB 3CRQA 1G3MA 1DADA 4L9WA 2JLVA 1R5NA 4RY2A 4HZIA 2CHVA 4LWZA 4LV8B 1KK0A 3KKPA 4NU0A 2O8EA 2FE4A 3MD0A 1N6IA 2QE7D 4IHQA 5JJLA 3REGA 1MRNA 4JJKA 3B6EA 1WE2A 1T0HB 4TMXA 3ND9A 1RKBA 3CPEA 3LAWA 4OHZA 2EFEB 2DY1A 4A0FA 3X1ZA 2G0TA 5EUMA 3VTKA 1TQ2A 2NTYC 3LV8A 3NHAA 3CZQA 2YC4C 2VBCA 4MDEA 3W5JA 3W9YA 4OHYA 1T91A 1XTSA 1Z6AA 4D6PA 5IT5A 3P1JA 2CE2X 4U5XA 3KTAA 5IF9A 5FOUA 2DFLA 5FR2A 3U5ZB 3L8YA 3IEVA 2BJWA 3FKSD 4GMDA 1OJLA 3MWYW 1G3IA 2E9SA 4DLTA 3B2EA 4Q9LA 1J8YF 3TUIC 3X1DA 4QGAA 1TQ4A 4YLGA 3I62A 1ZNYA 3ZJYA 1S96A 1NLZA 1HH4A 2ZE5A 5CJPA 1AZSC 1FP6A 4M8NE 2C99A 3MMPA 4WA7A 1JXOA 3CZPA 1UM8A 1OFTA 3Q7QA 2OZEA 3NVAA 4CT4B 4JBYA 2AKAB 3BD9A 3SE0A 4AD8A 1UFQA 1Q0UA 4BLTA 3LLUA 4ZCLA 4QGHA 3GLHA 2PZFA 4D80A 2ZREA 2HCBA 4PC7A 1KY2A 3I4LA 2TMKA 3TVTA 1S1MA 5JI3E 2KJQA 3ZVMA 2G77B 3DM9B 2PBRA 1NKSA 4C7OB 1GZSA 3L82B 4ITRC 4OQXA 3IPYA 1XCGB 3T15A 1NG1A 3FFAA 1OH7A 2W6JA 3GEHA 4KYIB 1PVOA 3SR0A 2FV8A 3RC8A 2Q3FA 3A1VA 4OBEA 3IIKA 5FPYA 3DOFA 1ZINA 3KXLA 1DAEA 4ZPXA 4HAZA 4XVRA 3CF6R 1GWNA 1T5LA 1R6BX 2RHDA 4GZMA 1FMLA 1KSGA 4QGGA 4G5GA 4NDZA 3A58B 1R4AA 2JLSA 3PUYA 4Q1FA 3RC3A 2OCYC 4M9SA 4MKHA 3KQUA 5LB2A 3FDIA 3LXRA 1K5DA 3QG5A 1NIJA 2OUKA 3NC0C 5IDVA 2NO0A 3RANA 2QP4A 1XEXA 1AN0A 1SVLA 3UATA 2O8DA 4IDNA 4Z51A 4DC9A 5EP3A 4B3DA 1MO5A 5CLQA 2XXAB 3KX2A 5E4FA 5JWOA 2Z4RA 2ZAMA 4B2IA 3WHKA 1OIXA 4LBYA 4ZIRB 3K53A 2ZRJA 3LBHA 1EFTA 4DCVA 4MYTA 3MG9A 3WBKA 4URUR 4EJSB 2GEDA 1S2MA 4M21A 1XTIA 1AJEA 2ZR0A 4I81A 3ZVLA 4HDOB 1FNNA 2ZI4A 3ZD6A 4V0LA 2JDIA 2RH5A 3FOZA 3BH6A 1JAHA 4NPHA 3RWOA 5CITA 2C9CA 1GRRA 2IT1A 4G5OA 1S3SA 3QJYA 2AN9A 2GEUA 2HF9A 3VX4A 1SXJE 3AVYA 2YWGA 3BORA 1JNYA 2OFOA 1U8AA 1DAIA 4IDPA 2IWRA 2R2AA 1SHKA 4C0BA 3WNDA 4C2UA 1Q44A 1ONBA 1IN8A 1I2DA 5CLLA 2VPPA 3QNUA 4M22A 1ZNXA 2JATA 2I1VB 4WOPA 1U9IC 3QXHA 2E87A 1AS3A 1ESNA 2ZRKA 3ETLA 3L8ZA 1A4RA 1CULC 1M74A 2ZUDA 3V00A 1MKYA 2JIZD 2GA8A 3L2OB 4B3CA 4FMCF 4BFVA 4YQFA 4HLQB 2ZEJA 4TMZA 3GMTA
chains in the Genus database with same CATH superfamily
1Q2UA 3IRUA 6REQA 1U4NA 2Z98A 3L49A 5EVCA 5HJEA 1XD8A 3AHDA 1CK4A 1LQTA 2O06A 2EC5A 3L1JA 1ZEJA 1G2IA 1QFJA 1OC4A 2BZGA 2O3UA 3UEOA 3QVXA 1JXMA 4FCVA 4PW0A 3AOEA 3T34A 1A7UA 4LFCB 3KR9A 1SWVA 2PV0A 1F8GA 1K08A 1QGUB 1RQLA 4JFRA 1GZ6A 2XUZA 4MQBA 4DWJA 1V6CA 1XU4A 4IIHA 3RRBA 3MJVA 1Q95A 1AQNA 4QBTA 4X92A 4FOLA 1WIWA 3CVWA 2QM7A 2WMOB 3IBGA 4P34A 4BZQA 1GKIA 1M2GA 3I0MA 2FPLA 1ZIYA 3WOVA 4B6OA 2HHLA 4MPJA 2H5EA 2Y1KA 2I54A 3HVRA 2Y77A 2V7XA 1QNFA 1ZO8A 3P2OA 2KW5A 3V97A 4N48A 3UUEA 1BROA 4K9DA 4U6SA 2V7TA 4XIIA 4TSKA 4P80A 5LYJB 1DLJA 2R8YA 4W8OA 4E31A 1V4VA 2ZYHA 2C84A 4H7PA 5KSZA 1D1SA 1Y9EA 4GBED 4FYXA 2GAIA 3HJFA 3ILVA 2FPPA 4U2KA 2ZWAA 5F7JA 2DP4E 3KOUA 4CUZA 3IHKA 4TS4A 6GPBA 4CODB 5ENZA 1V1RB 4ZIRA 1Q0RA 2WRZA 5HIIA 1W7AA 1M8JA 4NCAA 2CD7A 2GEJA 1GU7A 4WXYB 1YDFA 4JDUA 3ENKA 3UHOA 3DFUA 4PF1A 3SDBA 3HB0A 2PE5A 4EMUA 2XF8A 3D8TA 3A4NA 1KAMA 3VKWA 4M99A 1Q7TA 2NWQA 4C21A 2XYHA 3HPQA 5JY6A 3IQGX 2Z6AA 3K9QO 4RK6A 3ZZMA 3H6KA 1KR2A 1IXRC 1IN4A 1NPTO 2NQ8A 4ZAFA 3B1ZA 3HBJA 4I50B 4LS3A 1XD2A 3VPHA 1J21A 1EVLA 4KSYA 5D3ZA 5F5LA 4M8SA 4WK6A 4BS9A 4GDFA 2WMDA 1EVYA 3OLCX 2VR1A 2BBSA 1J23A 1A82A 4NCJA 1CQPA 1JU9A 2Q49A 3GJ6A 5FFFA 3BC1A 3RC2A 3EIUA 4RKRA 2ERYA 2OKCA 3HYTA 1T4CA 4JEHA 4EAQA 3N2KA 5JAZA 3CG4A 5J4LA 6CHYA 2ZM6B 4FFLA 1TJ4A 2V4UA 4GRDA 5B2FA 5IC4A 4X91A 3OZBA 4YCSA 5AI8A 1N0IA 5EJ9A 5HNKA 3VGPA 5AKLA 1C3OA 3RSLA 4ESHA 5KSYA 2QLFA 2XWPA 5K4HA 5L3SB 1EX6A 2M98A 4ZEMA 3WGQA 2QPAA 1M6VB 4HDKB 1SVOA 5CDSA 3UPDA 3O3MB 1YTLA 2ATXA 4IUDS 2GDZA 3R4CA 3ZDXB 4NX2A 1NZFA 3GO4A 2WA2A 3LBAA 4C6HA 2VDWB 3ACBA 4FFWA 1RI1A 2QR5A 1U2RA 5AHXA 1OA1A 5ALKA 4C08A 4AXXA 4Z1OA 1M2FA 1VA4A 3SZRA 4BL5A 4BB0A 4PGFA 5JG7A 1HSOA 4B87A 1U7HA 5KYNA 4PIVA 1I13A 4DA0A 4Z4GA 5CVCA 2LPMA 3OIVA 4H08A 1YRBA 4HWGA 5IBRA 2J3IA 4C7VA 3PPXA 3WB9A 2RGGA 3JQAD 3HZHA 5DGCA 1RP7A 1M2KA 1KK2A 4M1KA 2PLNA 5EMLA 2EL7A 2VHEA 2IV2X 2H07A 3T5PA 1A7AA 3THWA 4AJNA 1JTFA 1YVPA 2WJHA 1F48A 4PN7A 1TF2A 6PFKA 1DFGA 1YRHA 3IUQA 2ILVA 3K1TA 3K0BA 2O2XA 4LNUB 2ZE6A 2BBOA 3NT5A 1UFRA 2EWWA 2MSWA 3CGWA 4EG3A 2IIPA 3R8XA 3U4MA 3B1KA 4R54A 4ROSA 4IOJA 1W29A 4D41A 4EZIA 4ARIA 1QE5A 4FDLA 1C1XB 1I4DD 5E6RA 1PD1A 2HMUA 4OMFG 4XB2A 5AK5A 1NGSA 1F4PA 1BVYF 1TQ6A 3HS3A 2IELA 2VEDA 3HRIA 2H0RA 2BMEA 2FR0A 2IOFA 4JP5A 3ECCA 2Y1XA 3T7EA 1XYGA 4DSNA 2XKAA 4MINA 5L8VA 2Q5EA 4YASA 3RSCA 4D99A 1JHYA 2A30A 2CMDA 1K3UB 2Q6IA 5E9QA 5ELMA 4GI3A 4YALA 4Z4CA 2RGNA 5ITSA 1SXIA 1Z4MA 4OB8A 4EATA 4UW9A 3C15C 1DQPA 3LWNA 1X7YB 1P9RA 2WWGA 1ECPA 3O38A 3RVSA 1JJIA 5DF1A 4FWTA 2XHZA 4YAOA 3TOXA 2WJ3A 1Q6YA 4G0QA 1R5OA 3I04M 3HXOA 4OL0A 2CWWA 5FUQA 5HKKA 3IMEA 4X44A 3UMSA 2Z2JA 3SC6A 1V43A 3V8VA 1R7RA 1LTHR 1Z29A 4YDSA 2IUYA 1NX6A 3X2SA 4ZRNA 2P27A 4D3FA 1UF9A 4D5EA 2DHDA 3PQDA 4CNQA 2IS4A 1R00A 4NYMR 4O3MA 3FLAA 4PSDA 1ZW6A 3G49A 4LJ7A 1TYCA 4EHHA 1K5GA 4ZZIA 4HNGA 2FR8C 2XWBF 4XUEA 4HVLA 1N2CE 1TUBB 1W6UA 2QRKA 3L4EA 5DM2A 1W34A 5EFZA 4PEVA 5DXJA 2Y8EA 3PSAA 4WACA 3G6KA 4R01A 3VR5D 1W8DA 3LCMA 3VAYA 3DD5A 2JAUA 2V7PA 1JFVA 4RD4A 2P2DA 4GYYA 2NP7A 1BX3A 1ESMA 2X58A 1J1IA 1QC5A 5JJIA 1I6KA 2HEIA 1XU9A 1XQYA 5F51A 5GJWC 3D3WB 2RIPA 4WLFA 4ZI7B 1QGZA 3GLFA 2PG3A 3OUZA 3IQHX 2JCVA 2VTKA 4PLWA 1VIYA 3ENQA 5DEIA 4BQQA 2QS9A 2NVOA 3GT3A 4Y6SA 1E64A 5IC5A 4OJTA 3ONWA 2XB6A 5CH3A 3WGTA 5LQJA 2EZUA 1N7IA 4BYGA 3E8MA 1E2FA 4MYRA 5C1BA 1AC5A 3GLQA 4TSFD 5EXDA 3RYTC 3SS7X 1YXMA 4C4SA 2NTVA 2QVXX 2IZ5A 2JFOA 4OKNA 3TCNA 3N28A 3PL5A 1HDXA 2VDQB 2H4JA 3CVOA 5K2MA 4L8GA 3TE7A 2Z2XA 4GIBA 2P2LA 4IRUB 1YS9A 2OCBA 3HABA 3ZLUA 1R6DA 1E63A 2OP1A 2PNFA 2Q45A 1DDOA 3HSYA 2QN8A 1HM5A 3JQ7A 4HEJA 4LQDA 4MUNA 3MRXA 1X6VA 2SCUB 4RZHA 5FEMA 4AG6A 1NOJA 1JFLA 3OE1A 3OZXA 4I2VA 4K40A 1INLA 2XGMA 1GL7A 4XD7D 5C8YA 5BVGB 5HWSA 3H16A 4PFKA 5ICCA 3G0OA 4YPVA 5KWIA 4I9FA 5DNVA 2V6IA 3S99A 1XRNA 4L3OA 4KO3S 4LHZA 1JA0A 3WGJA 2A5YB 2R1UA 3I53A 4K6FA 3WL5A 4LBZA 1RXIA 4NKRA 2BM1A 3TPCA 2XCLA 4F45A 5L7YA 4PYIA 2H9AA 4MLCA 1NV8A 1J06A 2C0QA 3W6NA 5ILOA 4UCWA 1ADYA 3NWJA 4RYDA 2ZJ8A 4HVAA 2G0AA 1JX6A 1TLTA 2IZ6A 4EZEA 2RK3A 1KIAA 3H86A 3ODPA 3FIJA 3TEFA 5BWCA 4XFJA 4M9CA 3H7IA 5KREA 5A3RA 1Z25A 2V45A 3GNSA 1Z15A 3L0YA 3WMXA 1ZHHA 1CRQA 2LD4A 3U16A 1O94C 3Q7TA 2P3OA 4I1YA 5U4QA 3JYPA 3GAAA 3NWOA 5TQ2A 3OKAA 5AICA 2OWEA 4ITUA 4LZWA 1E7MA 3FF1A 4JJAA 1HUQA 1FNMA 1L7DA 3D2LA 4KLCA 2OHIA 4JXZA 3PQ5A 4BKQA 3WGMA 1W4AA 1YQWA 3RKUA 3ITEA 2QD1A 4NCIA 4L8WB 2AR9A 4IDQA 4FXOA 5JRZA 2V96A 1NMSA 1U2SA 3AVOA 4HDMA 2LVBA 4N3NA 5KYUA 3U56A 2BFWA 3MUNA 4EPRA 1DRVA 3WGGA 3IJRA 3P94A 2JRCA 1S02A 4BPBA 3OZGA 5AW1A 1DUSA 2FUEA 1KH2A 2A1UB 3VR3A 5DI3A 2AWOA 1V5EA 3U3ZA 3OOSA 4FGJA 2Y2VA 3U13A 1DQZA 5IZCA 2R85A 1ZN2A 3B9BA 1N5LA 3O7WA 1SZJG 1TUGA 4CM1A 1GFWA 3PS9A 3QOXA 4JVNA 4MZXA 3ZD7A 5JSFA 4RD2A 2PMDA 1GGKA 3E27A 4HR7A 1PFQA 3HJCA 1NJ5A 2ZSHA 3L7IA 1Y1PA 4AK9A 4JN6B 4LHWA 4QYXA 1NOIA 4CM9A 1DBQA 5D1HA 3DZDA 2BMWA 1UT8A 1T9ZA 2EG9A 2JIMA 1NL3A 2V3WA 4A10A 4DMLA 5F23A 4YJGB 4QT0A 3ROFA 3KQPA 3VHQA 3ZDEA 2CLHB 3D8NA 3WLEA 1D07A 1CDEA 4A03A 4UEJA 3PPVA 5F1KA 3JCZA 1SOAA 1OT5A 1C0EA 3RIGA 5EEHA 4BC0A 5LFAA 2M9MA 3IQZA 2B6HA 4LWQA 2PKEA 2CEAA 2ZR8A 2EKDA 2ZYTX 1KI9A 3I6ZA 1OZHA 3LF2A 3NXKA 4UQOA 2ZUTA 2IUTA 3VYSB 4Q66C 5DNUA 4DY4A 1PNTA 3R76A 1TLFA 1EFUA 1PJTA 4C3ZA 4F91B 3MIZA 3GY0A 1BYIA 5AH0A 4DF3A 5JPDA 2A94A 3CB2A 4X71A 1ZISA 2VAPA 3NAMA 4EGAA 1DXOA 3O4FA 4K8OA 2O5RA 5EUCA 5FWDA 4BFZA 5AI9A 1P7PA 1Y1QA 5TX7A 4GKKB 4M0PA 5KJ6A 4H15A 4OP2A 2ADOA 2GPAA 3BXXA 5ESRA 3SF8A 4E6EA 3DLPX 3I23A 1LBEA 4UE6A 4UTPA 3T54A 2V7GA 2FMTA 1LVUA 2WJGA 4RIGA 2A1UA 1FMFA 1SAYA 1CRWG 3I2JA 1ZGCA 2AMJA 2PR2A 3FDFA 3R24A 3BSFA 4OI2A 5CVUA 5AP9A 4AULA 2VCHA 4FNAA 4NC9A 4L0MA 1BGVA 2B99A 1DKOA 2G83A 3G9XA 5FLKA 2WTUA 3WL4A 4NE9A 2P4EA 1QIIA 2OD2A 3B36A 3AVUA 1K5PA 1SCDA 2WU1A 1ZJ5A 2INGX 3R2JA 4L2IA 4AG5A 5K4GA 2C0CA 3B6MA 2QBYA 1G9TA 1C2TA 1TGVA 1WPQA 3K1AB 4LXYA 1PR1A 2AZDA 4FOTA 2NU8A 2IEIA 1SVIA 3LU1A 3MJRA 2YV3A 2FPKA 3H9GA 4KWTA 3I4FA 2GCOA 2O6HA 221PA 2GPNA 3MRSA 3PFBA 1YT5A 1ZIDA 3BULA 3MJ4A 3Q15C 3PR2B 5KWJA 3GFQA 5U4XA 3MCTA 1U0LA 2QRHA 2CBGA 3AHHA 2PUAA 3RVOA 3O2QB 3OQ1A 2PL1A 4OJKA 4GPBA 4ZVUA 1BH2A 1CDOA 1E3SA 3EXFB 5H70A 1LV7A 2WD8A 3HY4A 3E1GA 3EB9A 4Q19A 3QU2A 3HCFA 4MR9A 4MVJD 1XK6A 3RYHA 3UK0A 1UDWA 4OGLA 3SXPA 3TMAA 4ZI2A 4TT3A 3UPUA 1IOLA 2QX6A 1ZH4A 5BV0A 3O93A 2XLBA 3CHYA 4MR7B 1P2SA 1G64A 3IKVA 2X8WA 2NU8B 4BNDB 5A9SB 1N5IA 3F5MA 4JLWA 1MB9A 2HADA 1DIRA 1RYBA 4Y1GA 3OIUA 3QUQA 4GF5A 1KQGA 1QU3A 1HQKA 2OE2A 3ZHCA 3KYDA 1YBHA 1FU4A 1RLMA 1TC1A 2GJAA 3P9ZA 4D0NA 3NH6A 4RA9A 1TZMA 4EJ0A 1CY1A 4NF2A 4JBHA 3JPYA 4J1QA 2B83A 3QF4A 3EVTA 1SMKA 2OBLA 2Y0DA 2L82A 3VR0A 4ABYA 4CG0A 2P77A 4DJTA 8LDHA 3C6XA 3EBOA 2VUUA 3Q3GE 5LL6P 5JFTA 1K6IA 1OF1A 3CGGA 5AOBA 3D6JA 3F96A 3KC2A 3L93A 2FKAA 1T3ZA 2VXYA 2HFKA 3ZJVA 3KTDA 5FTMA 1MQAA 4DSAA 3CW8X 1T43A 2IDMA 3MWJA 2QDKA 3PYLA 3M6AA 3U9LA 5K99A 4KRGA 2VSQA 3GJTA 1KK1A 3CZMA 4GFDA 2DH6A 1T1RA 2Q0XA 2EKPA 2XVAA 3BBLA 5G0SA 2DXIA 2BTQA 4IINA 4FE3A 4YRLA 4AT1A 2G71A 4BJ6A 3HWWA 3MTGA 1SVWA 4DV3B 2VP4A 2MSCB 1EWTA 4XDZA 4R7TA 4L5AA 3R6TA 3BL6A 4YCNA 2AW3A 1UL1X 2YZMA 4W6ZA 2F6RA 4DGSA 3F2IA 421PA 4B43A 3E9DA 1NXXA 4GZ6A 5KNCH 1WF3A 1KDOA 3ZIAA 3JQ8A 4U8HA 4GWLA 4L4YA 1GA1A 1ORDA 5EKTA 4YJHA 1DS6A 1D9ZA 1N0VC 4MRSA 4DQLA 1T1SA 2EQBA 4F1WA 4CQJA 4Q4JA 3DE2X 4M0CA 4NJMB 2BYTA 3A3YA 4ZANA 4MS1B 1ESDA 4C4ZA 1X74A 2NUPA 1T5BA 3I9V1 5DHRA 4GGMX 1GPYA 4IGIA 4P86A 3RYCB 4MUJA 1GNSA 3FFXA 3OFND 1T4DA 4QEDA 1XHFA 2PD3A 3DBIA 1XIVA 3ISTA 4WOJA 3GP8A 1YR6A 3L7JA 3IB3A 4PQYA 2N9UA 4PSVA 2X7XA 3I0ZA 4XDHA 1WDLA 1Z8DA 5E9AA 1YZVA 4IS2A 3HP4A 3N6VA 4ZU1X 2F8MA 2NXJA 4K6HA 4FFDA 4RY8A 5IYZB 4U0JA 3QI7A 1FP7A 1ML4A 4NHOA 1BA2A 3T3IA 3KD3A 4MV7A 4YT4A 4ZYZA 5JAHA 2ZCJA 2O8CB 3IO5A 3WWCA 2FU5C 4PE5B 5HM6A 2RGYA 4GH5A 2FRVA 1RI5A 1VIAA 3U4IA 1RKUA 1XHLA 2RBGA 3BHMA 5CIQA 5J23A 1HZJA 4NZYA 4MCAA 1Z6ZA 4O4HB 1Y9JA 3NZEA 1C9KA 4YFVA 3FNHA 3VSCA 3IVGA 5F35A 1J24A 1W2GA 1Y33E 2AOUB 3WNVA 3KL2A 2PKWA 1PJ3A 3RFUA 2HLDA 1PLKA 2WU8A 4RIFA 4EABA 2GJ4A 1NONA 3K2BA 4KLRA 2WAOA 3S2EA 1O2DA 3L0CA 1UMCA 2CNWA 2WWFA 4YAIA 1POWA 3D1JA 4FZ5A 4HCJA 4PLHA 4EMTA 2YIVX 1DJMA 4MAFA 4N49A 4DAOA 3KB2A 2O3SA 3NMUF 1I9CA 1YZUA 1ZYUA 2A86A 2YUIA 1WPXA 2B1GA 3HJUA 3NQ41 1EZ1A 1ZM3A 1USKA 4UTZA 2FLVA 3KUXA 1XVTA 5EPEA 3TGPA 1P9LA 2Z57A 3GUZA 2B8EA 1RW4A 3RUEA 2B3DA 5F1YA 4CF7A 4HRYA 4TGLA 1DTWB 5HFAA 1Q17A 4ETNA 3WKCA 5K6AA 5DJ5A 4D92A 1FP4A 3MRVA 4UVEA 1AGRA 1NF9A 3AXSA 3EF1A 1LD3A 3CXRA 4IFIA 3HZRA 4RHTA 3WLSA 4PG7A 4OQDA 5DH9A 5FUMA 4D4HA 3BD6A 1OXMA 2RHHA 4KGZA 3GGSA 1TJNA 3KT3A 4PM4A 1JU3A 2WHEA 3LHFA 3CUVA 4GXNA 3OCCA 4PS1A 1E9RA 4XW2A 1Z22A 4K0RA 2DQZA 2WNIA 2FQYA 4BEWA 1JE1A 1M34E 1QO0D 1M2OA 1SHUX 3KLOA 4MIYA 4TSRA 5C2JB 6ADHA 4J0JA 3QITA 5AESA 1OGIA 3BD7A 1CQIB 1JG6A 1XTKA 1D7OA 2O48X 3LA6A 2FSVA 1G8KA 3A0UA 3FSEA 3RTAA 1FNCA 3T3MB 3U7EB 4YBZA 5KINB 4D8UA 4EX7A 1KEWA 1MC1A 1RCFA 2J41A 4RFSB 7MDHA 4E51A 3TM4A 1M6WA 3AJEA 1FFDA 2HMSA 2W83A 4TTIA 3IAXA 4KB5A 4RAQA 3OZDA 4CTMA 1VE6A 1U1IA 1YFJA 2CE7A 4UHDA 4X7MA 2I2DA 5EXEA 3EEQA 3ORHA 3V8PA 1NVWQ 1EQUA 2TSYB 3CN7A 4J9UE 2DBZA 3SC4A 3TD9A 1IFXA 2OV2A 4PBSA 2I7XA 3PXXA 3RIXA 1LQUA 3G2MA 4XVCA 2VHJA 5DHQA 1ECFA 4PCVA 2FSSA 3DZKA 3BXEA 3GFVA 5FPQA 4D9KA 2WNHA 3MWEB 4RX1A 3RYIB 3J80A 5K6AC 4G86A 1YACA 3VR2A 1T3SA 3KKKA 1Q0TA 2XVZA 3GLRA 3FWYA 4MV0A 3R9IA 3H5VA 4A15A 5F7XA 3ANNA 1KETA 1ZD4A 3N5CA 4OU4A 1R6XA 1WSAA 2AB0A 3F3SA 1AE1A 3TTUA 2PANA 4LY3A 4LZPA 1BKSB 2F90A 4DPKA 1U8FO 3A1DA 3NM5A 3SJAA 1VE1A 3SNHA 2FH5B 2XGJA 2CLMB 5I5EA 3IBCA 2NTJA 4QLOA 3BE6A 2JAHA 1N34B 2PKXA 2DFTA 3K9LA 2VHUA 4WI1A 4WZAA 4YRCA 3TRJA 4DFDA 4EFMA 4PHFA 4L7QA 5L95A 2O8VA 3DE7X 3KPVA 3U31A 1K6XA 4OYHA 1RZ3A 4D2IA 4B09A 5H4GA 1HG0A 4X6LA 4B75A 2B7BA 1LC0A 1ZONA 3K0CA 2UYYA 2JLWA 3HA7A 4EGQA 3DBHA 3Q5GA 1EXVA 1I3OA 3KFVA 3FVQA 2XNDA 1EVQA 2ZWPA 2IEGA 5C81A 3EA5A 2UVDA 5AW5A 4C0QC 4Z2AA 2AOXA 1HDCA 3BMNB 3QPUA 3G7UA 4RGQA 3T1OA 4YR9A 1VBFA 2QAGC 3LUBA 1E2GA 4Q47A 4TWJA 4IG4A 1CR1A 2EJWA 5J58A 4DIFA 3C1AA 2H5IA 4G4GA 1U0OC 3D7RA 3V48A 2CLCX 1C8VB 3DUFB 1L4MA 2PPLA 3IAS1 2YVKA 3HCPA 3R3HA 2PS0A 4C87A 5CDYA 1ZH0A 1QMPA 1VSUA 1KMHB 1JQDA 4EYOA 5CT8A 4CM4B 3LCRA 3K0SA 2GXAA 1C41A 3UMFA 3K09C 1R10A 2KMLA 3A2NA 3EZNA 4GZ3A 3OY2A 2E4YA 4A8JB 3OUUA 1T9HA 1USIA 5L6MB 1AV7A 2OILA 4URYR 4F3NA 4CM5A 1BG6A 3BOSA 3LOQA 4BNNA 3QUCA 3BREA 4DG9A 3MTIA 3MT7A 2DLDA 5L40A 2HLHA 4OHOA 1D2RA 1VQ1A 3QBJA 2AZTA 4TLEA 3K96A 4RE5A 4LF9B 3RS8A 1EFAA 5CT6A 3GPBA 1XCBA 5SY9A 2OTCA 4ZP1A 2CJYA 2GVDC 2JGNA 2UVPA 1G18A 3EMKA 3O73A 4JEIA 3AUYA 1NQOA 4JY7A 3QV2A 2HMTA 4DC0A 1FJGB 4FIDA 4AO6A 4UNSA 1JQJC 4YCLA 1W5SA 3IAUA 2BBWA 4RMIA 2J5RA 3MLEA 5TJHA 5HOQA 3FMVA 4IIJB 5LLTA 1E2BA 4U7PB 3HGTA 1SZCA 3DC2A 4D8XA 2XRFA 5K0EA 2ORED 1ZNWA 2A84A 1OWPA 1Z6PA 3C1TA 3D1VA 5F5NA 1OASA 4PIPA 5I7VA 1NJGA 2DG2A 3IIEA 4D97A 1GA6A 3GDOA 1JALA 5LYJA 4Z53A 5BN4B 2Q29A 1L0BA 1RFLA 1L1QA 2EGGA 3VFDA 2PL3A 1G3QA 3CZ9A 3GJZA 4RK1A 2E5LB 2PWPA 4MUIA 4LXUA 3NVKI 1M2WA 1E9DA 3WNBA 3HU1A 4BKOA 1NVKA 4F6RB 1X8KA 3P4YA 4M2LA 2NG1A 2B3TA 1P4AA 2PUFA 1ZC4A 4LZAA 4EQZA 2DKFA 2Q5LA 1CRZA 4Q12A 3C4QA 3C6QA 1WZCA 4C2TA 4ALLA 1ZH6A 2YY5A 1E6KA 5D3MA 4P7JA 5AK6A 2W2TA 1P4HA 2JJ2A 2R2GA 2YVLA 4HLNA 1QCYA 4Y1RB 3E1SA 4YO8A 1P73A 3VYTB 5HCNA 5CA1B 2ZUEA 3EAQA 2GHRA 3L7OA 1YKFA 1W96A 2QZPA 5KU1A 5TC4A 3I52A 1IH8A 1WDKA 1N0HA 2CEKA 1ZHFA 2JF0A 4N03A 5CVJA 3VGJA 3KQSA 2JI7A 2GPWA 4RZQA 1JHAA 1FX0A 2A7XA 5JEDA 3EIFA 1MH9A 1J42A 1DIBA 2RHGB 3EPJA 2P7IA 3PGLA 4BXOB 4BJ5A 2J6IA 2QQFA 3UKOA 2BI8A 5KYTA 3MB8A 3RQSA 1BDJA 2OHJA 3ECAA 3ME5A 3UMVA 1J2EA 3LSTA 2CHUA 4HWSA 3O47A 1UJ4A 3UC9A 1QFZA 3UB3A 5AK4A 4BFTA 1GZHB 2CXPA 3G0DA 1ODCA 1JMYA 2AXNA 4UATA 3IPLA 5DHUA 4II3A 4XZ3A 5HIJA 5JD6A 2H3HA 1OXXK 1OB2A 2DLCX 3WMFA 4HPWA 2P5TB 3QLJA 1LNSA 4Y9DA 3EXEB 2HSGA 2OCPA 3JRXA 2C2GA 1IMJA 1E1MA 3ETEA 2ZSIA 4GKBA 1OV4A 5CLFA 1MENA 3G9UA 1HLDA 3JZMA 4HFNA 4HX5A 4ZK2A 2PZJA 1R27A 3NKLA 4YP0A 1KA9H 5CD1A 3TLKA 3ABZA 1P9OA 2XF2A 3CWZA 1IBCA 3DHVA 4GE0A 4IV0A 5DNDA 3T3PB 2AA3A 4KNVA 5KSPA 2OV4A 2WVAA 2MJLA 4P58A 3HKEA 3NXSA 2OYRA 4ZN6A 1HYHA 3ZWNA 4EI7A 1OI2A 3LLMA 4H6PA 2GZSA 1GQOA 3NG1A 1Z18A 1R3DA 3LA8A 5EIOA 4QDTA 4IZ6A 2QTLA 1QIMA 2ZBRA 3KV1A 4YA6A 3GJ5A 1RADA 3O7MA 4GGOA 1E89A 1PZFA 3FPAA 5E7QA 2IYPA 1RI3A 1OIVA 1YJQA 4KPUA 3U9SA 4RZSA 5EWMB 3WLIA 1O5IA 2R62A 2QUJA 4U7GA 1MV5A 3DMHA 2WKRA 4MPDA 3EGXB 3M6LA 3VRHA 3WK7A 4TMWA 1JSRA 3EC7A 1NRXA 1SU6A 4D96A 2X7HA 1AK1A 1B8UA 1UBNA 3EAGA 4PZ9A 4F11A 4U7WA 1XZCA 4DBZA 5LSAA 3QLVA 1S8OA 1TA0A 4G1UC 5HSGA 5KJCA 1X1RA 2FKNA 1M7GA 2IXDA 5JDCA 2BT4A 3C87A 4NFYA 4WDRA 3MOGA 4KL8S 5T3UA 4CM7A 4O0LA 3AKEA 1QHFA 2W6JD 4OQ4A 1KPGA 1P39A 4EZBA 2F59A 4RM2A 5DW0A 4BRWA 3B6IA 4K0KB 1SCIA 1MVOA 4FUTA 1KWKA 2M6KA 3WRWA 2VUHB 1RWOA 4FLEA 1NF3A 3P2KA 1EH5A 1KU0A 2VP9A 4HF7A 2JJYA 4YP1A 3LCVB 2YN0A 3D31A 4I5IA 4KN6A 5C52B 1TEVA 5AW6A 4ZZ0A 2OK8A 3EZ6A 3F5SA 3JQBC 1GEEA 2UVQA 2O1WA 1X80A 1FW8A 1QK3A 2NU9A 3L3BA 4I55A 2IBMA 4XI9A 3OI7A 3RGWS 3TKLA 4EHAA 3TWOA 4TS3A 4OX9Y 4DA7A 2O2SA 3CNHA 4FYYA 1BXZA 1TZCA 1WNFA 2Q2NA 3MJCA 1B42A 4J0IA 1SUWA 1Q7RA 2VDRB 5AJVB 4EB6B 4OQEA 3BXGA 2WIDA 3FFBA 4IMIB 3ZTWA 3R3JA 4MICA 1TCVA 4AZ0A 3HL0A 2W42A 3BXPA 1MB3A 4OJNA 4A3SA 2NO9A 2CLLB 4WV3A 5CTAA 4EQ6B 2A88A 3REQA 1I32A 4J1TC 4X5OA 1PFWA 2RKBA 3HKDB 1JJ7A 4HJXA 1W44A 3A06A 3DPIA 3TLJA 3V7WA 4HSEA 3UJ6A 4AZTA 4EGFA 1E1DA 1NPDA 4M98A 2JJ8A 1G4UR 3F4BA 4MKZA 2H0QA 2HSEA 4Y2XA 5SZHB 4AUEA 3IESA 5AKZA 1Z4QA 1JHVA 1NX9A 4RTPA 3NWPA 5JYCA 3ODGA 1ISSA 2IKSA 3ELYA 4II2A 4B3GA 2VDPB 3ESBA 1GFZA 3DEKA 4BB6A 2C7BA 2YTZA 4V0SA 4C06A 4EB6A 1W4RA 2GZAA 3KQNA 5A7GA 4NABA 2HPVA 2G1JA 4O2AB 4X41A 3OLVA 3LC2O 4K9PA 2YFHA 1GILA 1QQ7A 1TIPA 4EYSA 4MKRA 1PAUA 3NHFA 4NDNE 1PJBA 2BC9A 1LQ2A 3QLTA 4CMHA 1QP0A 2HJHA 2E82A 4UBMA 1HBJA 3W3AA 4W8HA 4DMKA 1DO0A 5ITZA 4ND5A 1XU7A 1VLLA 1FU8A 1JL3A 1R8JA 3K2QA 1BFUA 1BOFA 2EERA 1C8LA 3LY5A 4GD3Q 1R9MA 4OFWA 4Y9SA 4HUQA 2F7SA 3ZWAA 5C4IA 2VJOA 2R1VA 3GJRA 5A4IS 3OM0A 3T9EA 2CFOA 4R31A 4NBNA 2NZVG 3ZHQA 2JVJA 1BMTA 4QAQA 4D6XA 1E61A 1ETHA 1N4DA 4HNAA 1DLIA 3OLZA 2R7KA 3PNYA 4WK0B 1QP4A 4RJLA 3P45A 3E03A 1C4KA 1C1DA 2HL6A 3NP9A 3N76A 3HYLA 4K1LA 2GO7A 3BB3A 1XNRB 1G2PA 2BJVA 2N42A 4R1SA 3REQB 4B73A 1JN0A 2JAXA 4NZZA 4OKIA 1S3GA 3DOCA 4RMNA 1BW9A 3GZNB 3DJYA 3CX7A 3S70A 3W1VA 4BNIA 1IAQA 1YMUA 1QVAA 1VI2A 2P6UA 3O31A 4KV9A 4FJ0A 3I9MA 2PBLA 4YRZA 3SX2A 3ZDQA 1ZGZA 3DL2A 1XEAA 2GDJA 4GLLA 4PXSA 3UV7A 3ZNPA 1D1PA 3HUEA 3LLSA 1YB5A 3K9BA 5M29A 3U6KA 4MH0R 4D3XA 3GHHA 4I9UA 3RRYA 3ZK8A 4GECA 7GPBA 1OIWA 5HYVA 3D4BA 4NG5A 5DLDA 2J9ZB 3K6KA 1XZPA 3GEGA 3LYUA 5AI4A 4NECA 1YASA 1OOEA 1CVIA 2KLHA 2ZJ1A 1ABEA 3FSRA 4M9XA 1RKXA 2Q7OE 3QH4A 1ODTC 1IBKB 1AURA 3BXHA 1KP9A 3ETHA 1Z75A 2YW2A 3F7OA 4ZVSA 1NWCA 2VSYA 3CO0S 3IAM6 4B6FA 1U7XA 4HB0A 4J75A 3ZI4A 1LJUA 4PZYA 3VBEA 3IT0A 4S0XA 5DYGA 1Y8RA 4JJ7A 4D45A 3A4VA 3QPVA 1ACJA 5C5DA 3MTDA 4I5EA 2CXNA 4XWGA 2QQEA 3QOYA 3F73A 2C2OA 2FPIA 3HN7A 3GJ7A 5JASA 1E2EA 3BHJA 4G0VA 2QTVB 1N2SA 3O1JC 1Q0PA 5CJ2A 1R0WA 1K7SN 1KERA 2WJJA 3LDAA 1N75A 1TYEB 2JZCA 3DKPA 3RG2A 5EJ7A 5JW6A 3OY7A 4FB4A 1AQUA 1U11A 3JD1A 2CJWA 2WSMA 1LK0A 2IY7A 2Y1CA 4PU0A 1VJGA 2CLKB 4LPSA 1B3BA 3D7KA 5KVQA 1A8SA 4P4SA 4YFYA 4O4HF 5TXGA 1NQWA 5THXA 3AVQA 3AW9A 1U8UA 1TKCA 4DCPA 3FZNA 4BO5A 4LTDA 4MV9A 1NQXA 4Q7QA 3H0CA 2PIAA 3FKQA 2J4FA 4QPNA 5DULA 3RH0A 2OY0A 1TF5A 1Z4JA 3ADPA 2V54A 4POAA 2EKLA 4CTNA 5GY7A 1R4MA 4B8ZA 1LW7A 1FFBA 3D02A 3L9XA 1PO7A 4ZZ3A 4EI2A 3AY6A 5A2QA 1ISIA 2ZSUA 3MBKA 3N5KA 3ZVRA 4FB5A 2XCSB 3R3YA 2NX2A 2P6RA 2CXOA 4RPCA 1W0JD 3SR3A 5EHXA 1P8JA 1GNLA 3OP4A 3TQSA 4C5CA 5M2QA 3STHA 1BCRB 3KB6A 3Q3IA 4Q24A 4C0LA 1QYXA 4B31A 3TM5A 4GZ5A 2OT3B 2JBHA 4MV8A 1R4NB 2P3QA 1XBTA 2WI8A 5CIWA 3SK0A 4CKEB 2ON6A 2BE9A 2QN2A 2X8BA 2BMDA 3F0TA 3D4NA 2Q1XA 4EF4A 4R81A 3KEOA 1VZ3A 2BBTA 2ZIXA 2X0RA 3JQAB 1NW9B 5HZKA 1BS1A 5F33A 3OCYA 3SVZA 3Q6IA 1I4EB 4ENSA 4C78A 1MG0A 1X9IA 3PL1A 2ZB4A 10MHA 1WU7A 1VHWA 1ZG3A 1K7FB 1QX4A 3R4VA 3JZAA 4YVFA 5DIFA 1D2GA 3PFGA 5I7AA 3W4JA 1WR8A 1T2UA 2BM9A 3ID6C 3ZOZA 3BILA 3E8XA 4F2DA 2ZB8A 5EIWA 4DPLA 2X23A 4EI8A 1E0DA 4RSHA 5DBIA 4B7ZA 1RQ2A 5A0TA 5KYXB 1G9XA 3SZGA 4ZCRA 4O59O 4M7OA 5DCUA 4NMMA 3MM4A 3WFZA 1PT7A 4HGOA 1XROA 6LDHA 3DG9A 2P2YA 1G8FA 3PQ7A 2X41A 3RYFA 4CDGA 1XMIA 2NTEA 2P9EA 4DQDA 1OH6A 2NQ2C 1UWVA 1DHRA 2NAPA 3C8DA 2YDYA 4HMPA 1NBHA 5LWHA 3KKLA 5EP1A 2XCIA 4ZQFA 2PT7A 3VZBA 1UKAA 3JASB 1VIDA 2AEEA 3GUHA 1PDWA 1JR3A 4PPQA 3IL2A 3WC4A 1PL7A 3LH5A 1DXQA 3BVPA 3UWOA 3O4HA 1QM5A 1OYWA 1HDYA 2JLRA 2FF7A 2REBA 2JG3A 1XJ0A 5CCEA 4L9AA 2FG5A 1F6WA 1OX6A 1SRRA 1WULS 2WU4A 3LNTA 2ZYUX 2PZGA 3EOZA 4GEKA 5AM5A 4QATA 2XUFA 1JWBB 3RDPA 1VKNA 2Q41A 1WCWA 4DLSA 4ZQCB 1LLDA 5I4CA 1M7HA 4CKEA 4V0ME 1CQIA 3V6MA 3BJRA 3M83A 4KIFA 2NUAB 1RNLA 4X20A 5H02A 3T3DA 3AFMA 1PL0A 4AF8A 1J22A 1QLWA 2Z3VA 4MYDA 3SIWA 2Y3IA 3UXHA 4BZWA 5EQFA 1EWVA 3BF8A 3BRQA 1TIBA 3NATA 4DG8A 3CEAA 1G17A 1UZMA 1PJRA 2VJQA 4LHSA 2OCDA 5TT0A 4CMIB 2I4OA 3I5AA 1EK5A 5HKKD 2C07A 3KYJB 2GM5A 5E38A 3QE3A 1Q83A 4B2LA 4EJ6A 1FCJA 3EDQA 1O0CA 1N6LA 3HVHA 3K5IA 3DYIA 4N0DA 1TX4B 2CLDX 1CG6A 1R0XA 1VC2A 2ODBA 2CXRA 2XJ4A 4M53A 4V3CA 1BN6A 1RHMA 4HNVA 5JAOA 4DV5B 2G8LA 1U9JA 4UOQA 4EGCB 1DC7A 1ORTA 4XGKA 4IWYA 1U94A 1TEHA 3O9MA 2QORA 1Y6JA 2IIBA 1V1JA 2FPPB 2XSZA 3KWFA 3OZIA 4MVJM 5BSUA 3LBYA 3TW0A 4DCSA 1SQ0A 1BU8A 4Y3UA 5TF0A 2BR5A 5DGIA 5DYNA 2IEYA 3H2HA 1AKYA 2VQFB 4TV8F 2D2XA 3LKVA 1OROA 3QNMA 4NJEB 1QKKA 1JAZA 1O77A 3HRHA 3SIRA 2ZIXB 5IKOA 1LK5A 3ZV6A 1E69A 4GU5A 5JYBA 5DYWA 1X7WA 4XB1A 4M88A 3T3NA 2XGGA 4E4YA 2DR3A 3TZBA 1S2NA 1XRRA 4HYEA 3QUAA 1BS2A 1L6IA 3K70B 2J48A 3LM8A 4FHFA 4XCQA 2A0UA 2G04A 5F4BA 5H81A 2HRDA 1GL6A 1M2HA 1DG3A 1V95A 3KLMX