3OJMA

Crystal structure of fgf1 complexed with the ectodomain of fgfr2b harboring p253r apert mutation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
145
structure length
145
Chain Sequence
TALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title Plasticity in Interactions of Fibroblast Growth Factor 1 (FGF1) N Terminus with FGF Receptors Underlies Promiscuity of FGF1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/signaling protein
total genus 37
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2010-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3ojmA00
4GAIA 1TP0A 4ZKTB 4DENA 3FUOA 1DQGA 4A7YA 2Z49A 3I2AA 1ONKB 3Q7XA 1WBCA 2D1ZA 3HALA 3FJIA 1SZ6B 2LIEA 2NTDA 3O49A 4LO0C 1XYFA 3CA5A 4IZEA 3O4CA 4Q91A 4GOVA 1DZCA 2KKIA 2FFVA 4I1BA 2AFGA 2AXMA 2FFUA 3UDAA 1N4KA 3WINC 1TWEA 1RG8A 1JLXA 1HKNA 1FV3A 1Q04A 3BTAA 3ZXDA 2L5XA 4X3AA 1W3FA 3VT0A 1JT7A 4JQ0A 1JY0A 1M16A 2AAIB 4ISRA 1PUUB 1E0OA 3RSJA 1DIWA 1NZKA 2KH2A 4JRAA 1DJSB 2DS0A 2R9KB 5BXPA 4Q9PA 3AKGA 3WO4A 4JPZA 3CRGA 1T4QA 3O5WB 3B9UA 3KMVA 3Q7YA 4G6MA 2Q3NB 4I4SA 5D61A 1V6XA 1VCLA 3AH4A 3H6RB 4ZA3B 3P6JA 1FV2A 4ZOTA 3VUOA 5E24E 3H6QA 1FWVA 4Z9WB 4EFRA 3K1XA 4I4XA 3CQAA 3O4BA 4R6UB 5F8WA 4H9WA 3BA4A 1YYNA 4I4OA 4I37A 3FJAA 3T8SA 4QALA 4F34A 4GOYA 5FZZA 2QN4A 3QR5A 2NYYA 2DREA 4A7KA 3OJVA 3PHZA 2IHOA 1BLDA 2VXTI 2F2FC 3S8JA 2FGFA 4EFQA 3V79C 4HR6C 1L2HA 3CA4A 4QBVA 3FJCA 4P6AA 1ISVA 4LO2C 3E8LC 3N0KA 4Q9GA 1DLLA 3AZVA 3ZX7A 5I1BA 1FQ9A 2D7RA 3OBTA 3AH2A 5HPZA 3BA5A 3R4UA 2NVHA 1K5VA 3VT1A 2VXRA 2BEBA 5FNXA 5BP5C 1S0FA 2VSEA 3F1RA 3CAHA 3AKFA 1IRAX 3FJEA 2MIBA 3ILAA 3FUQA 3BAOA 4QD2B 3A23A 3AJ6A 4D0ZA 4HA2A 3BAHA 3CA0A 3VSFA 1TTUA 1YBIA 4OWJA 3IM5A 1I1EA 2WRYA 4OEEA 4X39A 3NBNA 3I2XA 4JP0A 2VSAA 1NUNA 2D22A 2NM1A 1YTOA 1YXWA 4I3NA 1ABRB 5F8YA 1DFQA 1AVXB 4D0TA 4F83A 4I1EA 3WO3A 4LO8B 4OEFA 2QYIB 1QXMA 2ERMA 3NBDA 1JT5A 4ZFYB 3LTQA 1CE7B 4TLPA 4I4QA 4PC4A 4ZBVB 3W9TA 5BXSA 3FFZA 4XFSA 5DZUA 3BB2A 4ZLBB 3EF2A 4QKSA 4XFTA 2ET2A 3AH1A 1BFFA 1S0DA 4DEPA 1Q03A 1K5UA 3IM7A 3HOMA 1WD4A 3BX1C 1F31A 4QC4A 1RY7A 1HWNB 5DVHA 2J3PA 2WBCA 4LO1C 1G9DA 3MPPG 2LIQA 1OQLB 1PUMB 3MALA 5F90A 8I1BA 4GAFA 1P63A 3FJ9A 4J2YA 1MC9A 1XHBA 1S0LA 2K8RA 3WMUA 2P23A 4QO3A 3AZWA 1SR4C 2NP0A 4I4YA 2D44A 4IHZA 2HW9A 3FJHA 1IT0A 1IRPA 1BFGA 4USOA 1EVTA 3WO2A 1G9CA 4X37A 2ZR1B 4J2SA 4IY9A 1WBAA 3AKHA 4ZFWB 5B2HA 2KI4A 3C9ZA 3BAQA 2GZBA 4ENDA 5BXTA 4KC3A 4L4HA 2XOAA 5G00A 4IYBA 4I4PA 3V0AA 3BA7A 4A7ZA 1JLYA 2E4MA 1J0SA 3CA6A 4P0LA 1ISWA 4II0A 4EEEB 1V6VA 5JLVA 4QD2C 5BQUA 31BIA 1FMMS 2HWMA 3Q7WA 1S0EA 3OBRA 1T9FA 3ZC9A 1BASA 3NJ5A 4YOLA 4ZGRB 1FWUA 2AQZA 1DZDA 2DRYA 5BOWA 3LLPA 3SNVA 41BIA 6I1BA 2HZ9A 1W3AA 3CA1A 2F8XC 2D20A 4I4UA 4IQPA 5D63A 1AFCA 4G6JA 1TOOA 3BAUA 4IZXA 4J2XA 5EC5A 3VEQA 3TC2A 4FVVA 2RG9B 2RSTA 2P39A 1Z0HA 3FJBA 4JAWA 1EPWA 3S8KA 1IJTA 1DFCA 4EFPA 3UJ4A 4J2KA 2K43A 1IILA 1I1BA 3CA3A 1PC8B 3UD9A 2VLCA 4I0YA 3N7JA 3VWCA 4OWKA 1G9AA 1HCDA 3RTJB 1JT4A 1QQLA 1D0HA 3HBWA 3O4DA 2KLLA 4LO7B 2GO2A 3UJ0A 5FNWA 3OJMA 3AJ5A 3WA1A 3POKA 4I6IA 3BADA 1MD6A 1FN0A 4QBCA 3RMXA 3H6RA 3HSMA 4XKIA 1DQOA 1EYLA 3IM6A 1WD3A 2D43A 4KEKA 7I1BA 2DRZA 2X2SA 4LO0A 3JUTA 5D62A 4LO3A 2MC2A 1RMLA 1ISZA 3HMYA 1KNMA 4GP3A 3PUBA 3WINA 3VT2A 4I4RA 1QQKA 4EB2B 2Z48A 3V0AB 3OGGA 2VU9A 5BVPI 1HWOB 3N7LA 1RZOB 3VSZA 4D8HA 5DSSB 3A22A 1UPSA 1S0GA 3BAVA 3F62B 1IHKA 4JKQA 1FMZA 3AKIA 4AN7B 1ISXA 3O44A 2KI6B 3BRFA 3V0BA 4P0JA 4OW4A 4USPA 3FGMA 3O3QA 4XFUA 3P53A 4OWLA 2IWTB 3P6IA 3ZC8A 4I96A 1BA7A 3JRRA 1Z4SA 2HWAA 1Z2VA 2RQ9A 5BXRA 1XG6A 1TWMA 2FDBM 4H04A 4OEGA 1HCEA 9ILBA 3ZXGA 4LO3C 3PG0A 4KEIA 3NBEA 1A8DA 3CU1B 5FZYA 3UD7A 1TFMB 2F2FA 2YUGA 3FJDA 3H6SE 1ITBA 4GP0A 2D7IA 3FJJA 3BRDA 1AVWB 1EV2A 5DUYA 4CJMA 1BARA 2K4AB 4KEJA 4IONA 3R4SA 4LO2A 1R8NA 1AVUA 1PWAA 3IAGC 1HIBA 1FGAA 1AXMA 1JQZA 3WMVA 1S0BA 4LO7C 5BP5A 5EHAA 1XZZA 5FZUA 4I4VA 3O4OA 5EG6C 1M2TB 1R8OA 4G1RA 4IY8A 1S0CA 2Q9XA 2X2TA 3RTIB 1ILR1 3BAGA 4ISQA 3A07A 4I2SA 1ISYA 4QKRA 1Q1UA 4OUJA 3OJ2A 2BFHA 4I7IA 2Y9FA 2M49A 1GGPB 1JT3A 2FO1A 1V6UA 4G9NA 4L4IA 2D23A 4JKXB 3RMYA 2VUAA 2E4MC 1V6WA 21BIA 3D7WB 4I8MA 3UD8A 5BQUC 3V0BB 1IOBA 1CVSA 4DCKC 3N7MA 2Y9WC 2BEAA 4EKXB 2I1BA 4J23B 3IIRA 2ESUA 3CRIA 1HWPB 2MLLB 1BFCA 4FGFA 4WBCA 4Z8SB 3O4AA 3QYDA 1JTCA 1TIEA 3I29B 5F8SA 3A21A 3FJKA 2NZ9A 1PZZA 1II4A 1W3GA 2Y9XE 3PMEA 4LO1A 4G9MA 1G82A 4AN6A 3BRGC 1G9BA 4KBBA 3N7KA 4P0KA 2Y9GA 2D24A 5JMCA 5GAQA 1AVAC 1SR4A 1BFBA 2UUSA 2ZQNA 3FJFA 1YF8B 3NBCA 4X38A 4HJJA 3CRHA 3OGFA 3FJ8A 4ZFUB 3HN1A 2ZQOA 1HWMB 1AF9A 1BLAA
chains in the Genus database with same CATH superfamily
4GAIA 1TP0A 4ZKTB 4DENA 3FUOA 1DQGA 4A7YA 2Z49A 3I2AA 1ONKB 3Q7XA 1WBCA 2D1ZA 3HALA 3FJIA 1SZ6B 2LIEA 2NTDA 3O49A 4LO0C 1XYFA 3CA5A 4IZEA 3O4CA 4Q91A 4GOVA 1DZCA 2KKIA 2FFVA 4I1BA 2AFGA 2AXMA 2FFUA 3UDAA 1N4KA 3WINC 1TWEA 1RG8A 1JLXA 1HKNA 1FV3A 1Q04A 3BTAA 3ZXDA 2L5XA 4X3AA 1W3FA 3VT0A 1JT7A 4JQ0A 1JY0A 1M16A 2AAIB 4ISRA 1PUUB 1E0OA 3RSJA 1DIWA 1NZKA 2KH2A 4JRAA 1DJSB 2DS0A 2R9KB 5BXPA 4Q9PA 3AKGA 3WO4A 4JPZA 3CRGA 1T4QA 3O5WB 3B9UA 3KMVA 3Q7YA 4G6MA 2Q3NB 4I4SA 5D61A 1V6XA 1VCLA 3AH4A 3H6RB 4ZA3B 3P6JA 1FV2A 4ZOTA 3VUOA 5E24E 3H6QA 1FWVA 4Z9WB 4EFRA 3K1XA 4I4XA 3CQAA 3O4BA 4R6UB 5F8WA 4H9WA 3BA4A 1YYNA 4I4OA 4I37A 3FJAA 3T8SA 4QALA 4F34A 4GOYA 5FZZA 2QN4A 3QR5A 2NYYA 2DREA 4A7KA 3OJVA 3PHZA 2IHOA 1BLDA 2VXTI 2F2FC 3S8JA 2FGFA 4EFQA 3V79C 4HR6C 1L2HA 3CA4A 4QBVA 3FJCA 4P6AA 1ISVA 4LO2C 3E8LC 3N0KA 4Q9GA 1DLLA 3AZVA 3ZX7A 5I1BA 1FQ9A 2D7RA 3OBTA 3AH2A 5HPZA 3BA5A 3R4UA 2NVHA 1K5VA 3VT1A 2VXRA 2BEBA 5FNXA 5BP5C 1S0FA 2VSEA 3F1RA 3CAHA 3AKFA 1IRAX 3FJEA 2MIBA 3ILAA 3FUQA 3BAOA 4QD2B 3A23A 3AJ6A 4D0ZA 4HA2A 3BAHA 3CA0A 3VSFA 1TTUA 1YBIA 4OWJA 3IM5A 1I1EA 2WRYA 4OEEA 4X39A 3NBNA 3I2XA 4JP0A 2VSAA 1NUNA 2D22A 2NM1A 1YTOA 1YXWA 4I3NA 1ABRB 5F8YA 1DFQA 1AVXB 4D0TA 4F83A 4I1EA 3WO3A 4LO8B 4OEFA 2QYIB 1QXMA 2ERMA 3NBDA 1JT5A 4ZFYB 3LTQA 1CE7B 4TLPA 4I4QA 4PC4A 4ZBVB 3W9TA 5BXSA 3FFZA 4XFSA 5DZUA 4MZHA 3BB2A 4ZLBB 3EF2A 4QKSA 4XFTA 2ET2A 3AH1A 1BFFA 1S0DA 4DEPA 1Q03A 1K5UA 3IM7A 3HOMA 1WD4A 3BX1C 1F31A 4QC4A 1RY7A 1HWNB 5DVHA 2J3PA 2WBCA 4LO1C 1G9DA 3MPPG 2LIQA 1OQLB 1PUMB 3MALA 5F90A 8I1BA 4GAFA 1P63A 3FJ9A 4J2YA 1MC9A 1XHBA 1S0LA 2K8RA 3WMUA 2P23A 4QO3A 3AZWA 1SR4C 2NP0A 4I4YA 2D44A 4IHZA 2HW9A 3FJHA 1IT0A 1IRPA 1BFGA 4USOA 1EVTA 3WO2A 1G9CA 4X37A 2ZR1B 4J2SA 4IY9A 1WBAA 3AKHA 4ZFWB 5B2HA 2KI4A 3C9ZA 3BAQA 2GZBA 4ENDA 5BXTA 4KC3A 4L4HA 2XOAA 5G00A 4IYBA 4I4PA 3V0AA 3BA7A 4A7ZA 1JLYA 2E4MA 1J0SA 3CA6A 4P0LA 1ISWA 4II0A 4EEEB 1V6VA 5JLVA 4QD2C 5BQUA 31BIA 1FMMS 2HWMA 3Q7WA 1S0EA 3OBRA 1T9FA 3ZC9A 1BASA 3NJ5A 4YOLA 4ZGRB 1FWUA 2AQZA 1DZDA 2DRYA 5BOWA 3LLPA 3SNVA 4UY4A 41BIA 6I1BA 2HZ9A 1W3AA 3CA1A 2F8XC 2D20A 4I4UA 4IQPA 5D63A 1AFCA 4G6JA 1TOOA 3BAUA 4IZXA 4J2XA 5EC5A 3VEQA 3TC2A 4FVVA 2RG9B 2RSTA 2P39A 1Z0HA 3FJBA 4JAWA 1EPWA 3S8KA 1IJTA 1DFCA 4EFPA 3UJ4A 4J2KA 2K43A 1IILA 1I1BA 3CA3A 1PC8B 3UD9A 2VLCA 4I0YA 3N7JA 3VWCA 4OWKA 1G9AA 1HCDA 3RTJB 1JT4A 1QQLA 1D0HA 3HBWA 3O4DA 2KLLA 4LO7B 2GO2A 3UJ0A 5FNWA 3OJMA 3AJ5A 3WA1A 3POKA 4I6IA 3BADA 1MD6A 1FN0A 4QBCA 3RMXA 3H6RA 3HSMA 4XKIA 1DQOA 1EYLA 3IM6A 1WD3A 2D43A 4KEKA 7I1BA 2DRZA 2X2SA 4LO0A 3JUTA 5D62A 4LO3A 2MC2A 1RMLA 1ISZA 3HMYA 1KNMA 4GP3A 3PUBA 3WINA 3VT2A 4I4RA 1QQKA 4EB2B 2Z48A 3V0AB 3OGGA 2VU9A 5BVPI 1HWOB 3N7LA 1RZOB 3VSZA 4D8HA 5DSSB 3A22A 1UPSA 1S0GA 3BAVA 3F62B 1IHKA 4JKQA 1FMZA 3AKIA 4AN7B 1ISXA 3O44A 2KI6B 3BRFA 2NS2A 3V0BA 4P0JA 4OW4A 4USPA 3FGMA 3O3QA 4XFUA 3P53A 4OWLA 2IWTB 3P6IA 3ZC8A 4I96A 1BA7A 3JRRA 1Z4SA 2HWAA 1Z2VA 2RQ9A 5BXRA 1XG6A 1TWMA 2FDBM 4H04A 4OEGA 1HCEA 9ILBA 3ZXGA 4LO3C 3PG0A 4KEIA 3NBEA 1A8DA 3CU1B 5FZYA 3UD7A 1TFMB 2F2FA 2YUGA 3FJDA 3H6SE 1ITBA 4GP0A 2D7IA 3FJJA 3BRDA 1AVWB 1EV2A 5DUYA 4CJMA 1BARA 2K4AB 4KEJA 4IONA 3R4SA 4LO2A 1R8NA 1AVUA 1PWAA 3IAGC 1HIBA 1FGAA 1AXMA 1JQZA 3WMVA 1S0BA 4MZGB 4LO7C 5BP5A 5EHAA 1XZZA 5FZUA 4I4VA 3O4OA 5EG6C 1M2TB 1R8OA 4G1RA 4IY8A 1S0CA 2Q9XA 2X2TA 3RTIB 1ILR1 3BAGA 4ISQA 3A07A 4I2SA 1ISYA 4QKRA 1Q1UA 4OUJA 3OJ2A 2BFHA 4I7IA 2Y9FA 2M49A 1GGPB 1JT3A 2FO1A 1V6UA 4G9NA 4L4IA 2D23A 4JKXB 3RMYA 2VUAA 2E4MC 1V6WA 21BIA 3D7WB 4I8MA 3UD8A 5BQUC 3V0BB 1IOBA 1CVSA 4DCKC 3N7MA 2Y9WC 2BEAA 4EKXB 2I1BA 4J23B 3IIRA 2ESUA 4H75A 3CRIA 1HWPB 2MLLB 1BFCA 4FGFA 4WBCA 4Z8SB 3O4AA 3QYDA 1JTCA 1TIEA 3I29B 5F8SA 3A21A 3FJKA 2NZ9A 1PZZA 1II4A 1W3GA 2Y9XE 3PMEA 4LO1A 4G9MA 4MZFB 1G82A 4AN6A 3BRGC 1G9BA 4KBBA 3N7KA 4P0KA 2Y9GA 2D24A 5JMCA 5GAQA 1AVAC 1SR4A 1BFBA 2UUSA 2ZQNA 3FJFA 1YF8B 3NBCA 4X38A 4HJJA 3CRHA 3OGFA 3FJ8A 4ZFUB 3HN1A 2ZQOA 1HWMB 1AF9A 1BLAA
chains in the Genus database with same CATH topology
4GAIA 1TP0A 4ZKTB 4DENA 3FUOA 1DQGA 4A7YA 2Z49A 3I2AA 1ONKB 3Q7XA 1WBCA 2D1ZA 3HALA 3FJIA 1SZ6B 2LIEA 2NTDA 3O49A 4LO0C 1XYFA 3CA5A 4IZEA 3O4CA 4Q91A 4GOVA 1DZCA 2KKIA 2FFVA 4I1BA 2AFGA 2AXMA 2FFUA 3UDAA 1N4KA 3WINC 1TWEA 1RG8A 1JLXA 1HKNA 1FV3A 1Q04A 3BTAA 3ZXDA 2L5XA 4X3AA 1W3FA 3VT0A 1JT7A 4JQ0A 1JY0A 1M16A 2AAIB 4ISRA 1PUUB 1E0OA 3RSJA 1DIWA 1NZKA 2KH2A 4JRAA 1DJSB 2DS0A 2R9KB 5BXPA 4Q9PA 3AKGA 3WO4A 4JPZA 3CRGA 1T4QA 3O5WB 3B9UA 3KMVA 3Q7YA 4G6MA 2Q3NB 4I4SA 5D61A 1V6XA 1VCLA 3AH4A 3H6RB 4ZA3B 3P6JA 1FV2A 4ZOTA 3VUOA 5E24E 3H6QA 1FWVA 4Z9WB 4EFRA 3K1XA 4I4XA 3CQAA 3O4BA 4R6UB 5F8WA 4H9WA 3BA4A 1YYNA 4I4OA 4I37A 3FJAA 3T8SA 4QALA 4F34A 4GOYA 5FZZA 2QN4A 3QR5A 2NYYA 2DREA 4A7KA 3OJVA 3PHZA 2IHOA 1BLDA 2VXTI 2F2FC 3S8JA 2FGFA 4EFQA 3V79C 4HR6C 1L2HA 3CA4A 4QBVA 3FJCA 4P6AA 1ISVA 4LO2C 3E8LC 3N0KA 4Q9GA 1DLLA 3AZVA 3ZX7A 5I1BA 1FQ9A 2D7RA 3OBTA 3AH2A 5HPZA 3BA5A 3R4UA 2NVHA 1K5VA 3VT1A 2VXRA 2BEBA 5FNXA 5BP5C 1S0FA 2VSEA 3F1RA 3CAHA 3AKFA 1IRAX 3FJEA 2MIBA 3ILAA 3FUQA 3BAOA 4QD2B 3A23A 3AJ6A 4D0ZA 4HA2A 3BAHA 3CA0A 3VSFA 1TTUA 1YBIA 4OWJA 3IM5A 1I1EA 2WRYA 4OEEA 4X39A 3NBNA 3I2XA 4JP0A 2VSAA 1NUNA 2D22A 2NM1A 1YTOA 1YXWA 4I3NA 1ABRB 5F8YA 1DFQA 1AVXB 4D0TA 4F83A 4I1EA 3WO3A 4LO8B 4OEFA 2QYIB 1QXMA 2ERMA 3NBDA 1JT5A 4ZFYB 3LTQA 1CE7B 4TLPA 4I4QA 4PC4A 4ZBVB 3W9TA 5BXSA 3FFZA 4XFSA 5DZUA 4MZHA 3BB2A 4ZLBB 3EF2A 4QKSA 4XFTA 2ET2A 3AH1A 1BFFA 1S0DA 4DEPA 1Q03A 1K5UA 3IM7A 3HOMA 1WD4A 3BX1C 1F31A 4QC4A 1RY7A 1HWNB 5DVHA 2J3PA 2WBCA 4LO1C 1G9DA 3MPPG 2LIQA 1OQLB 1PUMB 3MALA 5F90A 8I1BA 4GAFA 1P63A 3FJ9A 4J2YA 1MC9A 1XHBA 1S0LA 2K8RA 3WMUA 2P23A 4QO3A 3AZWA 1SR4C 2NP0A 4I4YA 2D44A 4IHZA 2HW9A 3FJHA 1IT0A 1IRPA 1BFGA 4USOA 1EVTA 3WO2A 1G9CA 4X37A 2ZR1B 4J2SA 4IY9A 1WBAA 3AKHA 4ZFWB 5B2HA 2KI4A 3C9ZA 3BAQA 2GZBA 4ENDA 5BXTA 4KC3A 4L4HA 2XOAA 5G00A 4IYBA 4I4PA 3V0AA 3BA7A 4A7ZA 1JLYA 2E4MA 1J0SA 3CA6A 4P0LA 1ISWA 4II0A 4EEEB 1V6VA 5JLVA 4QD2C 5BQUA 31BIA 1FMMS 2HWMA 3Q7WA 1S0EA 3OBRA 1T9FA 3ZC9A 1BASA 3NJ5A 4YOLA 4ZGRB 1FWUA 2AQZA 1DZDA 2DRYA 5BOWA 3LLPA 3SNVA 4UY4A 41BIA 6I1BA 2HZ9A 1W3AA 3CA1A 2F8XC 2D20A 4I4UA 4IQPA 5D63A 1AFCA 4G6JA 1TOOA 3BAUA 4IZXA 4J2XA 5EC5A 3VEQA 3TC2A 4FVVA 2RG9B 2RSTA 2P39A 1Z0HA 3FJBA 4JAWA 1EPWA 3S8KA 1IJTA 1DFCA 4EFPA 3UJ4A 4J2KA 2K43A 1IILA 1I1BA 3CA3A 1PC8B 3UD9A 2VLCA 4I0YA 3N7JA 3VWCA 4OWKA 1G9AA 1HCDA 3RTJB 1JT4A 1QQLA 1D0HA 3HBWA 3O4DA 2KLLA 4LO7B 2GO2A 3UJ0A 5FNWA 3OJMA 3AJ5A 3WA1A 3POKA 4I6IA 3BADA 1MD6A 1FN0A 4QBCA 3RMXA 3H6RA 3HSMA 4XKIA 1DQOA 1EYLA 3IM6A 1WD3A 2D43A 4KEKA 7I1BA 2DRZA 2X2SA 4LO0A 3JUTA 5D62A 4LO3A 2MC2A 1RMLA 1ISZA 3HMYA 1KNMA 4GP3A 3PUBA 3WINA 3VT2A 4I4RA 1QQKA 4EB2B 2Z48A 3V0AB 3OGGA 2VU9A 5BVPI 1HWOB 3N7LA 1RZOB 3VSZA 4D8HA 5DSSB 3A22A 1UPSA 1S0GA 3BAVA 3F62B 1IHKA 4JKQA 1FMZA 3AKIA 4AN7B 1ISXA 3O44A 2KI6B 3BRFA 2NS2A 3V0BA 4P0JA 4OW4A 4USPA 3FGMA 3O3QA 4XFUA 3P53A 4OWLA 2IWTB 3P6IA 3ZC8A 4I96A 1BA7A 3JRRA 1Z4SA 2HWAA 1Z2VA 2RQ9A 5BXRA 1XG6A 1TWMA 2FDBM 4H04A 4OEGA 1HCEA 9ILBA 3ZXGA 4LO3C 3PG0A 4KEIA 3NBEA 1A8DA 3CU1B 5FZYA 3UD7A 1TFMB 2F2FA 2YUGA 3FJDA 3H6SE 1ITBA 4GP0A 2D7IA 3FJJA 3BRDA 1AVWB 1EV2A 5DUYA 4CJMA 1BARA 2K4AB 4KEJA 4IONA 3R4SA 4LO2A 1R8NA 1AVUA 1PWAA 3IAGC 1HIBA 1FGAA 1AXMA 1JQZA 3WMVA 1S0BA 4MZGB 4LO7C 5BP5A 5EHAA 1XZZA 5FZUA 4I4VA 3O4OA 5EG6C 1M2TB 1R8OA 4G1RA 4IY8A 1S0CA 2Q9XA 2X2TA 3RTIB 1ILR1 3BAGA 4ISQA 3A07A 4I2SA 1ISYA 4QKRA 1Q1UA 4OUJA 3OJ2A 2BFHA 4I7IA 2Y9FA 2M49A 1GGPB 1JT3A 2FO1A 1V6UA 4G9NA 4L4IA 2D23A 4JKXB 3RMYA 2VUAA 2E4MC 1V6WA 21BIA 3D7WB 4I8MA 3UD8A 5BQUC 3V0BB 1IOBA 1CVSA 4DCKC 3N7MA 2Y9WC 2BEAA 4EKXB 2I1BA 4J23B 3IIRA 2ESUA 4H75A 3CRIA 1HWPB 2MLLB 1BFCA 4FGFA 4WBCA 4Z8SB 3O4AA 3QYDA 1JTCA 1TIEA 3I29B 5F8SA 3A21A 3FJKA 2NZ9A 1PZZA 1II4A 1W3GA 2Y9XE 3PMEA 4LO1A 4G9MA 4MZFB 1G82A 4AN6A 3BRGC 1G9BA 4KBBA 3N7KA 4P0KA 2Y9GA 2D24A 5JMCA 5GAQA 1AVAC 1SR4A 1BFBA 2UUSA 2ZQNA 3FJFA 1YF8B 3NBCA 4X38A 4HJJA 3CRHA 3OGFA 3FJ8A 4ZFUB 3HN1A 2ZQOA 1HWMB 1AF9A 1BLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GAI A;  1TP0 A;  4ZKT B;  4DEN A;  3FUO A;  1DQG A;  4A7Y A;  2Z49 A;  3I2A A;  1ONK B;  3Q7X A;  1WBC A;  2D1Z A;  3HAL A;  3FJI A;  1SZ6 B;  2LIE A;  2NTD A;  3O49 A;  4LO0 C;  1XYF A;  3CA5 A;  4IZE A;  3O4C A;  4Q91 A;  4GOV A;  1DZC A;  2KKI A;  2FFV A;  4I1B A;  2AFG A;  2AXM A;  2FFU A;  3UDA A;  1N4K A;  3WIN C;  1TWE A;  1RG8 A;  1JLX A;  1HKN A;  1FV3 A;  1Q04 A;  3BTA A;  3ZXD A;  2L5X A;  4X3A A;  1W3F A;  3VT0 A;  1JT7 A;  4JQ0 A;  1JY0 A;  1M16 A;  2AAI B;  4ISR A;  1PUU B;  1E0O A;  3RSJ A;  1DIW A;  1NZK A;  2KH2 A;  4JRA A;  1DJS B;  2DS0 A;  2R9K B;  5BXP A;  4Q9P A;  3AKG A;  3WO4 A;  4JPZ A;  3CRG A;  1T4Q A;  3O5W B;  3B9U A;  3KMV A;  3Q7Y A;  4G6M A;  2Q3N B;  4I4S A;  5D61 A;  1V6X A;  1VCL A;  3AH4 A;  3H6R B;  4ZA3 B;  3P6J A;  1FV2 A;  4ZOT A;  3VUO A;  5E24 E;  3H6Q A;  1FWV A;  4Z9W B;  4EFR A;  3K1X A;  4I4X A;  3CQA A;  3O4B A;  4R6U B;  5F8W A;  4H9W A;  3BA4 A;  1YYN A;  4I4O A;  4I37 A;  3FJA A;  3T8S A;  4QAL A;  4F34 A;  4GOY A;  5FZZ A;  2QN4 A;  3QR5 A;  2NYY A;  2DRE A;  4A7K A;  3OJV A;  3PHZ A;  2IHO A;  1BLD A;  2VXT I;  2F2F C;  3S8J A;  2FGF A;  4EFQ A;  3V79 C;  4HR6 C;  1L2H A;  3CA4 A;  4QBV A;  3FJC A;  4P6A A;  1ISV A;  4LO2 C;  3E8L C;  3N0K A;  4Q9G A;  1DLL A;  3AZV A;  3ZX7 A;  5I1B A;  1FQ9 A;  2D7R A;  3OBT A;  3AH2 A;  5HPZ A;  3BA5 A;  3R4U A;  2NVH A;  1K5V A;  3VT1 A;  2VXR A;  2BEB A;  5FNX A;  5BP5 C;  1S0F A;  2VSE A;  3F1R A;  3CAH A;  3AKF A;  1IRA X;  3FJE A;  2MIB A;  3ILA A;  3FUQ A;  3BAO A;  4QD2 B;  3A23 A;  3AJ6 A;  4D0Z A;  4HA2 A;  3BAH A;  3CA0 A;  3VSF A;  1TTU A;  1YBI A;  4OWJ A;  3IM5 A;  1I1E A;  2WRY A;  4OEE A;  4X39 A;  3NBN A;  3I2X A;  4JP0 A;  2VSA A;  1NUN A;  2D22 A;  2NM1 A;  1YTO A;  1YXW A;  4I3N A;  1ABR B;  5F8Y A;  1DFQ A;  1AVX B;  4D0T A;  4F83 A;  4I1E A;  3WO3 A;  4LO8 B;  4OEF A;  2QYI B;  1QXM A;  2ERM A;  3NBD A;  1JT5 A;  4ZFY B;  3LTQ A;  1CE7 B;  4TLP A;  4I4Q A;  4PC4 A;  4ZBV B;  3W9T A;  5BXS A;  3FFZ A;  4XFS A;  5DZU A;  3BB2 A;  4ZLB B;  3EF2 A;  4QKS A;  4XFT A;  2ET2 A;  3AH1 A;  1BFF A;  1S0D A;  4DEP A;  1Q03 A;  1K5U A;  3IM7 A;  3HOM A;  1WD4 A;  3BX1 C;  1F31 A;  4QC4 A;  1RY7 A;  1HWN B;  5DVH A;  2J3P A;  2WBC A;  4LO1 C;  1G9D A;  3MPP G;  2LIQ A;  1OQL B;  1PUM B;  3MAL A;  5F90 A;  8I1B A;  4GAF A;  1P63 A;  3FJ9 A;  4J2Y A;  1MC9 A;  1XHB A;  1S0L A;  2K8R A;  3WMU A;  2P23 A;  4QO3 A;  3AZW A;  1SR4 C;  2NP0 A;  4I4Y A;  2D44 A;  4IHZ A;  2HW9 A;  3FJH A;  1IT0 A;  1IRP A;  1BFG A;  4USO A;  1EVT A;  3WO2 A;  1G9C A;  4X37 A;  2ZR1 B;  4J2S A;  4IY9 A;  1WBA A;  3AKH A;  4ZFW B;  5B2H A;  2KI4 A;  3C9Z A;  3BAQ A;  2GZB A;  4END A;  5BXT A;  4KC3 A;  4L4H A;  2XOA A;  5G00 A;  4IYB A;  4I4P A;  3V0A A;  3BA7 A;  4A7Z A;  1JLY A;  2E4M A;  1J0S A;  3CA6 A;  4P0L A;  1ISW A;  4II0 A;  4EEE B;  1V6V A;  5JLV A;  4QD2 C;  5BQU A;  31BI A;  1FMM S;  2HWM A;  3Q7W A;  1S0E A;  3OBR A;  1T9F A;  3ZC9 A;  1BAS A;  3NJ5 A;  4YOL A;  4ZGR B;  1FWU A;  2AQZ A;  1DZD A;  2DRY A;  5BOW A;  3LLP A;  3SNV A;  41BI A;  6I1B A;  2HZ9 A;  1W3A A;  3CA1 A;  2F8X C;  2D20 A;  4I4U A;  4IQP A;  5D63 A;  1AFC A;  4G6J A;  1TOO A;  3BAU A;  4IZX A;  4J2X A;  5EC5 A;  3VEQ A;  3TC2 A;  4FVV A;  2RG9 B;  2RST A;  2P39 A;  1Z0H A;  3FJB A;  4JAW A;  1EPW A;  3S8K A;  1IJT A;  1DFC A;  4EFP A;  3UJ4 A;  4J2K A;  2K43 A;  1IIL A;  1I1B A;  3CA3 A;  1PC8 B;  3UD9 A;  2VLC A;  4I0Y A;  3N7J A;  3VWC A;  4OWK A;  1G9A A;  1HCD A;  3RTJ B;  1JT4 A;  1QQL A;  1D0H A;  3HBW A;  3O4D A;  2KLL A;  4LO7 B;  2GO2 A;  3UJ0 A;  5FNW A;  3OJM A;  3AJ5 A;  3WA1 A;  3POK A;  4I6I A;  3BAD A;  1MD6 A;  1FN0 A;  4QBC A;  3RMX A;  3H6R A;  3HSM A;  4XKI A;  1DQO A;  1EYL A;  3IM6 A;  1WD3 A;  2D43 A;  4KEK A;  7I1B A;  2DRZ A;  2X2S A;  4LO0 A;  3JUT A;  5D62 A;  4LO3 A;  2MC2 A;  1RML A;  1ISZ A;  3HMY A;  1KNM A;  4GP3 A;  3PUB A;  3WIN A;  3VT2 A;  4I4R A;  1QQK A;  4EB2 B;  2Z48 A;  3V0A B;  3OGG A;  2VU9 A;  5BVP I;  1HWO B;  3N7L A;  1RZO B;  3VSZ A;  4D8H A;  5DSS B;  3A22 A;  1UPS A;  1S0G A;  3BAV A;  3F62 B;  1IHK A;  4JKQ A;  1FMZ A;  3AKI A;  4AN7 B;  1ISX A;  3O44 A;  2KI6 B;  3BRF A;  3V0B A;  4P0J A;  4OW4 A;  4USP A;  3FGM A;  3O3Q A;  4XFU A;  3P53 A;  4OWL A;  2IWT B;  3P6I A;  3ZC8 A;  4I96 A;  1BA7 A;  3JRR A;  1Z4S A;  2HWA A;  1Z2V A;  2RQ9 A;  5BXR A;  1XG6 A;  1TWM A;  2FDB M;  4H04 A;  4OEG A;  1HCE A;  9ILB A;  3ZXG A;  4LO3 C;  3PG0 A;  4KEI A;  3NBE A;  1A8D A;  3CU1 B;  5FZY A;  3UD7 A;  1TFM B;  2F2F A;  2YUG A;  3FJD A;  3H6S E;  1ITB A;  4GP0 A;  2D7I A;  3FJJ A;  3BRD A;  1AVW B;  1EV2 A;  5DUY A;  4CJM A;  1BAR A;  2K4A B;  4KEJ A;  4ION A;  3R4S A;  4LO2 A;  1R8N A;  1AVU A;  1PWA A;  3IAG C;  1HIB A;  1FGA A;  1AXM A;  1JQZ A;  3WMV A;  1S0B A;  4LO7 C;  5BP5 A;  5EHA A;  1XZZ A;  5FZU A;  4I4V A;  3O4O A;  5EG6 C;  1M2T B;  1R8O A;  4G1R A;  4IY8 A;  1S0C A;  2Q9X A;  2X2T A;  3RTI B;  1ILR 1;  3BAG A;  4ISQ A;  3A07 A;  4I2S A;  1ISY A;  4QKR A;  1Q1U A;  4OUJ A;  3OJ2 A;  2BFH A;  4I7I A;  2Y9F A;  2M49 A;  1GGP B;  1JT3 A;  2FO1 A;  1V6U A;  4G9N A;  4L4I A;  2D23 A;  4JKX B;  3RMY A;  2VUA A;  2E4M C;  1V6W A;  21BI A;  3D7W B;  4I8M A;  3UD8 A;  5BQU C;  3V0B B;  1IOB A;  1CVS A;  4DCK C;  3N7M A;  2Y9W C;  2BEA A;  4EKX B;  2I1B A;  4J23 B;  3IIR A;  2ESU A;  3CRI A;  1HWP B;  2MLL B;  1BFC A;  4FGF A;  4WBC A;  4Z8S B;  3O4A A;  3QYD A;  1JTC A;  1TIE A;  3I29 B;  5F8S A;  3A21 A;  3FJK A;  2NZ9 A;  1PZZ A;  1II4 A;  1W3G A;  2Y9X E;  3PME A;  4LO1 A;  4G9M A;  1G82 A;  4AN6 A;  3BRG C;  1G9B A;  4KBB A;  3N7K A;  4P0K A;  2Y9G A;  2D24 A;  5JMC A;  5GAQ A;  1AVA C;  1SR4 A;  1BFB A;  2UUS A;  2ZQN A;  3FJF A;  1YF8 B;  3NBC A;  4X38 A;  4HJJ A;  3CRH A;  3OGF A;  3FJ8 A;  4ZFU B;  3HN1 A;  2ZQO A;  1HWM B;  1AF9 A;  1BLA A; 
#chains in the Genus database with same CATH topology
 4GAI A;  1TP0 A;  4ZKT B;  4DEN A;  3FUO A;  1DQG A;  4A7Y A;  2Z49 A;  3I2A A;  1ONK B;  3Q7X A;  1WBC A;  2D1Z A;  3HAL A;  3FJI A;  1SZ6 B;  2LIE A;  2NTD A;  3O49 A;  4LO0 C;  1XYF A;  3CA5 A;  4IZE A;  3O4C A;  4Q91 A;  4GOV A;  1DZC A;  2KKI A;  2FFV A;  4I1B A;  2AFG A;  2AXM A;  2FFU A;  3UDA A;  1N4K A;  3WIN C;  1TWE A;  1RG8 A;  1JLX A;  1HKN A;  1FV3 A;  1Q04 A;  3BTA A;  3ZXD A;  2L5X A;  4X3A A;  1W3F A;  3VT0 A;  1JT7 A;  4JQ0 A;  1JY0 A;  1M16 A;  2AAI B;  4ISR A;  1PUU B;  1E0O A;  3RSJ A;  1DIW A;  1NZK A;  2KH2 A;  4JRA A;  1DJS B;  2DS0 A;  2R9K B;  5BXP A;  4Q9P A;  3AKG A;  3WO4 A;  4JPZ A;  3CRG A;  1T4Q A;  3O5W B;  3B9U A;  3KMV A;  3Q7Y A;  4G6M A;  2Q3N B;  4I4S A;  5D61 A;  1V6X A;  1VCL A;  3AH4 A;  3H6R B;  4ZA3 B;  3P6J A;  1FV2 A;  4ZOT A;  3VUO A;  5E24 E;  3H6Q A;  1FWV A;  4Z9W B;  4EFR A;  3K1X A;  4I4X A;  3CQA A;  3O4B A;  4R6U B;  5F8W A;  4H9W A;  3BA4 A;  1YYN A;  4I4O A;  4I37 A;  3FJA A;  3T8S A;  4QAL A;  4F34 A;  4GOY A;  5FZZ A;  2QN4 A;  3QR5 A;  2NYY A;  2DRE A;  4A7K A;  3OJV A;  3PHZ A;  2IHO A;  1BLD A;  2VXT I;  2F2F C;  3S8J A;  2FGF A;  4EFQ A;  3V79 C;  4HR6 C;  1L2H A;  3CA4 A;  4QBV A;  3FJC A;  4P6A A;  1ISV A;  4LO2 C;  3E8L C;  3N0K A;  4Q9G A;  1DLL A;  3AZV A;  3ZX7 A;  5I1B A;  1FQ9 A;  2D7R A;  3OBT A;  3AH2 A;  5HPZ A;  3BA5 A;  3R4U A;  2NVH A;  1K5V A;  3VT1 A;  2VXR A;  2BEB A;  5FNX A;  5BP5 C;  1S0F A;  2VSE A;  3F1R A;  3CAH A;  3AKF A;  1IRA X;  3FJE A;  2MIB A;  3ILA A;  3FUQ A;  3BAO A;  4QD2 B;  3A23 A;  3AJ6 A;  4D0Z A;  4HA2 A;  3BAH A;  3CA0 A;  3VSF A;  1TTU A;  1YBI A;  4OWJ A;  3IM5 A;  1I1E A;  2WRY A;  4OEE A;  4X39 A;  3NBN A;  3I2X A;  4JP0 A;  2VSA A;  1NUN A;  2D22 A;  2NM1 A;  1YTO A;  1YXW A;  4I3N A;  1ABR B;  5F8Y A;  1DFQ A;  1AVX B;  4D0T A;  4F83 A;  4I1E A;  3WO3 A;  4LO8 B;  4OEF A;  2QYI B;  1QXM A;  2ERM A;  3NBD A;  1JT5 A;  4ZFY B;  3LTQ A;  1CE7 B;  4TLP A;  4I4Q A;  4PC4 A;  4ZBV B;  3W9T A;  5BXS A;  3FFZ A;  4XFS A;  5DZU A;  4MZH A;  3BB2 A;  4ZLB B;  3EF2 A;  4QKS A;  4XFT A;  2ET2 A;  3AH1 A;  1BFF A;  1S0D A;  4DEP A;  1Q03 A;  1K5U A;  3IM7 A;  3HOM A;  1WD4 A;  3BX1 C;  1F31 A;  4QC4 A;  1RY7 A;  1HWN B;  5DVH A;  2J3P A;  2WBC A;  4LO1 C;  1G9D A;  3MPP G;  2LIQ A;  1OQL B;  1PUM B;  3MAL A;  5F90 A;  8I1B A;  4GAF A;  1P63 A;  3FJ9 A;  4J2Y A;  1MC9 A;  1XHB A;  1S0L A;  2K8R A;  3WMU A;  2P23 A;  4QO3 A;  3AZW A;  1SR4 C;  2NP0 A;  4I4Y A;  2D44 A;  4IHZ A;  2HW9 A;  3FJH A;  1IT0 A;  1IRP A;  1BFG A;  4USO A;  1EVT A;  3WO2 A;  1G9C A;  4X37 A;  2ZR1 B;  4J2S A;  4IY9 A;  1WBA A;  3AKH A;  4ZFW B;  5B2H A;  2KI4 A;  3C9Z A;  3BAQ A;  2GZB A;  4END A;  5BXT A;  4KC3 A;  4L4H A;  2XOA A;  5G00 A;  4IYB A;  4I4P A;  3V0A A;  3BA7 A;  4A7Z A;  1JLY A;  2E4M A;  1J0S A;  3CA6 A;  4P0L A;  1ISW A;  4II0 A;  4EEE B;  1V6V A;  5JLV A;  4QD2 C;  5BQU A;  31BI A;  1FMM S;  2HWM A;  3Q7W A;  1S0E A;  3OBR A;  1T9F A;  3ZC9 A;  1BAS A;  3NJ5 A;  4YOL A;  4ZGR B;  1FWU A;  2AQZ A;  1DZD A;  2DRY A;  5BOW A;  3LLP A;  3SNV A;  4UY4 A;  41BI A;  6I1B A;  2HZ9 A;  1W3A A;  3CA1 A;  2F8X C;  2D20 A;  4I4U A;  4IQP A;  5D63 A;  1AFC A;  4G6J A;  1TOO A;  3BAU A;  4IZX A;  4J2X A;  5EC5 A;  3VEQ A;  3TC2 A;  4FVV A;  2RG9 B;  2RST A;  2P39 A;  1Z0H A;  3FJB A;  4JAW A;  1EPW A;  3S8K A;  1IJT A;  1DFC A;  4EFP A;  3UJ4 A;  4J2K A;  2K43 A;  1IIL A;  1I1B A;  3CA3 A;  1PC8 B;  3UD9 A;  2VLC A;  4I0Y A;  3N7J A;  3VWC A;  4OWK A;  1G9A A;  1HCD A;  3RTJ B;  1JT4 A;  1QQL A;  1D0H A;  3HBW A;  3O4D A;  2KLL A;  4LO7 B;  2GO2 A;  3UJ0 A;  5FNW A;  3OJM A;  3AJ5 A;  3WA1 A;  3POK A;  4I6I A;  3BAD A;  1MD6 A;  1FN0 A;  4QBC A;  3RMX A;  3H6R A;  3HSM A;  4XKI A;  1DQO A;  1EYL A;  3IM6 A;  1WD3 A;  2D43 A;  4KEK A;  7I1B A;  2DRZ A;  2X2S A;  4LO0 A;  3JUT A;  5D62 A;  4LO3 A;  2MC2 A;  1RML A;  1ISZ A;  3HMY A;  1KNM A;  4GP3 A;  3PUB A;  3WIN A;  3VT2 A;  4I4R A;  1QQK A;  4EB2 B;  2Z48 A;  3V0A B;  3OGG A;  2VU9 A;  5BVP I;  1HWO B;  3N7L A;  1RZO B;  3VSZ A;  4D8H A;  5DSS B;  3A22 A;  1UPS A;  1S0G A;  3BAV A;  3F62 B;  1IHK A;  4JKQ A;  1FMZ A;  3AKI A;  4AN7 B;  1ISX A;  3O44 A;  2KI6 B;  3BRF A;  2NS2 A;  3V0B A;  4P0J A;  4OW4 A;  4USP A;  3FGM A;  3O3Q A;  4XFU A;  3P53 A;  4OWL A;  2IWT B;  3P6I A;  3ZC8 A;  4I96 A;  1BA7 A;  3JRR A;  1Z4S A;  2HWA A;  1Z2V A;  2RQ9 A;  5BXR A;  1XG6 A;  1TWM A;  2FDB M;  4H04 A;  4OEG A;  1HCE A;  9ILB A;  3ZXG A;  4LO3 C;  3PG0 A;  4KEI A;  3NBE A;  1A8D A;  3CU1 B;  5FZY A;  3UD7 A;  1TFM B;  2F2F A;  2YUG A;  3FJD A;  3H6S E;  1ITB A;  4GP0 A;  2D7I A;  3FJJ A;  3BRD A;  1AVW B;  1EV2 A;  5DUY A;  4CJM A;  1BAR A;  2K4A B;  4KEJ A;  4ION A;  3R4S A;  4LO2 A;  1R8N A;  1AVU A;  1PWA A;  3IAG C;  1HIB A;  1FGA A;  1AXM A;  1JQZ A;  3WMV A;  1S0B A;  4MZG B;  4LO7 C;  5BP5 A;  5EHA A;  1XZZ A;  5FZU A;  4I4V A;  3O4O A;  5EG6 C;  1M2T B;  1R8O A;  4G1R A;  4IY8 A;  1S0C A;  2Q9X A;  2X2T A;  3RTI B;  1ILR 1;  3BAG A;  4ISQ A;  3A07 A;  4I2S A;  1ISY A;  4QKR A;  1Q1U A;  4OUJ A;  3OJ2 A;  2BFH A;  4I7I A;  2Y9F A;  2M49 A;  1GGP B;  1JT3 A;  2FO1 A;  1V6U A;  4G9N A;  4L4I A;  2D23 A;  4JKX B;  3RMY A;  2VUA A;  2E4M C;  1V6W A;  21BI A;  3D7W B;  4I8M A;  3UD8 A;  5BQU C;  3V0B B;  1IOB A;  1CVS A;  4DCK C;  3N7M A;  2Y9W C;  2BEA A;  4EKX B;  2I1B A;  4J23 B;  3IIR A;  2ESU A;  4H75 A;  3CRI A;  1HWP B;  2MLL B;  1BFC A;  4FGF A;  4WBC A;  4Z8S B;  3O4A A;  3QYD A;  1JTC A;  1TIE A;  3I29 B;  5F8S A;  3A21 A;  3FJK A;  2NZ9 A;  1PZZ A;  1II4 A;  1W3G A;  2Y9X E;  3PME A;  4LO1 A;  4G9M A;  4MZF B;  1G82 A;  4AN6 A;  3BRG C;  1G9B A;  4KBB A;  3N7K A;  4P0K A;  2Y9G A;  2D24 A;  5JMC A;  5GAQ A;  1AVA C;  1SR4 A;  1BFB A;  2UUS A;  2ZQN A;  3FJF A;  1YF8 B;  3NBC A;  4X38 A;  4HJJ A;  3CRH A;  3OGF A;  3FJ8 A;  4ZFU B;  3HN1 A;  2ZQO A;  1HWM B;  1AF9 A;  1BLA A; 
#chains in the Genus database with same CATH homology
 4GAI A;  1TP0 A;  4ZKT B;  4DEN A;  3FUO A;  1DQG A;  4A7Y A;  2Z49 A;  3I2A A;  1ONK B;  3Q7X A;  1WBC A;  2D1Z A;  3HAL A;  3FJI A;  1SZ6 B;  2LIE A;  2NTD A;  3O49 A;  4LO0 C;  1XYF A;  3CA5 A;  4IZE A;  3O4C A;  4Q91 A;  4GOV A;  1DZC A;  2KKI A;  2FFV A;  4I1B A;  2AFG A;  2AXM A;  2FFU A;  3UDA A;  1N4K A;  3WIN C;  1TWE A;  1RG8 A;  1JLX A;  1HKN A;  1FV3 A;  1Q04 A;  3BTA A;  3ZXD A;  2L5X A;  4X3A A;  1W3F A;  3VT0 A;  1JT7 A;  4JQ0 A;  1JY0 A;  1M16 A;  2AAI B;  4ISR A;  1PUU B;  1E0O A;  3RSJ A;  1DIW A;  1NZK A;  2KH2 A;  4JRA A;  1DJS B;  2DS0 A;  2R9K B;  5BXP A;  4Q9P A;  3AKG A;  3WO4 A;  4JPZ A;  3CRG A;  1T4Q A;  3O5W B;  3B9U A;  3KMV A;  3Q7Y A;  4G6M A;  2Q3N B;  4I4S A;  5D61 A;  1V6X A;  1VCL A;  3AH4 A;  3H6R B;  4ZA3 B;  3P6J A;  1FV2 A;  4ZOT A;  3VUO A;  5E24 E;  3H6Q A;  1FWV A;  4Z9W B;  4EFR A;  3K1X A;  4I4X A;  3CQA A;  3O4B A;  4R6U B;  5F8W A;  4H9W A;  3BA4 A;  1YYN A;  4I4O A;  4I37 A;  3FJA A;  3T8S A;  4QAL A;  4F34 A;  4GOY A;  5FZZ A;  2QN4 A;  3QR5 A;  2NYY A;  2DRE A;  4A7K A;  3OJV A;  3PHZ A;  2IHO A;  1BLD A;  2VXT I;  2F2F C;  3S8J A;  2FGF A;  4EFQ A;  3V79 C;  4HR6 C;  1L2H A;  3CA4 A;  4QBV A;  3FJC A;  4P6A A;  1ISV A;  4LO2 C;  3E8L C;  3N0K A;  4Q9G A;  1DLL A;  3AZV A;  3ZX7 A;  5I1B A;  1FQ9 A;  2D7R A;  3OBT A;  3AH2 A;  5HPZ A;  3BA5 A;  3R4U A;  2NVH A;  1K5V A;  3VT1 A;  2VXR A;  2BEB A;  5FNX A;  5BP5 C;  1S0F A;  2VSE A;  3F1R A;  3CAH A;  3AKF A;  1IRA X;  3FJE A;  2MIB A;  3ILA A;  3FUQ A;  3BAO A;  4QD2 B;  3A23 A;  3AJ6 A;  4D0Z A;  4HA2 A;  3BAH A;  3CA0 A;  3VSF A;  1TTU A;  1YBI A;  4OWJ A;  3IM5 A;  1I1E A;  2WRY A;  4OEE A;  4X39 A;  3NBN A;  3I2X A;  4JP0 A;  2VSA A;  1NUN A;  2D22 A;  2NM1 A;  1YTO A;  1YXW A;  4I3N A;  1ABR B;  5F8Y A;  1DFQ A;  1AVX B;  4D0T A;  4F83 A;  4I1E A;  3WO3 A;  4LO8 B;  4OEF A;  2QYI B;  1QXM A;  2ERM A;  3NBD A;  1JT5 A;  4ZFY B;  3LTQ A;  1CE7 B;  4TLP A;  4I4Q A;  4PC4 A;  4ZBV B;  3W9T A;  5BXS A;  3FFZ A;  4XFS A;  5DZU A;  4MZH A;  3BB2 A;  4ZLB B;  3EF2 A;  4QKS A;  4XFT A;  2ET2 A;  3AH1 A;  1BFF A;  1S0D A;  4DEP A;  1Q03 A;  1K5U A;  3IM7 A;  3HOM A;  1WD4 A;  3BX1 C;  1F31 A;  4QC4 A;  1RY7 A;  1HWN B;  5DVH A;  2J3P A;  2WBC A;  4LO1 C;  1G9D A;  3MPP G;  2LIQ A;  1OQL B;  1PUM B;  3MAL A;  5F90 A;  8I1B A;  4GAF A;  1P63 A;  3FJ9 A;  4J2Y A;  1MC9 A;  1XHB A;  1S0L A;  2K8R A;  3WMU A;  2P23 A;  4QO3 A;  3AZW A;  1SR4 C;  2NP0 A;  4I4Y A;  2D44 A;  4IHZ A;  2HW9 A;  3FJH A;  1IT0 A;  1IRP A;  1BFG A;  4USO A;  1EVT A;  3WO2 A;  1G9C A;  4X37 A;  2ZR1 B;  4J2S A;  4IY9 A;  1WBA A;  3AKH A;  4ZFW B;  5B2H A;  2KI4 A;  3C9Z A;  3BAQ A;  2GZB A;  4END A;  5BXT A;  4KC3 A;  4L4H A;  2XOA A;  5G00 A;  4IYB A;  4I4P A;  3V0A A;  3BA7 A;  4A7Z A;  1JLY A;  2E4M A;  1J0S A;  3CA6 A;  4P0L A;  1ISW A;  4II0 A;  4EEE B;  1V6V A;  5JLV A;  4QD2 C;  5BQU A;  31BI A;  1FMM S;  2HWM A;  3Q7W A;  1S0E A;  3OBR A;  1T9F A;  3ZC9 A;  1BAS A;  3NJ5 A;  4YOL A;  4ZGR B;  1FWU A;  2AQZ A;  1DZD A;  2DRY A;  5BOW A;  3LLP A;  3SNV A;  4UY4 A;  41BI A;  6I1B A;  2HZ9 A;  1W3A A;  3CA1 A;  2F8X C;  2D20 A;  4I4U A;  4IQP A;  5D63 A;  1AFC A;  4G6J A;  1TOO A;  3BAU A;  4IZX A;  4J2X A;  5EC5 A;  3VEQ A;  3TC2 A;  4FVV A;  2RG9 B;  2RST A;  2P39 A;  1Z0H A;  3FJB A;  4JAW A;  1EPW A;  3S8K A;  1IJT A;  1DFC A;  4EFP A;  3UJ4 A;  4J2K A;  2K43 A;  1IIL A;  1I1B A;  3CA3 A;  1PC8 B;  3UD9 A;  2VLC A;  4I0Y A;  3N7J A;  3VWC A;  4OWK A;  1G9A A;  1HCD A;  3RTJ B;  1JT4 A;  1QQL A;  1D0H A;  3HBW A;  3O4D A;  2KLL A;  4LO7 B;  2GO2 A;  3UJ0 A;  5FNW A;  3OJM A;  3AJ5 A;  3WA1 A;  3POK A;  4I6I A;  3BAD A;  1MD6 A;  1FN0 A;  4QBC A;  3RMX A;  3H6R A;  3HSM A;  4XKI A;  1DQO A;  1EYL A;  3IM6 A;  1WD3 A;  2D43 A;  4KEK A;  7I1B A;  2DRZ A;  2X2S A;  4LO0 A;  3JUT A;  5D62 A;  4LO3 A;  2MC2 A;  1RML A;  1ISZ A;  3HMY A;  1KNM A;  4GP3 A;  3PUB A;  3WIN A;  3VT2 A;  4I4R A;  1QQK A;  4EB2 B;  2Z48 A;  3V0A B;  3OGG A;  2VU9 A;  5BVP I;  1HWO B;  3N7L A;  1RZO B;  3VSZ A;  4D8H A;  5DSS B;  3A22 A;  1UPS A;  1S0G A;  3BAV A;  3F62 B;  1IHK A;  4JKQ A;  1FMZ A;  3AKI A;  4AN7 B;  1ISX A;  3O44 A;  2KI6 B;  3BRF A;  2NS2 A;  3V0B A;  4P0J A;  4OW4 A;  4USP A;  3FGM A;  3O3Q A;  4XFU A;  3P53 A;  4OWL A;  2IWT B;  3P6I A;  3ZC8 A;  4I96 A;  1BA7 A;  3JRR A;  1Z4S A;  2HWA A;  1Z2V A;  2RQ9 A;  5BXR A;  1XG6 A;  1TWM A;  2FDB M;  4H04 A;  4OEG A;  1HCE A;  9ILB A;  3ZXG A;  4LO3 C;  3PG0 A;  4KEI A;  3NBE A;  1A8D A;  3CU1 B;  5FZY A;  3UD7 A;  1TFM B;  2F2F A;  2YUG A;  3FJD A;  3H6S E;  1ITB A;  4GP0 A;  2D7I A;  3FJJ A;  3BRD A;  1AVW B;  1EV2 A;  5DUY A;  4CJM A;  1BAR A;  2K4A B;  4KEJ A;  4ION A;  3R4S A;  4LO2 A;  1R8N A;  1AVU A;  1PWA A;  3IAG C;  1HIB A;  1FGA A;  1AXM A;  1JQZ A;  3WMV A;  1S0B A;  4MZG B;  4LO7 C;  5BP5 A;  5EHA A;  1XZZ A;  5FZU A;  4I4V A;  3O4O A;  5EG6 C;  1M2T B;  1R8O A;  4G1R A;  4IY8 A;  1S0C A;  2Q9X A;  2X2T A;  3RTI B;  1ILR 1;  3BAG A;  4ISQ A;  3A07 A;  4I2S A;  1ISY A;  4QKR A;  1Q1U A;  4OUJ A;  3OJ2 A;  2BFH A;  4I7I A;  2Y9F A;  2M49 A;  1GGP B;  1JT3 A;  2FO1 A;  1V6U A;  4G9N A;  4L4I A;  2D23 A;  4JKX B;  3RMY A;  2VUA A;  2E4M C;  1V6W A;  21BI A;  3D7W B;  4I8M A;  3UD8 A;  5BQU C;  3V0B B;  1IOB A;  1CVS A;  4DCK C;  3N7M A;  2Y9W C;  2BEA A;  4EKX B;  2I1B A;  4J23 B;  3IIR A;  2ESU A;  4H75 A;  3CRI A;  1HWP B;  2MLL B;  1BFC A;  4FGF A;  4WBC A;  4Z8S B;  3O4A A;  3QYD A;  1JTC A;  1TIE A;  3I29 B;  5F8S A;  3A21 A;  3FJK A;  2NZ9 A;  1PZZ A;  1II4 A;  1W3G A;  2Y9X E;  3PME A;  4LO1 A;  4G9M A;  4MZF B;  1G82 A;  4AN6 A;  3BRG C;  1G9B A;  4KBB A;  3N7K A;  4P0K A;  2Y9G A;  2D24 A;  5JMC A;  5GAQ A;  1AVA C;  1SR4 A;  1BFB A;  2UUS A;  2ZQN A;  3FJF A;  1YF8 B;  3NBC A;  4X38 A;  4HJJ A;  3CRH A;  3OGF A;  3FJ8 A;  4ZFU B;  3HN1 A;  2ZQO A;  1HWM B;  1AF9 A;  1BLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...