3OJVA

Crystal structure of fgf1 complexed with the ectodomain of fgfr1c exhibiting an ordered ligand specificity-determining betac'-betae loop
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
133
structure length
133
Chain Sequence
b'GNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title Plasticity in Interactions of Fibroblast Growth Factor 1 (FGF1) N Terminus with FGF Receptors Underlies Promiscuity of FGF1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/signaling protein
total genus 33
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3ojvA00
4LO3A 2NYYA 1CE7B 31BIA 1Z4SA 4GP0A 2AXMA 4USPA 1IHKA 5JLVA 1R8NA 2FGFA 2K43A 1S0EA 2K4AB 3VEQA 1T4QA 4J2XA 4I4QA 1DQOA 3HN1A 3MPPG 5DUYA 3Q7WA 4LO1A 3FJ8A 3Q7YA 1I1EA 2XOAA 5E24E 4I4UA 2KI6B 4L4HA 2DREA 2AQZA 1MC9A 2X2TA 1J0SA 4ENDA 4IONA 4Q91A 3K1XA 4KEKA 1V6UA 3AH1A 4IZXA 5D61A 5EG6C 2WRYA 1T9FA 1IJTA 1FV3A 3FGMA 4LO2C 1FQ9A 3BB2A 4OWLA 3W9TA 4I4OA 1ISYA 1YBIA 3A22A 1AVUA 3F1RA 1N4KA 1PUUB 4IY8A 1PZZA 4CJMA 3VSZA 1RY7A 4J2YA 1V6VA 3VT0A 2E4MA 3PUBA 4I96A 2X2SA 3CRGA 2RQ9A 1YTOA 4HR6C 1SR4A 4LO3C 4ZGRB 2ERMA 1HIBA 5F90A 3PMEA 1G9DA 1HCEA 1M16A 3FJDA 2KKIA 4I0YA 2D22A 1ISVA 4LO1C 3V0AB 2RG9B 1BLAA 1ABRB 2DRZA 3OJ2A 4OEFA 3AJ5A 3HBWA 3AKGA 2I1BA 3OGFA 4G6JA 4JAWA 5BXSA 3NBCA 3P53A 3FFZA 3FJBA 1QQLA 4OWJA 3WMVA 2KLLA 3FJKA 5BXRA 4XFUA 5BOWA 3FJAA 4XKIA 3N7KA 1JY0A 1JLYA 2QN4A 1HWNB 1RG8A 3QYDA 2NM1A 8I1BA 3P6JA 1QQKA 1VCLA 1BFGA 4F34A 3QR5A 3IIRA 2Z49A 1YF8B 3UD7A 3FUQA 5BP5A 3H6RA 1ISXA 3I2AA 3PHZA 2E4MC 1TTUA 1FWUA 3VSFA 2D1ZA 4A7KA 3WINA 3EF2A 2NP0A 2HZ9A 4I4XA 1SR4C 1TIEA 4QKRA 3POKA 3RSJA 3S8KA 4IHZA 1XYFA 1BASA 4GOYA 3AKFA 3R4SA 4FGFA 4ISQA 4X38A 4GAFA 1S0LA 3BA5A 1S0FA 3LTQA 4G9MA 3KMVA 2LIQA 2GO2A 5D63A 4GOVA 2VSAA 2AFGA 1XZZA 2HWAA 4LO0A 5FZUA 2MC2A 2YUGA 1QXMA 2D23A 4DCKC 1EV2A 2LIEA 3BA7A 3WA1A 3CAHA 5BVPI 3O5WB 3RMXA 1PUMB 1IRAX 3C9ZA 2FFVA 4D0TA 4A7ZA 4QBCA 1BA7A 3O4AA 1PC8B 4DEPA 1DLLA 2Y9XE 3LLPA 4ZFYB 1G9CA 2Q3NB 3I2XA 3NBNA 4I6IA 1WD3A 2IHOA 1MD6A 3AH4A 3BAQA 1A8DA 3FJFA 3WINC 4A7YA 1II4A 1G82A 5DSSB 4HJJA 4TLPA 1DJSB 3FJCA 2DS0A 1P63A 3FJJA 1IRPA 6I1BA 5FNXA 5FZYA 4QD2C 3UJ0A 3AKHA 3VWCA 4EKXB 4XFSA 1KNMA 1WBAA 4Z8SB 4ZFWB 2D7IA 4IZEA 3BADA 3O4DA 4Q9GA 5DVHA 3CRIA 3A21A 3FJEA 1Q03A 1JT3A 3JUTA 2F2FC 3UD8A 3CA1A 1Z2VA 1YYNA 3P6IA 4OEGA 3H6SE 4OW4A 1AVXB 4LO0C 3A23A 2ET2A 1CVSA 3H6QA 3O44A 1IILA 1TP0A 4I4YA 3CA4A 4H9WA 7I1BA 3O3QA 1ILR1 1BFBA 2ZR1B 2FDBM 4P0KA 2D24A 2F8XC 2M49A 2RSTA 3ZC8A 3D7WB 5DZUA 4X3AA 4I37A 3RTIB 4PC4A 3CA3A 4AN6A 1FGAA 1JQZA 4I7IA 1YXWA 1EYLA 3UJ4A 1Q04A 1PWAA 3BRDA 4KC3A 1AVAC 4YOLA 3FJIA 1NZKA 4AN7B 5GAQA 3BTAA 3OGGA 2VU9A 4JPZA 21BIA 1TOOA 2IWTB 4JKQA 1EPWA 1IOBA 4OUJA 4QALA 4LO7C 1K5VA 1V6XA 3WO3A 4ZOTA 1JLXA 3CA6A 1W3GA 1S0DA 3HSMA 3JRRA 3O4CA 4LO7B 3T8SA 5JMCA 4HA2A 3N0KA 4H04A 4ZKTB 3BAGA 1TWMA 1F31A 2VSEA 3HMYA 3BRFA 4F83A 4I2SA 3VT2A 2L5XA 3O49A 2NZ9A 5BXTA 2ZQOA 5F8YA 1FV2A 1JT5A 1AF9A 2NTDA 1HWPB 4JKXB 2VXTI 3NJ5A 2GZBA 4X39A 2VLCA 1JT4A 3RTJB 4X37A 2D43A 3BAHA 41BIA 3N7LA 3ZXDA 3CA5A 3BAOA 4IQPA 4QBVA 4I1EA 3WO2A 4EFRA 4II0A 1D0HA 3ZC9A 1AVWB 4WBCA 2WBCA 4I4RA 3N7JA 4G9NA 3NBDA 4I3NA 4J23B 3V79C 4I4SA 3ILAA 2VUAA 1W3AA 2NVHA 3OBTA 1DZDA 3BAUA 4EB2B 1SZ6B 1DFQA 5BP5C 4GAIA 1XHBA 3OBRA 3H6RB 4I1BA 3ZXGA 4ZLBB 4OWKA 2AAIB 3HOMA 4D8HA 3BAVA 2FFUA 3V0AA 4QC4A 5BQUA 1S0GA 2FO1A 3AZVA 1RZOB 1HWOB 1WBCA 2D44A 3AKIA 3CQAA 1V6WA 1AXMA 1DFCA 1GGPB 2R9KB 9ILBA 4P0JA 3E8LC 4G1RA 4QD2B 4Q9PA 2Q9XA 1S0BA 4OEEA 3V0BA 2KI4A 2HW9A 3MALA 3B9UA 4KBBA 3A07A 1FMMS 3VUOA 3WMUA 1I1BA 3UD9A 4USOA 3PG0A 2ESUA 4FVVA 1BFCA 5FNWA 1FMZA 4JQ0A 5EC5A 4ISRA 4J2KA 3BRGC 4I8MA 1DZCA 4I4PA 4XFTA 2BEBA 4KEJA 4R6UB 2Y9GA 4ZA3B 2D7RA 1HWMB 5HPZA 1AFCA 1IT0A 2QYIB 2P23A 4IYBA 3UDAA 3AH2A 1BFFA 3FUOA 5F8SA 3NBEA 5EHAA 4QKSA 1M2TB 1BLDA 5B2HA 4Z9WB 1NUNA 3R4UA 1UPSA 1ISZA 3IM7A 3FJHA 3RMYA 5BQUC 3N7MA 1Q1UA 4GP3A 1EVTA 3WO4A 1DQGA 1G9BA 4ZBVB 3BX1C 1G9AA 1JTCA 1WD4A 1S0CA 3TC2A 1Z0HA 3S8JA 5FZZA 3O4BA 4D0ZA 2P39A 2MIBA 4JP0A 3SNVA 5G00A 1XG6A 3V0BB 3CU1B 5I1BA 4KEIA 4EFPA 4LO8B 4L4IA 1BARA 2HWMA 1JT7A 2BEAA 4EFQA 3AZWA 2J3PA 3OJMA 3IAGC 5F8WA 3I29B 2D20A 3F62B 1HKNA 3BA4A 1TWEA 4G6MA 2Z48A 4IY9A 3VT1A 1ONKB 4ZFUB 1ISWA 2KH2A 1DIWA 2BFHA 2Y9WC 4P0LA 3Q7XA 1FWVA 1FN0A 2Y9FA 1ITBA 1RMLA 2K8RA 2DRYA 1OQLB 4I4VA 3CRHA 2UUSA 4QO3A 4DENA 2ZQNA 4P6AA 3AJ6A 5BXPA 4LO2A 3OJVA 3IM6A 5D62A 1TFMB 1L2HA 1E0OA 1R8OA 1W3FA 1HCDA 3FJ9A 3IM5A 2MLLB 1K5UA 2F2FA 4EEEB 4J2SA 2VXRA 3CA0A 4JRAA 3HALA 3ZX7A 3O4OA
chains in the Genus database with same CATH superfamily
4LO3A 2NYYA 1CE7B 31BIA 1Z4SA 4GP0A 2AXMA 4USPA 1IHKA 5JLVA 1R8NA 2FGFA 2K43A 1S0EA 2K4AB 3VEQA 1T4QA 4J2XA 4I4QA 1DQOA 3HN1A 3MPPG 5DUYA 3Q7WA 4LO1A 3FJ8A 3Q7YA 1I1EA 2XOAA 5E24E 4I4UA 2KI6B 4L4HA 2DREA 2AQZA 1MC9A 2X2TA 1J0SA 4ENDA 4IONA 4Q91A 3K1XA 4KEKA 1V6UA 3AH1A 4IZXA 5D61A 5EG6C 4UY4A 2WRYA 1T9FA 1IJTA 1FV3A 3FGMA 4LO2C 1FQ9A 3BB2A 4OWLA 3W9TA 2NS2A 4I4OA 1ISYA 1YBIA 3A22A 1AVUA 3F1RA 1N4KA 1PUUB 4IY8A 1PZZA 4CJMA 3VSZA 1RY7A 4J2YA 1V6VA 3VT0A 2E4MA 3PUBA 4I96A 2X2SA 3CRGA 2RQ9A 1YTOA 4HR6C 1SR4A 4LO3C 4ZGRB 2ERMA 1HIBA 5F90A 3PMEA 1G9DA 1HCEA 1M16A 3FJDA 2KKIA 4I0YA 2D22A 1ISVA 4LO1C 3V0AB 2RG9B 1BLAA 1ABRB 2DRZA 3OJ2A 4OEFA 3AJ5A 3HBWA 3AKGA 2I1BA 3OGFA 4G6JA 4JAWA 5BXSA 3NBCA 3P53A 3FFZA 3FJBA 1QQLA 4OWJA 3WMVA 2KLLA 3FJKA 5BXRA 4XFUA 5BOWA 3FJAA 4XKIA 3N7KA 1JY0A 1JLYA 2QN4A 1HWNB 1RG8A 3QYDA 2NM1A 8I1BA 3P6JA 1QQKA 1VCLA 1BFGA 4F34A 3QR5A 3IIRA 2Z49A 1YF8B 3UD7A 3FUQA 5BP5A 3H6RA 1ISXA 3I2AA 3PHZA 2E4MC 1TTUA 1FWUA 3VSFA 2D1ZA 4A7KA 3WINA 3EF2A 2NP0A 2HZ9A 4I4XA 1SR4C 1TIEA 4QKRA 3POKA 3RSJA 3S8KA 4IHZA 1XYFA 1BASA 4GOYA 3AKFA 3R4SA 4FGFA 4ISQA 4X38A 4GAFA 1S0LA 3BA5A 1S0FA 3LTQA 4G9MA 3KMVA 2LIQA 2GO2A 5D63A 4GOVA 2VSAA 2AFGA 1XZZA 2HWAA 4LO0A 5FZUA 2MC2A 2YUGA 1QXMA 2D23A 4DCKC 1EV2A 2LIEA 3BA7A 3WA1A 3CAHA 5BVPI 3O5WB 3RMXA 1PUMB 1IRAX 3C9ZA 2FFVA 4D0TA 4A7ZA 4QBCA 1BA7A 3O4AA 1PC8B 4DEPA 1DLLA 2Y9XE 3LLPA 4ZFYB 1G9CA 2Q3NB 3I2XA 3NBNA 4I6IA 1WD3A 2IHOA 1MD6A 3AH4A 3BAQA 1A8DA 3FJFA 3WINC 4A7YA 1II4A 1G82A 5DSSB 4HJJA 4TLPA 1DJSB 3FJCA 2DS0A 1P63A 3FJJA 1IRPA 4MZHA 6I1BA 5FNXA 5FZYA 4QD2C 3UJ0A 3AKHA 3VWCA 4EKXB 4XFSA 1KNMA 1WBAA 4Z8SB 4ZFWB 2D7IA 4IZEA 3BADA 3O4DA 4Q9GA 5DVHA 3CRIA 3A21A 3FJEA 1Q03A 1JT3A 3JUTA 2F2FC 3UD8A 3CA1A 1Z2VA 1YYNA 3P6IA 4OEGA 3H6SE 4H75A 1AVXB 4LO0C 4OW4A 3A23A 2ET2A 1CVSA 3H6QA 3O44A 1IILA 1TP0A 4I4YA 3CA4A 4H9WA 7I1BA 3O3QA 1ILR1 1BFBA 2ZR1B 2FDBM 4P0KA 2D24A 2F8XC 2M49A 2RSTA 3ZC8A 3D7WB 5DZUA 4X3AA 4I37A 3RTIB 4PC4A 3CA3A 4AN6A 1FGAA 1JQZA 4I7IA 1YXWA 1EYLA 3UJ4A 1Q04A 1PWAA 3BRDA 4KC3A 1AVAC 4YOLA 3FJIA 1NZKA 4AN7B 5GAQA 3BTAA 3OGGA 2VU9A 4JPZA 21BIA 1TOOA 2IWTB 4JKQA 1EPWA 1IOBA 4OUJA 4QALA 4LO7C 1K5VA 1V6XA 3WO3A 4ZOTA 1JLXA 3CA6A 1W3GA 1S0DA 3HSMA 3JRRA 3O4CA 4LO7B 3T8SA 5JMCA 4HA2A 3N0KA 4H04A 4ZKTB 3BAGA 1TWMA 1F31A 2VSEA 3HMYA 3BRFA 4F83A 4I2SA 3VT2A 2L5XA 3O49A 2NZ9A 5BXTA 2ZQOA 5F8YA 1FV2A 1JT5A 1AF9A 2NTDA 1HWPB 4JKXB 2VXTI 3NJ5A 2GZBA 4X39A 2VLCA 1JT4A 3RTJB 4X37A 2D43A 3BAHA 41BIA 3N7LA 3ZXDA 3CA5A 3BAOA 4IQPA 4QBVA 4I1EA 3WO2A 4EFRA 4II0A 1D0HA 3ZC9A 1AVWB 4WBCA 2WBCA 4I4RA 3N7JA 4G9NA 3NBDA 4I3NA 4J23B 3V79C 4I4SA 3ILAA 2VUAA 1W3AA 2NVHA 3OBTA 1DZDA 3BAUA 4EB2B 1SZ6B 1DFQA 5BP5C 4GAIA 1XHBA 3OBRA 3H6RB 4I1BA 3ZXGA 4ZLBB 4OWKA 2AAIB 3HOMA 4D8HA 3BAVA 4MZFB 2FFUA 3V0AA 4QC4A 5BQUA 1S0GA 2FO1A 3AZVA 1RZOB 1HWOB 1WBCA 2D44A 3AKIA 3CQAA 1V6WA 1AXMA 1DFCA 1GGPB 2R9KB 9ILBA 4P0JA 3E8LC 4G1RA 4QD2B 4Q9PA 2Q9XA 1S0BA 4OEEA 3V0BA 2KI4A 2HW9A 3MALA 3B9UA 4KBBA 3A07A 1FMMS 3VUOA 3WMUA 1I1BA 3UD9A 4USOA 3PG0A 2ESUA 4FVVA 1BFCA 5FNWA 1FMZA 4JQ0A 5EC5A 4ISRA 4J2KA 3BRGC 4I8MA 1DZCA 4I4PA 4XFTA 2BEBA 4KEJA 4R6UB 2Y9GA 4ZA3B 2D7RA 1HWMB 5HPZA 1AFCA 1IT0A 2QYIB 2P23A 4IYBA 3UDAA 3AH2A 1BFFA 3FUOA 5F8SA 3NBEA 5EHAA 4QKSA 1M2TB 1BLDA 5B2HA 4Z9WB 1NUNA 3R4UA 1UPSA 1ISZA 3IM7A 3FJHA 3RMYA 5BQUC 3N7MA 1Q1UA 4GP3A 1EVTA 3WO4A 1DQGA 1G9BA 4ZBVB 3BX1C 1G9AA 1JTCA 1WD4A 1S0CA 3TC2A 1Z0HA 3S8JA 5FZZA 3O4BA 4D0ZA 2P39A 2MIBA 4JP0A 3SNVA 5G00A 1XG6A 3V0BB 3CU1B 5I1BA 4KEIA 4EFPA 4LO8B 4L4IA 1BARA 2HWMA 1JT7A 2BEAA 4EFQA 3AZWA 2J3PA 3OJMA 3IAGC 5F8WA 3I29B 2D20A 3F62B 1HKNA 3BA4A 1TWEA 4G6MA 2Z48A 4IY9A 3VT1A 1ONKB 4ZFUB 1ISWA 2KH2A 1DIWA 2BFHA 2Y9WC 4P0LA 3Q7XA 1FWVA 1FN0A 4MZGB 2Y9FA 1ITBA 1RMLA 2K8RA 2DRYA 1OQLB 4I4VA 3CRHA 2UUSA 4QO3A 4DENA 2ZQNA 4P6AA 3AJ6A 5BXPA 4LO2A 3OJVA 3IM6A 5D62A 1TFMB 1L2HA 1E0OA 1R8OA 1W3FA 1HCDA 3FJ9A 3IM5A 2MLLB 1K5UA 2F2FA 4EEEB 4J2SA 2VXRA 3CA0A 4JRAA 3HALA 3ZX7A 3O4OA
chains in the Genus database with same CATH topology
4LO3A 2NYYA 1CE7B 31BIA 1Z4SA 4GP0A 2AXMA 4USPA 1IHKA 5JLVA 1R8NA 2FGFA 2K43A 1S0EA 2K4AB 3VEQA 1T4QA 4J2XA 4I4QA 1DQOA 3HN1A 3MPPG 5DUYA 3Q7WA 4LO1A 3FJ8A 3Q7YA 1I1EA 2XOAA 5E24E 4I4UA 2KI6B 4L4HA 2DREA 2AQZA 1MC9A 2X2TA 1J0SA 4ENDA 4IONA 4Q91A 3K1XA 4KEKA 1V6UA 3AH1A 4IZXA 5D61A 5EG6C 4UY4A 2WRYA 1T9FA 1IJTA 1FV3A 3FGMA 4LO2C 1FQ9A 3BB2A 4OWLA 3W9TA 2NS2A 4I4OA 1ISYA 1YBIA 3A22A 1AVUA 3F1RA 1N4KA 1PUUB 4IY8A 1PZZA 4CJMA 3VSZA 1RY7A 4J2YA 1V6VA 3VT0A 2E4MA 3PUBA 4I96A 2X2SA 3CRGA 2RQ9A 1YTOA 4HR6C 1SR4A 4LO3C 4ZGRB 2ERMA 1HIBA 5F90A 3PMEA 1G9DA 1HCEA 1M16A 3FJDA 2KKIA 4I0YA 2D22A 1ISVA 4LO1C 3V0AB 2RG9B 1BLAA 1ABRB 2DRZA 3OJ2A 4OEFA 3AJ5A 3HBWA 3AKGA 2I1BA 3OGFA 4G6JA 4JAWA 5BXSA 3NBCA 3P53A 3FFZA 3FJBA 1QQLA 4OWJA 3WMVA 2KLLA 3FJKA 5BXRA 4XFUA 5BOWA 3FJAA 4XKIA 3N7KA 1JY0A 1JLYA 2QN4A 1HWNB 1RG8A 3QYDA 2NM1A 8I1BA 3P6JA 1QQKA 1VCLA 1BFGA 4F34A 3QR5A 3IIRA 2Z49A 1YF8B 3UD7A 3FUQA 5BP5A 3H6RA 1ISXA 3I2AA 3PHZA 2E4MC 1TTUA 1FWUA 3VSFA 2D1ZA 4A7KA 3WINA 3EF2A 2NP0A 2HZ9A 4I4XA 1SR4C 1TIEA 4QKRA 3POKA 3RSJA 3S8KA 4IHZA 1XYFA 1BASA 4GOYA 3AKFA 3R4SA 4FGFA 4ISQA 4X38A 4GAFA 1S0LA 3BA5A 1S0FA 3LTQA 4G9MA 3KMVA 2LIQA 2GO2A 5D63A 4GOVA 2VSAA 2AFGA 1XZZA 2HWAA 4LO0A 5FZUA 2MC2A 2YUGA 1QXMA 2D23A 4DCKC 1EV2A 2LIEA 3BA7A 3WA1A 3CAHA 5BVPI 3O5WB 3RMXA 1PUMB 1IRAX 3C9ZA 2FFVA 4D0TA 4A7ZA 4QBCA 1BA7A 3O4AA 1PC8B 4DEPA 1DLLA 2Y9XE 3LLPA 4ZFYB 1G9CA 2Q3NB 3I2XA 3NBNA 4I6IA 1WD3A 2IHOA 1MD6A 3AH4A 3BAQA 1A8DA 3FJFA 3WINC 4A7YA 1II4A 1G82A 5DSSB 4HJJA 4TLPA 1DJSB 3FJCA 2DS0A 1P63A 3FJJA 1IRPA 4MZHA 6I1BA 5FNXA 5FZYA 4QD2C 3UJ0A 3AKHA 3VWCA 4EKXB 4XFSA 1KNMA 1WBAA 4Z8SB 4ZFWB 2D7IA 4IZEA 3BADA 3O4DA 4Q9GA 5DVHA 3CRIA 3A21A 3FJEA 1Q03A 1JT3A 3JUTA 2F2FC 3UD8A 3CA1A 1Z2VA 1YYNA 3P6IA 4OEGA 3H6SE 4H75A 1AVXB 4LO0C 4OW4A 3A23A 2ET2A 1CVSA 3H6QA 3O44A 1IILA 1TP0A 4I4YA 3CA4A 4H9WA 7I1BA 3O3QA 1ILR1 1BFBA 2ZR1B 2FDBM 4P0KA 2D24A 2F8XC 2M49A 2RSTA 3ZC8A 3D7WB 5DZUA 4X3AA 4I37A 3RTIB 4PC4A 3CA3A 4AN6A 1FGAA 1JQZA 4I7IA 1YXWA 1EYLA 3UJ4A 1Q04A 1PWAA 3BRDA 4KC3A 1AVAC 4YOLA 3FJIA 1NZKA 4AN7B 5GAQA 3BTAA 3OGGA 2VU9A 4JPZA 21BIA 1TOOA 2IWTB 4JKQA 1EPWA 1IOBA 4OUJA 4QALA 4LO7C 1K5VA 1V6XA 3WO3A 4ZOTA 1JLXA 3CA6A 1W3GA 1S0DA 3HSMA 3JRRA 3O4CA 4LO7B 3T8SA 5JMCA 4HA2A 3N0KA 4H04A 4ZKTB 3BAGA 1TWMA 1F31A 2VSEA 3HMYA 3BRFA 4F83A 4I2SA 3VT2A 2L5XA 3O49A 2NZ9A 5BXTA 2ZQOA 5F8YA 1FV2A 1JT5A 1AF9A 2NTDA 1HWPB 4JKXB 2VXTI 3NJ5A 2GZBA 4X39A 2VLCA 1JT4A 3RTJB 4X37A 2D43A 3BAHA 41BIA 3N7LA 3ZXDA 3CA5A 3BAOA 4IQPA 4QBVA 4I1EA 3WO2A 4EFRA 4II0A 1D0HA 3ZC9A 1AVWB 4WBCA 2WBCA 4I4RA 3N7JA 4G9NA 3NBDA 4I3NA 4J23B 3V79C 4I4SA 3ILAA 2VUAA 1W3AA 2NVHA 3OBTA 1DZDA 3BAUA 4EB2B 1SZ6B 1DFQA 5BP5C 4GAIA 1XHBA 3OBRA 3H6RB 4I1BA 3ZXGA 4ZLBB 4OWKA 2AAIB 3HOMA 4D8HA 3BAVA 4MZFB 2FFUA 3V0AA 4QC4A 5BQUA 1S0GA 2FO1A 3AZVA 1RZOB 1HWOB 1WBCA 2D44A 3AKIA 3CQAA 1V6WA 1AXMA 1DFCA 1GGPB 2R9KB 9ILBA 4P0JA 3E8LC 4G1RA 4QD2B 4Q9PA 2Q9XA 1S0BA 4OEEA 3V0BA 2KI4A 2HW9A 3MALA 3B9UA 4KBBA 3A07A 1FMMS 3VUOA 3WMUA 1I1BA 3UD9A 4USOA 3PG0A 2ESUA 4FVVA 1BFCA 5FNWA 1FMZA 4JQ0A 5EC5A 4ISRA 4J2KA 3BRGC 4I8MA 1DZCA 4I4PA 4XFTA 2BEBA 4KEJA 4R6UB 2Y9GA 4ZA3B 2D7RA 1HWMB 5HPZA 1AFCA 1IT0A 2QYIB 2P23A 4IYBA 3UDAA 3AH2A 1BFFA 3FUOA 5F8SA 3NBEA 5EHAA 4QKSA 1M2TB 1BLDA 5B2HA 4Z9WB 1NUNA 3R4UA 1UPSA 1ISZA 3IM7A 3FJHA 3RMYA 5BQUC 3N7MA 1Q1UA 4GP3A 1EVTA 3WO4A 1DQGA 1G9BA 4ZBVB 3BX1C 1G9AA 1JTCA 1WD4A 1S0CA 3TC2A 1Z0HA 3S8JA 5FZZA 3O4BA 4D0ZA 2P39A 2MIBA 4JP0A 3SNVA 5G00A 1XG6A 3V0BB 3CU1B 5I1BA 4KEIA 4EFPA 4LO8B 4L4IA 1BARA 2HWMA 1JT7A 2BEAA 4EFQA 3AZWA 2J3PA 3OJMA 3IAGC 5F8WA 3I29B 2D20A 3F62B 1HKNA 3BA4A 1TWEA 4G6MA 2Z48A 4IY9A 3VT1A 1ONKB 4ZFUB 1ISWA 2KH2A 1DIWA 2BFHA 2Y9WC 4P0LA 3Q7XA 1FWVA 1FN0A 4MZGB 2Y9FA 1ITBA 1RMLA 2K8RA 2DRYA 1OQLB 4I4VA 3CRHA 2UUSA 4QO3A 4DENA 2ZQNA 4P6AA 3AJ6A 5BXPA 4LO2A 3OJVA 3IM6A 5D62A 1TFMB 1L2HA 1E0OA 1R8OA 1W3FA 1HCDA 3FJ9A 3IM5A 2MLLB 1K5UA 2F2FA 4EEEB 4J2SA 2VXRA 3CA0A 4JRAA 3HALA 3ZX7A 3O4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LO3 A;  2NYY A;  1CE7 B;  31BI A;  1Z4S A;  4GP0 A;  2AXM A;  4USP A;  1IHK A;  5JLV A;  1R8N A;  2FGF A;  2K43 A;  1S0E A;  2K4A B;  3VEQ A;  1T4Q A;  4J2X A;  4I4Q A;  1DQO A;  3HN1 A;  3MPP G;  5DUY A;  3Q7W A;  4LO1 A;  3FJ8 A;  3Q7Y A;  1I1E A;  2XOA A;  5E24 E;  4I4U A;  2KI6 B;  4L4H A;  2DRE A;  2AQZ A;  1MC9 A;  2X2T A;  1J0S A;  4END A;  4ION A;  4Q91 A;  3K1X A;  4KEK A;  1V6U A;  3AH1 A;  4IZX A;  5D61 A;  5EG6 C;  2WRY A;  1T9F A;  1IJT A;  1FV3 A;  3FGM A;  4LO2 C;  1FQ9 A;  3BB2 A;  4OWL A;  3W9T A;  4I4O A;  1ISY A;  1YBI A;  3A22 A;  1AVU A;  3F1R A;  1N4K A;  1PUU B;  4IY8 A;  1PZZ A;  4CJM A;  3VSZ A;  1RY7 A;  4J2Y A;  1V6V A;  3VT0 A;  2E4M A;  3PUB A;  4I96 A;  2X2S A;  3CRG A;  2RQ9 A;  1YTO A;  4HR6 C;  1SR4 A;  4LO3 C;  4ZGR B;  2ERM A;  1HIB A;  5F90 A;  3PME A;  1G9D A;  1HCE A;  1M16 A;  3FJD A;  2KKI A;  4I0Y A;  2D22 A;  1ISV A;  4LO1 C;  3V0A B;  2RG9 B;  1BLA A;  1ABR B;  2DRZ A;  3OJ2 A;  4OEF A;  3AJ5 A;  3HBW A;  3AKG A;  2I1B A;  3OGF A;  4G6J A;  4JAW A;  5BXS A;  3NBC A;  3P53 A;  3FFZ A;  3FJB A;  1QQL A;  4OWJ A;  3WMV A;  2KLL A;  3FJK A;  5BXR A;  4XFU A;  5BOW A;  3FJA A;  4XKI A;  3N7K A;  1JY0 A;  1JLY A;  2QN4 A;  1HWN B;  1RG8 A;  3QYD A;  2NM1 A;  8I1B A;  3P6J A;  1QQK A;  1VCL A;  1BFG A;  4F34 A;  3QR5 A;  3IIR A;  2Z49 A;  1YF8 B;  3UD7 A;  3FUQ A;  5BP5 A;  3H6R A;  1ISX A;  3I2A A;  3PHZ A;  2E4M C;  1TTU A;  1FWU A;  3VSF A;  2D1Z A;  4A7K A;  3WIN A;  3EF2 A;  2NP0 A;  2HZ9 A;  4I4X A;  1SR4 C;  1TIE A;  4QKR A;  3POK A;  3RSJ A;  3S8K A;  4IHZ A;  1XYF A;  1BAS A;  4GOY A;  3AKF A;  3R4S A;  4FGF A;  4ISQ A;  4X38 A;  4GAF A;  1S0L A;  3BA5 A;  1S0F A;  3LTQ A;  4G9M A;  3KMV A;  2LIQ A;  2GO2 A;  5D63 A;  4GOV A;  2VSA A;  2AFG A;  1XZZ A;  2HWA A;  4LO0 A;  5FZU A;  2MC2 A;  2YUG A;  1QXM A;  2D23 A;  4DCK C;  1EV2 A;  2LIE A;  3BA7 A;  3WA1 A;  3CAH A;  5BVP I;  3O5W B;  3RMX A;  1PUM B;  1IRA X;  3C9Z A;  2FFV A;  4D0T A;  4A7Z A;  4QBC A;  1BA7 A;  3O4A A;  1PC8 B;  4DEP A;  1DLL A;  2Y9X E;  3LLP A;  4ZFY B;  1G9C A;  2Q3N B;  3I2X A;  3NBN A;  4I6I A;  1WD3 A;  2IHO A;  1MD6 A;  3AH4 A;  3BAQ A;  1A8D A;  3FJF A;  3WIN C;  4A7Y A;  1II4 A;  1G82 A;  5DSS B;  4HJJ A;  4TLP A;  1DJS B;  3FJC A;  2DS0 A;  1P63 A;  3FJJ A;  1IRP A;  6I1B A;  5FNX A;  5FZY A;  4QD2 C;  3UJ0 A;  3AKH A;  3VWC A;  4EKX B;  4XFS A;  1KNM A;  1WBA A;  4Z8S B;  4ZFW B;  2D7I A;  4IZE A;  3BAD A;  3O4D A;  4Q9G A;  5DVH A;  3CRI A;  3A21 A;  3FJE A;  1Q03 A;  1JT3 A;  3JUT A;  2F2F C;  3UD8 A;  3CA1 A;  1Z2V A;  1YYN A;  3P6I A;  4OEG A;  3H6S E;  4OW4 A;  1AVX B;  4LO0 C;  3A23 A;  2ET2 A;  1CVS A;  3H6Q A;  3O44 A;  1IIL A;  1TP0 A;  4I4Y A;  3CA4 A;  4H9W A;  7I1B A;  3O3Q A;  1ILR 1;  1BFB A;  2ZR1 B;  2FDB M;  4P0K A;  2D24 A;  2F8X C;  2M49 A;  2RST A;  3ZC8 A;  3D7W B;  5DZU A;  4X3A A;  4I37 A;  3RTI B;  4PC4 A;  3CA3 A;  4AN6 A;  1FGA A;  1JQZ A;  4I7I A;  1YXW A;  1EYL A;  3UJ4 A;  1Q04 A;  1PWA A;  3BRD A;  4KC3 A;  1AVA C;  4YOL A;  3FJI A;  1NZK A;  4AN7 B;  5GAQ A;  3BTA A;  3OGG A;  2VU9 A;  4JPZ A;  21BI A;  1TOO A;  2IWT B;  4JKQ A;  1EPW A;  1IOB A;  4OUJ A;  4QAL A;  4LO7 C;  1K5V A;  1V6X A;  3WO3 A;  4ZOT A;  1JLX A;  3CA6 A;  1W3G A;  1S0D A;  3HSM A;  3JRR A;  3O4C A;  4LO7 B;  3T8S A;  5JMC A;  4HA2 A;  3N0K A;  4H04 A;  4ZKT B;  3BAG A;  1TWM A;  1F31 A;  2VSE A;  3HMY A;  3BRF A;  4F83 A;  4I2S A;  3VT2 A;  2L5X A;  3O49 A;  2NZ9 A;  5BXT A;  2ZQO A;  5F8Y A;  1FV2 A;  1JT5 A;  1AF9 A;  2NTD A;  1HWP B;  4JKX B;  2VXT I;  3NJ5 A;  2GZB A;  4X39 A;  2VLC A;  1JT4 A;  3RTJ B;  4X37 A;  2D43 A;  3BAH A;  41BI A;  3N7L A;  3ZXD A;  3CA5 A;  3BAO A;  4IQP A;  4QBV A;  4I1E A;  3WO2 A;  4EFR A;  4II0 A;  1D0H A;  3ZC9 A;  1AVW B;  4WBC A;  2WBC A;  4I4R A;  3N7J A;  4G9N A;  3NBD A;  4I3N A;  4J23 B;  3V79 C;  4I4S A;  3ILA A;  2VUA A;  1W3A A;  2NVH A;  3OBT A;  1DZD A;  3BAU A;  4EB2 B;  1SZ6 B;  1DFQ A;  5BP5 C;  4GAI A;  1XHB A;  3OBR A;  3H6R B;  4I1B A;  3ZXG A;  4ZLB B;  4OWK A;  2AAI B;  3HOM A;  4D8H A;  3BAV A;  2FFU A;  3V0A A;  4QC4 A;  5BQU A;  1S0G A;  2FO1 A;  3AZV A;  1RZO B;  1HWO B;  1WBC A;  2D44 A;  3AKI A;  3CQA A;  1V6W A;  1AXM A;  1DFC A;  1GGP B;  2R9K B;  9ILB A;  4P0J A;  3E8L C;  4G1R A;  4QD2 B;  4Q9P A;  2Q9X A;  1S0B A;  4OEE A;  3V0B A;  2KI4 A;  2HW9 A;  3MAL A;  3B9U A;  4KBB A;  3A07 A;  1FMM S;  3VUO A;  3WMU A;  1I1B A;  3UD9 A;  4USO A;  3PG0 A;  2ESU A;  4FVV A;  1BFC A;  5FNW A;  1FMZ A;  4JQ0 A;  5EC5 A;  4ISR A;  4J2K A;  3BRG C;  4I8M A;  1DZC A;  4I4P A;  4XFT A;  2BEB A;  4KEJ A;  4R6U B;  2Y9G A;  4ZA3 B;  2D7R A;  1HWM B;  5HPZ A;  1AFC A;  1IT0 A;  2QYI B;  2P23 A;  4IYB A;  3UDA A;  3AH2 A;  1BFF A;  3FUO A;  5F8S A;  3NBE A;  5EHA A;  4QKS A;  1M2T B;  1BLD A;  5B2H A;  4Z9W B;  1NUN A;  3R4U A;  1UPS A;  1ISZ A;  3IM7 A;  3FJH A;  3RMY A;  5BQU C;  3N7M A;  1Q1U A;  4GP3 A;  1EVT A;  3WO4 A;  1DQG A;  1G9B A;  4ZBV B;  3BX1 C;  1G9A A;  1JTC A;  1WD4 A;  1S0C A;  3TC2 A;  1Z0H A;  3S8J A;  5FZZ A;  3O4B A;  4D0Z A;  2P39 A;  2MIB A;  4JP0 A;  3SNV A;  5G00 A;  1XG6 A;  3V0B B;  3CU1 B;  5I1B A;  4KEI A;  4EFP A;  4LO8 B;  4L4I A;  1BAR A;  2HWM A;  1JT7 A;  2BEA A;  4EFQ A;  3AZW A;  2J3P A;  3OJM A;  3IAG C;  5F8W A;  3I29 B;  2D20 A;  3F62 B;  1HKN A;  3BA4 A;  1TWE A;  4G6M A;  2Z48 A;  4IY9 A;  3VT1 A;  1ONK B;  4ZFU B;  1ISW A;  2KH2 A;  1DIW A;  2BFH A;  2Y9W C;  4P0L A;  3Q7X A;  1FWV A;  1FN0 A;  2Y9F A;  1ITB A;  1RML A;  2K8R A;  2DRY A;  1OQL B;  4I4V A;  3CRH A;  2UUS A;  4QO3 A;  4DEN A;  2ZQN A;  4P6A A;  3AJ6 A;  5BXP A;  4LO2 A;  3OJV A;  3IM6 A;  5D62 A;  1TFM B;  1L2H A;  1E0O A;  1R8O A;  1W3F A;  1HCD A;  3FJ9 A;  3IM5 A;  2MLL B;  1K5U A;  2F2F A;  4EEE B;  4J2S A;  2VXR A;  3CA0 A;  4JRA A;  3HAL A;  3ZX7 A;  3O4O A; 
#chains in the Genus database with same CATH topology
 4LO3 A;  2NYY A;  1CE7 B;  31BI A;  1Z4S A;  4GP0 A;  2AXM A;  4USP A;  1IHK A;  5JLV A;  1R8N A;  2FGF A;  2K43 A;  1S0E A;  2K4A B;  3VEQ A;  1T4Q A;  4J2X A;  4I4Q A;  1DQO A;  3HN1 A;  3MPP G;  5DUY A;  3Q7W A;  4LO1 A;  3FJ8 A;  3Q7Y A;  1I1E A;  2XOA A;  5E24 E;  4I4U A;  2KI6 B;  4L4H A;  2DRE A;  2AQZ A;  1MC9 A;  2X2T A;  1J0S A;  4END A;  4ION A;  4Q91 A;  3K1X A;  4KEK A;  1V6U A;  3AH1 A;  4IZX A;  5D61 A;  5EG6 C;  4UY4 A;  2WRY A;  1T9F A;  1IJT A;  1FV3 A;  3FGM A;  4LO2 C;  1FQ9 A;  3BB2 A;  4OWL A;  3W9T A;  2NS2 A;  4I4O A;  1ISY A;  1YBI A;  3A22 A;  1AVU A;  3F1R A;  1N4K A;  1PUU B;  4IY8 A;  1PZZ A;  4CJM A;  3VSZ A;  1RY7 A;  4J2Y A;  1V6V A;  3VT0 A;  2E4M A;  3PUB A;  4I96 A;  2X2S A;  3CRG A;  2RQ9 A;  1YTO A;  4HR6 C;  1SR4 A;  4LO3 C;  4ZGR B;  2ERM A;  1HIB A;  5F90 A;  3PME A;  1G9D A;  1HCE A;  1M16 A;  3FJD A;  2KKI A;  4I0Y A;  2D22 A;  1ISV A;  4LO1 C;  3V0A B;  2RG9 B;  1BLA A;  1ABR B;  2DRZ A;  3OJ2 A;  4OEF A;  3AJ5 A;  3HBW A;  3AKG A;  2I1B A;  3OGF A;  4G6J A;  4JAW A;  5BXS A;  3NBC A;  3P53 A;  3FFZ A;  3FJB A;  1QQL A;  4OWJ A;  3WMV A;  2KLL A;  3FJK A;  5BXR A;  4XFU A;  5BOW A;  3FJA A;  4XKI A;  3N7K A;  1JY0 A;  1JLY A;  2QN4 A;  1HWN B;  1RG8 A;  3QYD A;  2NM1 A;  8I1B A;  3P6J A;  1QQK A;  1VCL A;  1BFG A;  4F34 A;  3QR5 A;  3IIR A;  2Z49 A;  1YF8 B;  3UD7 A;  3FUQ A;  5BP5 A;  3H6R A;  1ISX A;  3I2A A;  3PHZ A;  2E4M C;  1TTU A;  1FWU A;  3VSF A;  2D1Z A;  4A7K A;  3WIN A;  3EF2 A;  2NP0 A;  2HZ9 A;  4I4X A;  1SR4 C;  1TIE A;  4QKR A;  3POK A;  3RSJ A;  3S8K A;  4IHZ A;  1XYF A;  1BAS A;  4GOY A;  3AKF A;  3R4S A;  4FGF A;  4ISQ A;  4X38 A;  4GAF A;  1S0L A;  3BA5 A;  1S0F A;  3LTQ A;  4G9M A;  3KMV A;  2LIQ A;  2GO2 A;  5D63 A;  4GOV A;  2VSA A;  2AFG A;  1XZZ A;  2HWA A;  4LO0 A;  5FZU A;  2MC2 A;  2YUG A;  1QXM A;  2D23 A;  4DCK C;  1EV2 A;  2LIE A;  3BA7 A;  3WA1 A;  3CAH A;  5BVP I;  3O5W B;  3RMX A;  1PUM B;  1IRA X;  3C9Z A;  2FFV A;  4D0T A;  4A7Z A;  4QBC A;  1BA7 A;  3O4A A;  1PC8 B;  4DEP A;  1DLL A;  2Y9X E;  3LLP A;  4ZFY B;  1G9C A;  2Q3N B;  3I2X A;  3NBN A;  4I6I A;  1WD3 A;  2IHO A;  1MD6 A;  3AH4 A;  3BAQ A;  1A8D A;  3FJF A;  3WIN C;  4A7Y A;  1II4 A;  1G82 A;  5DSS B;  4HJJ A;  4TLP A;  1DJS B;  3FJC A;  2DS0 A;  1P63 A;  3FJJ A;  1IRP A;  4MZH A;  6I1B A;  5FNX A;  5FZY A;  4QD2 C;  3UJ0 A;  3AKH A;  3VWC A;  4EKX B;  4XFS A;  1KNM A;  1WBA A;  4Z8S B;  4ZFW B;  2D7I A;  4IZE A;  3BAD A;  3O4D A;  4Q9G A;  5DVH A;  3CRI A;  3A21 A;  3FJE A;  1Q03 A;  1JT3 A;  3JUT A;  2F2F C;  3UD8 A;  3CA1 A;  1Z2V A;  1YYN A;  3P6I A;  4OEG A;  3H6S E;  4H75 A;  1AVX B;  4LO0 C;  4OW4 A;  3A23 A;  2ET2 A;  1CVS A;  3H6Q A;  3O44 A;  1IIL A;  1TP0 A;  4I4Y A;  3CA4 A;  4H9W A;  7I1B A;  3O3Q A;  1ILR 1;  1BFB A;  2ZR1 B;  2FDB M;  4P0K A;  2D24 A;  2F8X C;  2M49 A;  2RST A;  3ZC8 A;  3D7W B;  5DZU A;  4X3A A;  4I37 A;  3RTI B;  4PC4 A;  3CA3 A;  4AN6 A;  1FGA A;  1JQZ A;  4I7I A;  1YXW A;  1EYL A;  3UJ4 A;  1Q04 A;  1PWA A;  3BRD A;  4KC3 A;  1AVA C;  4YOL A;  3FJI A;  1NZK A;  4AN7 B;  5GAQ A;  3BTA A;  3OGG A;  2VU9 A;  4JPZ A;  21BI A;  1TOO A;  2IWT B;  4JKQ A;  1EPW A;  1IOB A;  4OUJ A;  4QAL A;  4LO7 C;  1K5V A;  1V6X A;  3WO3 A;  4ZOT A;  1JLX A;  3CA6 A;  1W3G A;  1S0D A;  3HSM A;  3JRR A;  3O4C A;  4LO7 B;  3T8S A;  5JMC A;  4HA2 A;  3N0K A;  4H04 A;  4ZKT B;  3BAG A;  1TWM A;  1F31 A;  2VSE A;  3HMY A;  3BRF A;  4F83 A;  4I2S A;  3VT2 A;  2L5X A;  3O49 A;  2NZ9 A;  5BXT A;  2ZQO A;  5F8Y A;  1FV2 A;  1JT5 A;  1AF9 A;  2NTD A;  1HWP B;  4JKX B;  2VXT I;  3NJ5 A;  2GZB A;  4X39 A;  2VLC A;  1JT4 A;  3RTJ B;  4X37 A;  2D43 A;  3BAH A;  41BI A;  3N7L A;  3ZXD A;  3CA5 A;  3BAO A;  4IQP A;  4QBV A;  4I1E A;  3WO2 A;  4EFR A;  4II0 A;  1D0H A;  3ZC9 A;  1AVW B;  4WBC A;  2WBC A;  4I4R A;  3N7J A;  4G9N A;  3NBD A;  4I3N A;  4J23 B;  3V79 C;  4I4S A;  3ILA A;  2VUA A;  1W3A A;  2NVH A;  3OBT A;  1DZD A;  3BAU A;  4EB2 B;  1SZ6 B;  1DFQ A;  5BP5 C;  4GAI A;  1XHB A;  3OBR A;  3H6R B;  4I1B A;  3ZXG A;  4ZLB B;  4OWK A;  2AAI B;  3HOM A;  4D8H A;  3BAV A;  4MZF B;  2FFU A;  3V0A A;  4QC4 A;  5BQU A;  1S0G A;  2FO1 A;  3AZV A;  1RZO B;  1HWO B;  1WBC A;  2D44 A;  3AKI A;  3CQA A;  1V6W A;  1AXM A;  1DFC A;  1GGP B;  2R9K B;  9ILB A;  4P0J A;  3E8L C;  4G1R A;  4QD2 B;  4Q9P A;  2Q9X A;  1S0B A;  4OEE A;  3V0B A;  2KI4 A;  2HW9 A;  3MAL A;  3B9U A;  4KBB A;  3A07 A;  1FMM S;  3VUO A;  3WMU A;  1I1B A;  3UD9 A;  4USO A;  3PG0 A;  2ESU A;  4FVV A;  1BFC A;  5FNW A;  1FMZ A;  4JQ0 A;  5EC5 A;  4ISR A;  4J2K A;  3BRG C;  4I8M A;  1DZC A;  4I4P A;  4XFT A;  2BEB A;  4KEJ A;  4R6U B;  2Y9G A;  4ZA3 B;  2D7R A;  1HWM B;  5HPZ A;  1AFC A;  1IT0 A;  2QYI B;  2P23 A;  4IYB A;  3UDA A;  3AH2 A;  1BFF A;  3FUO A;  5F8S A;  3NBE A;  5EHA A;  4QKS A;  1M2T B;  1BLD A;  5B2H A;  4Z9W B;  1NUN A;  3R4U A;  1UPS A;  1ISZ A;  3IM7 A;  3FJH A;  3RMY A;  5BQU C;  3N7M A;  1Q1U A;  4GP3 A;  1EVT A;  3WO4 A;  1DQG A;  1G9B A;  4ZBV B;  3BX1 C;  1G9A A;  1JTC A;  1WD4 A;  1S0C A;  3TC2 A;  1Z0H A;  3S8J A;  5FZZ A;  3O4B A;  4D0Z A;  2P39 A;  2MIB A;  4JP0 A;  3SNV A;  5G00 A;  1XG6 A;  3V0B B;  3CU1 B;  5I1B A;  4KEI A;  4EFP A;  4LO8 B;  4L4I A;  1BAR A;  2HWM A;  1JT7 A;  2BEA A;  4EFQ A;  3AZW A;  2J3P A;  3OJM A;  3IAG C;  5F8W A;  3I29 B;  2D20 A;  3F62 B;  1HKN A;  3BA4 A;  1TWE A;  4G6M A;  2Z48 A;  4IY9 A;  3VT1 A;  1ONK B;  4ZFU B;  1ISW A;  2KH2 A;  1DIW A;  2BFH A;  2Y9W C;  4P0L A;  3Q7X A;  1FWV A;  1FN0 A;  4MZG B;  2Y9F A;  1ITB A;  1RML A;  2K8R A;  2DRY A;  1OQL B;  4I4V A;  3CRH A;  2UUS A;  4QO3 A;  4DEN A;  2ZQN A;  4P6A A;  3AJ6 A;  5BXP A;  4LO2 A;  3OJV A;  3IM6 A;  5D62 A;  1TFM B;  1L2H A;  1E0O A;  1R8O A;  1W3F A;  1HCD A;  3FJ9 A;  3IM5 A;  2MLL B;  1K5U A;  2F2F A;  4EEE B;  4J2S A;  2VXR A;  3CA0 A;  4JRA A;  3HAL A;  3ZX7 A;  3O4O A; 
#chains in the Genus database with same CATH homology
 4LO3 A;  2NYY A;  1CE7 B;  31BI A;  1Z4S A;  4GP0 A;  2AXM A;  4USP A;  1IHK A;  5JLV A;  1R8N A;  2FGF A;  2K43 A;  1S0E A;  2K4A B;  3VEQ A;  1T4Q A;  4J2X A;  4I4Q A;  1DQO A;  3HN1 A;  3MPP G;  5DUY A;  3Q7W A;  4LO1 A;  3FJ8 A;  3Q7Y A;  1I1E A;  2XOA A;  5E24 E;  4I4U A;  2KI6 B;  4L4H A;  2DRE A;  2AQZ A;  1MC9 A;  2X2T A;  1J0S A;  4END A;  4ION A;  4Q91 A;  3K1X A;  4KEK A;  1V6U A;  3AH1 A;  4IZX A;  5D61 A;  5EG6 C;  4UY4 A;  2WRY A;  1T9F A;  1IJT A;  1FV3 A;  3FGM A;  4LO2 C;  1FQ9 A;  3BB2 A;  4OWL A;  3W9T A;  2NS2 A;  4I4O A;  1ISY A;  1YBI A;  3A22 A;  1AVU A;  3F1R A;  1N4K A;  1PUU B;  4IY8 A;  1PZZ A;  4CJM A;  3VSZ A;  1RY7 A;  4J2Y A;  1V6V A;  3VT0 A;  2E4M A;  3PUB A;  4I96 A;  2X2S A;  3CRG A;  2RQ9 A;  1YTO A;  4HR6 C;  1SR4 A;  4LO3 C;  4ZGR B;  2ERM A;  1HIB A;  5F90 A;  3PME A;  1G9D A;  1HCE A;  1M16 A;  3FJD A;  2KKI A;  4I0Y A;  2D22 A;  1ISV A;  4LO1 C;  3V0A B;  2RG9 B;  1BLA A;  1ABR B;  2DRZ A;  3OJ2 A;  4OEF A;  3AJ5 A;  3HBW A;  3AKG A;  2I1B A;  3OGF A;  4G6J A;  4JAW A;  5BXS A;  3NBC A;  3P53 A;  3FFZ A;  3FJB A;  1QQL A;  4OWJ A;  3WMV A;  2KLL A;  3FJK A;  5BXR A;  4XFU A;  5BOW A;  3FJA A;  4XKI A;  3N7K A;  1JY0 A;  1JLY A;  2QN4 A;  1HWN B;  1RG8 A;  3QYD A;  2NM1 A;  8I1B A;  3P6J A;  1QQK A;  1VCL A;  1BFG A;  4F34 A;  3QR5 A;  3IIR A;  2Z49 A;  1YF8 B;  3UD7 A;  3FUQ A;  5BP5 A;  3H6R A;  1ISX A;  3I2A A;  3PHZ A;  2E4M C;  1TTU A;  1FWU A;  3VSF A;  2D1Z A;  4A7K A;  3WIN A;  3EF2 A;  2NP0 A;  2HZ9 A;  4I4X A;  1SR4 C;  1TIE A;  4QKR A;  3POK A;  3RSJ A;  3S8K A;  4IHZ A;  1XYF A;  1BAS A;  4GOY A;  3AKF A;  3R4S A;  4FGF A;  4ISQ A;  4X38 A;  4GAF A;  1S0L A;  3BA5 A;  1S0F A;  3LTQ A;  4G9M A;  3KMV A;  2LIQ A;  2GO2 A;  5D63 A;  4GOV A;  2VSA A;  2AFG A;  1XZZ A;  2HWA A;  4LO0 A;  5FZU A;  2MC2 A;  2YUG A;  1QXM A;  2D23 A;  4DCK C;  1EV2 A;  2LIE A;  3BA7 A;  3WA1 A;  3CAH A;  5BVP I;  3O5W B;  3RMX A;  1PUM B;  1IRA X;  3C9Z A;  2FFV A;  4D0T A;  4A7Z A;  4QBC A;  1BA7 A;  3O4A A;  1PC8 B;  4DEP A;  1DLL A;  2Y9X E;  3LLP A;  4ZFY B;  1G9C A;  2Q3N B;  3I2X A;  3NBN A;  4I6I A;  1WD3 A;  2IHO A;  1MD6 A;  3AH4 A;  3BAQ A;  1A8D A;  3FJF A;  3WIN C;  4A7Y A;  1II4 A;  1G82 A;  5DSS B;  4HJJ A;  4TLP A;  1DJS B;  3FJC A;  2DS0 A;  1P63 A;  3FJJ A;  1IRP A;  4MZH A;  6I1B A;  5FNX A;  5FZY A;  4QD2 C;  3UJ0 A;  3AKH A;  3VWC A;  4EKX B;  4XFS A;  1KNM A;  1WBA A;  4Z8S B;  4ZFW B;  2D7I A;  4IZE A;  3BAD A;  3O4D A;  4Q9G A;  5DVH A;  3CRI A;  3A21 A;  3FJE A;  1Q03 A;  1JT3 A;  3JUT A;  2F2F C;  3UD8 A;  3CA1 A;  1Z2V A;  1YYN A;  3P6I A;  4OEG A;  3H6S E;  4H75 A;  1AVX B;  4LO0 C;  4OW4 A;  3A23 A;  2ET2 A;  1CVS A;  3H6Q A;  3O44 A;  1IIL A;  1TP0 A;  4I4Y A;  3CA4 A;  4H9W A;  7I1B A;  3O3Q A;  1ILR 1;  1BFB A;  2ZR1 B;  2FDB M;  4P0K A;  2D24 A;  2F8X C;  2M49 A;  2RST A;  3ZC8 A;  3D7W B;  5DZU A;  4X3A A;  4I37 A;  3RTI B;  4PC4 A;  3CA3 A;  4AN6 A;  1FGA A;  1JQZ A;  4I7I A;  1YXW A;  1EYL A;  3UJ4 A;  1Q04 A;  1PWA A;  3BRD A;  4KC3 A;  1AVA C;  4YOL A;  3FJI A;  1NZK A;  4AN7 B;  5GAQ A;  3BTA A;  3OGG A;  2VU9 A;  4JPZ A;  21BI A;  1TOO A;  2IWT B;  4JKQ A;  1EPW A;  1IOB A;  4OUJ A;  4QAL A;  4LO7 C;  1K5V A;  1V6X A;  3WO3 A;  4ZOT A;  1JLX A;  3CA6 A;  1W3G A;  1S0D A;  3HSM A;  3JRR A;  3O4C A;  4LO7 B;  3T8S A;  5JMC A;  4HA2 A;  3N0K A;  4H04 A;  4ZKT B;  3BAG A;  1TWM A;  1F31 A;  2VSE A;  3HMY A;  3BRF A;  4F83 A;  4I2S A;  3VT2 A;  2L5X A;  3O49 A;  2NZ9 A;  5BXT A;  2ZQO A;  5F8Y A;  1FV2 A;  1JT5 A;  1AF9 A;  2NTD A;  1HWP B;  4JKX B;  2VXT I;  3NJ5 A;  2GZB A;  4X39 A;  2VLC A;  1JT4 A;  3RTJ B;  4X37 A;  2D43 A;  3BAH A;  41BI A;  3N7L A;  3ZXD A;  3CA5 A;  3BAO A;  4IQP A;  4QBV A;  4I1E A;  3WO2 A;  4EFR A;  4II0 A;  1D0H A;  3ZC9 A;  1AVW B;  4WBC A;  2WBC A;  4I4R A;  3N7J A;  4G9N A;  3NBD A;  4I3N A;  4J23 B;  3V79 C;  4I4S A;  3ILA A;  2VUA A;  1W3A A;  2NVH A;  3OBT A;  1DZD A;  3BAU A;  4EB2 B;  1SZ6 B;  1DFQ A;  5BP5 C;  4GAI A;  1XHB A;  3OBR A;  3H6R B;  4I1B A;  3ZXG A;  4ZLB B;  4OWK A;  2AAI B;  3HOM A;  4D8H A;  3BAV A;  4MZF B;  2FFU A;  3V0A A;  4QC4 A;  5BQU A;  1S0G A;  2FO1 A;  3AZV A;  1RZO B;  1HWO B;  1WBC A;  2D44 A;  3AKI A;  3CQA A;  1V6W A;  1AXM A;  1DFC A;  1GGP B;  2R9K B;  9ILB A;  4P0J A;  3E8L C;  4G1R A;  4QD2 B;  4Q9P A;  2Q9X A;  1S0B A;  4OEE A;  3V0B A;  2KI4 A;  2HW9 A;  3MAL A;  3B9U A;  4KBB A;  3A07 A;  1FMM S;  3VUO A;  3WMU A;  1I1B A;  3UD9 A;  4USO A;  3PG0 A;  2ESU A;  4FVV A;  1BFC A;  5FNW A;  1FMZ A;  4JQ0 A;  5EC5 A;  4ISR A;  4J2K A;  3BRG C;  4I8M A;  1DZC A;  4I4P A;  4XFT A;  2BEB A;  4KEJ A;  4R6U B;  2Y9G A;  4ZA3 B;  2D7R A;  1HWM B;  5HPZ A;  1AFC A;  1IT0 A;  2QYI B;  2P23 A;  4IYB A;  3UDA A;  3AH2 A;  1BFF A;  3FUO A;  5F8S A;  3NBE A;  5EHA A;  4QKS A;  1M2T B;  1BLD A;  5B2H A;  4Z9W B;  1NUN A;  3R4U A;  1UPS A;  1ISZ A;  3IM7 A;  3FJH A;  3RMY A;  5BQU C;  3N7M A;  1Q1U A;  4GP3 A;  1EVT A;  3WO4 A;  1DQG A;  1G9B A;  4ZBV B;  3BX1 C;  1G9A A;  1JTC A;  1WD4 A;  1S0C A;  3TC2 A;  1Z0H A;  3S8J A;  5FZZ A;  3O4B A;  4D0Z A;  2P39 A;  2MIB A;  4JP0 A;  3SNV A;  5G00 A;  1XG6 A;  3V0B B;  3CU1 B;  5I1B A;  4KEI A;  4EFP A;  4LO8 B;  4L4I A;  1BAR A;  2HWM A;  1JT7 A;  2BEA A;  4EFQ A;  3AZW A;  2J3P A;  3OJM A;  3IAG C;  5F8W A;  3I29 B;  2D20 A;  3F62 B;  1HKN A;  3BA4 A;  1TWE A;  4G6M A;  2Z48 A;  4IY9 A;  3VT1 A;  1ONK B;  4ZFU B;  1ISW A;  2KH2 A;  1DIW A;  2BFH A;  2Y9W C;  4P0L A;  3Q7X A;  1FWV A;  1FN0 A;  4MZG B;  2Y9F A;  1ITB A;  1RML A;  2K8R A;  2DRY A;  1OQL B;  4I4V A;  3CRH A;  2UUS A;  4QO3 A;  4DEN A;  2ZQN A;  4P6A A;  3AJ6 A;  5BXP A;  4LO2 A;  3OJV A;  3IM6 A;  5D62 A;  1TFM B;  1L2H A;  1E0O A;  1R8O A;  1W3F A;  1HCD A;  3FJ9 A;  3IM5 A;  2MLL B;  1K5U A;  2F2F A;  4EEE B;  4J2S A;  2VXR A;  3CA0 A;  4JRA A;  3HAL A;  3ZX7 A;  3O4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...