3OJVA

Crystal structure of fgf1 complexed with the ectodomain of fgfr1c exhibiting an ordered ligand specificity-determining betac'-betae loop
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
133
structure length
133
Chain Sequence
GNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title Plasticity in Interactions of Fibroblast Growth Factor 1 (FGF1) N Terminus with FGF Receptors Underlies Promiscuity of FGF1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/signaling protein
total genus 33
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3ojvA00
5B2HA 2WRYA 1FMMS 2RSTA 4GAFA 4GP3A 4II0A 1TWMA 1RMLA 1G9BA 1XG6A 3FJAA 4A7KA 2E4MC 2BFHA 1IOBA 2Q9XA 1SR4A 1S0CA 4LO1A 4A7ZA 1KNMA 3UD7A 3AH1A 2X2SA 1ITBA 1AXMA 2D7IA 4HR6C 4EB2B 1S0EA 1V6VA 3BRGC 2NM1A 1T4QA 1VCLA 3BA7A 4ZFYB 4I4OA 3OBTA 1S0BA 4IHZA 5FZYA 4OUJA 2LIQA 4ZOTA 2Y9FA 1DQGA 2QYIB 1TP0A 1EV2A 1XYFA 1Q1UA 3POKA 3VT1A 1G9CA 1DZCA 4I4XA 1FWUA 4DCKC 3VWCA 5F8YA 3ZXDA 1EPWA 2ZQOA 5BXTA 1ISZA 5EG6C 3I2XA 1N4KA 3FJBA 3Q7YA 2VXTI 3E8LC 2VXRA 1FMZA 2KLLA 5F90A 3W9TA 3S8KA 3A21A 4EKXB 5I1BA 4X38A 2MC2A 3BAUA 1NUNA 4P0LA 1BFGA 4GAIA 6I1BA 1S0FA 3BAQA 2ZQNA 1PUMB 3WMUA 3AJ5A 4FGFA 4USPA 3HN1A 3RSJA 4OWJA 4I4PA 1TFMB 3QR5A 1W3AA 1FV3A 4KBBA 4ZBVB 5D63A 1W3FA 3ZC9A 4I1BA 1RZOB 1TTUA 4I4SA 1BFBA 3PUBA 3QYDA 1WD3A 4AN7B 2KKIA 4G1RA 4IQPA 3AH4A 3ZXGA 5BOWA 4EFPA 4I0YA 3HSMA 2HWMA 5EC5A 1TWEA 2L5XA 1HCDA 3I2AA 3O44A 3RTJB 4G9NA 1DJSB 2D22A 4QC4A 1XHBA 3HALA 2D43A 3BRFA 4JRAA 2KI6B 1G9AA 1FGAA 2NP0A 4X3AA 5D62A 1WBAA 3OGFA 1Z4SA 2DRZA 3O4OA 3HBWA 1AVAC 2NYYA 3ZX7A 3CU1B 3CA5A 1G9DA 5G00A 2D7RA 3NBCA 4WBCA 3FJFA 2I1BA 1Z0HA 4LO0A 4JP0A 1JT4A 1IILA 4LO7C 41BIA 5FNWA 1F31A 4KEIA 2K43A 4YOLA 3A07A 5BXSA 1JT3A 4GP0A 1I1EA 2D1ZA 1A8DA 3RTIB 2DREA 3VSZA 4P6AA 4ENDA 3A22A 1G82A 3ILAA 4I96A 3LTQA 3UD9A 1S0DA 3AZVA 3EF2A 4QKSA 2GO2A 4I2SA 3NBNA 1RY7A 5BP5C 1BFFA 2K8RA 4JQ0A 4ZLBB 4G9MA 1YXWA 3PG0A 2F8XC 1I1BA 2Z48A 3BAOA 2Y9WC 1EYLA 4PC4A 1S0GA 3BRDA 4CJMA 4LO3A 5BQUA 2HZ9A 3OJVA 3VT0A 3IAGC 1M2TB 3AKIA 2D20A 3N7JA 3WINA 5BXRA 1HKNA 1K5VA 2D23A 3LLPA 2VSEA 4J2SA 5DZUA 2IWTB 1PWAA 5D61A 2NVHA 1QQKA 1WBCA 4HA2A 3CA3A 2DS0A 3IIRA 5HPZA 1K5UA 1WD4A 3BAHA 4EEEB 2E4MA 2KI4A 1ISYA 4JAWA 4OEGA 3FUQA 4LO2C 1DFQA 4I3NA 4XFTA 3CRIA 2FDBM 3N7MA 2MLLB 1QQLA 3UJ0A 3S8JA 4ISQA 3BADA 1AF9A 4J23B 3UD8A 4DENA 1MD6A 1ISVA 3FJKA 2ZR1B 2F2FC 3N0KA 3WO4A 4GOYA 4XFUA 2D44A 1DZDA 2DRYA 4ZGRB 4I1EA 3AJ6A 4D0ZA 2FFVA 4DEPA 1BLDA 3HMYA 5JLVA 4ZA3B 3IM5A 2HW9A 4I4UA 1BA7A 5FNXA 3R4SA 4J2KA 5E24E 2BEAA 2WBCA 1FN0A 4USOA 8I1BA 2FGFA 3Q7XA 1SZ6B 1Q03A 1EVTA 3H6SE 1GGPB 1UPSA 3WO2A 1DFCA 7I1BA 3PMEA 3CA4A 4P0KA 3BA4A 4KEKA 3H6RA 5DVHA 2Q3NB 3A23A 3V79C 4QBVA 5BXPA 3FJDA 4I4YA 4ZKTB 4JKXB 31BIA 4IY8A 4IONA 4IY9A 4J2XA 4Q91A 4EFQA 3HOMA 2RQ9A 3BX1C 2QN4A 1TIEA 4P0JA 4OWLA 1JT5A 3CRHA 4Z9WB 3WO3A 1BFCA 1OQLB 4L4HA 2P39A 3CRGA 4R6UB 3FUOA 3V0AA 4JPZA 1V6XA 3F1RA 2BEBA 2P23A 3O4AA 3VEQA 3K1XA 2GZBA 2AXMA 3BAVA 1J0SA 3BAGA 3BTAA 2AAIB 3B9UA 4I37A 1YTOA 3Q7WA 4X39A 4QD2B 3MALA 2Y9GA 2Z49A 1S0LA 3P6JA 3KMVA 1XZZA 1BASA 3WA1A 1NZKA 3R4UA 1IHKA 3H6QA 3P53A 5F8SA 3VT2A 1SR4C 4I7IA 1D0HA 4LO1C 1Q04A 1AVXB 2IHOA 4Q9GA 3FJJA 3O4CA 1PC8B 4EFRA 3RMXA 1IRAX 1IRPA 4OEFA 1AVWB 2XOAA 4KC3A 3N7LA 3NBDA 3V0BA 4I4RA 2ESUA 4QBCA 4I6IA 1ABRB 4F34A 5BP5A 2Y9XE 3FFZA 1JQZA 4G6MA 1JTCA 1V6WA 3OJ2A 1AVUA 1MC9A 4OW4A 1DIWA 1PZZA 3SNVA 3OBRA 1YF8B 3RMYA 2VU9A 3TC2A 2NTDA 4G6JA 3WMVA 1JY0A 2MIBA 4I8MA 1FQ9A 4D0TA 3MPPG 5EHAA 3NBEA 1BLAA 1JT7A 1FWVA 1T9FA 3CAHA 5JMCA 2X2TA 3VSFA 1HCEA 3H6RB 1ONKB 3P6IA 3UDAA 4QO3A 3FJCA 1HWOB 4HJJA 2VUAA 4XFSA 1DLLA 2RG9B 3I29B 2VSAA 3O4DA 5DUYA 2J3PA 2FFUA 4QKRA 5FZUA 4IZEA 4D8HA 3CA6A 2AQZA 4FVVA 1CE7B 3BA5A 4JKQA 4LO2A 3JRRA 2FO1A 4H04A 1HIBA 1M16A 9ILBA 1JLXA 3AKFA 4ISRA 3FJIA 3IM6A 3O5WB 5BVPI 2F2FA 3CA0A 2ET2A 3OGGA 1HWMB 2NZ9A 4I4VA 3ZC8A 3V0AB 1ISWA 3JUTA 2YUGA 1PUUB 3O4BA 1BARA 3UJ4A 3F62B 5DSSB 2K4AB 4AN6A 3D7WB 3AKHA 4L4IA 1YYNA 21BIA 1TOOA 4TLPA 3FJHA 3OJMA 1QXMA 3C9ZA 1II4A 3BB2A 5FZZA 4IYBA 4XKIA 4LO0C 1ILR1 1YBIA 1V6UA 4GOVA 1FV2A 1JLYA 1R8NA 1IJTA 3IM7A 1W3GA 3FJ8A 1Z2VA 3FJ9A 3N7KA 3AKGA 4LO7B 1E0OA 1R8OA 1RG8A 4H9WA 2UUSA 4KEJA 4Q9PA 4I4QA 1AFCA 2D24A 3O3QA 4ZFUB 1L2HA 1HWNB 4IZXA 3V0BB 2LIEA 1IT0A 5GAQA 4Z8SB 3CQAA 4LO8B 1CVSA 1HWPB 4ZFWB 3FJEA 4A7YA 2AFGA 3FGMA 4J2YA 5F8WA 1P63A 4LO3C 5BQUC 4F83A 3AH2A 3O49A 2HWAA 2R9KB 2VLCA 3CA1A 3AZWA 4OWKA 1DQOA 3WINC 2KH2A 2M49A 3T8SA 3NJ5A 3VUOA 3PHZA 4QALA 4X37A 4OEEA 4QD2C 1ISXA 2ERMA
chains in the Genus database with same CATH superfamily
5B2HA 2WRYA 1FMMS 2RSTA 4GAFA 4GP3A 4II0A 1TWMA 1RMLA 1G9BA 1XG6A 3FJAA 4A7KA 2E4MC 2BFHA 1IOBA 2Q9XA 1SR4A 1S0CA 4LO1A 4A7ZA 1KNMA 3UD7A 3AH1A 2X2SA 1ITBA 1AXMA 2D7IA 4HR6C 4EB2B 1S0EA 1V6VA 3BRGC 2NM1A 1T4QA 1VCLA 3BA7A 4ZFYB 4I4OA 3OBTA 1S0BA 4IHZA 5FZYA 4MZFB 4OUJA 2LIQA 4ZOTA 2Y9FA 1DQGA 2QYIB 1TP0A 1EV2A 1XYFA 1Q1UA 3POKA 3VT1A 1G9CA 1DZCA 4I4XA 1FWUA 4DCKC 3VWCA 5F8YA 3ZXDA 1EPWA 2ZQOA 5BXTA 1ISZA 5EG6C 3I2XA 1N4KA 3FJBA 3Q7YA 2VXTI 3E8LC 2VXRA 1FMZA 2KLLA 5F90A 3W9TA 3S8KA 3A21A 4EKXB 5I1BA 4X38A 2MC2A 3BAUA 1NUNA 4P0LA 1BFGA 4GAIA 6I1BA 1S0FA 3BAQA 2ZQNA 1PUMB 3WMUA 3AJ5A 4FGFA 4USPA 3HN1A 3RSJA 4OWJA 4I4PA 1TFMB 3QR5A 1W3AA 1FV3A 4KBBA 4ZBVB 5D63A 1W3FA 3ZC9A 4I1BA 1RZOB 1TTUA 4I4SA 1BFBA 3PUBA 3QYDA 1WD3A 4AN7B 2KKIA 4G1RA 4IQPA 3AH4A 3ZXGA 5BOWA 4EFPA 4I0YA 3HSMA 2HWMA 5EC5A 1TWEA 2L5XA 1HCDA 3I2AA 3O44A 3RTJB 4G9NA 1DJSB 2D22A 4QC4A 1XHBA 3HALA 2D43A 3BRFA 4JRAA 2NS2A 2KI6B 1G9AA 1FGAA 2NP0A 4X3AA 5D62A 1WBAA 3OGFA 1Z4SA 2DRZA 3O4OA 3HBWA 1AVAC 2NYYA 3ZX7A 3CU1B 3CA5A 1G9DA 5G00A 2D7RA 3NBCA 4WBCA 3FJFA 2I1BA 1Z0HA 4LO0A 4JP0A 1JT4A 1IILA 4LO7C 41BIA 5FNWA 1F31A 4KEIA 2K43A 4YOLA 3A07A 5BXSA 1JT3A 4GP0A 1I1EA 2D1ZA 1A8DA 3RTIB 2DREA 3VSZA 4P6AA 4ENDA 3A22A 1G82A 3ILAA 4I96A 3LTQA 3UD9A 1S0DA 3AZVA 3EF2A 4QKSA 2GO2A 4I2SA 3NBNA 1RY7A 5BP5C 1BFFA 2K8RA 4JQ0A 4ZLBB 4G9MA 1YXWA 3PG0A 2F8XC 1I1BA 2Z48A 3BAOA 2Y9WC 1EYLA 4PC4A 1S0GA 3BRDA 4CJMA 4LO3A 5BQUA 2HZ9A 3OJVA 3VT0A 3IAGC 1M2TB 3AKIA 2D20A 3N7JA 3WINA 5BXRA 1HKNA 1K5VA 2D23A 3LLPA 2VSEA 4J2SA 5DZUA 2IWTB 1PWAA 5D61A 2NVHA 1QQKA 1WBCA 4HA2A 3CA3A 2DS0A 3IIRA 5HPZA 1K5UA 1WD4A 3BAHA 4EEEB 2E4MA 2KI4A 1ISYA 4JAWA 4OEGA 3FUQA 4LO2C 1DFQA 4I3NA 4XFTA 3CRIA 2FDBM 3N7MA 2MLLB 1QQLA 3UJ0A 3S8JA 4ISQA 3BADA 1AF9A 4J23B 4MZHA 3UD8A 4DENA 1MD6A 1ISVA 3FJKA 2ZR1B 2F2FC 3N0KA 3WO4A 4GOYA 4XFUA 2D44A 1DZDA 2DRYA 4ZGRB 4I1EA 3AJ6A 4D0ZA 2FFVA 4DEPA 1BLDA 3HMYA 5JLVA 4ZA3B 3IM5A 2HW9A 4I4UA 1BA7A 5FNXA 3R4SA 4J2KA 5E24E 2BEAA 2WBCA 1FN0A 4USOA 8I1BA 2FGFA 3Q7XA 1SZ6B 1Q03A 1EVTA 3H6SE 1GGPB 1UPSA 3WO2A 1DFCA 7I1BA 3PMEA 3CA4A 4P0KA 3BA4A 4KEKA 3H6RA 5DVHA 2Q3NB 3A23A 3V79C 4QBVA 5BXPA 3FJDA 4I4YA 4ZKTB 4JKXB 31BIA 4IY8A 4IONA 4IY9A 4J2XA 4Q91A 4EFQA 3HOMA 2RQ9A 3BX1C 2QN4A 1TIEA 4P0JA 4OWLA 1JT5A 3CRHA 4Z9WB 3WO3A 1BFCA 1OQLB 4L4HA 2P39A 3CRGA 4R6UB 3FUOA 3V0AA 4JPZA 1V6XA 3F1RA 2BEBA 4H75A 2P23A 3O4AA 4MZGB 3VEQA 3K1XA 2GZBA 2AXMA 3BAVA 1J0SA 3BAGA 3BTAA 2AAIB 3B9UA 4I37A 1YTOA 3Q7WA 4X39A 4QD2B 3MALA 2Y9GA 2Z49A 1S0LA 3P6JA 3KMVA 1XZZA 1BASA 3WA1A 1NZKA 3R4UA 1IHKA 3H6QA 3P53A 5F8SA 3VT2A 1SR4C 4I7IA 1D0HA 4LO1C 1Q04A 1AVXB 2IHOA 4Q9GA 3FJJA 3O4CA 1PC8B 4EFRA 4UY4A 3RMXA 1IRAX 1IRPA 4OEFA 1AVWB 2XOAA 4KC3A 3N7LA 3NBDA 3V0BA 4I4RA 2ESUA 4QBCA 4I6IA 1ABRB 4F34A 5BP5A 2Y9XE 3FFZA 1JQZA 4G6MA 1JTCA 1V6WA 3OJ2A 1AVUA 1MC9A 4OW4A 1DIWA 1PZZA 3SNVA 3OBRA 1YF8B 3RMYA 2VU9A 3TC2A 2NTDA 4G6JA 3WMVA 1JY0A 2MIBA 4I8MA 1FQ9A 4D0TA 3MPPG 5EHAA 3NBEA 1BLAA 1JT7A 1FWVA 1T9FA 3CAHA 5JMCA 2X2TA 3VSFA 1HCEA 3H6RB 1ONKB 3P6IA 3UDAA 4QO3A 3FJCA 1HWOB 4HJJA 2VUAA 4XFSA 1DLLA 2RG9B 3I29B 2VSAA 3O4DA 5DUYA 2J3PA 2FFUA 4QKRA 5FZUA 4IZEA 4D8HA 3CA6A 2AQZA 4FVVA 1CE7B 3BA5A 4JKQA 4LO2A 3JRRA 2FO1A 4H04A 1HIBA 1M16A 9ILBA 1JLXA 3AKFA 4ISRA 3FJIA 3IM6A 3O5WB 5BVPI 2F2FA 3CA0A 2ET2A 3OGGA 1HWMB 2NZ9A 4I4VA 3ZC8A 3V0AB 1ISWA 3JUTA 2YUGA 1PUUB 3O4BA 1BARA 3UJ4A 3F62B 5DSSB 2K4AB 4AN6A 3D7WB 3AKHA 4L4IA 1YYNA 21BIA 1TOOA 4TLPA 3FJHA 3OJMA 1QXMA 3C9ZA 1II4A 3BB2A 5FZZA 4IYBA 4XKIA 4LO0C 1ILR1 1YBIA 1V6UA 4GOVA 1FV2A 1JLYA 1R8NA 1IJTA 3IM7A 1W3GA 3FJ8A 1Z2VA 3FJ9A 3N7KA 3AKGA 4LO7B 1E0OA 1R8OA 1RG8A 4H9WA 2UUSA 4KEJA 4Q9PA 4I4QA 1AFCA 2D24A 3O3QA 4ZFUB 1L2HA 1HWNB 4IZXA 3V0BB 2LIEA 1IT0A 5GAQA 4Z8SB 3CQAA 4LO8B 1CVSA 1HWPB 4ZFWB 3FJEA 4A7YA 2AFGA 3FGMA 4J2YA 5F8WA 1P63A 4LO3C 5BQUC 4F83A 3AH2A 3O49A 2HWAA 2R9KB 2VLCA 3CA1A 3AZWA 4OWKA 1DQOA 3WINC 2KH2A 2M49A 3T8SA 3NJ5A 3VUOA 3PHZA 4QALA 4X37A 4OEEA 4QD2C 1ISXA 2ERMA
chains in the Genus database with same CATH topology
5B2HA 2WRYA 1FMMS 2RSTA 4GAFA 4GP3A 4II0A 1TWMA 1RMLA 1G9BA 1XG6A 3FJAA 4A7KA 2E4MC 2BFHA 1IOBA 2Q9XA 1SR4A 1S0CA 4LO1A 4A7ZA 1KNMA 3UD7A 3AH1A 2X2SA 1ITBA 1AXMA 2D7IA 4HR6C 4EB2B 1S0EA 1V6VA 3BRGC 2NM1A 1T4QA 1VCLA 3BA7A 4ZFYB 4I4OA 3OBTA 1S0BA 4IHZA 5FZYA 4MZFB 4OUJA 2LIQA 4ZOTA 2Y9FA 1DQGA 2QYIB 1TP0A 1EV2A 1XYFA 1Q1UA 3POKA 3VT1A 1G9CA 1DZCA 4I4XA 1FWUA 4DCKC 3VWCA 5F8YA 3ZXDA 1EPWA 2ZQOA 5BXTA 1ISZA 5EG6C 3I2XA 1N4KA 3FJBA 3Q7YA 2VXTI 3E8LC 2VXRA 1FMZA 2KLLA 5F90A 3W9TA 3S8KA 3A21A 4EKXB 5I1BA 4X38A 2MC2A 3BAUA 1NUNA 4P0LA 1BFGA 4GAIA 6I1BA 1S0FA 3BAQA 2ZQNA 1PUMB 3WMUA 3AJ5A 4FGFA 4USPA 3HN1A 3RSJA 4OWJA 4I4PA 1TFMB 3QR5A 1W3AA 1FV3A 4KBBA 4ZBVB 5D63A 1W3FA 3ZC9A 4I1BA 1RZOB 1TTUA 4I4SA 1BFBA 3PUBA 3QYDA 1WD3A 4AN7B 2KKIA 4G1RA 4IQPA 3AH4A 3ZXGA 5BOWA 4EFPA 4I0YA 3HSMA 2HWMA 5EC5A 1TWEA 2L5XA 1HCDA 3I2AA 3O44A 3RTJB 4G9NA 1DJSB 2D22A 4QC4A 1XHBA 3HALA 2D43A 3BRFA 4JRAA 2NS2A 2KI6B 1G9AA 1FGAA 2NP0A 4X3AA 5D62A 1WBAA 3OGFA 1Z4SA 2DRZA 3O4OA 3HBWA 1AVAC 2NYYA 3ZX7A 3CU1B 3CA5A 1G9DA 5G00A 2D7RA 3NBCA 4WBCA 3FJFA 2I1BA 1Z0HA 4LO0A 4JP0A 1JT4A 1IILA 4LO7C 41BIA 5FNWA 1F31A 4KEIA 2K43A 4YOLA 3A07A 5BXSA 1JT3A 4GP0A 1I1EA 2D1ZA 1A8DA 3RTIB 2DREA 3VSZA 4P6AA 4ENDA 3A22A 1G82A 3ILAA 4I96A 3LTQA 3UD9A 1S0DA 3AZVA 3EF2A 4QKSA 2GO2A 4I2SA 3NBNA 1RY7A 5BP5C 1BFFA 2K8RA 4JQ0A 4ZLBB 4G9MA 1YXWA 3PG0A 2F8XC 1I1BA 2Z48A 3BAOA 2Y9WC 1EYLA 4PC4A 1S0GA 3BRDA 4CJMA 4LO3A 5BQUA 2HZ9A 3OJVA 3VT0A 3IAGC 1M2TB 3AKIA 2D20A 3N7JA 3WINA 5BXRA 1HKNA 1K5VA 2D23A 3LLPA 2VSEA 4J2SA 5DZUA 2IWTB 1PWAA 5D61A 2NVHA 1QQKA 1WBCA 4HA2A 3CA3A 2DS0A 3IIRA 5HPZA 1K5UA 1WD4A 3BAHA 4EEEB 2E4MA 2KI4A 1ISYA 4JAWA 4OEGA 3FUQA 4LO2C 1DFQA 4I3NA 4XFTA 3CRIA 2FDBM 3N7MA 2MLLB 1QQLA 3UJ0A 3S8JA 4ISQA 3BADA 1AF9A 4J23B 4MZHA 3UD8A 4DENA 1MD6A 1ISVA 3FJKA 2ZR1B 2F2FC 3N0KA 3WO4A 4GOYA 4XFUA 2D44A 1DZDA 2DRYA 4ZGRB 4I1EA 3AJ6A 4D0ZA 2FFVA 4DEPA 1BLDA 3HMYA 5JLVA 4ZA3B 3IM5A 2HW9A 4I4UA 1BA7A 5FNXA 3R4SA 4J2KA 5E24E 2BEAA 2WBCA 1FN0A 4USOA 8I1BA 2FGFA 3Q7XA 1SZ6B 1Q03A 1EVTA 3H6SE 1GGPB 1UPSA 3WO2A 1DFCA 7I1BA 3PMEA 3CA4A 4P0KA 3BA4A 4KEKA 3H6RA 5DVHA 2Q3NB 3A23A 3V79C 4QBVA 5BXPA 3FJDA 4I4YA 4ZKTB 4JKXB 31BIA 4IY8A 4IONA 4IY9A 4J2XA 4Q91A 4EFQA 3HOMA 2RQ9A 3BX1C 2QN4A 1TIEA 4P0JA 4OWLA 1JT5A 3CRHA 4Z9WB 3WO3A 1BFCA 1OQLB 4L4HA 2P39A 3CRGA 4R6UB 3FUOA 3V0AA 4JPZA 1V6XA 3F1RA 2BEBA 4H75A 2P23A 3O4AA 4MZGB 3VEQA 3K1XA 2GZBA 2AXMA 3BAVA 1J0SA 3BAGA 3BTAA 2AAIB 3B9UA 4I37A 1YTOA 3Q7WA 4X39A 4QD2B 3MALA 2Y9GA 2Z49A 1S0LA 3P6JA 3KMVA 1XZZA 1BASA 3WA1A 1NZKA 3R4UA 1IHKA 3H6QA 3P53A 5F8SA 3VT2A 1SR4C 4I7IA 1D0HA 4LO1C 1Q04A 1AVXB 2IHOA 4Q9GA 3FJJA 3O4CA 1PC8B 4EFRA 4UY4A 3RMXA 1IRAX 1IRPA 4OEFA 1AVWB 2XOAA 4KC3A 3N7LA 3NBDA 3V0BA 4I4RA 2ESUA 4QBCA 4I6IA 1ABRB 4F34A 5BP5A 2Y9XE 3FFZA 1JQZA 4G6MA 1JTCA 1V6WA 3OJ2A 1AVUA 1MC9A 4OW4A 1DIWA 1PZZA 3SNVA 3OBRA 1YF8B 3RMYA 2VU9A 3TC2A 2NTDA 4G6JA 3WMVA 1JY0A 2MIBA 4I8MA 1FQ9A 4D0TA 3MPPG 5EHAA 3NBEA 1BLAA 1JT7A 1FWVA 1T9FA 3CAHA 5JMCA 2X2TA 3VSFA 1HCEA 3H6RB 1ONKB 3P6IA 3UDAA 4QO3A 3FJCA 1HWOB 4HJJA 2VUAA 4XFSA 1DLLA 2RG9B 3I29B 2VSAA 3O4DA 5DUYA 2J3PA 2FFUA 4QKRA 5FZUA 4IZEA 4D8HA 3CA6A 2AQZA 4FVVA 1CE7B 3BA5A 4JKQA 4LO2A 3JRRA 2FO1A 4H04A 1HIBA 1M16A 9ILBA 1JLXA 3AKFA 4ISRA 3FJIA 3IM6A 3O5WB 5BVPI 2F2FA 3CA0A 2ET2A 3OGGA 1HWMB 2NZ9A 4I4VA 3ZC8A 3V0AB 1ISWA 3JUTA 2YUGA 1PUUB 3O4BA 1BARA 3UJ4A 3F62B 5DSSB 2K4AB 4AN6A 3D7WB 3AKHA 4L4IA 1YYNA 21BIA 1TOOA 4TLPA 3FJHA 3OJMA 1QXMA 3C9ZA 1II4A 3BB2A 5FZZA 4IYBA 4XKIA 4LO0C 1ILR1 1YBIA 1V6UA 4GOVA 1FV2A 1JLYA 1R8NA 1IJTA 3IM7A 1W3GA 3FJ8A 1Z2VA 3FJ9A 3N7KA 3AKGA 4LO7B 1E0OA 1R8OA 1RG8A 4H9WA 2UUSA 4KEJA 4Q9PA 4I4QA 1AFCA 2D24A 3O3QA 4ZFUB 1L2HA 1HWNB 4IZXA 3V0BB 2LIEA 1IT0A 5GAQA 4Z8SB 3CQAA 4LO8B 1CVSA 1HWPB 4ZFWB 3FJEA 4A7YA 2AFGA 3FGMA 4J2YA 5F8WA 1P63A 4LO3C 5BQUC 4F83A 3AH2A 3O49A 2HWAA 2R9KB 2VLCA 3CA1A 3AZWA 4OWKA 1DQOA 3WINC 2KH2A 2M49A 3T8SA 3NJ5A 3VUOA 3PHZA 4QALA 4X37A 4OEEA 4QD2C 1ISXA 2ERMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B2H A;  2WRY A;  1FMM S;  2RST A;  4GAF A;  4GP3 A;  4II0 A;  1TWM A;  1RML A;  1G9B A;  1XG6 A;  3FJA A;  4A7K A;  2E4M C;  2BFH A;  1IOB A;  2Q9X A;  1SR4 A;  1S0C A;  4LO1 A;  4A7Z A;  1KNM A;  3UD7 A;  3AH1 A;  2X2S A;  1ITB A;  1AXM A;  2D7I A;  4HR6 C;  4EB2 B;  1S0E A;  1V6V A;  3BRG C;  2NM1 A;  1T4Q A;  1VCL A;  3BA7 A;  4ZFY B;  4I4O A;  3OBT A;  1S0B A;  4IHZ A;  5FZY A;  4OUJ A;  2LIQ A;  4ZOT A;  2Y9F A;  1DQG A;  2QYI B;  1TP0 A;  1EV2 A;  1XYF A;  1Q1U A;  3POK A;  3VT1 A;  1G9C A;  1DZC A;  4I4X A;  1FWU A;  4DCK C;  3VWC A;  5F8Y A;  3ZXD A;  1EPW A;  2ZQO A;  5BXT A;  1ISZ A;  5EG6 C;  3I2X A;  1N4K A;  3FJB A;  3Q7Y A;  2VXT I;  3E8L C;  2VXR A;  1FMZ A;  2KLL A;  5F90 A;  3W9T A;  3S8K A;  3A21 A;  4EKX B;  5I1B A;  4X38 A;  2MC2 A;  3BAU A;  1NUN A;  4P0L A;  1BFG A;  4GAI A;  6I1B A;  1S0F A;  3BAQ A;  2ZQN A;  1PUM B;  3WMU A;  3AJ5 A;  4FGF A;  4USP A;  3HN1 A;  3RSJ A;  4OWJ A;  4I4P A;  1TFM B;  3QR5 A;  1W3A A;  1FV3 A;  4KBB A;  4ZBV B;  5D63 A;  1W3F A;  3ZC9 A;  4I1B A;  1RZO B;  1TTU A;  4I4S A;  1BFB A;  3PUB A;  3QYD A;  1WD3 A;  4AN7 B;  2KKI A;  4G1R A;  4IQP A;  3AH4 A;  3ZXG A;  5BOW A;  4EFP A;  4I0Y A;  3HSM A;  2HWM A;  5EC5 A;  1TWE A;  2L5X A;  1HCD A;  3I2A A;  3O44 A;  3RTJ B;  4G9N A;  1DJS B;  2D22 A;  4QC4 A;  1XHB A;  3HAL A;  2D43 A;  3BRF A;  4JRA A;  2KI6 B;  1G9A A;  1FGA A;  2NP0 A;  4X3A A;  5D62 A;  1WBA A;  3OGF A;  1Z4S A;  2DRZ A;  3O4O A;  3HBW A;  1AVA C;  2NYY A;  3ZX7 A;  3CU1 B;  3CA5 A;  1G9D A;  5G00 A;  2D7R A;  3NBC A;  4WBC A;  3FJF A;  2I1B A;  1Z0H A;  4LO0 A;  4JP0 A;  1JT4 A;  1IIL A;  4LO7 C;  41BI A;  5FNW A;  1F31 A;  4KEI A;  2K43 A;  4YOL A;  3A07 A;  5BXS A;  1JT3 A;  4GP0 A;  1I1E A;  2D1Z A;  1A8D A;  3RTI B;  2DRE A;  3VSZ A;  4P6A A;  4END A;  3A22 A;  1G82 A;  3ILA A;  4I96 A;  3LTQ A;  3UD9 A;  1S0D A;  3AZV A;  3EF2 A;  4QKS A;  2GO2 A;  4I2S A;  3NBN A;  1RY7 A;  5BP5 C;  1BFF A;  2K8R A;  4JQ0 A;  4ZLB B;  4G9M A;  1YXW A;  3PG0 A;  2F8X C;  1I1B A;  2Z48 A;  3BAO A;  2Y9W C;  1EYL A;  4PC4 A;  1S0G A;  3BRD A;  4CJM A;  4LO3 A;  5BQU A;  2HZ9 A;  3OJV A;  3VT0 A;  3IAG C;  1M2T B;  3AKI A;  2D20 A;  3N7J A;  3WIN A;  5BXR A;  1HKN A;  1K5V A;  2D23 A;  3LLP A;  2VSE A;  4J2S A;  5DZU A;  2IWT B;  1PWA A;  5D61 A;  2NVH A;  1QQK A;  1WBC A;  4HA2 A;  3CA3 A;  2DS0 A;  3IIR A;  5HPZ A;  1K5U A;  1WD4 A;  3BAH A;  4EEE B;  2E4M A;  2KI4 A;  1ISY A;  4JAW A;  4OEG A;  3FUQ A;  4LO2 C;  1DFQ A;  4I3N A;  4XFT A;  3CRI A;  2FDB M;  3N7M A;  2MLL B;  1QQL A;  3UJ0 A;  3S8J A;  4ISQ A;  3BAD A;  1AF9 A;  4J23 B;  3UD8 A;  4DEN A;  1MD6 A;  1ISV A;  3FJK A;  2ZR1 B;  2F2F C;  3N0K A;  3WO4 A;  4GOY A;  4XFU A;  2D44 A;  1DZD A;  2DRY A;  4ZGR B;  4I1E A;  3AJ6 A;  4D0Z A;  2FFV A;  4DEP A;  1BLD A;  3HMY A;  5JLV A;  4ZA3 B;  3IM5 A;  2HW9 A;  4I4U A;  1BA7 A;  5FNX A;  3R4S A;  4J2K A;  5E24 E;  2BEA A;  2WBC A;  1FN0 A;  4USO A;  8I1B A;  2FGF A;  3Q7X A;  1SZ6 B;  1Q03 A;  1EVT A;  3H6S E;  1GGP B;  1UPS A;  3WO2 A;  1DFC A;  7I1B A;  3PME A;  3CA4 A;  4P0K A;  3BA4 A;  4KEK A;  3H6R A;  5DVH A;  2Q3N B;  3A23 A;  3V79 C;  4QBV A;  5BXP A;  3FJD A;  4I4Y A;  4ZKT B;  4JKX B;  31BI A;  4IY8 A;  4ION A;  4IY9 A;  4J2X A;  4Q91 A;  4EFQ A;  3HOM A;  2RQ9 A;  3BX1 C;  2QN4 A;  1TIE A;  4P0J A;  4OWL A;  1JT5 A;  3CRH A;  4Z9W B;  3WO3 A;  1BFC A;  1OQL B;  4L4H A;  2P39 A;  3CRG A;  4R6U B;  3FUO A;  3V0A A;  4JPZ A;  1V6X A;  3F1R A;  2BEB A;  2P23 A;  3O4A A;  3VEQ A;  3K1X A;  2GZB A;  2AXM A;  3BAV A;  1J0S A;  3BAG A;  3BTA A;  2AAI B;  3B9U A;  4I37 A;  1YTO A;  3Q7W A;  4X39 A;  4QD2 B;  3MAL A;  2Y9G A;  2Z49 A;  1S0L A;  3P6J A;  3KMV A;  1XZZ A;  1BAS A;  3WA1 A;  1NZK A;  3R4U A;  1IHK A;  3H6Q A;  3P53 A;  5F8S A;  3VT2 A;  1SR4 C;  4I7I A;  1D0H A;  4LO1 C;  1Q04 A;  1AVX B;  2IHO A;  4Q9G A;  3FJJ A;  3O4C A;  1PC8 B;  4EFR A;  3RMX A;  1IRA X;  1IRP A;  4OEF A;  1AVW B;  2XOA A;  4KC3 A;  3N7L A;  3NBD A;  3V0B A;  4I4R A;  2ESU A;  4QBC A;  4I6I A;  1ABR B;  4F34 A;  5BP5 A;  2Y9X E;  3FFZ A;  1JQZ A;  4G6M A;  1JTC A;  1V6W A;  3OJ2 A;  1AVU A;  1MC9 A;  4OW4 A;  1DIW A;  1PZZ A;  3SNV A;  3OBR A;  1YF8 B;  3RMY A;  2VU9 A;  3TC2 A;  2NTD A;  4G6J A;  3WMV A;  1JY0 A;  2MIB A;  4I8M A;  1FQ9 A;  4D0T A;  3MPP G;  5EHA A;  3NBE A;  1BLA A;  1JT7 A;  1FWV A;  1T9F A;  3CAH A;  5JMC A;  2X2T A;  3VSF A;  1HCE A;  3H6R B;  1ONK B;  3P6I A;  3UDA A;  4QO3 A;  3FJC A;  1HWO B;  4HJJ A;  2VUA A;  4XFS A;  1DLL A;  2RG9 B;  3I29 B;  2VSA A;  3O4D A;  5DUY A;  2J3P A;  2FFU A;  4QKR A;  5FZU A;  4IZE A;  4D8H A;  3CA6 A;  2AQZ A;  4FVV A;  1CE7 B;  3BA5 A;  4JKQ A;  4LO2 A;  3JRR A;  2FO1 A;  4H04 A;  1HIB A;  1M16 A;  9ILB A;  1JLX A;  3AKF A;  4ISR A;  3FJI A;  3IM6 A;  3O5W B;  5BVP I;  2F2F A;  3CA0 A;  2ET2 A;  3OGG A;  1HWM B;  2NZ9 A;  4I4V A;  3ZC8 A;  3V0A B;  1ISW A;  3JUT A;  2YUG A;  1PUU B;  3O4B A;  1BAR A;  3UJ4 A;  3F62 B;  5DSS B;  2K4A B;  4AN6 A;  3D7W B;  3AKH A;  4L4I A;  1YYN A;  21BI A;  1TOO A;  4TLP A;  3FJH A;  3OJM A;  1QXM A;  3C9Z A;  1II4 A;  3BB2 A;  5FZZ A;  4IYB A;  4XKI A;  4LO0 C;  1ILR 1;  1YBI A;  1V6U A;  4GOV A;  1FV2 A;  1JLY A;  1R8N A;  1IJT A;  3IM7 A;  1W3G A;  3FJ8 A;  1Z2V A;  3FJ9 A;  3N7K A;  3AKG A;  4LO7 B;  1E0O A;  1R8O A;  1RG8 A;  4H9W A;  2UUS A;  4KEJ A;  4Q9P A;  4I4Q A;  1AFC A;  2D24 A;  3O3Q A;  4ZFU B;  1L2H A;  1HWN B;  4IZX A;  3V0B B;  2LIE A;  1IT0 A;  5GAQ A;  4Z8S B;  3CQA A;  4LO8 B;  1CVS A;  1HWP B;  4ZFW B;  3FJE A;  4A7Y A;  2AFG A;  3FGM A;  4J2Y A;  5F8W A;  1P63 A;  4LO3 C;  5BQU C;  4F83 A;  3AH2 A;  3O49 A;  2HWA A;  2R9K B;  2VLC A;  3CA1 A;  3AZW A;  4OWK A;  1DQO A;  3WIN C;  2KH2 A;  2M49 A;  3T8S A;  3NJ5 A;  3VUO A;  3PHZ A;  4QAL A;  4X37 A;  4OEE A;  4QD2 C;  1ISX A;  2ERM A; 
#chains in the Genus database with same CATH topology
 5B2H A;  2WRY A;  1FMM S;  2RST A;  4GAF A;  4GP3 A;  4II0 A;  1TWM A;  1RML A;  1G9B A;  1XG6 A;  3FJA A;  4A7K A;  2E4M C;  2BFH A;  1IOB A;  2Q9X A;  1SR4 A;  1S0C A;  4LO1 A;  4A7Z A;  1KNM A;  3UD7 A;  3AH1 A;  2X2S A;  1ITB A;  1AXM A;  2D7I A;  4HR6 C;  4EB2 B;  1S0E A;  1V6V A;  3BRG C;  2NM1 A;  1T4Q A;  1VCL A;  3BA7 A;  4ZFY B;  4I4O A;  3OBT A;  1S0B A;  4IHZ A;  5FZY A;  4MZF B;  4OUJ A;  2LIQ A;  4ZOT A;  2Y9F A;  1DQG A;  2QYI B;  1TP0 A;  1EV2 A;  1XYF A;  1Q1U A;  3POK A;  3VT1 A;  1G9C A;  1DZC A;  4I4X A;  1FWU A;  4DCK C;  3VWC A;  5F8Y A;  3ZXD A;  1EPW A;  2ZQO A;  5BXT A;  1ISZ A;  5EG6 C;  3I2X A;  1N4K A;  3FJB A;  3Q7Y A;  2VXT I;  3E8L C;  2VXR A;  1FMZ A;  2KLL A;  5F90 A;  3W9T A;  3S8K A;  3A21 A;  4EKX B;  5I1B A;  4X38 A;  2MC2 A;  3BAU A;  1NUN A;  4P0L A;  1BFG A;  4GAI A;  6I1B A;  1S0F A;  3BAQ A;  2ZQN A;  1PUM B;  3WMU A;  3AJ5 A;  4FGF A;  4USP A;  3HN1 A;  3RSJ A;  4OWJ A;  4I4P A;  1TFM B;  3QR5 A;  1W3A A;  1FV3 A;  4KBB A;  4ZBV B;  5D63 A;  1W3F A;  3ZC9 A;  4I1B A;  1RZO B;  1TTU A;  4I4S A;  1BFB A;  3PUB A;  3QYD A;  1WD3 A;  4AN7 B;  2KKI A;  4G1R A;  4IQP A;  3AH4 A;  3ZXG A;  5BOW A;  4EFP A;  4I0Y A;  3HSM A;  2HWM A;  5EC5 A;  1TWE A;  2L5X A;  1HCD A;  3I2A A;  3O44 A;  3RTJ B;  4G9N A;  1DJS B;  2D22 A;  4QC4 A;  1XHB A;  3HAL A;  2D43 A;  3BRF A;  4JRA A;  2NS2 A;  2KI6 B;  1G9A A;  1FGA A;  2NP0 A;  4X3A A;  5D62 A;  1WBA A;  3OGF A;  1Z4S A;  2DRZ A;  3O4O A;  3HBW A;  1AVA C;  2NYY A;  3ZX7 A;  3CU1 B;  3CA5 A;  1G9D A;  5G00 A;  2D7R A;  3NBC A;  4WBC A;  3FJF A;  2I1B A;  1Z0H A;  4LO0 A;  4JP0 A;  1JT4 A;  1IIL A;  4LO7 C;  41BI A;  5FNW A;  1F31 A;  4KEI A;  2K43 A;  4YOL A;  3A07 A;  5BXS A;  1JT3 A;  4GP0 A;  1I1E A;  2D1Z A;  1A8D A;  3RTI B;  2DRE A;  3VSZ A;  4P6A A;  4END A;  3A22 A;  1G82 A;  3ILA A;  4I96 A;  3LTQ A;  3UD9 A;  1S0D A;  3AZV A;  3EF2 A;  4QKS A;  2GO2 A;  4I2S A;  3NBN A;  1RY7 A;  5BP5 C;  1BFF A;  2K8R A;  4JQ0 A;  4ZLB B;  4G9M A;  1YXW A;  3PG0 A;  2F8X C;  1I1B A;  2Z48 A;  3BAO A;  2Y9W C;  1EYL A;  4PC4 A;  1S0G A;  3BRD A;  4CJM A;  4LO3 A;  5BQU A;  2HZ9 A;  3OJV A;  3VT0 A;  3IAG C;  1M2T B;  3AKI A;  2D20 A;  3N7J A;  3WIN A;  5BXR A;  1HKN A;  1K5V A;  2D23 A;  3LLP A;  2VSE A;  4J2S A;  5DZU A;  2IWT B;  1PWA A;  5D61 A;  2NVH A;  1QQK A;  1WBC A;  4HA2 A;  3CA3 A;  2DS0 A;  3IIR A;  5HPZ A;  1K5U A;  1WD4 A;  3BAH A;  4EEE B;  2E4M A;  2KI4 A;  1ISY A;  4JAW A;  4OEG A;  3FUQ A;  4LO2 C;  1DFQ A;  4I3N A;  4XFT A;  3CRI A;  2FDB M;  3N7M A;  2MLL B;  1QQL A;  3UJ0 A;  3S8J A;  4ISQ A;  3BAD A;  1AF9 A;  4J23 B;  4MZH A;  3UD8 A;  4DEN A;  1MD6 A;  1ISV A;  3FJK A;  2ZR1 B;  2F2F C;  3N0K A;  3WO4 A;  4GOY A;  4XFU A;  2D44 A;  1DZD A;  2DRY A;  4ZGR B;  4I1E A;  3AJ6 A;  4D0Z A;  2FFV A;  4DEP A;  1BLD A;  3HMY A;  5JLV A;  4ZA3 B;  3IM5 A;  2HW9 A;  4I4U A;  1BA7 A;  5FNX A;  3R4S A;  4J2K A;  5E24 E;  2BEA A;  2WBC A;  1FN0 A;  4USO A;  8I1B A;  2FGF A;  3Q7X A;  1SZ6 B;  1Q03 A;  1EVT A;  3H6S E;  1GGP B;  1UPS A;  3WO2 A;  1DFC A;  7I1B A;  3PME A;  3CA4 A;  4P0K A;  3BA4 A;  4KEK A;  3H6R A;  5DVH A;  2Q3N B;  3A23 A;  3V79 C;  4QBV A;  5BXP A;  3FJD A;  4I4Y A;  4ZKT B;  4JKX B;  31BI A;  4IY8 A;  4ION A;  4IY9 A;  4J2X A;  4Q91 A;  4EFQ A;  3HOM A;  2RQ9 A;  3BX1 C;  2QN4 A;  1TIE A;  4P0J A;  4OWL A;  1JT5 A;  3CRH A;  4Z9W B;  3WO3 A;  1BFC A;  1OQL B;  4L4H A;  2P39 A;  3CRG A;  4R6U B;  3FUO A;  3V0A A;  4JPZ A;  1V6X A;  3F1R A;  2BEB A;  4H75 A;  2P23 A;  3O4A A;  4MZG B;  3VEQ A;  3K1X A;  2GZB A;  2AXM A;  3BAV A;  1J0S A;  3BAG A;  3BTA A;  2AAI B;  3B9U A;  4I37 A;  1YTO A;  3Q7W A;  4X39 A;  4QD2 B;  3MAL A;  2Y9G A;  2Z49 A;  1S0L A;  3P6J A;  3KMV A;  1XZZ A;  1BAS A;  3WA1 A;  1NZK A;  3R4U A;  1IHK A;  3H6Q A;  3P53 A;  5F8S A;  3VT2 A;  1SR4 C;  4I7I A;  1D0H A;  4LO1 C;  1Q04 A;  1AVX B;  2IHO A;  4Q9G A;  3FJJ A;  3O4C A;  1PC8 B;  4EFR A;  4UY4 A;  3RMX A;  1IRA X;  1IRP A;  4OEF A;  1AVW B;  2XOA A;  4KC3 A;  3N7L A;  3NBD A;  3V0B A;  4I4R A;  2ESU A;  4QBC A;  4I6I A;  1ABR B;  4F34 A;  5BP5 A;  2Y9X E;  3FFZ A;  1JQZ A;  4G6M A;  1JTC A;  1V6W A;  3OJ2 A;  1AVU A;  1MC9 A;  4OW4 A;  1DIW A;  1PZZ A;  3SNV A;  3OBR A;  1YF8 B;  3RMY A;  2VU9 A;  3TC2 A;  2NTD A;  4G6J A;  3WMV A;  1JY0 A;  2MIB A;  4I8M A;  1FQ9 A;  4D0T A;  3MPP G;  5EHA A;  3NBE A;  1BLA A;  1JT7 A;  1FWV A;  1T9F A;  3CAH A;  5JMC A;  2X2T A;  3VSF A;  1HCE A;  3H6R B;  1ONK B;  3P6I A;  3UDA A;  4QO3 A;  3FJC A;  1HWO B;  4HJJ A;  2VUA A;  4XFS A;  1DLL A;  2RG9 B;  3I29 B;  2VSA A;  3O4D A;  5DUY A;  2J3P A;  2FFU A;  4QKR A;  5FZU A;  4IZE A;  4D8H A;  3CA6 A;  2AQZ A;  4FVV A;  1CE7 B;  3BA5 A;  4JKQ A;  4LO2 A;  3JRR A;  2FO1 A;  4H04 A;  1HIB A;  1M16 A;  9ILB A;  1JLX A;  3AKF A;  4ISR A;  3FJI A;  3IM6 A;  3O5W B;  5BVP I;  2F2F A;  3CA0 A;  2ET2 A;  3OGG A;  1HWM B;  2NZ9 A;  4I4V A;  3ZC8 A;  3V0A B;  1ISW A;  3JUT A;  2YUG A;  1PUU B;  3O4B A;  1BAR A;  3UJ4 A;  3F62 B;  5DSS B;  2K4A B;  4AN6 A;  3D7W B;  3AKH A;  4L4I A;  1YYN A;  21BI A;  1TOO A;  4TLP A;  3FJH A;  3OJM A;  1QXM A;  3C9Z A;  1II4 A;  3BB2 A;  5FZZ A;  4IYB A;  4XKI A;  4LO0 C;  1ILR 1;  1YBI A;  1V6U A;  4GOV A;  1FV2 A;  1JLY A;  1R8N A;  1IJT A;  3IM7 A;  1W3G A;  3FJ8 A;  1Z2V A;  3FJ9 A;  3N7K A;  3AKG A;  4LO7 B;  1E0O A;  1R8O A;  1RG8 A;  4H9W A;  2UUS A;  4KEJ A;  4Q9P A;  4I4Q A;  1AFC A;  2D24 A;  3O3Q A;  4ZFU B;  1L2H A;  1HWN B;  4IZX A;  3V0B B;  2LIE A;  1IT0 A;  5GAQ A;  4Z8S B;  3CQA A;  4LO8 B;  1CVS A;  1HWP B;  4ZFW B;  3FJE A;  4A7Y A;  2AFG A;  3FGM A;  4J2Y A;  5F8W A;  1P63 A;  4LO3 C;  5BQU C;  4F83 A;  3AH2 A;  3O49 A;  2HWA A;  2R9K B;  2VLC A;  3CA1 A;  3AZW A;  4OWK A;  1DQO A;  3WIN C;  2KH2 A;  2M49 A;  3T8S A;  3NJ5 A;  3VUO A;  3PHZ A;  4QAL A;  4X37 A;  4OEE A;  4QD2 C;  1ISX A;  2ERM A; 
#chains in the Genus database with same CATH homology
 5B2H A;  2WRY A;  1FMM S;  2RST A;  4GAF A;  4GP3 A;  4II0 A;  1TWM A;  1RML A;  1G9B A;  1XG6 A;  3FJA A;  4A7K A;  2E4M C;  2BFH A;  1IOB A;  2Q9X A;  1SR4 A;  1S0C A;  4LO1 A;  4A7Z A;  1KNM A;  3UD7 A;  3AH1 A;  2X2S A;  1ITB A;  1AXM A;  2D7I A;  4HR6 C;  4EB2 B;  1S0E A;  1V6V A;  3BRG C;  2NM1 A;  1T4Q A;  1VCL A;  3BA7 A;  4ZFY B;  4I4O A;  3OBT A;  1S0B A;  4IHZ A;  5FZY A;  4MZF B;  4OUJ A;  2LIQ A;  4ZOT A;  2Y9F A;  1DQG A;  2QYI B;  1TP0 A;  1EV2 A;  1XYF A;  1Q1U A;  3POK A;  3VT1 A;  1G9C A;  1DZC A;  4I4X A;  1FWU A;  4DCK C;  3VWC A;  5F8Y A;  3ZXD A;  1EPW A;  2ZQO A;  5BXT A;  1ISZ A;  5EG6 C;  3I2X A;  1N4K A;  3FJB A;  3Q7Y A;  2VXT I;  3E8L C;  2VXR A;  1FMZ A;  2KLL A;  5F90 A;  3W9T A;  3S8K A;  3A21 A;  4EKX B;  5I1B A;  4X38 A;  2MC2 A;  3BAU A;  1NUN A;  4P0L A;  1BFG A;  4GAI A;  6I1B A;  1S0F A;  3BAQ A;  2ZQN A;  1PUM B;  3WMU A;  3AJ5 A;  4FGF A;  4USP A;  3HN1 A;  3RSJ A;  4OWJ A;  4I4P A;  1TFM B;  3QR5 A;  1W3A A;  1FV3 A;  4KBB A;  4ZBV B;  5D63 A;  1W3F A;  3ZC9 A;  4I1B A;  1RZO B;  1TTU A;  4I4S A;  1BFB A;  3PUB A;  3QYD A;  1WD3 A;  4AN7 B;  2KKI A;  4G1R A;  4IQP A;  3AH4 A;  3ZXG A;  5BOW A;  4EFP A;  4I0Y A;  3HSM A;  2HWM A;  5EC5 A;  1TWE A;  2L5X A;  1HCD A;  3I2A A;  3O44 A;  3RTJ B;  4G9N A;  1DJS B;  2D22 A;  4QC4 A;  1XHB A;  3HAL A;  2D43 A;  3BRF A;  4JRA A;  2NS2 A;  2KI6 B;  1G9A A;  1FGA A;  2NP0 A;  4X3A A;  5D62 A;  1WBA A;  3OGF A;  1Z4S A;  2DRZ A;  3O4O A;  3HBW A;  1AVA C;  2NYY A;  3ZX7 A;  3CU1 B;  3CA5 A;  1G9D A;  5G00 A;  2D7R A;  3NBC A;  4WBC A;  3FJF A;  2I1B A;  1Z0H A;  4LO0 A;  4JP0 A;  1JT4 A;  1IIL A;  4LO7 C;  41BI A;  5FNW A;  1F31 A;  4KEI A;  2K43 A;  4YOL A;  3A07 A;  5BXS A;  1JT3 A;  4GP0 A;  1I1E A;  2D1Z A;  1A8D A;  3RTI B;  2DRE A;  3VSZ A;  4P6A A;  4END A;  3A22 A;  1G82 A;  3ILA A;  4I96 A;  3LTQ A;  3UD9 A;  1S0D A;  3AZV A;  3EF2 A;  4QKS A;  2GO2 A;  4I2S A;  3NBN A;  1RY7 A;  5BP5 C;  1BFF A;  2K8R A;  4JQ0 A;  4ZLB B;  4G9M A;  1YXW A;  3PG0 A;  2F8X C;  1I1B A;  2Z48 A;  3BAO A;  2Y9W C;  1EYL A;  4PC4 A;  1S0G A;  3BRD A;  4CJM A;  4LO3 A;  5BQU A;  2HZ9 A;  3OJV A;  3VT0 A;  3IAG C;  1M2T B;  3AKI A;  2D20 A;  3N7J A;  3WIN A;  5BXR A;  1HKN A;  1K5V A;  2D23 A;  3LLP A;  2VSE A;  4J2S A;  5DZU A;  2IWT B;  1PWA A;  5D61 A;  2NVH A;  1QQK A;  1WBC A;  4HA2 A;  3CA3 A;  2DS0 A;  3IIR A;  5HPZ A;  1K5U A;  1WD4 A;  3BAH A;  4EEE B;  2E4M A;  2KI4 A;  1ISY A;  4JAW A;  4OEG A;  3FUQ A;  4LO2 C;  1DFQ A;  4I3N A;  4XFT A;  3CRI A;  2FDB M;  3N7M A;  2MLL B;  1QQL A;  3UJ0 A;  3S8J A;  4ISQ A;  3BAD A;  1AF9 A;  4J23 B;  4MZH A;  3UD8 A;  4DEN A;  1MD6 A;  1ISV A;  3FJK A;  2ZR1 B;  2F2F C;  3N0K A;  3WO4 A;  4GOY A;  4XFU A;  2D44 A;  1DZD A;  2DRY A;  4ZGR B;  4I1E A;  3AJ6 A;  4D0Z A;  2FFV A;  4DEP A;  1BLD A;  3HMY A;  5JLV A;  4ZA3 B;  3IM5 A;  2HW9 A;  4I4U A;  1BA7 A;  5FNX A;  3R4S A;  4J2K A;  5E24 E;  2BEA A;  2WBC A;  1FN0 A;  4USO A;  8I1B A;  2FGF A;  3Q7X A;  1SZ6 B;  1Q03 A;  1EVT A;  3H6S E;  1GGP B;  1UPS A;  3WO2 A;  1DFC A;  7I1B A;  3PME A;  3CA4 A;  4P0K A;  3BA4 A;  4KEK A;  3H6R A;  5DVH A;  2Q3N B;  3A23 A;  3V79 C;  4QBV A;  5BXP A;  3FJD A;  4I4Y A;  4ZKT B;  4JKX B;  31BI A;  4IY8 A;  4ION A;  4IY9 A;  4J2X A;  4Q91 A;  4EFQ A;  3HOM A;  2RQ9 A;  3BX1 C;  2QN4 A;  1TIE A;  4P0J A;  4OWL A;  1JT5 A;  3CRH A;  4Z9W B;  3WO3 A;  1BFC A;  1OQL B;  4L4H A;  2P39 A;  3CRG A;  4R6U B;  3FUO A;  3V0A A;  4JPZ A;  1V6X A;  3F1R A;  2BEB A;  4H75 A;  2P23 A;  3O4A A;  4MZG B;  3VEQ A;  3K1X A;  2GZB A;  2AXM A;  3BAV A;  1J0S A;  3BAG A;  3BTA A;  2AAI B;  3B9U A;  4I37 A;  1YTO A;  3Q7W A;  4X39 A;  4QD2 B;  3MAL A;  2Y9G A;  2Z49 A;  1S0L A;  3P6J A;  3KMV A;  1XZZ A;  1BAS A;  3WA1 A;  1NZK A;  3R4U A;  1IHK A;  3H6Q A;  3P53 A;  5F8S A;  3VT2 A;  1SR4 C;  4I7I A;  1D0H A;  4LO1 C;  1Q04 A;  1AVX B;  2IHO A;  4Q9G A;  3FJJ A;  3O4C A;  1PC8 B;  4EFR A;  4UY4 A;  3RMX A;  1IRA X;  1IRP A;  4OEF A;  1AVW B;  2XOA A;  4KC3 A;  3N7L A;  3NBD A;  3V0B A;  4I4R A;  2ESU A;  4QBC A;  4I6I A;  1ABR B;  4F34 A;  5BP5 A;  2Y9X E;  3FFZ A;  1JQZ A;  4G6M A;  1JTC A;  1V6W A;  3OJ2 A;  1AVU A;  1MC9 A;  4OW4 A;  1DIW A;  1PZZ A;  3SNV A;  3OBR A;  1YF8 B;  3RMY A;  2VU9 A;  3TC2 A;  2NTD A;  4G6J A;  3WMV A;  1JY0 A;  2MIB A;  4I8M A;  1FQ9 A;  4D0T A;  3MPP G;  5EHA A;  3NBE A;  1BLA A;  1JT7 A;  1FWV A;  1T9F A;  3CAH A;  5JMC A;  2X2T A;  3VSF A;  1HCE A;  3H6R B;  1ONK B;  3P6I A;  3UDA A;  4QO3 A;  3FJC A;  1HWO B;  4HJJ A;  2VUA A;  4XFS A;  1DLL A;  2RG9 B;  3I29 B;  2VSA A;  3O4D A;  5DUY A;  2J3P A;  2FFU A;  4QKR A;  5FZU A;  4IZE A;  4D8H A;  3CA6 A;  2AQZ A;  4FVV A;  1CE7 B;  3BA5 A;  4JKQ A;  4LO2 A;  3JRR A;  2FO1 A;  4H04 A;  1HIB A;  1M16 A;  9ILB A;  1JLX A;  3AKF A;  4ISR A;  3FJI A;  3IM6 A;  3O5W B;  5BVP I;  2F2F A;  3CA0 A;  2ET2 A;  3OGG A;  1HWM B;  2NZ9 A;  4I4V A;  3ZC8 A;  3V0A B;  1ISW A;  3JUT A;  2YUG A;  1PUU B;  3O4B A;  1BAR A;  3UJ4 A;  3F62 B;  5DSS B;  2K4A B;  4AN6 A;  3D7W B;  3AKH A;  4L4I A;  1YYN A;  21BI A;  1TOO A;  4TLP A;  3FJH A;  3OJM A;  1QXM A;  3C9Z A;  1II4 A;  3BB2 A;  5FZZ A;  4IYB A;  4XKI A;  4LO0 C;  1ILR 1;  1YBI A;  1V6U A;  4GOV A;  1FV2 A;  1JLY A;  1R8N A;  1IJT A;  3IM7 A;  1W3G A;  3FJ8 A;  1Z2V A;  3FJ9 A;  3N7K A;  3AKG A;  4LO7 B;  1E0O A;  1R8O A;  1RG8 A;  4H9W A;  2UUS A;  4KEJ A;  4Q9P A;  4I4Q A;  1AFC A;  2D24 A;  3O3Q A;  4ZFU B;  1L2H A;  1HWN B;  4IZX A;  3V0B B;  2LIE A;  1IT0 A;  5GAQ A;  4Z8S B;  3CQA A;  4LO8 B;  1CVS A;  1HWP B;  4ZFW B;  3FJE A;  4A7Y A;  2AFG A;  3FGM A;  4J2Y A;  5F8W A;  1P63 A;  4LO3 C;  5BQU C;  4F83 A;  3AH2 A;  3O49 A;  2HWA A;  2R9K B;  2VLC A;  3CA1 A;  3AZW A;  4OWK A;  1DQO A;  3WIN C;  2KH2 A;  2M49 A;  3T8S A;  3NJ5 A;  3VUO A;  3PHZ A;  4QAL A;  4X37 A;  4OEE A;  4QD2 C;  1ISX A;  2ERM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...