3OKDA

Crystal structure of s25-39 in complex with kdo
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
219
structure length
219
Chain Sequence
DIVMTQSPSSLAVSAGEKVTMNCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFALTISSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERANGVLNSWTDQDSKDSTYSMTSTLTLTKDEYERHNSYTCEASHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords S25-39 Fab (IgG1k) light chain
total genus 51
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2010-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okdA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okdA01
4NM8H 4LLAA 5IMLB 3HPJB 3PABA 5TQ0L 3IAPA 5J6GA 3ZDXF 4OD2A 4LVOC 1CD1A 1G6RH 3BQUB 5F88B 5BW7A 2JB6B 3UMTA 5CEZH 1X5GA 3VXUA 5T3ZE 4MQSB 3MOQA 3QDAA 4NGHH 4WW2B 2XA8L 1P4BH 4ODWB 3K4AA 4Q6IA 1YC8A 1MCHA 2GAZB 3QUZD 5DJDA 4RGNB 3MYJA 1CGYA 5CFHA 4JFDD 1NCWL 3S97C 1N0XL 2YS4A 4N0CD 1AIFA 5IVNA 4PRPA 5DWUH 2B1AL 4QHLB 3M8OH 3DMMB 3ZE1F 2F9BT 5CIPH 3QPQD 4KTYA 1ZANH 5FO9B 4NN7C 5EOQL 4BM7A 4WTZA 5JNYB 2P5WD 2WINB 2Q86A 1MAMH 2I9LA 3FB7A 2FHBA 2OR9L 3QFJA 5E8DH 2X4TA 1J1XH 5L2KD 2CK0L 5CEXB 5BO1H 1RZGA 3ULSA 3W2DL 3ZT6A 3TYGH 3BE1L 2V9RA 2R9HD 5F8RC 1FYTD 3SCMB 1PG7W 1S7XB 4JHBA 3QEGH 1QSVA 1FFQA 4YDIH 3TJHC 5C0RL 3UPAA 1B4RA 2BY2A 5C70A 4ZTOH 5D2LB 5HHME 3QO1B 2P24B 4NUGL 5DQJA 2NW2B 1NLDL 2XKUA 4F2MB 3VFPA 5KZCB 2C1OA 3S3PA 1IEHA 5GRYA 1FO0H 3WDJA 4QGTA 5C08D 3R8QA 1J87A 3NCJH 5FYKE 2FIRT 4O2FA 1U8PA 3RUGA 1M71A 4P48A 4WUKL 5HVHC 3ES6B 3QDMD 1JPFB 3K2UH 3KYMA 15C8H 1SYSA 2IANB 4FABL 1JHLH 5F1IB 3WFEL 3IFNL 1T0NA 1IGYB 3DRQA 4O5LH 1XCQA 5F9OH 5BXFA 4JO4L 2UZIL 1T6WA 4P2QD 5DEGB 2WIIA 1NANH 3UEZA 2DS4A 3EOYG 2OZ4L 3PWJB 3AM8C 3H9SA 5IW3A 2B2XL 3MJ8B 1UACH 2OL3A 4YK4C 3QJHA 4U31A 5I1JL 3QUYB 3KXFD 2Z8RA 3C6LC 4P23C 4P23A 2O61A 1GGYA 4N9OB 2IH1A 1KCRH 4JHZA 5HYQA 3IJYA 4MNHA 5D9SB 4YZFF 4Z6AT 3OB0H 4GMTH 1GZQA 3C60D 1FC1A 4RFNC 3GMLA 4R7NA 5MP6H 2CQVA 1XGQA 1VCAA 2LQRA 2VDNH 4WENB 1HCVA 3QH3B 1NGPH 4H88H 4JFFA 4X6EA 1KOAA 3JWOH 4L8BB 4HXAH 1NH6A 1VGKA 1KFAH 1PZ5B 3GSWA 1OY3B 1ZHKA 5H2BA 4Y5VC 2FJHA 4PJGA 5HY9B 4MB5A 2XG4A 1FVEA 5L2JB 5I15L 3VW3L 3G6JF 5C0CA 3MQIA 3DV4B 4UUJB 4RZCA 2CIIA 1MRFL 4KDTC 3ARFB 3KPSE 4M9OA 4ALAH 2BNQD 2DKSA 4Y5VA 3UC0L 3WUWB 3ZSTA 1OW0A 2HJLB 1ZS8A 1A21A 3R1GL 1EJOL 2HVKB 2GK2A 1ES0B 3WXVH 3KPPB 4M61A 3QNXA 4PP2A 4JO2L 5EU6A 1IAMA 1I8KA 3KWWB 1CG9A 3TIDB 4MNQD 1M4KA 2ZCKL 5DC4B 5FB8A 3AAZB 3GBML 4F9LA 4K9EC 3ILPA 1JUFB 1NDGA 1VKXA 5L6YL 1FCCA 4M6OL 4UBDC 1V3LA 1Q1JH 1L4IA 3KHQA 1J9CT 1YN6B 4KJPC 2VUOA 2Z92B 2QV2A 4NQXA 5D7LB 3NOIA 3WLWD 4N1CA 1JHKH 5C0IA 5H94A 1QSFE 2XN9A 4LLYB 3TIEA 2LAGB 3UTTB 4MA3B 5FGSA 4AQOA 1G9NC 4HS8L 5IESH 2FRGP 4UT7H 5GS0D 4JFYA 3BZEB 1DUYB 4N8CL 4UILH 3DETD 3MV7D 3TN0D 4HPOH 5IQ7L 3LEVL 3MCLL 2WLZA 3MA9H 5C0RH 4FQPA 1AGBB 4XVTL 5FGRA 5E8EA 4EI6A 4G8GB 3WMSA 2BSSA 1A7OH 2WUCH 1IRAY 3KLHD 4IEFB 5EZIH 4NRZB 4MJ5A 5JXAH 4U1NB 4J1UB 4KTDL 3U30B 1K8IB 4RDQG 1BZ9A 2R0ZL 3EO1A 4X6CA 3U2SB 5E5UB 4OZHB 2YXMA 1Z2KA 3ARQA 2NYYD 3RL2B 4FQIL 1CU4H 4U0RC 2VLKE 4XB8A 5HYJB 4KTDH 3ARDD 3TZVA 3MNZA 2DTML 4M9PA 3E8UL 4LPWA 5HHOB 5GGSB 1G7LB 5I6XC 5T3XE 1A4KA 1ZEAL 1YEJH 4FQJH 1GCFA 5D6DC 2IMNA 5E8NA 3H8NA 4I2XB 4NO2A 4LVHC 1KPVB 1U95A 2I07B 2XTJE 2EDXA 3OZ9L 5E00B 5I73B 2OXHA 2VLJA 5IMLA 1Q9OA 1S7WA 5CIPB 1BQHB 5E8OB 4EKXA 5C0BE 4U1SB 4PRHA 5I1LA 4MQXD 3VXQB 5KSVA 3JV6B 4LP5A 2EXYC 4MJIB 4Y2OA 1W0WA 3GHBL 1G7QA 1U0QA 4YHOL 3WJJC 4ODXB 5HGBB 2VLRE 4F3FB 3WS3A 1HNGA 4P46D 1I85C 3P9MA 3O2DL 5C9KA 2P49B 4MA1B 3E6FB 1I8MA 4D0DA 1BIIB 2CGRL 3RZCA 4OFIA 5FA4A 5D1QC 4JZNA 3HS0B 1OWRM 2VISA 1ZOXA 4MDJB 3U46A 3CSPA 1QSFB 3BKMH 4HCRL 1UC6A 2VAAB 3GSOB 3OKYA 5KVGL 4HCRH 3ZO0A 4BSVA 3RWFA 5EFIA 2Y5TB 3FO9A 4QY8A 1J88A 2X4TB 4P2RD 2AJXH 3IFLH 1RJYA 5D7LE 3F6LA 4U6VL 3MBEA 4EJ1C 4JCLA 3HI6H 1HH9B 4S1SL 4H26B 3BKYL 3OR7B 4LVNB 3U4EB 5J0BA 4WO4D 4G9FD 2OI9B 3NPZB 3SJVD 4EI5A 2H41A 1CDBA 3D3VD 1MRDH 2VLJD 4XBPA 2A0LD 2D9QB 3S4SG 1SEBA 3ULVD 4OIIL 2SEBB 1TITA 1UEMA 1CBVL 2BJML 2W0PA 3DXAB 4OFYD 4KK9C 4N0UE 1TNMA 1ZANL 1T1XB 4WFEE 1YECL 2XWBA 4KI5F 1FZMA 2Z31A 1JPFA 4S1DC 2XQBH 5MENB 4Z0BH 1JIBA 4XPBH 3F62A 1Y18A 4I9WD 3SE8L 3CDYA 4PRPB 4XAWL 2HN7B 5GS3A 4Z7VA 4O2EA 3IFOA 5F9AC 4HPOL 5IQ7H 1JFQH 2OTUB 1FL3A 3IFPA 5DVKA 5E5MA 4JPWL 5T5FH 3GSNL 3DROB 3HE7D 2APVA 1MCPL 2X4PB 3RKDC 3IJSB 3QWOA 1FVDB 5CJBA 3QUYA 3QFJB 1MFCL 3SOBH 3ZDYF 3ZYJA 3TVMB 5E1AA 2DM7A 5EZJB 3WJJA 5EZIL 2WBJC 4JKPL 1TTUA 2DLFH 5KSBB 3V2AR 4OGAC 4HPYL 2DLGA 4GKSA 3W82A 1KB9K 15C8L 1JZ6A 3DUSA 2K7PA 3RVWC 3MX0A 3WN5B 1I75A 4OAWB 2XWJA 1JYVA 4L5FL 4NQEE 2DQHH 5F7DA 4LQFL 1S5HB 3QDHA 4KU1A 1I1CA 3IYLW 7CGTA 4Y4FD 2ZUUA 3UTSD 1A7QH 3SKUD 3S5LA 3ARFA 1BJMA 5E4IA 1HQ4B 4HZLB 5C08E 1F4XH 4JB9L 1F13A 2HJLA 3DSNA 5FEBA 3U0TA 4CNIB 5GGSY 2H3NA 3NCEB 1FZKA 3QI9B 1KIQA 5B8CC 3TYGL 5FYLL 1DP0A 1AD9B 4K7PL 4X83A 3P4MA 5KSAC 4JEGB 2WZPD 1KCUL 3G6DH 4LIQE 2NR6D 1DSFH 4LRIA 2F54E 4ZFZB 1AXTL 4R3SB 1BFSA 3OX8A 3G6JB 4P59H 5ADOL 3PP4H 2OQJB 2ARJB 3FQUA 2QSQA 1WBXA 1W0VA 3UYRL 2F53B 4NJ9L 1NBZB 3AMLA 3IXAB 3O2DA 1JZ3A 3I3EA 4G42A 4X6CE 1NC2B 2H6PB 5I8KH 3QQNA 4GAFB 2FGWL 1MCSA 4MAYA 2VB5A 3BRDA 4OD1H 2BSED 2DYPB 4F80A 3NZHH 4YDJB 1RVFL 2R2EA 5DZNA 1OQOA 4QRTB 3RI5F 4HKJB 4BSJA 2MJWA 4JQXA 1JJUA 5BV7B 1BM3H 4ZMAT 2LABA 3HKFA 2HJKA 1FGNL 5EZLA 1V8HA 2BVUA 3VMNA 3SDAC 3BZFB 1EGJL 1YPZF 3ESVF 1HWGB 1MIMH 5IG7A 3K4ZA 4JY4A 3KYOB 4Y88A 4XNXH 2VLJE 1S9WB 4HBCL 3FB5B 4R4ND 2GTWB 5SX4I 5IMKB 3GMNB 1PY9A 1P69B 3EIFA 4R9HA 1NKOA 1HSBB 3MLUH 5ERWA 5B21A 5TFSH 4PJCB 4JJ5B 4N0FA 3LDBC 4NYLA 2XICA 4PGZA 2A74B 4LSVL 3H6JA 4JKWA 3PGFH 4LVHB 5TDNA 1C5DB 4HBQA 5EU3B 1UJTA 5CJXC 2NXZD 5F71A 1PSKL 1GAFL 3WSQL 4LSUL 4OLUL 2VJXA 3BW9B 4LHUG 4YDVA 3ULVL 5LXGL 2VDLL 1OP5H 1G7PB 3BZ4B 1DLFL 3PHQB 4ZTOL 5D5MF 3EFDH 2CGRH 3TPUB 5IK3A 3ZKNC 1YEKL 5M95B 2A6KB 4PJGE 3TT3L 3QG6A 1D5MB 4FS0A 4EBQH 1FZJB 2GSIB 4M1GL 1JGUH 4MA1C 2QHRH 1HH6B 4D9LH 4LLYA 2EH8L 1QSEA 3EOAA 2N4IA 1MFCH 1LNUA 4QYOA 1X5IA 3UTZA 3WLBB 1AE6H 5IQ9A 3BDXA 4U0QB 2WUBL 1KIRA 5IT2H 1PBYA 3U0WL 1A5FL 4JZJA 1NMAH 4YHYC 1RAMA 2D2OA 3WIFA 1ZLVH 1PG7X 3MFGB 4JM4L 2BOBB 4NQDB 3ULUE 3VMPA 3SGJA 3LKOA 2R0KH 4HWZA 4H0IA 4PJCF 3CVIH 2EDDA 4OFPA 1SM3H 4LBEA 1JGEB 1DBMH 4WI9A 1E4XH 4OCRH 1FNEA 5FO9A 5C0JA 1GGUA 2B1HH 5BMFH 3MO1B 4NO3B 5C07B 2UVEA 4NFCA 5IJVA 1G84A 3NTCL 4NBXB 3BEWA 3MNVB 3KLSA 4BSVB 3VI3F 4PJ7E 2VAJA 4S1QL 1I9EA 2FR4A 3VFTB 1EBPA 3QPQC 4ZXBC 5GGSA 1F3RB 1T2XA 5EOTB 3VFMB 4JM2C 1XIWB 3N0PB 1UM5H 3CXHJ 4HK0A 2JJWA 4U1MA 5DEFB 4I2XA 3VXUE 1TPXC 5I75C 4M00A 2HFFB 1A7BA 3BPOC 1U3HB 4KK8D 4ZPVB 2R8SH 3BISA 5CIPA 1XGPB 4NP4H 4N8CH 1NCNA 1Q9WB 1IGCL 2WBWB 1KB5L 1CXHA 3STZA 1FZOA 3RWIB 5DJAB 1AFVH 2I60H 2Z93A 1YNTB 4WHTA 1IT9L 4TRPL 2FJGA 2J88H 3HN3A 1L7IH 4L4VD 1T89C 4ZOAA 4FN0A 5KVDH 3F6IA 2NZ9C 3MGAA 1RUAH 4WU5A 3VGAC 4M48L 3ARGC 1KV3A 3CH8A 1A6UL 3WNOA 3MMEA 5D1ZB 4ZAKB 3H7LA 4LQ1A 5E99H 4L4TE 4WTZG 4DAGH 4HH9A 4WWKB 5D2NE 5EBLB 4MXVF 4HT1H 3QUMB 3GMOA 2X4PA 4JDTH 4RCAA 5T1LA 3O3AA 4ZDHA 4Y4HC 5GGVL 2AJVL 4FTVD 3VFUB 1TENA 5FUOL 2GK0A 3LKRB 4EUPG 4YHIA 3UJIL 1GZQB 4G6KL 5D8JL 5IFJB 3D2UA 5E0QA 2CDEB 3S8WA 4G8FB 4HQQL 5DD3H 4UTAH 3OKKB 3NZ8B 5E2VH 4JFFB 4HS3A 5SX4H 1DFBH 3W11C 1EEYA 1WC7A 4NNPH 3BP5B 4LFHD 3S9DB 3H7BB 2VLMD 1D9KC 4DKFL 1N6VA 1IFHH 3HRPA 1KIPB 4FFWD 3FZUC 4MCZA 1FORL 1FFNB 1G6RA 2QHRL 3O6LH 4K7PH 5E9DB 3LOWA 3QAZC 4EXPX 1MF2L 5KTEL 3SO5A 2NNAB 1EZVX 3WL9B 4GO6B 5I8EB 4ELMF 1IC1A 1QFPA 4OQTH 3VFSB 1TNNA 4LCUB 1OF2B 3V4PH 3VGEA 4NKIH 3PWLB 4Z77B 5JHLH 1ES0A 3KAAA 3B9VA 5CBEA 3S36X 3VXOA 1IM3A 3HAEB 2EO1A 1MFEH 4U1LB 4URTB 3MACL 5DF0A 2IFFL 3BGMB 1YDPB 2YA2A 2XKSA 3RJQB 1PSKH 4C55A 4WO4C 5E70A 4KQ3H 1QR1B 1DBJH 1KBGL 4PJIA 2CJUL 3IS0X 1T22A 4BZYA 2ZJSH 1FG2A 5EO1A 2KDGA 4JFQB 5E08H 4P2QE 5MEQB 2H6PA 4K3DL 4BH7A 5TE6L 1CDIA 2E3VA 4X6DA 5DO2C 2MPAH 3SHSA 4XTRC 2YSSB 2X4UA 3OKLB 1N2RA 4GKOA 3V5DB 2GTZA 4PJFE 1N5YL 3AS1A 1ITBB 3O45B 3QXDA 4OCSH 5GGVY 3V0WH 5IFHH 2ZSVB 2XWTB 3LPGA 1IGJA 4Q7DA 4D3CL 2YD8A 2WMPA 4LAQH 5F1OB 3MRRA 1BBDH 1T04A 2FD6H 2VSDA 3QWRA 4OCWH 2FL5B 4HHAB 1CLOH 2CIKB 4ZS6C 5GGRB 3C8KA 6FABL 1RJZB 1JPTH 4JO2H 2CPCA 5ACLA 1RY7B 3HZYB 4HGWA 5GJTH 1H0DB 3P2TA 3OXRB 4LGRB 2OJEB 1ZVYA 5LG1A 2KKQA 4LLDB 2NXYD 1OVZA 4N0FB 1YZZA 2C7UA 1NFDF 2AXFB 4M6NL 2RCSH 1QEWB 4ALAL 1RZKC 5TDNB 1CFBA 1A5FH 2WBJA 1NSNH 5EWIH 1BZ9B 4LPCA 4Q9BA 4EN3D 5GISH 4LLUA 3B2VH 2COQA 1U41A 1Q0YL 1KG0A 1GHFH 1I1FA 4WY7L 4AENA 1W72B 3MUGB 4PJ5B 3TZVB 3CK0L 5LGHL 2ZCLH 4HUVB 4LAJH 1NAML 4RMSA 1NCWH 2W9DL 3JWNC 3IDXL 4KKAC 5SWSE 4XNUH 5IK3B 1UM6L 1DJSA 2B4CC 3GKZA 2QR0B 5DMKA 5C0EB 5E08L 4QF1B 3PDOB 4BKLA 3AXLB 2R23B 2F5BL 3QG6B 4PLJC 2EEDA 4M8QA 4LCYA 4V2CB 2NY7L 4UTBL 4NZRH 4FG6D 1X44A 2CJUH 2VYRE 5BS0A 3EOAB 3PWUB 3KYMB 5GIRA 4IRJC 5C2BH 3MOAL 2FBOJ 4X6CF 1P6FA 1M7DA 3A6CL 2AV1A 5DC0A 3UPCA 3VWKB 1MPAL 4LSRL 5EU7E 1CDCA 1QA9A 5IB1A 5HVWA 3PGFL 1EFXA 5DJZB 4I0PC 3ZE0E 2DQTH 3AUVA 4XP6H 5IB3B 3DYPA 1X5AA 1N26A 1XZ0B 1OP5K 3DVGB 1QLRB 4ZO9A 4PJCA 2DL9A 3PQYE 1MJ7L 1IGTA 4LNRA 4LLWB 3JWDL 1T7WA 1ZHBB 2X9YA 3JTSA 3F8UB 4LDLB 1M05B 2DQEL 5GRJL 1D7FA 2VZTA 4BZ1L 1LO2L 4HEME 5SWQB 3UYOD 1MY5A 1F02I 3MUZ1 4ZXBB 4OBRA 3KPOA 1BJ8A 3LKQB 3RUGF 1Z0MA 5CEYB 5JHLL 3SDCC 4YE4L 3VFGH 3V4PL 4J3SA 1WIUA 4NO0B 1T2JA 4U7KA 3IDGB 1ITCA 1NAKH 4NFDA 4QHNB 4Y4KA 3RIFF 4R4BA 5IBLD 3SKJL 1L0YA 3GKWH 4OZFH 1CGVA 4G6FB 3U4EA 1RUMH 4NNYA 2DTMH 2W65B 2CK0H 1RUPL 4FXKA 1R3HA 2AK4E 1HHKB 4PBVC 5DK0B 1KLUB 4Y19A 4U1HB 1P2CA 1KIRB 3NA9H 4JFEA 2P5EB 2Y7QB 4FQHA 5EIIB 1B90A 1MCBA 2WNGA 5ESAA 3OKEA 1KIUA 4I13B 4OBSA 4FXGB 1QKZL 2L7JA 1B0GB 2P7TB 4FQCL 1WFNA 1D5XA 3MRGB 1IQDA 1F4XL 4JB9H 4J4PC 3C87A 5AG9A 4DW2H 2R69L 4WU5B 1P9MA 4YH6A 5EZOH 4BSWB 4U6TA 2C5DC 3MRMB 1D6EB 2VWEC 4C4KT 1YMMD 3GSUA 1SHMA 43CAA 3K8LA 2G75A 1OLZA 4L9LB 3MO1A 4NO3A 1IC7L 2FX8H 3LQAH 2FO1A 3BFOA 2PETA 3SE4C 4P3WA 2MHAB 4PG2C 1F6AB 1K3ZA 1U91B 1XF4A 3BUYA 1ZE3C 2CDGB 3LKRA 2GK0B 5FYKD 1SJVA 4NQEB 3ZHLA 5IJKC 1L7TH 3L3KB 3QUZA 4HC1L 3QCUL 4U1MB 5DEFA 1XCTA 4JHAH 2AJZB 4MQXC 4RIRA 2BMKB 3JVGC 4JRWA 2VABB 4ODSL 3G5YB 4P3DB 3QI9C 4BH8A 1RZ7L 4MYWB 1ZGLP 3MBXH 1FE8H 5E8EB 2X4OB 3EW3B 4MB3A 3DOSA 4PRDB 2UVFA 4XXCC 5T1DL 4PRID 4Z0XB 4LPTA 25C8L 1K4CA 4WJ5A 3GMMA 1KIPA 1U6AH 2F5BH 3AU1B 3KPLB 5HI5D 1WZLA 4D0CA 3SE9H 4L1DA 5ILTH 5E6ID 2YK1H 3O4LA 3QXVA 4U1JA 2R2BB 3CMOL 1A3QA 2D03H 4S0TD 1KUMA 4PJEF 2YKLL 3OKDA 5GPRA 4G80A 1T66D 1M6OB 4FTVE 1F3JB 4NWUL 2RBLA 3HAEA 3OJDB 2DMKA 1MEXL 2QQKH 4NNPL 5E7FA 1FO0B 1KCSL 2X9WA 5EU5B 5EC2B 4PJXB 3REVA 3ULVE 1N0XH 4U05A 4GW1B 4KKBD 5GSVB 3QDGB 3I75B 1T5WB 1YNKH 2V2WB 3AVEA 5T3ZD 1BQSA 2BFVH 3GMQA 3WHXA 3RBSA 4R8WH 2UY6A 3NZ8A 4L4VE 1MWAA 1T1YA 2FWOA 3Q1SH 5HGBA 1MCOL 3HE7C 4HDIA 3DURA 1WC7B 2DQDL 1QLFA 1NQBA 4K8RC 4JN1H 1UACL 4V2BA 4GQ9H 4NRXB 2D7NA 3BP6A 3HZMA 3QHFL 5FM5O 4NDMB 2UUDK 1D5BA 5E9DA 3VH8A 4OGAD 5F9OL 3VD4A 1QSFA 2XN9E 4IM8A 5DURB 1BD2A 3FO0H 4XCYB 4NNXA 2B39A 2WM0A 3D85B 1YEIL 4JVPA 1CR9L 3U36A 2ITCA 3T65B 4OIBA 5CJ8A 1J1PL 1DZBA 4BQ9A 4K3JH 2LU7A 4LASL 1QFWL 5CKAA 5HVHB 3GJFB 2EH7L 1Z0NA 4QRRA 1N8ZB 5C08A 5MHSD 2EKJA 1ND0A 1CICA 1K85A 1J7VR 2CLVA 4FFWC 4PJ5A 4DW2L 3QQ9C 4MNGB 4NQCB 1N64L 4OZIB 5I8KL 1A7PL 3CFEA 3FFCD 5D7SH 1TVHA 2NY2B 2QR0A 3BP7B 4ODHH 4OLVH 3Q5TA 2P5WE 2AK1L 1NFDB 2D31A 2A38A 2BRRL 1T7VA 4K7FB 5FO8A 1EMTL 1T1XA 2BNQA 5GZOD 4QYOB 4FQIH 1RSFA 2WSKA 4P5KB 2ZUVA 4WUUB 3P77A 1EXUA 1ZWIB 5I1GL 2NY4C 4BA8A 1UZ8A 4YUEL 1M7DB 1DE4A 3MROB 1PG7L 1T04B 4JVWA 4Q6IC 3ESUF 3HI1A 2CIKA 4HCRA 4HHAA 5E2UH 5GSRB 3TA3D 4J3VA 4RRPG 2EDTA 2R0LL 1IM9B 4M5YH 4Y16A 1N5AB 4IJ3C 1RUQL 4JM2B 5DJ8B 5DMGD 3HG1A 4N0UB 3DJ9A 4HWEL 4X7DC 1ROWA 2IADB 1IKNA 1PKQB 3CFJA 4ZFOB 5I9QB 4QRRD 3MJ6A 1FN4A 3G9VA 4HS8H 3S96B 4XP4L 5DLML 1MQKL 3MRIA 4KQ4H 1FPTH 1ED3B 5MERA 4JQIL 3BI9X 4L9DA 3RX5A 1U8IA 2VXTH 3ARPA 2D7PA 5CILH 4Y4KB 1MQKH 3RGVA 4G6JH 4KUZL 1GC1L 3DO7A 35C8L 4K23H 1S9XA 3BRGC 4QNPE 3HPJA 4RMUA 1JZ8A 3ARED 1TZIA 1AR1C 3SY0B 1SVCP 4JN2B 3V6ZA 2H3NB 5DMYA 3L7EA 2AXJA 3NH7L 2X5PA 2AJYH 3NCFB 4HJ0C 2WWMC 4HPYH 1ORQB 1WWAX 2GJ6E 1CCZA 1OP9A 2RQ8A 3D69A 1HHIA 4L8CB 3MJ9H 4IBLT 3U7YH 4TNWF 5T3ZH 5CEZE 5F7EH 4LHUD 2PN5A 1JCKA 5KSAA 3KLDA 3QXWA 1M05A 2C1OB 1BEYH 4JFPA 3IS1X 1RZIA 2J8HA 2R4RH 3RVUC 4CBPA 3ULVC 5HI3D 1JTPA 4LARH 4ZTPL 3ARFC 3ARBC 3D0LA 5F1KC 3LKNB 3UTTE 3R0MA 3KPNA 4O2CA 4GQPH 4KAQH 4JFDB 8FABB 1PZUB 5BS0E 3ZE2E 2BCKA 4CU7A 1JZ7A 1S3KL 5I76A 2WIIB 1BBDL 4HJGB 1DQQB 2X05A 1XCTB 1I7RB 3NCYS 3C8DA 3DV6A 5TQ2H 2OL3B 3PP4L 4ACPA 4Y5YC 4AT6A 4P3DA 4NKMB 4BH8B 3RAJH 5DK0A 2XT1B 3HMXA 3PF2A 5IBUG 2G5BB 4QRQB 5KBNC 5L2KB 3Q48A 3F5WA 4UV7H 3ZMRA 3VDBA 1I3VA 5D4QA 5T1KD 3NPSB 5FV1L 1T4KA 4M48H 5C6PB 4UIMB 4FXGA 1DQJA 4LKCA 4WCYH 3V7MA 1XF3A 2ZKHH 2DI8A 3U6RA 1A3LH 1PX4A 5CUSL 4TRPH 5FUZL 4EDXA 4F57H 4U3CA 4BSWA 5HY9A 4CDGC 3HA0A 1Z3GH 4M1CC 1IM3B 3MCKA 4XBGB 2Z9TA 3GSUB 4U1LA 5KJRH 3CDCA 5GGTH 3EYUL 4PJXF 4UUJA 2VE6A 2YA0A 2NX5B 2Z31C 2UWEB 3GI9L 1I8LC 1HQRB 5I1DB 3M45A 3QWQB 4GS7C 5DJYA 3QAZB 1WITA 2AP2A 3QWRD 2X40A 2X4SB 2FB4L 3REVB 2HA1A 3V6BR 4JO1L 2N7AA 2JJSC 1ZA6A 4HGKC 1UKTA 5C0BA 4I0KA 1GVIA 2X41A 3RVXC 2G2RB 5KSAD 4WHDA 3RWCB 2ZUXA 3WS6A 3VD7A 3KXFB 4G9FE 4NKOA 3TN0A 5DFTA 1JBJA 4JRYD 1LE9A 4GUPB 5KANG 1KTDA 5F7LB 2XZCH 3MRNB 2EC9T 2HTKC 5DMIL 3I2CL 2HT4D 5I30H 1JNNL 2D7TL 4G8EB 2F19L 3O0RL 4PJBE 3CFCH 2XN9B 4OZ4A 5FM8A 3RPIB 3D39A 4XVTH 3QXAA 4ZD3H 5ANMA 3C2AH 4HUWB 3EOTH 5I1GH 4OGXH 4PD4J 2Z91B 2J8OA 1NJ9A 4LEXH 2FIKB 4EVNB 2Q76A 4QTHB 4XP1L 4JQXC 2EIEA 5C1MB 5E95B 1WIOA 3ILPB 1K2DA 3FTGB 4GXVL 1S78C 1FYTA 5EC2A 3S88L 3FRPA 1QRNA 3GBNH 4XBEH 1JPSH 1EO8H 4ELKA 5E24E 3GIZH 4WV1C 4U6VH 4KI5C 1T5WA 1A7QL 2ATKB 1LK3H 3QCTH 1VFMA 2XY1A 3K1KC 2YPLE 4IJ3B 4KROB 3I6LE 1NFDA 1QFWH 1Q0XH 3ALXA 2PTTA 1WBYB 3BO8A 5C07E 1NEUA 4I5BB 3IGAA 1F90H 1U2CA 4K94C 5A2IH 1F3DJ 2NY6B 1FGVH 4HF5L 2X6MA 1D5BB 2Y4SA 5HHXL 5D1ZA 5D1ZC 5T1MB 3ZKND 1RK1B 1B0WA 4WCYL 1H15A 5JPNB 1FJ1A 4Z78B 3HMXL 5LWYL 4GKZB 2J6EH 5DTFB 1N6UA 3DYOA 3WIHA 5HHVL 3HC3L 3VXUD 3IF1A 4B41A 1EO7A 4M43L 2A6JA 1AHWB 1K8DB 3LS4L 5JHDE 1RZGB 3ULSB 1KJ3H 1QSZA 4DQOH 5CGYD 1G7QB 1F3DH 4OZGF 1CLYH 1ZAGA 5F3BA 4PV8B 3S3SA 1CL7I 3L7FA 3OF6D 1G9EA 3IRPX 3V0VB 4MVBC 2ATPB 1V7NH 5F7YC 3QULB 3KS0J 3L3DA 4FRWA 4PB9L 1A4KB 4Z8FL 1CBVH 2UV3A 1T3FA 1KN2H 5I1JH 5TE7L 1U8PB 4L4TB 3T4AB 1E4JA 3P77B 1F4WH 5B22A 4JFEB 4B7IA 4JO1H 2YD5A 4NSKB 3MNWA 2JIXD 5B39G 1MSPA 1XR8A 3F7RA 4RFOL 5BVJA 2KQMA 5I1AA 4QWWC 5HYFA 5MEOB 1W0WB 5L9DH 5DEGA 3BGMA 3CLEH 3VD3A 1QD0A 5LVEA 3R0NA 1D5XB 3P9MB 1JWMB 3PQYB 4EN3C 4ZAKC 1J8HE 1I7TB 3LEVH 3MCLH 1JHTA 1HI6B 1I8MB 4XMPL 4GAYB 1MI5D 3MJ9A 4YBLB 3CCHB 3J8F7 4APQC 5HGGS 4CAGA 1A6AB 4WUUE 4AJ0A 1IGCH 1TDQA 3V7AG 1NEZB 4Q9QH 4OLYH 5IVOA 4P3CL 1OAZL 3UZQA 4OB5H 1P7KB 4G6JL 1X5HA 3HC4H 5HI4D 4UNUA 4JHAL 4BFGA 5FV2A 5IMMA 5TFSL 1QRND 3WIHL 2VZUA 1F6AA 1N2RB 3LV3A 5D5MB 2Q8AH 1JPSL 2V7HB 2WLYA 4HXBH 2AV7B 3D87B 2BNQE 1NMCB 4U33A 2ED7A 5EORL 3IFOB 1Q0YH 1QSED 3LMJH 4XHJD 3RWDB 3RVUD 3MLXH 1H0DA 1ZVSA 5CINL 2VN7A 5DD6A 3VGFA 2YUZA 3VXPA 2OJEA 1NGZA 4EXKA 5FYKL 5TDPB 4Z7QE 3PL6D 4N5EC 4TULH 3TO4B 2J1KA 1R24A 3T1WA 1BD2D 1HYSD 3OB0K 1YY8B 4HUUB 1NDGB 3U9UB 3GSNB 4WEBH 5ETUB 4U1IB 3OKDB 2DJUA 1M6OA 4WNQB 1AKJA 4HUVA 3TBWA 4NC0B 3HNTH 5AUMB 3DVNA 2MCPH 5C0EA 3DXAD 4XMLH 2CRMA 1NCAH 4GRMB 1EBAA 5SWZB 1B4JL 5D7LA 5GGTA 5EUOF 3ARGA 2EH8H 5TQ0H 4HIXL 4R97B 5HBBA 1PW3A 1QFWI 5EA0L 2WUCL 2ZSWA 4O2CB 3U83A 1RZKL 3KDMB 4JE4B 4PBWD 1DQLH 5HD8D 1ERNA 4R0LB 4HWBH 4YC2C 2N56A 4KVCL 5EOCL 2V2WA 3FT2B 2C26A 2VL5A 3X13A 4OLXH 4PGEA 3KR3L 1H8OA 4NKQB 1KTKE 1FYHB 1CICD 4O9HL 2G2RA 1F11B 1QO3B 4JPIA 3PE9A 1AGCB 1WCBB 2EE6A 3EZ8A 5DI8A 2CXKA 1W8NA 3DURB 4GRWB 5CMAA 5KS9A 1GH7A 5CSBA 2RIKA 5FUZH 4IOIA 3QB7C 3S36H 4LSVH 4J4PD 1J8HD 3GHEH 2WK2A 3RTQD 3TJEH 3WFEH 2C1PB 1INQB 1WEJH 4RFOH 5DVMA 5TPWH 4K2UH 2A2QT 5DQDL 1IGML 1KLGA 2X70B 2XPGB 2HAZA 3U7WL 5ID0A 4TUJA 2EYTB 3QJFA 4GBXC 4JRXB 2WINA 1ZSDA 4KQ4L 2IWGA 5ACZB 5IM7A 5IVXA 4OCYH 3V79C 1DEDA 1ZVHA 2RGSA 2MSPA 1AD0A 4JDZB 4IMLA 1JFQL 4EVNA 3EJZC 3S34H 4Z7WB 3RGHA 4Z0BL 3T4YB 4CGTA 4HQQH 4NUJA 2W65A 4HUXB 2F8VA 3BRFA 3DGGA 3W39B 1W0VB 2CH8A 4X4MA 1YEGL 2OTWB 1CDJA 3QI9D 4PJXE 1CLYL 1OT1A 3IETB 4P2OC 3MRHA 4HIIA 1BHGA 5FHAL 5HDBF 4HT1L 2YWYA 1JPGB 1RHFA 3BGFC 3GJFK 3BW9A 1A64A 2PO6D 3L5XH 5FGBC 5EN2A 3MREB 1IL1B 1YEHL 4W4NA 3MRDA 4WI7A 3QT2A 4Y89A 5F7FA 3X14A 4P2RE 1EFXD 5EZLB 5J4MA 1DE4B 3MROA 3N1GC 2RB8A 1E4XI 1IGYA 3DRQB 3C6SA 4LKXB 5DHVH 4PRPE 4HKXB 2YWZA 3KYOA 2AJXL 2EZ0C 2V17L 2CO7B 2QSCL 2QEJA 3D39D 3GMNA 5GGUA 1WWCA 2NY4D 2GITB 4Y1AE 3BQUD 4GG8B 1JI1A 1U91A 2CUHA 3MV9B 1BFOA 1UVQB 4TSAL 3RWFB 5DO2D 1DVFC 2Y5TA 3FO9B 1TQBC 1AHWA 1K8DA 4OF8A 5GZNC 2CSPA 5D7KE 1JYXA 1OT2A 4UIKL 4DUWA 3VWJB 3QUZB 3KPSB 3T8XB 3I9GH 2IAMA 5CILL 4D9RD 3VI4E 4JANA 4HK3N 3ZHKA 1JNHA 2DI7A 4TOYH 3C08L 3O2DH 1LP9B 2FECL 4JQIH 5IV2B 3QEQE 5DJXA 4YEEA 3TPUA 3I9GL 1FRGL 1GYAA 3L5IA 2A6KA 3D3VA 1C5BH 5GQBA 2FNBA 4E42A 1LO4H 5K59F 2XTJD 3HC0B 3QZWA 1WFUA 2FSEB 4DJMA 2QADB 1MLCA 3GB7A 4R90H 4O02L 3ARZA 3MNVA 4AIZB 1EZVY 2ZCKH 3C2AL 1I4FB 1NC4B 2VMFA 3GGWB 4PRAB 4NQVA 5EZOL 3P73B 3RWHA 2R0LH 1IAIM 1BREA 3SKNB 1AGEA 4IMKA 1BBJA 2NCMA 4I77L 2ZCLL 3DVIA 4LCWE 1I9RL 5DRZB 1MCWW 1OARH 4X5WB 1S78D 4JY5H 5F9WC 4D9QE 5CS7A 2R4SH 1S7TA 4YUEH 4A2MA 2BVEA 4Z7NF 5J6GB 1GZPA 2AJ3B 4ZS7L 3AY4A 1FVDA 4M7KL 3RNKA 1YNLH 5C3LD 1J0YA 3QUXD 4XXCA 1OLLA 5TE7H 4PJIE 1CLCA 1YN6A 1DEEA 1YNLL 2BOCB 1UA6H 2C3VB 2DBLL 2MKLC 3P4LA 2ICWB 4UB0L 3SKJH 3L3OB 2KQNA 2C3XA 5ILTL 3BN9C 1UJ3B 3NPSC 4RQQA 2UYLB 3MA9L 1ODAA 4YDKH 3F58L 4P2QB 3CPLB 2DICA 3SDXE 4NDMA 1I7UB 1PKQE 4P2CG 4YFLI 3MXWH 5CEZL 5JNYA 1N5YH 3M1BB 3LB6D 4BQCA 4X9FA 4BZ1H 2VLKB 2X4NB 4P4KA 4HWBA 3TT1L 3S35H 3HC3H 1S7SA 3JWDH 4NNXB 3NIGF 2ITDA 2C4FU 4XNQB 4OZHE 2VR5A 2DD8H 1MHCB 1KGCE 4KUZH 1H5BA 4X4ZA 3VXPB 3IAQA 3OXSA 5HJ3A 2IBBA 3SE3A 5I1KL 4NC1E 2GFBA 2BNUA 5HVFB 3UTOA 2E6JA 2CDEA 3RQ3A 3GHEL 5FM4A 1NL0H 1IT9H 3STLA 2F74B 3QEQB 1HSAB 4YDLB 4OZHA 1UXSA 1E4KC 4XVJH 4YHKL 4UT9L 4YO0A 2HT2D 3FQUB 4GRWH 4DGIL 1A1NB 5HYJA 4DUVA 2HTLD 1RZFL 2XZZA 1U9KA 4TVPD 5JXED 1WAAE 5BRZD 2ED8A 2P1YA 5FHBH 2Q1EA 5T5NF 1PD6A 3X3GL 1I3GH 4OKVA 3OZ9H 1P7KA 4MAUL 3CX5K 2NNAA 3MGTA 3NMEA 3VH8G 4TNVK 3UXFA 3PWLA 1CS6A 1VFAB 5ITFA 1MFNA 2EIZA 3IXTB 5J89A 4NPYA 1NBVL 1T0NB 1IAIL 4MNQB 5DRWA 5BO1L 3RVVC 5EO0A 5FYJL 3UPRB 3DETC 3TN0C 5E4EB 1JGLL 1JWSB 1TMCB 3IDJA 4NHUB 4OLWL 4PGEB 1MRFH 2W59A 4I18A 1QR1A 3X3FL 1EMTH 5DI8B 3ZDZE 3FN3A 5DD6B 1SYVB 5AZEL 1YMHB 3B6SA 2ZUQB 3KLHC 3EDFA 1R6VA 2BHUA 5ITBH 2WAHA 3HAEG 4PTUA 1KJ2L 2QBWA 4PJAE 1A7PH 3HR5B 4YK4B 4G8EA 4XNYL 5ADPH 1XGQB 2NYYC 3AS0A 3B9AA 6FABH 3QQ4A 3QH3A 3EHBC 2OM5A 2L0DA 1NDMB 4XC1H 4FNLL 5BCAA 3OAUH 4ZQKB 3IVKA 2HJFB 1E4WH 4OZGE 4HMCA 2EC8A 3QXDB 3RDTD 3UZVB 1JRHI 3U9UA 1EJ6A 1LO3L 5IVXB 1LK2A 5CBEB 1U8JB 2VLRD 3DECA 3MV7B 4L5FH 1VADA 2R2HB 1A7RH 3K2MC 4CVZA 5AUMA 5CZVL 4FQXC 4GRWF 4CL7A 3MTRA 4QHUA 2FL5A 1HKLL 3NFNA 4PY8J 2W38A 4GW4B 4Y4KC 3CIQA 5B4MD 2WWKO 3TJEL 3OV6A 1O0VA 1RIVH 5IVZA 2FB4H 1F2XK 1ZA3A 1EUTA 1HKLH 1VEOA 4ZUSB 3O2VH 4L1HA 5JOPE 3CUPA 1UEYA 1R0AL 5ICXB 2V2XA 4F7PA 1P7QB 2LVCA 2NY1B 4X7CC 3BPCA 2VDRH 5F6IC 1Q72L 1AP2A 3C6LD 1WBZA 2DJ4A 4AENB 5KS9B 4C56B 1HHIB 1F42A 4N1HB 1TCRB 2H32A 3GIVA 5C09D 2QSTA 4I5BA 1T03H 1JZ5A 1Q9KA 2LVEA 4GFTB 3FHQA 1QKZH 1H3UA 4HSQA 1EEQA 2H45A 1KLGB 2X70A 4DGYL 3C8KB 4GRWE 4HKXA 5DUBB 1B2WL 5IROA 3SGKC 4EQ2A 4B53A 3QUYC 4FQQB 3AMKA 3VFRB 1KACB 4OD2B 4U7MA 1U2HA 3CZFA 3TM6A 5JR1H 1BM3L 1TVDA 2AQ2A 1DN2A 1DBML 4GLRH 2NPLX 3DVFA 2PW2A 2J2ZA 4NCC2 2YRPA 4HJGA 1U8HB 2BSTA 3E2HC 3CMOH 4EI6B 4XX1E 3DUSB 1RMFL 3QISA 2HFFA 4O4YH 1W72A 3MUGA 3HNSH 4YBLC 4CN4A 2OTWA 4JLRA 1CZ8L 1QSFD 1D6VH 1U8OB 2BHZA 4DVRH 4HZAA 2DLHA 4LU5L 5IBTL 2R39A 4OCSL 4QO1A 4H8WH 2QLVB 1KN4L 4EN3B 1AHWC 4F15B 1FC2D 1S5IH 3RRQA 3TCLB 1K3IA 3OKNB 1DQJB 1FE8L 3MBXL 2WW8A 2VDPH 3V0WL 4XP5L 5EN2B 4X7SL 3IU4H 4PJ8B 1DCLA 4HZLA 4X7TB 3HMXH 2NY5H 5LWYH 5T5NG 3DGCR 4K94L 3H9HA 4XGZB 1KIQB 1CXIA 4D8PB 3GM0A 4X9HA 4LKXA 1T0MB 1NLBL 4PTTA 4AM0B 5IB3A 3DBXA 3GSVA 3N9GL 3L3JB 5GGUB 4HH9B 1HCFX 4OB5L 4WWKA 2VLJB 3ZYIA 3IKCA 1I7TA 4GG8A 5D2LA 3QO1A 1P2CB 1RZJL 1WBXB 5E8PA 5CSGA 2N7BA 32C2A 4DN4H 1SMAA 1Z9MA 4BELD 4B50A 1VGEL 4G3YL 5J1SC 1BGXL 3U0PB 3T0WA 1B0GA 1C1EH 4AIOA 4XVUC 4EEEA 1I1AD 3FONA 4KTEH 1UM6H 5GRVL 4L8SB 1P5VA 2IANA 4OF7A 4U1KB 4GMSL 5FYJE 2JJVA 1CF8L 3KYKH 1OSPL 1TJIH 1ZLVK 3GUTA 5J12B 1FGNH 4GAGL 4PGDB 3SEPA 3QUXC 4KKCD 4C57C 3C9NB 1MLCB 3GB7B 5HPMA 3HLAB 5D6DA 4C56E 5E2VL 3GSOA 2VQTA 3VGDA 1QNZH 3JV0A 3ARDC 2X4NA 4PJ9C 1DFBL 2IG2H 4PRAA 1XF4B 4LIQH 3BUYB 4YXKL 1F2QA 3SE8H 1TQCB 3ZYZA 2CXGA 2KZWA 3TO2A 3EYFA 5D9SA 3VXOB 5DVNA 2A74A 3UJJH 5CP7B 5CHNA 4ZOEA 1EHLL 1A6WL 3VGHA 4H26A 4JG1H 3P4NB 2DM3A 2OI9C 1PLGH 3LY6A 2GKIA 1VGKB 4KKLD 2ZP0T 2DQJL 1VERA 5C6TL 2P8PB 3I50H 1K4CB 1CIDA 1YPZE 3GNML 4WJ5B 5GS1A 4P57A 4Y4FB 2ESVE 2Y6SC 2JIXA 5DUPL 3ZDYE 4PJBF 1VENA 3O9WA 4I8DA 4OKVB 1RPQA 4QT5A 4EBQL 4TOYL 2A1WH 4FQ1H 3HI6L 3KPRB 2Z8SA 1E0OB 3QCVH 4JQVC 2BVQA 4JKKA 3DARA 4CJ1A 3O45A 1LVEA 2CDGA 2AK4A 4DZ8A 3ZT5A 1UWXK 4F7EB 3O8XB 4KY1L 2H1PL 1IQWL 2MOVA 3A6OA 5J1AA 1X5KA 4YHKH 4XHQA 3OG6B 5EBMB 1LDSA 3T3PF 1FNGA 1YUHA 2QSCH 1XAUA 5D5ME 4QRPA 4XBEL 3TVMA 1KEMH 4MB4A 3MGOA 4MXWL 3VXMD 2ERJB 3ARBD 1RULL 4R6UA 1AQDB 1ZT4A 2ZOKB 3EYVA 5DQ9B 1NMBL 5F9JB 1L9MA 2XPGA 1KXTB 3S35X 4G9FA 4BZ2L 3BEVA 3HR6A 1UA6L 2YPLB 1U58A 1JZ4A 3BZDA 4OCXH 1WICA 4PRIB 1MREL 5AD0A 3HZMB 5C92A 5F6IB 5LAXA 4NZDA 1OAQH 4JG1L 3IKKA 5L8KB 1S3KH 5M7QA 1DBAH 4ZFOL 3PL6C 3F7YB 2D0GA 3VGGA 1ZMYA 3O0RH 4JGMA 4KGJA 1DBAL 2IPKA 2EIZB 3IXTA 3VRLF 1WLHA 3BMWA 1MFBL 2H32H 3T65A 2WUBH 5IT2L 4X5LA 5JR1L 5EO0B 3UPRA 3CUPB 4J1UA 2DQIH 1A3RL 4MDIB 3UJTL 1EAPA 3L6FB 1EK3A 5GRJH 4ZFZA 3TEUA 2R4SL 4OZGA 5EU7C 1AP2B 1FCGA 3EGSB 5EO9A 2Z0BA 3NACH 1FFPB 1UCTA 1JRHH 2YD4A 3VG9B 5I8OL 5KVDL 4K3DH 3QDGD 4JKMA 1NCBH 3BP6B 2DJSA 2DQUL 3CFEB 3WEXA 3S36L 2CRIA 5DUMH 1UT9A 3WNKA 2X1OA 5GHWL 4OD3H 3PIQA 1CICC 2MKWA 1G7IA 4LSUH 4HKBA 4ZQKA 5T1DH 1CFTB 3GI9H 4QRTA 5C0DB 1RHHA 1Q0XL 5KG9B 3ES6A 2BVPB 1ZWIA 4PG2A 3TGXA 5T1LB 3GSXB 3HCVA 3C5ZC 1NUFA 3TYFB 2GT9B 2V7HA 3OMZA 3RHWK 2A0LC 3O2VL 5ESQA 3KGRA 3N9GH 3QO0A 4YHIB 3RL1A 6CGTA 1NGXB 4UDTB 1MFAL 3CLFL 1SY6A 1N8ZA 3D1MC 2H26A 4ODXA 1U8HA 3H9SB 5IVXE 4GBXD 3LEXB 1N5AA 1ACYL 3SO3C 5HHPB 4UV7L 2FZ3B 1F8TH 3TNMA 4F7PB 5DJCB 3QUYD 5T5FL 1I9JH 1IFHL 4MCZB 5HHMD 3PWVA 1MWAH 2PYEB 4PS4L 5KVMC 4L29B 2GW5A 1R24B 2VQ1B 3U4BH 5ANME 5HHQA 1VESA 4LEOA 4NQCD 3T2PA 3WXVL 1UZ8B 2DF3A 3R1GH 3FFCB 4LIQL 4S1DD 5FYKH 2EYSA 5L2KE 1IAII 3TBWB 5EPMB 3U4BL 2P8LB 4LARL 5JQHC 2H9GB 1HN1A 4DKEL 1OSZA 1YDPA 4HS6B 2CDFA 4ZO7A 3T0ED 2HYMA 4ZTPH 4R4FH 1QVOB 2AEQL 3J7HA 5D7IF 3RVWD 4J2XA 2VIRA 1DQDH 1FIGL 1X9QA 1N7ML 4QTIL 1KCUH 1TZHA 2WQ8A 4KZDH 1HXYA 4PJ9A 2AJUL 3FT2A 4H88L 4X6DE 1P84J 3FAXA 5H37H 4G8IA 3TA3B 3IU3A 4RFEA 3K8MA 1TQCC 4L8DA 1OGAD 2PYFA 2XZAL 4Z7UE 4HF5H 1CVRA 5D1ZD 5T33L 3MV9E 5DSCA 2NXZC 2P46B 1JN6B 2EH7H 1HINH 4WWKD 3BXNB 4POZC 4NN5B 2A9MH 1GC1H 5C0CB 1IEBA 1ADQH 3IFPB 4DK6A 2AW2A 3IJSA 3KPNB 3QNYA 2LTQB 4NC1C 1MHCA 1NEZG 1D5IL 1JHLL 3MRQB 5I8OH 1A7NH 4JKPH 4LLDA 3LSOA 5LGJB 3WJLA 1RFDH 2JE8A 1BVLB 5IHUL 4CADA 2F74A 1NCCH 4AL8L 3TIDA 1QPXA 4LSPL 1N4XL 4P2YA 3MJ7B 5FDWA 3IAGC 2D3VA 4RMWA 4WWID 5D2LF 3A0OA 4QRQA 4DVBB 4M5YL 4MMXC 1S5HA 2W91A 3ISWA 4HW6A 3SCMC 4MJ5B 1SJXA 3OPZH 4J4PA 4YHNB 4HIIB 1K8IA 2NY6C 3GMQB 4PLOB 2YBRA 5D1XA 4M6ML 3MBEC 2DM2A 4UB0H 4DFIA 4J3XA 1VFAA 2L4OA 4OZFG 1NFDE 5JXEC 4E41A 4PJEB 5AZEH 3MCKB 2JJUA 3BPLC 3VW3H 3C5JB 4JY6B 5K9QG 1I9JL 1DUYA 4I0CC 3HMWL 5DA4A 3ARDB 4M62H 2VXVL 1AI1H 1HQRA 3C9NA 5HPMB 5I17A 5JMRA 1N3NA 5DJYB 4NO2B 1WZMA 2J8UB 3V5HA 1JL8A 4HG4J 4I1NB 1XZ0A 4Q58C 2GITA 3RVVD 2DLEA 2F53A 4G8GA 4OM1L 1B0RB 4PTUB 5C09A 4K3EH 1A7OL 5C0AB 4XPTL 1RJLB 1YEFH 1FSKB 4X8JA 5FYJD 5B3JE 4TVPH 2ZOKA 1AKJD 3RWCA 4OTXH 4WW2F 2I24N 1NDMA 2ED9A 3SQOL 3BD4A 2DDQL 1IGIH 5J8OA 3I02A 2GCYA 3SQOH 1LE9B 4AYFA 5IV2A 1U3HC 4OTXL 4KJPD 3EYQD 3LD8C 2XQYK 4KK5C 4MJ4A 4XP9H 2HG5A 5E56A 4XPAL 3SGDH 4KKCC 5HHOA 1JHKL 4R4BB 4OZ4B 4JFXA 2OP4L 2ADGA 2CLZA 1UCBH 1FL6B 1WGOA 4GXVH 2NXYB 2DIBA 4HUWA 3HFMH 3ET9F 3IU4L 3MRKA 4LRNL 4MA7L 1CGSH 3GSRA 1K4DA 1C5DA 4HWUA 5CSZB 3CX2A 5EU3A 4PLKC 1P7QA 1Y0LB 3A67L 1HHGA 3MXWL 4TTDC 1MJ8L 1H8SA 4PJDE 3BYTA 4PJ5D 1U3ZA 2R69H 2NY3B 2WWKT 2WP3T 4KRMB 1JF5A 5JQ6L 4YDKL 4HIEA 2XQBL 2XV6B 1EX0A 3O41B 2ARWA 4P9ML 2KUTA 1KTDB 1R5WB 3LZFL 2NY0D 5AYQA 3EOBB 5CAYB 5JORB 1YN7B 1EHXA 4GSDL 4ZSOA 3FB8A 2FDBP 2QTEA 4OF5A 2VXQL 5ADOH 2PO6A 1LEKB 5F96H 4F8QA 2MWCA 1QPPA 3F7QA 4HJJH 4KK8C 3CZFB 1LEGB 1UQSB 5F97E 1RFDL 5ICYA 2FIKA 4L9LC 3FFDA 4WIQA 1P4LA 5TH2B 1T89A 3V4VH 5IB2A 5MEPA 3N85H 5DTFA 2IALA 4YE4H 4OF3A 5GGVH 3Q3GA 1U6AL 5E6ZA 3SN6N 2BY0A 4PREB 5KOVC 1IQWH 4UILL 3ARRA 1DVFD 4R97C 1HINL 3QFJD 4KJYB 4KVNH 2AI0L 3PWPE 1AXSA 3O6FC 3TVMD 5GS0H 1WFOA 4L29A 3EGSA 1K6QL 1H9VA 4P5TC 2X9XA 4X7TA 3WN5A 3BDYL 3FO2A 4D94A 2NY5L 3L95A 5L0QC 3HUJF 2O5ZH 5H35A 5FA3B 4M02A 4S1RH 1T0MA 1X7QA 4QOKD 3GHBH 3NCCB 3QHTC 2DLIA 2M8XA 3M17B 2JJSA 5I1IH 4WTXA 2CDFB 5FCSH 3SDAB 3CGTA 2P5ED 4JPWH 2IC2A 4OGXL 5B4MC 2YZ1A 1CFNB 4LSTH 5SX5H 4FFYH 4CNIA 5E8PB 1H5BC 1FYTE 2BFVL 3STZB 2VZOA 4NSKA 4GW1A 3ULUD 1FV1A 2JK5A 4MA8L 4XNYH 4P4KC 2FGWH 3U0PA 1EO8L 5FUCC 4WHTB 4B5EA 5CZXC 4C4KO 3LN5B 3HUJA 2VDOH 3VDAA 4HKZB 1OPGH 4RFEB 1DUZB 5IF0A 5ISZE 4I18B 3C5ZA 4Y2DA 1HDMA 3WUZA 1YEHH 2ZUQC 4LLWA 4MZ3A 1JMXA 2G5BA 2R4RL 1NBZA 5L2KA 3L3DB 1TVBB 3I6GA 4RWYH 2O26U 5DA0B 3MJGX 4QXTB 2Q87A 4OT1L 3HR5A 4ISVA 4LSSH 1ETZB 1NCDH 3MV11 1OTUD 1JI2A 5GS2H 5IMMB 2DYPA 1C8PA 4RNRB 1NC2D 3CVIL 2HJFA 1UWEL 4C83B 3H42L 3FFCA 5DD1H 4WI3A 3MV7A 4IRZH 1LILA 1G9NH 1IVLA 1MJ8H 1XR8B 1IARB 1I3GL 5BVJB 5I1AB 5FYJU 4QRRE 5J13B 1U3YA 3TH2T 1OSZB 5DGQA 3SQBA 3ARWA 2X89A 1F00I 5EIQA 1A6VL 1LO4L 2VWEE 1U8QA 4G5ZL 4IMKC 4NZUH 3H7BA 4U1HA 1ZA3B 2X4SA 4OQTA 4P0DA 2WBJD 3QRGH 1L7TL 1CGWA 2JIXB 4OZIA 3OKEB 5ICXA 4G42B 1FFNA 1J05A 3TT3H 4NQTA 1MCLA 1YEKH 4L3CA 1KTLB 1FFOA 4WUKH 1UWGH 2IGFL 2NXZB 4G7YL 3QRGL 3NCJL 2XFXB 4ODTL 5IEHB 1BQLH 1VEPA 4NBYB 5JMOC 4NJAL 3MRMA 1BFTA 5CP3A 3BPNB 3SKOA 4GUPA 4JG0H 3H9YA 4FMKA 1UKSA 3GBMH 4P2RA 4KJQD 5C0BD 4Y4FC 4OD3L 5DHYA 3WUWG 3KR3H 4IOFD 3V4UH 1BJ1H 5EBMA 1FSKC 2X1QA 2ZUSA 4NHCL 3SCMD 3T1FB 4OZIF 3PV7A 2FBJL 3QXAB 1EDQA 3BHBA 1YC7A 5ERWB 3WLBA 1BLNA 2YRZA 2E7CA 1J1XL 3WFCL 5MEQA 3L3KA 2IPUK 4JZJB 4PR5B 2VQUA 3D0VB 3UDWA 4NRYB 2CLRA 2YSSA 2Q7YB 3CXHK 4LLMB 3ZTNH 2PCPA 5I8CB 4X7FC 3RWGA 4LLVA 2X4OA 4XVUD 5ELIA 1R5IA 1W2KT 1ED3A 4ZYKA 2AXHA 3DSFH 4RSVA 1U8OA 4PRBA 1JGEA 1LWRA 2ATKA 3ILQD 2CIIB 3UTSE 4BFIB 1T21B 3BSZL 3ARGB 5AZ2L 2YBRB 4JCMA 2GSIA 4HGWB 5B8CA 1UH3A 1FL6A 1UWXH 3UYRH 2APFA 1A2YA 3QIWD 4W4OA 3QUMH 4LSTL 5I19L 4O02H 4R0LA 3KJ4C 4WI8A 5EU6B 2PKDA 2OSLA 2VR9A 3Q6GH 4MD4A 5CEZD 4MDIA 2OZ4H 3ARDA 5FKAA 5F7EL 3T4YA 3QXTA 3C60B 2GJ6D 4GG6A 5MI0B 1XF5B 1MCDA 3QIBB 2ORBH 3ZL4L 1Z6JT 3DGGB 1AGDA 4W6XB 1D5IH 5BZWB 3WV0A 3QDMA 1O5DT 4YHZH 2ZWLT 1BF2A 3OKMB 3BIBX 1JV5B 5D7IA 4GRLB 1J5OH 5HDOA 5JOFB 1G7IB 5C0JB 1D9KB 4GKNA 2NLJB 5F21B 3UTTA 5F3BB 2ZZUT 2Y23A 3L5HA 2PR4H 3P3YA 4BK4A 1U92B 3X14B 4KFZC 2NY7H 2CR3A 4UTBH 3VE0B 1XF2A 4PJFB 5D70H 3O6FA 3L3IB 2VXTL 4MX7B 5AYUH 1NGXA 1YQ2A 3RIAF 3ZKMD 5I76B 4P5TB 5E6IC 4HIXH 3WD5L 1XIWA 4JFZH 4PGDA 5DZLA 3REWB 2PYEE 4WVRA 5H37G 3FMGL 3DVGA 1S9VA 2G60L 4U49A 3FB7B 1AI1L 2MFNA 3U36B 4AMKH 4AEIL 5F8QC 3KHOA 2ID5A 3VWJA 4JGUA 5CJOL 2PYEA 2BNRA 1Y6KR 2NZ9D 1OARL 5FKPB 2J4WL 3ALWA 2VDOL 1OTSD 3BIAX 3MPCA 4LVOB 4PB0H 4NWTH 1FVCA 4Y4KD 5ALBH 1AO7D 1R3KA 3P11H 3T3ME 3VA6A 3G5XA 2OR8A 3F7VB 1LP9E 3SO3B 5KN5A 4KRNA 4F2MA 3C6SB 4FZ8H 1KULA 4HMDA 2HWZH 2OCFD 3RP1A 2IMMA 4ZAKA 3LMJL 4N0YH 4FXKB 3WHE0 2PO6B 1MRDL 1OWWA 5E00A 1YMME 5EBLA 4UU9B 3HFML 5GRXG 1S8DA 2QKIA 4ONOA 4YWGH 1CF8H 1KLUA 3KYKL 4Y19B 3TBVB 1FL5A 2UUDH 3U7WH 3U82B 1UCBL 3MZTA 3HHRB 3T8XA 4XI5C 5HHXH 4X5WA 3D2UB 1NFKA 5A2FA 4PIRF 4M3KB 1XH3B 3TNNB 5GS0L 2X4QB 4IS6B 2XIDA 1M1SA 2EDFA 3ULVH 3MLVL 4WGVB 4CKVX 2ESVB 2NY0C 4PREA 3L3GA 1A0QL 1OAXH 3C5ZD 4HUMB 1KB5H 5FUCE 2HFEB 4W6YB 3UYPA 4QKXB 4L3AA 1F58L 4NP4L 2FHFA 3FQWB 4ZFOA 2ICWA 4K7PX 2AABH 3VXNB 1HZHL 5B38G 4IRSA 5AZ2H 4LSQH 3BEVB 1NC4A 1X3DA 3O2WL 2E7LA 4E5XA 1YY8A 4POZD 1E6JH 5H8DA 4WHYG 1YEDB 4RGMC 1AGEB 5DUPH 4MAYD 1IAOA 4QXUL 4YPJA 1EERB 2B1HL 2HKHL 2VDMH 2NZIA 5F96L 3B2VL 1G7MB 5IBTH 4GG6F 4FMFA 3FTGA 2VXUH 2FYYB 3CJJA 5SV3A 4DVBA 1GGIH 1QP1A 4ELKB 1SM3L 1ZHLB 2R9HC 3R8BB 4XVSH 1A4JB 5MP6L 4TULL 2Z35B 4M7LL 4H8WC 1HIML 3HNVL 4BH7B 4L8CA 4JPIB 3V4UL 2DM4A 2AK4D 1UJ3A 1KT2A 3LHPH 1BECA 3FRUA 1MRCH 3SKMA 1FFPA 1Y18B 4R90L 1KJ2B 2NW3B 1YYLL 2NX5D 1C08A 3CNKA 1RI8A 4JY6A 1RZIB 1AE6L 4HX1B 3UTSA 3CFKA 4X0KA 4P2RB 4DGYH 4ZUVA 2C1PA 1T80A 3MR9A 4JFZL 5IWLC 2NXYC 4D9LL 3Q6FB 1L6XA 4NM8L 5EU5A 3MLRH 3P4OB 5CD5D 4TSBH 1J86A 4GH7B 4IIQC 4F37K 3PABB 1CXFA 4K9EL 4ZFFB 4WO4B 3N06B 1PY4A 1BGXH 3I75A 2E8ZA 4YX2H 3VFOA 1EPFA 4D9RE 1J0KA 1VFBA 2VL4A 3OHXB 4H0GA 1DQQA 3QO0B 3ARVA 3EJYD 3DV6B 4YPGB 5SWZE 3U4AA 4JRYB 35C8H 4K23L 1CTNA 2IFFH 1E4WL 1CQKA 1CLZH 3F12A 3V95A 2XWJB 3MYJB 1DQLL 3PJSA 3DIFB 4K55A 5SWSA 4YHZL 1YEEL 4G6AC 3JV4B 2FZ3A 4PRBB 1WSST 1I7ZA 3C60C 1OD7A 4PRPD 4X99B 3D6GA 4ORZC 3EO1B 4X6CB 3U2SA 1JPGA 2DB8A 3NTCH 4OT1H 3EO0B 3X3FH 2FX7H 3MRKB 4QTIH 5IR1B 2ITCB 4WEBL 4E9LA 1CYGA 4H8WL 5DRWB 1P84K 2IBZY 3PWNA 5GZOC 2ICEB 3G5ZB 3TFKC 2AV1B 1CXLA 4L4JA 1RURH 2YHGA 3CFCL 4I4WA 2MQCA 2KPNA 2BDNH 5F3HA 2ARJA 2J4WH 3U7AA 1CLOL 4MJ6A 4KAQL 1S7WB 2CD0A 1R5WA 1ZGLA 5E8OA 3T77B 1IGFH 1MWAL 3VFPB 1MVFA 1H3PL 1FH5H 1KJ3L 1F6LL 1U93A 2CKNA 2PXYD 4M7JH 4NGHL 4XCCL 3SDCD 4HWNA 1WAAA 4NT6A 2ZOLB 2NTSP 1BVZA 2R1YA 5E99L 4CMHC 3STBA 1N0LA 1B6DA 1IQDB 2K1MA 5FOBA 1HHHB 1Q9KB 1LP9A 3QZWG 5D5MA 4XPHH 4KJQC 4UOJA 2EEBA 1W0YT 4Q74A 3GRWA 1RZ8B 1CWVA 3SDXF 5IVZB 3QDME 5EBWA 4LL9A 4XPFH 5HYSB 1YYMH 1BFVH 3X17A 5GS0C 5EBGA 1C12A 4PGJA 4G6MH 4JFEE 3MOBH 4OCMC 4ZNEE 3MLVH 3B5TA 4MD4B 1S7VB 1E27A 3ZSSA 3CFJB 3SDDC 1A6ZB 3SPVB 1J0IA 5FKPA 3FO0L 3MLUL 3O9WC 2EE9A 3UTPE 3MLRL 1TCRA 3GIVB 3SGJC 2XG5A 3TBYB 4RGNE 5F93C 3Q0HA 2Q8BL 2X89D 1MPAH 4LSRH 2FJHB 2Q3AA 4M1DL 3RY6C 3AU1A 2YD6A 3HNTL 4L4TD 5GISL 1S9XB 1LMKA 2EDRA 4GRMA 2DQIL 3CVHB 3CH1B 3BO8B 1JGDA 1DDHB 1RVFH 1PX3A 2JCCA 2XWBB 2EDOA 4ZD3L 3BSZH 5SWSD 4E41B 2AGJL 4F33A 4XNUL 2JK5B 4GAJH 4I77H 4OI8A 1DQMH 2VDQH 1ORQA 3ROOB 4JDTL 5CINH 4ZPTB 3IF1B 1ULVA 2DWEB 3FQXA 4Y2DD 4YC2B 3CU1A 3BGFB 1S7SB 4P4KD 4E0RB 1CGSL 4CVXB 5IFHL 32C2B 1CK0H 4IOIB 4NKDB 5C0AA 2VLLA 2YPVL 2APTA 4PRHE 4YXLH 5AEAA 3K0WA 5TE6H 4RGMB 1HYSC 3O4LE 2E27L 4X6EB 1MWAB 1T1YB 3TF7C 3QEQA 5EULV 1T03L 3H3KA 5JZ7D 4MXWH 1MNUH 3EFDL 3IB4A 1UADC 3FN0L 4LAQL 4M5ZH 4Q9QL 2Y06L 3DV4A 2ADJA 3RU8L 3RPKA 4YXHH 3EO9L 1EVUA 2Z31D 4YX2L 3R06B 4HLJA 4X4ME 5C2UB 5E2TH 1NFIA 2BSSB 2GSGB 4WI6A 1FL5B 1G7HA 3IDYC 2Y36H 3VD9A 5LCVH 4K3EL 1INDL 4UZGA 4HIHB 4LCWA 5CHNB 3T0XA 2VDKH 2Z35A 5DC9B 3P4NA 2C3HA 3DYMA 3GJFA 2FJGB 2BC4B 1DBJL 3AAZA 2X10A 4XP1H 3LEYL 4G7VL 5LJYH 3CFBB 4EDXB 1CD9B 5J56B 3LIZL 4JZOB 1LDPH 3G5VA 5L88H 3LH2H 2DQDH 1I3RB 4YGVA 3SKOB 4NN6B 1CTOA 4MNGA 3SGEH 3GUTB 1JNLH 3ZKXB 4AEHH 2QQLL 4Z8FH 1G7LA 1SY6L 1KELL 1NC2A 4IRSD 4FQJL 3UO1L 3C09B 4ZSOB 4YFDB 3Q2CA 1QFWM 5K9JH 4GLRI 2A6IA 2A77L 5A3IC 1RURL 4D9QD 4ELMB 2BJMH 3NFPB 2R1WB 3EJZD 2FLRT 3GK8L 3OHXA 5DDHA 2XI9A 4OCYL 3O3UN 3VD5A 5HHNB 3MFFA 4TUKH 3QQ9D 1YUHB 3G6DL 3GZKA 3FB6A 4G8GE 4ODHL 2V5SA 3OF6A 5CZXD 3JWOL 3O6ML 3VXMA 3MV7E 2VO5A 4YJZL 4RFNB 4NRZA 1UM4L 3TPKA 5E5RB 4KTEL 2A9NH 2IADA 5BOPA 1SQ2N 3B5GA 2ZNXA 1XGTB 4ZAKD 4POYA 3WL9A 4G3YH 1AXSB 1V3MA 3AS3A 2BSRA 4Q9RL 1A2YB 3FRUB 3SKMB 5ANMB 5FO8B 4C56A 5HYJE 2XZQH 2A6DA 1Z3GL 5EUKB 1KJ2A 4F7CB 4UAOB 3TP4A 5HGHA 1MJ7H 4W68A 4P9HC 5TDOA 1GIGL 3QCUH 5SWZA 1BF8A 3RUGE 1J1OL 2X4RA 3W0WD 3DO7B 1DL7L 4GG6B 2CR6A 1ZK9A 1K6QH 3GBNL 3GEWB 3ZKSD 4JFFD 1FAIL 4YWGL 1G9MH 3DHMA 1CDUA 3F65A 5HDQH 5F9JA 3KJ4B 3MRJA 4MJIA 4X6DB 2MQ3A 4HWEH 4P23D 2PW2B 2Y25A 1PKQA 3DXAA 4M93C 1LO0L 3FT3B 4OSUL 1X5XA 1OM3L 4ENED 1U58B 3F58H 1DUZA 4EQ3A 5KAQF 4PGBB 3OKOB 3WYRA 3MV01 3O81A 2IH3B 4PJFA 4CVUA 4LDOB 4NN7B 5I1HH 4ZUTA 2C3GA 3SDDB 3QUKB 4P2QA 5DD5L 3JV5A 3BWUC 4P9HH 3VXSD 4FOMA 2VITB 4XMLL 1MUJA 4HV8A 5CJOH 4BYHA 1CFTA 4TPRH 4Z7NE 4M62L 5E5MB 3D0LB 4PJ8A 2GT9A 3PHSA 1LD9A 2J5LB 1J8KA 2RCSL 1RQ5A 4OV5B 3KPSD 3TWCL 5E6IA 1QRKA 3HPLB 4YIQB 4IOSD 3QEUB 1A9BB 3MBEB 3M8OL 5IMOA 2BNRD 3RZCC 4UMGA 4DKAA 4QXGL 4NHCH 4OLZH 3D69B 4XCFL 1RIHH 2V5YA 3SGKA 1ONQB 3DUUB 5EU6E 1A9EA 4P2OB 5TGBA 2QADD 3QDJD 3EYUH 1VFUA 1JWUA 2R29L 4MA7H 5I2IB 5JXEA 5KJRL 3WE6A 4UT6H 3MLTB 4DEPC 3LQZB 4UIMA 5DEZA 5J7CC 2NMSA 1QG3A 2YMXL 2H8PB 2NY5C 5CWSB 4Q2ZA 3TLRA 5T3XL 4DGVL 3O3EA 3RBGA 2LTQC 3CFDA 5BV7H 2XFXA 3U0TB 4DTGH 4TTDD 5DJ2A 3T2NH 5A40E 4GJTB 3FN9A 5L8JB 3D25B 4I18C 1P1ZB 2V2TA 5C0FA 1DLFH 4O2EB 1NGQL 1AGFA 1IC5L 3JVGA 4WFFD 2VKXA 4EUPH 3SDXA 2OTUA 4WV1B 2VDPL 4P4RB 4LVNC 2X4QA 4KMQA 3UROR 1VACB 3JSSA 1GGBH 5T1LD 1INEH 3PV6B 3V6FB 2FGZA 3NFSL 3WJLC 4CVXA 1YEFL 2DQFB 5ADPL 2A9NL 4HJ0D 1UM4H 3AROA 3ULUC 1AXIB 4PD4K 1CDGA 4XB7A 2A73A 3KJ6L 2IF7A 4L8DB 3MRBB 5DXWA 4GBXB 3OKKA 3VI3E 1YJDH 5KVFL 3BVNB 1JMZA 4NO0A 3WFBH 1NCDL 3E6HA 4L3EE 4PJIF 2PYED 1TZGH 3ZTJH 1T6VN 4N1EA 5AAWA 2XYCA 5EOQH 2ENSA 4OM0L 4QHKI 4HFWB 5AWNL 1NBVH 3VXRE 5I1EH 4NYLB 1BPVA 2E6PA 3QEQD 4QCIA 3VGBA 3O9WD 4YZFE 1HYRC 1FLRL 1AXTH 2ICCA 2XKNA 2AEWA 4F15C 1XF5A 2PYFB 3QIBA 1WBZB 4NBZB 3ZKQD 5I1IL 5J6HA 4FA8A 5BRZB 3BZ4A 1FNLA 4N9GA 4TNVF 5F1NB 4PJ8C 4HLZG 2G75B 4S1RL 3EYVB 5KW9L 1G7JA 3TBSB 1INDH 4OCNC 4D2NA 3NA4A 3DRTA 5EC1A 5GRZA 3RTQC 1KCKA 5GGRY 5DUBA 3T0EE 1J1OH 2X4UB 4FFVC 3IDNA 4G6FD 3OKLA 3V5DA 2GJZB 3KDMA 1WVZA 2Y07H 4FQQA 3AB0B 2XWTA 1OL0A 1Q1JL 4KQ3L 4WDIB 3VFOB 2XTJC 3O6FB 2VL5B 3X13B 5DRXA 2DBJA 4MNGE 3QFDA 3Q1SL 5KVEH 2IQAB 1BVLA 2ADJB 1H15B 5JPNA 3MFFB 2GTWA 5IMKA 1LEIA 3QIUC 1MNUL 4K7PY 5ALCL 2ITDB 2ZUTA 1MJUL 5ESVA 3UJJL 5I71C 2DQUH 4JREB 2MCG1 3S88H 1NAMH 3GMMB 3CK0H 2OTPA 3EJYC 3V4VL 3MRFB 1JRHL 3BE1H 1BOGB 5BV7C 2HT3C 3NIDF 1C16B 3MV8D 4N5UA 1EFQA 3BN3B 3RVXD 5D1QA 3MYZA 1FIGH 1QFOA 3GK8H 4Y16D 3BH8B 4PV8A 3CFBA 5C07A 5IJVB 3O11B 1I1FB 2PF6A 4G6AD 5I6XB 1XEDA 4JZOA 1AR2A 1T0PB 1SMOA 2VUYA 4KMLB 3CVHL 2NTFB 5E94B 2ATPA 1PFCA 3C5JA 1F3JA 4CMHB 1T7ZA 2HLAB 3WFHA 5GJTL 5D7JB 4H1LA 4XPGL 2NR6C 4Z7UA 1WWBX 3MUJA 3W39A 5JQ6H 3TV3H 3DX7B 4XT1C 1OM3H 1J10A 2N1KA 4ORGA 1JNLL 4AEHL 1Q9WA 3HE6C 3L1OL 5FECA 1FNHA 4ODVH 4DZBB 3ARBA 4X6BB 1F4YH 4JFED 1OB1B 3LEYH 1ORSA 4U2YA 2VSCA 3BKYH 2GAZA 3WXWH 5CUSH 4EZMA 2Q8AL 1L0XA 3ARSA 3IFNH 5IEKA 1ZT1A 2ZJSL 2AXGA 2PUQT 5I0ZA 1GIGH 4XP9L 2MTPA 2OMBA 3QULA 1CFVL 4QHLA 3ROLB 2AI0H 4HV8B 4MSWA 5D96C 3D85A 1HOCA 1WFTA 1C12B 5J12C 4HMEA 4E5XB 5JW5B 1TFHA 2IJ0C 1YPZA 3EYFB 1P4LB 4FQLL 4GW4A 1UM5L 3BYYA 5IFJA 5HYSG 4XPTH 1P4IH 2H9GA 3GDBA 4JANB 4DK3A 3ZE2F 4HIEB 4HUKB 3PQYA 1Z5LA 2F8XC 4TUKL 2DN7A 1MIEH 5C6TH 1I1YA 1NGZB 1TVHB 4P57B 4Y4FA 4FQHB 4V1DD 3WFBL 1A1MB 5CJQH 1A14L 1NEZA 4FZEL 4HGMA 5ACMA 3VJ6A 3LQZA 2VDQL 3QNZA 5FHAH 5BVPL 1B2WH 4WEMB 3TESA 4MD0B 4UQ3B 5GXBB 3GRWL 2V7NB 2EDBA 2R0KL 3VFGL 2R2CA 3NVQA 5F44A 4PLJD 1ZGLM 5IB2B 2PNDA 1YMMA 2YR3A 4OSUH 5JHDB 1CVSC 5J1AB 4JG0L 1T7YA 3QUMA 4NJAH 3Q3GB 3VFRA 2VLRA 3G6AA 4J8RB 1QTYT 3GMPB 1WIPA 3DX8B 5DJ0B 3P4OA 4IDJL 2J8UE 2O5YH 3PG2A 3W9DB 1NMBH 3VXTB 4KDTA 5HHOE 1FBIL 1FG2B 1QACA 2PTVA 3B9KB 4I0PD 4P46C 2JCCF 3T2NL 4FQXB 2AJZA 5IF0B 2EICA 4XI5D 1DN0A 5I16B 5D70L 4JRYA 4KJWC 4KV5E 3ZKMC 4APQD 4G5ZH 2FX8L 3LQAL 1GPOL 1PZ5A 3S3JA 2UZXB 1MH5A 3CDGA 4Y4HB 4WNQA 4M5ZL 2R15A 1BZ7A 4EN3A 4I3RL 3WE6B 3MLTA 3LRGA 1XGRB 3OAUL 3OKNA 4KVCH 5EOCH 3M1BA 1PEZA 4YHNA 1JK8B 5I8EA 5ID0B 1BJ1J 3LCYA 3O3EB 5ENWB 2DTSA 1NGYA 1AO7E 4HWBL 3VXSA 1VB9A 3I84A 3N85L 3T0AA 4WU7B 5JW4Q 4KXZI 4U3XA 3H9HB 4HIHA 4LCWB 1P1ZA 4G80B 2OYPA 3G5ZA 2DOCA 1RUKL 1QFHA 1UYWL 2EDNA 4K71B 3N1QC 3GMRB 4HKZA 3UJTH 1BX2B 1AGCA 1TZGL 4F9PA 1JYWA 2VXSH 4PJIB 5AG8A 3EKCA 3PV6A 2P47B 1A1NA 4YHML 3ULUL 2X7LB 4P5MB 2P43B 1WTLA 4TN9A 2DQFA 3HNVH 1OCWH 2FATH 4N0CC 1ETZA 2H2SD 3WHXB 1WQVT 3W0WA 5C0IB 1QNZL 2R1YB 3VG9C 4MQTB 4JFDA 1XFPA 3MREA 2ZSVA 2Q6WB 1HHJB 4Y5YB 5CJXA 2HKFL 4MNQA 4PJGF 4UV4L 4WDIA 4YAQB 3FOLB 1P53A 3S7GA 1LO2H 4Z7VE 4MWFB 4EUPB 5LQBL 2YXFA 2B4CH 4BZ2H 5I18H 1F8TL 1EFXB 3VRIB 1RJZA 4FFZH 5K9KA 1JGUL 3WFZA 2H26B 2HRLA 4KDVA 2VDNL 5F7MC 1RK0A 3VXMB 1Q9LA 4ZUUB 1QQDA 1XMWA 5I1KH 3QNXB 4Y5XB 1HZHH 2AJYL 3FJTA 1KCLA 4XPAH 5A16B 1NUDA 1OHQA 4YNYB 2V9QA 3MRHB 3MV9D 3QQ4B 4KY1H 2IAMB 2APXA 3IJHB 2E7MA 3KPOB 5D2NB 3VWJD 5CEYA 2BK8A 3UTPD 1TTGA 1WISA 4F7CA 4EDWH 1LE5B 1EAJA 4JJHA 5INDB 4HIJA 5TDOB 1I1AC 5DUML 3GIZL 2J6EA 3EOBA 3MRLA 5DYOB 3HUJE 3QQ3A 4KPHH 4N8VB 5DHVA 2X4RB 1KEGH 5EC1B 4Z7VF 3E3QE 5IFAL 4DGVH 1DTUA 1A6PA 4Z7UB 3RVTD 3DHJA 1QVOA 2XTJB 4HEPG 4X4XB 1L9NA 1I8IB 1HHKA 5KSUA 1KN4H 3HB3D 4NQVB 1DQDL 1BQHA 1WZKA 4ONGH 1A6VH 2HKFH 2DQJH 4DZ8B 4B0MM 5JLZB 5C0BB 1OP3H 3ETBF 3TZVC 4PB9H 3MRJB 3TFKD 3LN4A 4NQCE 5DD3L 4ONHA 2YKLH 4PJ9D 4IRZL 5TH2A 2Q7YA 4KXZH 4X6BA 2YPKB 3I3DA 2JELH 2KZ1B 1S7UB 4M6MH 1JF1A 3IRZA 3RNQA 4ETQA 5I1HL 1ZT1B 2AXGB 2J12B 4YR6B 1WJ3A 3F7PC 2DQCH 4IRJB 3BWAB 3TWCH 3B5HA 2XNAA 4Z7WE 1MEXH 2QQKL 3BXNA 2E7LC 3HG1D 5IHZB 3RPIA 1FN4B 3HE6D 4OJFL 1MJJA 3S96A 3MODL 1B88A 3MV8E 2Q7NA 2B5IC 5KAQG 4PRIA 3DUHA 3U48A 5MERB 2Z91A 2X1XR 2VDKL 4PG9B 2OP4H 1CE6A 4WFHE 1A6TB 4H5SB 5FKAB 5IHLB 1RULH 4G43B 4MXVE 1BBJB 1D5ZB 2F5AH 3RGVB 1TQBB 1HH9A 2Y5EA 4MAUH 1KPVA 2IANE 2C3WA 1B9ZA 4Z7UF 5FCUH 4OF0A 4D0BB 1Q9OB 3CC5A 2XY2A 4JLRB 4LQFH 1GZPB 5GRUL 4EI5B 4OLUH 4PRHB 2HT3D 1MCKA 3MOBL 1MHPH 4Z0XA 1NBYA 4RAVA 5IESL 1DEEB 1U36A 3KVQA 5DGRA 3JWOC 2M26A 2W0KA 3QIBD 1LK3L 3QCTL 3S5LG 1QFUH 5DT1L 2E27H 4NZTH 3S98A 4KMTL 4LPVA 3MLYH 1I1RA 2OL3H 4UNTA 2QADC 3QDGE 4JKLA 5DJ2B 1R5VA 4Y1AB 3L9RB 4RQQB 5C71A 3ULVF 2FEDD 3I50L 4ZFGH 1CL7H 5I18L 2EDQA 3PWJA 4WFGD 3L3JA 2QJDA 2R0WH 2YZ8A 2WBKA 1S9VB 4FNLH 1HOCB 5F6HI 4Z76B 3DROA 1ZLUK 4KGLA 4QRPD 3NZHL 5B39A 4AEFA 5HYQB 4GAJL 3S4SB 1KJ2H 1OGAB 1CXEA 3GRWH 2CKBB 5DDHB 3UO1H 1OTTC 2V5MA 1MAKA 3OR7A 3QPXL 4JR9L 1QYGL 3E1F1 4PY7B 4R26L 1HSAA 3TC9A 4NKMA 1UXSB 4POUB 4ONGL 5C0CD 1M7IA 2JB5L 1DLHA 1RUML 4QXUH 5CZKA 4PYHA 5ABDE 2NY6D 8CGTA 4D0CB 1J05B 4WI2A 2W0FA 4RAUB 4HD9A 4RGOL 5I66A 5IROC 5AYUL 3S5LB 4LHUA 4L8SC 3WHE1 1KB9J 1AO7B 1O7VA 2PR4L 2QQLH 4XXDA 4P99A 5LXGH 2UY7A 4Y8AA 1INEL 1HILA 3PWPD 3IDJB 5FB8B 3RU8H 5HGDA 1FO0A 4KI5E 1XH3A 3TNNA 1JWMA 2ZCHH 1JUFA 1MCCA 3BKML 1A1OB 3AREA 2OJZL 4Y19D 5DJ0A 3G6JA 1ZV5A 3CCHA 3NIFE 1A6AA 3B6SB 4U6XA 1ZA6B 4YLQT 4QEGA 3EAKA 5KW9H 3BX7C 2B8OT 4ODWA 4RWHA 2YA1A 3S35L 3BP4A 1IBGL 2CLRB 4JFOA 1F4YL 1G0YR 3TIEB 1P7QD 4HDIB 4YXHL 4MA3A 4NZUL 4K7FA 2O5YL 1GHFL 2ESVD 3IVKB 5I19H 5DJDB 1MELA 4HLZH 1OAYH 4M6OH 1EXUB 5KZCD 1H3PH 4ZYKB 3CFKB 4JO3H 4CDHA 4PP1C 3QFDB 3OGCB 4LU5H 1KPRA 1IEBB 2YD9A 5E1HB 4UINH 4OD1L 1MFDH 3V5KA 2V17H 2GEEA 5D72H 2OS7A 1HIMH 4A6YB 5C0AD 2H2PC 3WKNA 3MGOB 4OM0H 4YHMH 3QUXA 3CVHH 1A4JA 5A3ID 5E8DL 2FJFA 2OSLB 3P40A 4N0UA 5D1QB 1UKQA 3L3HB 3V6OC 2HFGL 1S7XA 1AY1L 5I1CL 2AK1H 2OQJA 4HUUA 1AGDB 1QRNB 2AQ1A 5E94A 5DD5H 4LF3B 1ONQA 3DUUA 5DQJB 4W4OC 4X0KB 4HIJB 1TJHL 3O2WH 3H9ZA 3BP7A 1OAKL 2VN4A 3OKMA 1X7QB 3F7YA 4OCWL 4N8VA 2FD6L 1N6QL 5J57B 1FZJA 3Q6FA 2YN3A 3W81A 4FFYL 3OAYK 5K9QI 3CSYA 1D9KA 2W9EH 3EO0A 4GKNB 1QSEB 3IT8D 3ARYA 3QHZH 1F58H 4RAHA 4U2ZA 1OAYL 4S11A 4WWKC 1BQLL 4PJAB 4PV9B 3FHAA 5IQ9B 2Y07L 4PJ8D 1RZJC 3D25A 2E9IA 1T2QH 5D96B 5FECB 5JIHA 4A6YH 2UWEF 4D8PA 1CFVH 3BH9B 3T3PE 1WCBA 4JO4H 4OZGB 3FB5A 4KHXH 3WS3B 1PDKA 5IIEA 1RK0B 3ECBA 1IM9A 5T1KA 5IW6A 1Z9LA 4XMKL 3BKJL 5DJ8A 5GRVK 5J3HC 4PGCA 4UIKH 3T77A 4X7SH 3SGDI 5A16A 1JE6A 2JB5H 1EGJH 3C5SA 1YY9C 3QSKB 1FNEB 4ZOCA 4TQEL 1KN2L 1YQVH 2YC1B 4JRXA 4UOW0 3WFDL 1GSMA 5KG9A 1MJJB 5IR1A 2FX9L 3BIKB 1JGVL 1I1AB 4BFEA 1RUQH 2QQNH 4FFVD 4RMQA 3PWNB 5ESQB 2HTKD 5D8JH 5H2BB 5J9PB 3NBNA 3G5XB 4IMLB 5IGXH 4X98B 4Z7WA 2ADGB 2CLZB 3OJVC 1A14H 4FZEH 3CXDL 1T3FB 4Y16C 3QA3A 5HYSA 1BVKA 4HJJL 1KENL 4Y5VB 4OCXL 3IKCB 4P59L 3O8XC 3LS4H 1S9KC 2JJTA 1FFRA 2YUWA 3G04A 1MY7A 4JR9H 4WEUD 2BRRH 3LAFA 1T4KB 5CKGA 2YPKA 5K9JL 1CG9B 3MV8A 3VDCA 4MA8H 4OGYL 2V7NA 2DIAA 4YBHA 2EE3A 1YEEH 3NGBB 1EA9C 4JRXD 4QOKB 5B38A 5D93C 4CN6A 1FG9C 1T20B 1AFVL 2O5XH 4J12A 5F1NA 2PXYB 3VG0L 4XBGA 2JJTC 3LIZH 4KRPC 2H1PH 1Q8MA 2VDRL 1MHPL 3FQWA 2DQHL 3WO4B 4PRNA 3BESR 3RVTC 4QT5B 3A6BL 5H94B 4UT7L 3WNLA 3MA7A 3HB3C 3RIFK 4NCC1 8FABA 2D9CA 1LHZA 1BQUA 3IDIB 3QIBC 1MCJA 3KPRD 1QUNA 3QIUB 5B39B 3C6LA 1FLTX 3MRCA 3B9KA 5ID1B 1R3JB 1MLBA 1YEDA 1MFAH 1WF5A 2EC9U 3CLFH 5FGCE 3V8OA 1U8LB 4TSCL 3SPVA 3IU3B 1BD2E 2GJJA 4NRYA 5C0CE 4F58H