3OKDB

Crystal structure of s25-39 in complex with kdo
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
221
structure length
218
Chain Sequence
b'EVKLVESGGGLVQPGGSLRLACATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQSSLYLQMNTLRAEDSATYYCARDHDGYYERFAYWGQGTLVTVSAAATTPPSVYPLAPGSTNSMVTLGCLVKGYFPEPVTVTWNSGSLSTGVHTFPAVLSSDLYTLTSSVTVPSKTWPSETVTCNVAHPASSTKVDKKIVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-39 Fab (IgG1k) light chain
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 218
sequence length 221
ec nomenclature
pdb deposition date 2010-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okdB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okdB01
5ESQA 5B8CC 5JMOC 1QEWB 3MCKA 2NY3D 1KCUL 3VFTA 4J4PA 1LEGB 2AW2A 3HB3D 2ZCLH 4K7FA 1YMMD 4L9DA 4M93C 4JREC 5FV1L 4U6HA 3RY6A 3AS1A 3NGBC 3HC3L 1E6JL 3MNWB 2VLJA 2CJUL 1CCZA 1DSFH 4DOHE 1IGYA 4OJFH 3PGFH 3ALXA 4MJ4A 4WRLA 3U48A 2JE8A 4ZPVA 1RMFL 1AY1H 3RZWA 3STLB 4GXVL 5EH1A 2A1WH 3O11B 4I3RH 4JFHD 4HH9B 2IQ9L 3QDGE 3KPNA 2BVTA 3V6ZB 3REWB 5F1OB 4LCWB 3BKJL 4Z7WA 5IM7B 3MGOA 4JFEA 2CDGB 5BMFH 5BXFA 2VKWA 5C3LD 3CVIL 3WDJA 2BVUA 3WNMA 3VD4A 3W81A 2A6JA 1TETL 4NN6B 1Q9WA 5JDSA 3QH3A 1FZJA 4JFFA 5J06A 4JGMA 2JKXA 3QUZD 4MD5B 4GRWF 4N1CA 2DLHA 5INCA 2XQBL 3P9MB 4UDUB 5JHDD 1S7RA 5GGSA 4GLRI 1MRFH 3UTQB 1XF2A 3MQIA 5HGDA 1KGCD 3DJ9A 5CEXB 2UWEE 2UYLA 3WS3A 1Q9KB 3H9HB 3MFFB 5FA3B 2ATKA 5DTFA 1BF2A 4JZNA 3DLQR 3LRSA 2B1HL 4NP4L 1EX0A 3TVMA 3L7EB 1QEWA 4HXAH 1AQKL 4TULL 1MRCH 4RMTA 1ZA6A 4NO0A 4XT1C 3UJTH 3CU1A 4JQXA 3MNWA 2QJDA 3C08L 1W72L 4LSTL 4NQXA 5AYUH 3UYPA 1PSKH 4FNLH 2Q76B 1HOCB 2Y07L 3DPBA 3O11A 1OTSD 1D5ZA 3CFBB 3QQ4B 3ZTNL 3NIGE 4ZO7A 5KSAA 5KS9E 3V6ZA 3REWA 2WP3T 4LCWA 5IM7A 3VA6A 2FX9H 2CDGA 4ODTH 2CMRH 2EYSB 2FX7L 3DETC 1G7LB 4CU6A 4EEEA 1ZLUK 5J9PB 1K4DB 2J6EH 4XGZB 1UB5A 4LEXL 2Z4QB 4CAGA 4K23H 3FQRB 5C07D 3V4PL 1B4JH 2E6QA 2LTQB 4OF7A 1E4KA 4JHWL 4U6VH 5ACLA 4MD5A 3CC5B 5I1KL 2YKLH 4UDUA 1IEHA 2OK0L 3BP4B 5CEXA 3WYRA 1FLTX 1Q9KA 1A6UH 3H9HA 2HKHL 3MFFA 4H88H 5FA3A 2JCCA 2FCBA 4NGHH 4XB8A 4C56A 4ZD3L 2L4OA 4LNVA 1MAJA 2D4DA 2MKLC 4IRSB 2E9BA 2R0LH 3L7EA 1V7NH 1T5XB 3LHPH 3MRJA 5EOTB 2H2PD 4HJ0D 3BIKB 5JW5B 1NBVL 1WAAE 5I1CL 3TFKD 3LKSB 3VXRD 3G04B 3SE3C 5CJ8A 2PCPB 1EXUB 4Q9CA 5BVPL 3C2AH 1IE5A 2MWCA 3QR2A 4PJ5B 5EC2B 2Q76A 1HOCA 3OZ9L 5TQ0H 3BE1L 3CZJA 4PRPD 1W0YT 3CFBA 5HXMA 4D0BB 3PP3K 4WIQA 2NYYC 1RY7B 2AEQL 1FQ9C 2DLGA 5AZ2L 3VXME 3SGKA 1EEZB 2EYSA 3W0WA 1G7LA 5J9PA 3U2SA 1KCUH 1BFSA 5JQ6L 1LWRA 4XGZA 1I7TB 2Z4QA 5D71L 4XC1L 1A6ZB 3HC3H 1E6JH 3CC5A 2CJUH 2YD8A 1T22B 3H9SE 4U1NB 2P5EB 3GZKA 1QSZA 4RWYH 1EUTA 1OGAD 4J12A 4XP9L 5D1QD 4X0KB 3U30C 2NY4D 5FO9B 3SDYL 1F45A 3LRHA 2D7TL 5FGCE 4FFVC 4GXVH 1KIQB 3TBVB 4HWBA 4IRSA 3QWQB 2IQ9H 5F21B 3HI6L 43C9B 3N85L 5EOTA 3KXFB 1QR1B 1HCFX 1QSFE 4IRJA 3BIKA 1LGVA 5JW5A 3D2UB 4DFIA 3G04A 3CVIH 1EXUA 1KB9K 4OKDA 1NAKL 3UBXG 1C1EH 5FA4B 2UUDK 4PG2C 4PJ5A 1ZMYA 1TETH 5I18H 4NQDB 3GJFB 1AGEB 1G6RH 4MJIB 2ATPB 4QNPE 4WGWB 1C5BL 3B3IB 1T2XA 4IS6B 5C0AB 3IETB 4X4ME 4P2RB 3TP4A 2B1HH 4D0BA 5HYSB 5IIEB 2P44B 2FJFB 2WZPD 2HT4C 2UV3A 5SWZB 1EEZA 1AQKH 4TULH 4IEFB 2H1PH 1PZ5A 3D39E 1I7TA 3RIFF 4EOWH 2VLKE 1R5IB 2F74B 1A6ZA 5C9KA 5GS3A 3G9AB 1U3JA 1B0RB 1ZANH 2CK0H 3GSUB 2DWDB 4MJ5B 5KANG 4WGVB 1QFWL 3C08H 5FYJL 1GRWA 1W72H 2P5EA 5BOZG 4LSTH 4X0KA 1ETZB 4M1DL 5DK0B 5FO9A 4Y2DC 4QXUL 5JXAL 5JORB 2RHEA 1KIQA 2WSKA 1DLFH 4JJ5B 4YBQC 1ED3B 2EDDA 3WS6A 1U8NB 3KPMB 43C9A 5IR1A 1QR1A 3KXFA 5DURD 1QOKA 4HLJA 3RDTB 3VJ6B 4NT6B 3B9KB 1MEXH 3PL6B 1GJIA 4ODVH 1OT2A 1VDGA 2FX7H 1PLGL 4XVUD 3RPKA 3AMLA 5EBLB 2IAMC 5FA4A 4WDIB 4LEXH 4YK4B 3SDDD 3V4PH 3GB7B 3B2VH 3QBTB 4JHWH 4MJIA 5E08L 2ATPA 2JB5L 1JF6A 2P46B 3DHMA 2OK0H 3G08B 4MA3B 4IS6A 4NO2B 5C0AA 3IETA 4PJ9D 1TJIL 4ISVB 4P2RA 2PTTB 1KBGL 1TTGA 5HYSA 4Q6YA 5DQJB 5IIEA 4ZD3H 3WLWC 1RURL 1A3QA 1T1XA 4R7DB 5SWZA 4F37F 1K85A 1IILE 3H3BC 4D0DB 5J1SC 3IU3A 3L3IB 1RSFA 3X12B 5JHLL 4ZUUB 5I1CH 4HK0A 1C7TA 1R5IA 2F74A 5IMMB 5HYJA 3W82A 1B0RA 2XG5A 4XMPL 3GSUA 2DWDA 1I9IH 4MJ5A 4YDLC 3OF6D 4L3EE 2R29L 2CLZB 4N0UB 1R0AL 5HHME 6FABH 1S7VB 4U1JB 1ETZA 2E27L 2IH3B 3OZ9H 3RZCD 5D96B 2E6PA 3IF1A 4ODXA 3BE1H 4OLUL 1ADQL 4NC2B 3MA7B 4JJ5A 1U91B 2BNUB 4LLQB 1ED3A 3RX8A 1U8NA 4Y5YB 3ZYZA 1CGYA 3DROB 5I8EB 2AEQH 3RDTA 3VJ6A 3B9KA 3PL6A 5AZ2H 1G84A 3QUZB 1JMZA 3A67L 4AY0A 5JHDB 2ADIA 5EBLA 5JQ6H 4WDIA 3JWDL 4HGMA 1FCCA 4KK9C 1C16A 5D71H 3WFDL 4RA0C 2AKRB 4F57L 2JIXD 1VENA 3TIDB 3G08A 4MA3A 1D6EB 2IBZY 4NO2A 4XP9H 2OI9B 4MS8C 2XFXB 2PTTA 2AK1L 1II4E 3DECA 4FZ8L 2D7TH 5DQJA 3KHOA 4OFYA 1HKFA 4XCYA 4R7DA 1Q72L 1NL0L 1PYWA 2KL6A 1URLA 4M4RA 5KTEH 4EDWH 1MFDH 1U8MA 4D0DA 3X12A 5SV4A 5DA0B 1NAML 4ZUUA 1C12B 3IDMB 4MVBC 4X4XB 1MLCB 5IMMA 4WCYL 2HFGH 1KELL 3ZSSA 1NAKH 3A0OA 2B0SL 4M6ML 5IW6B 2CLZA 4XNZC 2XXCB 5LJYH 4I0PC 5EU5B 2P1YA 1S7VA 4GJTB 1ZHKB 4U1JA 1JNLH 4PGDB 2IH3A 1G7PA 1WFUA 2I5YH 4L29B 2EEDA 2H26B 3EJZC 3IB4A 1U91A 2BNUA 4LLQA 5CEZD 1F3RB 4CVWA 1HHHB 4JY4B 4MNQE 1WT5A 3GMMB 1P4IH 2R1YB 1BQHG 3DROA 4K3JH 5I8EA 5C07B 2A73B 2R2EB 1ZTXL 3IFNL 1T5WB 2PYEA 1KB5B 3QUZA 5KVMC 3FQXA 5IVXB 5JHDA 1JF1B 1CVRA 5IHBA 4XPFL 4Z8FL 3EDEA 3MBED 1MCCA 3VA2C 1JGLL 4F7CB 4JM2D 5EOCH 1HN1A 3TIDA 1BD2A 3PWJB 1QFWH 5FYJH 1D6EA 4OLZL 3OB8A 4PJHB 4LASL 2XFXA 2F5BL 1TXKA 2H3NB 3MRBB 4QXUH 1KOAA 5JXAH 2DQIL 3VXRB 5FK9B 4MMZC 1CR9L 5E1AB 2E5EA 3MJ7B 3WJLA 1RJCA 4JFPB 4JRXD 3L3OB 1I1FB 5I30L 1C12A 4GS7B 4X4XA 1MLCA 1OD7A 1MCBA 4N90D 1KJVB 1PLGH 1S7TB 4GLRH 3KLDA 3QT2A 5IW6A 2WIMA 4PRPB 2QQLH 5GS1C 5I1AB 5EU5A 5E08H 4EUPG 4PGDA 3LB6C 4LU5H 5EN2B 1Z2KA 2VAAB 4BKLB 2H26A 3L5WB 5I0DA 1HHHA 4JY4A 1KBGH 1ZWIB 3GMMA 1QG3A 2R1YA 2BJML 1MCLA 5E0QA 1BFVL 2A73A 2R2EA 4PJBE 1T5WA 1I8IB 1KB5A 3L1OL 4GRLC 5IVXA 1JF1A 4KK8D 2V2XB 4XWGL 3QIUD 1OGAB 5JHLH 1FFPB 4HPOH 2BY2A 1CDCA 5D1QB 5BS0E 2NY4B 2GJZA 3O3AB 2MQCA 3RWGB 3DOSA 2DM7A 2R69L 1TLKA 2NXZD 3FRPA 1YPZB 5EIVA 3PWJA 2IANA 2R29H 3K4AA 4JFZH 1N5AB 3CLFL 1R0AH 4PJHA 2VDNL 4OF5A 1MQ8A 2E27H 2XWJB 2H3NA 3MRBA 4NFBA 2VITB 1TCRA 1AHWB 5FK9A 3VXRA 1DBAL 5J7CC 3IDUA 1ADQH 4OLUH 5E1AA 3MJ7A 2YRZA 4I9WE 4JFPA 3EJYD 3V6BR 2EE2A 1RZIB 3L9RA 3NPSB 1BJ1J 3L3OA 2O5YH 1I1FA 4B7LA 2XY2A 2EEBA 3ULUF 3AS2A 3VFMB 3P11L 4OZIE 1DANT 1KJVA 3MV8E 3N1FC 5FYLD 1EFQA 5T33L 5GGTA 4C59B 1TJGH 4PRPA 1MCQA 4QRPE 4KRMB 4F57H 1UA6L 3OR6B 5E5MB 3ZHDA 1ZT7B 3MLPA 2VAAA 4G9FE 4BKLA 4UMGA 4X8XA 3L5WA 1QBAA 4YHZH 4NM4L 2VYRE 5HVGB 3FOMB 2AK1H 1T1WA 5IBUG 4Q58C 4FZ8H 4ZSOB 3DYOA 1ZT1B 2CIIB 1I8IA 1Q72H 4HMEA 4QRQB 5I73B 1KJ3L 5SX5H 3MRDB 2V2XA 2C9AA 2BXZA 1CN4A 1FFPA 1NAMH 2XG4A 5D1QA 5C0IB 1BFOB 2ORBL 4WCYH 4G80B 1KELH 1YPZA 1R5VA 5HHOA 2B0SH 4M6MH 3OQ3B 3S3SA 4V1DD 3T3ME 3G5XB 2W65B 1T20B 2X4NA 1DJSA 4FFYL 4KJQC 3RQ3A 4LOUC 4XBPA 2XWJA 3NCFB 2R15A 5ALBL 1MHCB 2C1PB 1LNUA 2VITA 1AHWA 4EI5B 1JNJA 2CUMA 4LVHB 4Q0XL 4KVCL 1F2QA 1FO0B 4NCC2 1A9EB 2AEPL 4W4NA 1RZIA 4RFOL 1ZTXH 3IFNH 3VMNA 5E99L 2D31B 2BP3A 3BN9D 3VFMA 4YHLL 1NKRA 3CFCH 3EO0B 4N0YH 3IFLL 3EAKA 4Z7OF 4XPFH 4Z8FH 3ULVL 4ODUB 4PJ9B 1XGYH 3O0RL 5D2LF 2R1XB 3OR6A 5E5MA 1HNFA 1ZT7A 3QI9C 2X1QA 3FB6B 4OLZH 3HUJF 1H5BC 4LASH 4Q2ZB 2F5BH 3FOMA 4R4FH 5DGQA 2O5XL 3WN5B 4ZSOA 4WWKC 1YQVH 3OKEB 4QXGL 1ZT1A 5K33A 2CIIA 2ESVB 3CXHK 4QRQA 2HP4A 3MRDA 5GSVB 2FYYA 1J0JA 1HSBB 3W39B 3B8YA 1GGBL 5C0IA 2AABL 3RZCB 4R26H 1B0GB 3OAYH 4G80A 4PJIB 5AAMA 2NXYD 2BY3A 1IGTB 4HKZB 3QFDB 4ZOCA 3C87A 3G5XA 2X70B 2W65A 3TWCL 3LMJL 4IOSD 4H8WC 1T20A 2WUCL 3QJFB 4PJCE 2X44D 2C1PA 4EI5A 5JOEA 1WFOA 3ELAT 2NZ9D 1FO0A 2JJTA 3HA0A 1JZ8A 3OSKA 3HAEB 1ZLVH 3ET9F 2DQDL 3E6HB 1BFVH 4D9RE 1U2CA 4XRCB 2JIXB 3MRHA 2D31A 4X80H 2C4FT 3EO0A 1XF3B 2NY0D 2OX5A 4XWGH 1CYGA 1K2DB 1WTLA 5A43C 4ODUA 2Y36L 4Z7UA 2R1XA 5IESH 1NSNH 3V4VL 5TGBB 1MHPL 1Y6KR 4F7PB 1AD0B 3MGAA 4IDJL 4KHXH 3FB6A 3MRMA 3F7QA 4M3JA 3WJJC 4Q2ZA 2VDNH 4XWOD 2BC4B 5JIKA 1RFDL 1OAQL 3WN5A 3X3GL 1DBAH 4UINH 4L4TB 2ESVA 4WFHE 1BZ9B 3OF6A 1NJ9A 4NJ9L 4WHYH 1BQLL 5GSVA 1HSBA 1PG7H 3W39A 5D6CA 3RZCA 3FB5B 3P11H 4HMDA 4AIZB 5T33H 1IGTA 4HKZA 5C0FA 1OAZL 5AEAA 1IARB 4Q74A 4H5SB 2X70A 2RB8A 2Z8VC 1JIBA 2PO6D 3QJFA 1JK8B 1UA6H 2FJHB 5E9DE 1T7VA 4B7IA 1INDH 1U8JB 4KK5D 3T2NH 5EU7E 1JZ3A 5BRZE 3HAEA 3MBEB 4J23A 4AL8L 2AGJH 2Q3AA 3E6HA 4MJ6B 3W11D 3OKYA 4XRCA 2JIXA 1E28B 4ODBD 5J13C 1KJ3H 1XF3A 1IC7L 1RZ8B 3OR7B 1K2DA 1N3NB 1ZSDA 4MAYD 2FWOB 1NQBA 2ORBH 4PV9B 3RU8H 1MPAL 5TGBA 3P9WB 4HKJA 4F7PA 1AD0A 1S9WB 4QKXB 2LABA 2J8UF 3FN0H 2DTML 5DLML 4FFYH 4JRXB 3G6DL 3RWEB 2BC4A 1OY3B 5ALBH 3ZDZF 5L7XL 2XZQL 4L4TA 4Q0XH 5JZ7D 1BZ9A 2AEPH 3QDJE 4LMQE 4RFOH 1BIHA 2W9EL 4XPHL 3FB5A 4PBVC 4YHLH 4FZEL 4P4KB 3ULVH 2XT1B 3O0RH 1L0XA 1JK8A 5F9OL 2IPUK 2FJHA 1WBYB 3HPJB 4W70A 32C2B 1QQDB 1LO3L 2IEPA 1U8JA 4B53A 3OX8A 4AJ0A 4CU8A 3K1KC 3MBEA 2O5XH 5C08B 4MJ6A 2Q87A 4HH8A 2R39A 2N1KA 1E28A 3OHXB 1RZ8A 4KRPC 3OR7A 1N3NA 3C8KA 4PP1C 1I1AC 2FWOA 2ZPKL 4L8DA 1FIGL 4PV9A 2AABH 4PJEB 3WLBB 5TQ2L 3L6FB 4Z76B 1S9WA 4NQSB 3KAAA 3STZB 1UQSA 3NZHL 1AXIB 4X5LA 1N6VA 1PD6A 3LMJH 1BP3B 3U0TB 1IAII 2WUCH 2DYPD 1IKNC 4Z7WE 5I9QB 5CD5D 1AJ7L 1DN2A 3GGWB 2P45B 3FOLB 3QQ3B 1KJ2L 3TJEH 4PLJD 5IW1B 5ITBL 1CGVA 4HC1A 3CX5K 2FB4L 5C6WH 1A6VL 1LE9B 2R0WH 2ADGA 2PN5A 4N8PA 4LHUD 1L7TL 3CX5J 5CMAB 4P4KA 1X5GA 2Q1EA 3GBNL 4ZFFB 5MEND 2PETA 2K7QA 3V4VH 4XAWL 4RWHA 4N0CD 4HW6A 1MHPH 4ZMAT 4JFQB 3HPJA 4KGLA 4OF8A 4IDJH 4WEMB 3DVNB 4X5WB 1FG2A 1JTPA 1RFDH 4PP2B 5FECA 1OAQH 3GMQA 4M7JL 5C08A 3X3GH 1M6OA 4JE4B 4X7DC 4Y16D 5L8KB 2FGZA 3OHXA 3PGDB 4V1DB 5IHLB 1BQLH 2CLVB 5ICYB 3P4MB 3TN0C 3VG0L 4B41A 2DI9A 5E8PB 3PXJA 3KNBB 3WLBA 2QHLA 3L6FA 1HI6A 4GRWB 4GRMA 4Z76A 3KG5A 4JFDB 4A2MA 4NQSA 3ARBD 3STZA 2CXKA 1V7ML 5KOVC 4JPIA 3IDYB 3U0TA 4KV5E 5DFTA 4LCWE 4EI6B 2IADB 1FSKC 3QUXB 2YUXA 1QSEB 3GGWA 3FOLA 3QQ3A 4JR9L 4R90L 5E7FA 4TSBL 5IW1A 1MAKA 5JW4Q 1FH5L 1OQXA 1BM3L 3JWOC 2DQJL 4XHJD 1MHEB 4LCCC 3IDGB 2BVQB 2D7MA 1IC7H 3QIWD 2HRLA 4LLWB 2YXFA 1EAPB 5HHVH 3T65B 4ZFFA 1MPAH 4LFHG 4JFQA 3AREC 3MLTB 4IMKC 2Y1VA 3EW3B 3F8UB 3OL2A 4LAQH 1UM4H 2DTMH 3DVNA 5DLMH 4X5WA 4AENB 3G6DH 3FO1B 2I07B 5KVDL 5DD1L 4PP2A 3OGOE 4PJ7F 3NFSL 3OB0K 3KPQB 4K71B 5L7XH 2XZQH 4WFFE 4OZFH 5LCVL 2EC9T 2NXYB 3MOBL 4K3HA 4Y89A 3O6KL 1KEGL 3PGDA 4J3SA 2VL4A 3J8F7 1F8TL 2CLVA 4MWFB 5ICYA 4OLVH 3P4MA 4XPHH 3IFOA 5E8PA 2WV3A 3KNBA 4JFDA 1CLOL 5I1EL 3BN3B 3RVXD 4RBPH 1CICD 3BQUD 3E0GA 4EI6A 2IADA 4JKWA 5D7IA 5F9OH 2OR9L 3QUXA 1QSEA 2DQUH 3SGEH 1QFUH 4WJ5B 3NABL 4PJGF 2R1WB 4WI5A 2JTDA 4LQ1A 2EICA 4XNMB 4B0MM 2VQUA 3MRCA 1UENA 1UZ6E 2APXA 4QWWD 4RRPA 3WIHA 1A6PA 4LLUB 3LVEA 5HGBA 2DMCA 4YXLL 1MHEA 3O6FD 3IDGA 1J18A 1XT5A 5F70A 4LLWA 1MVFA 2ZPKH 4XBEH 1EAPA 1T0MB 1J8KA 2KDGA 4OZHF 5TQ2H 1O0VA 3T4AB 1I8LC 1J86A 5D6DA 2V5RA 3MLTA 4X6FB 3U4AA 3BH9B 3PWPD 2CQVA 2VLRE 4AENA 1Q9LB 3FO1A 1CXLA 2I07A 5BZWA 4YR6A 4XB7A 3OTTA 5HY9A 5HD8D 3KPQA 1KJ2H 1L9MA 5IFAL 3O2DA 3VW3L 5ITBH 3BDXA 4PJ5E 1NGXB 3H9YA 3GO1L 3NCJL 4UT6L 4A2LA 4YBLB 5ID1B 4MWFA 1QFWM 1NBZB 2PO6B 4WI3A 3VXSD 2EEAA 2B8OT 3V0AC 1L7TH 4MXWL 1JBJA 1QR4A 2CPCA 3GBNH 1YQ2A 2AEIT 5CHNB 3BKYL 4S11A 5GRUH 2OTPA 3CD4A 5FHAH 4CDGC 4W6XB 4NOBA 4WJ5A 3HTLX 1W0WA 1WJ3A 4XNMA 2XWBB 5FYJD 3DV4B 4MAYB 5HSFA 1QTYT 5LXGH 5TPWL 4M7JH 3HE6D 1NLBL 2VDML 2OZ4A 2P5EE 35C8L 1FVEB 3GSXB 5FGBC 3SKMB 2GFBA 3M07A 3QPQC 4NM8L 2QQKH 3HR6A 3VGAC 4E9LA 1T0MA 1TTUA 2BFVL 3ULUD 3T4AA 3I3EA 1IZJA 3SKNB 2AXJA 4U6YB 3BH9A 1V7MH 4R2GD 2XTJD 3KXFE 4D3CH 4XP5L 2OCFD 1G9NL 1R3IL 5FHBL 4J3OC 3H3PL 4B5EA 4JR9H 4ZS6D 1MCDA 1FYHB 4BFEA 4TSBH 3WCYA 2X4OB 4TNWF 3NTCL 4NQDE 2WBKA 1FH5H 4HCRL 5ID1A 2F15A 4NQEB 1UADC 4MJIE 4Y88A 1NBZA 2PO6A 2W9DL 1BM3H 5HTSA 2DQJH 1N2RB 3ARDA 4KC3B 3MRLB 4XHQA 5H8DA 5CEYB 4FQXD 3L95A 4YFEA 1QO3B 5C0AE 4P2RE 3RBSA 1RUMH 2ERJC 5GGRY 5CHNA 2VZ1A 5JQHC 4YDKL 3BIAX 3J7HA 5SWZE 3MJ8A 3SDAD 4RGOL 1LO5A 5J12B 2R56H 3AAZB 1HILB 5I0ZA 2XWBA 3DV4A 4EXPX 4MAYA 2ILLA 5KVDH 5DD1H 1JPFB 3NFSH 2BK8A 3IDIB 4FQPA 1SM3H 2F19L 1FRGL 4OGAC 3MOBH 1KEGH 3ARPA 4UU9A 3LEVL 2X4QA 4D9QE 3SKMA 5FKPB 2DYPB 5CZXD 1CFBA 4JFOB 3VI4F 2FGWL 4FQ1L 1CDGA 2G5BB 3GJFK 1XF1A 2FR4B 5GS2H 1X5ZA 1CLOH 5I1EH 1U8QB 2P8LB 1OLZA 5CJQL 2OR9H 3RKDC 4LHUB 1D5BB 1OCWL 1GGUA 3PV6A 5MENB 4NQEA 2DTSA 4LSDA 1FE8L 5JW4M 1N2RA 3MRLA 4YXLH 4X7TB 5CEYA 1OWWA 3IXTB 4R4BA 1REIA 5E4EB 1QO3A 4PLKC 4F15C 3CNKA 5D1ZD 1T21B 4WHDA 2MJWA 3GSQB 2AQ1A 1OAKH 4JDZB 3C60D 3BAEL 1CE1H 4X6BB 1BGXL 3D3VD 2X1XR 4L5FH 4Y16B 2J7LA 4K55A 4YNYB 3BDYH 4XZUB 2JLLA 3AAZA 1HILA 3FQUB 5HYFA 3O3BB 5AG8A 5CWSB 1JPFA 5C2BL 3IDIA 3KS0J 1EZVY 5IFAH 4W4OC 5EZJB 5C1MB 3VW3H 5GRVK 1BZQK 1BJ8A 4JFHE 2D4FA 3GO1H 5C6TH 2BSRB 3ARBB 3NCJH 4N0UE 4OUUB 3T2QA 4CMMB 1VKXA 4C57C 5FKPA 2DYPA 1ZGLM 5E6IC 1XGUB 4LKCB 1GL4B 1K6QH 2G5BA 5CGYC 4AT6B 3RAJL 4GG6F 2FR4A 2CH8A 1H3PH 2WANA 4OCRH 4XPGL 3BEWB 3FO0L 2NCMA 5I74B 4XC3H 4MZ2A 5EBWB 4JDTL 2P8LA 4FQIL 1CFQB 3WMSA 4PRHD 4LHUA 5JHDE 4RAHA 1D5BA 4NN5B 2CRIA 5ITFB 1X6LA 1KGCE 4NUGH 3TBSA 1MI5A 2RCSH 1X5AA 2YMXL 5TPWH 3BD4A 3VI3F 5MENA 1ZS8B 3DUUB 1M7IB 1NLBH 2EXYC 1OP3K 1I8KB 5D7LB 1IFHH 1WF5A 5C0BA 5C3TA 3IXTA 4YC2C 1MCHA 5DK2A 1VGKA 1X4ZA 1RAMA 4NM8H 1T21A 5GZOC 2BFVH 3GSQA 2VQTA 2MCPH 2HTLC 1M71A 4JDZA 1G9EA 2YZ8A 1KCSL 4X6BA 4YNYA 3JWNC 4XZUA 1CL7I 5IF0B 2YOCA 4XP5H 3FQUA 4Y4HD 3WO3B 1G9NH 1R3IH 2ZSVB 3O3BA 5LGKA 5AYQA 5FHBH 1MY5A 2VN7A 2EXWC 4Y4FD 5CWSA 5HI5C 2BSSB 3H3PH 5FCUL 4ALAH 2Q20A 3S5LB 1OOAA 2YK1L 5CSBA 3FRPG 5CUSL 2BSRA 5BJTB 4HCRH 4KRLB 1CICB 4OUUA 3BQUB 4CMMA 3KPSD 2W9DH 3IAQA 5IEHB 4WU5B 1KG0B 4H0GA 1XGUA 4LKCA 3AMKA 4Y4KC 3MJ9A 1F00I 4N5ED 3BEWA 4EJ1C 3CH1B 5DQ9B 5J6HA 3DYPA 2LQRA 5C07E 4YDKH 4N8CL 3HMWL 1QKZH 2HLFC 5IVXE 4RGOH 1TPXC 3ARZA 3O6FB 1PX3A 5AWNL 3TT3L 1LEKB 5INDB 1ZS8A 5MI0C 2J88L 4ZOEA 5MERA 2F19H 5J3HC 5D7LA 1FRGH 3KJ6L 3LEVH 5D70L 5T1MB 3MLXL 4I3SL 4NRYB 5GJSL 1QRKA 4PJHE 5GQBA 4ZG1A 1OW0A 3HE7B 1E4JA 4BQ6A 5T1DL 4FQ1H 4G9DB 2BRRH 1CF8H 5I1HL 3VXRE 4QYOB 1F42A 2H32B 1I1CA 4JHAL 1OTTC 5IF0A 1D5IL 3PXHA 4TVSa 2ZSVA 3TYGL 3RL2A 5CJQH 3VXSB 1RQ5A 2BSSA 3RUGA 4KUCF 1XIWD 1IAKB 1I9RH 5F3HB 3CLEH 4UILL 3S5LA 4O5LL 1OCWH 2AK4B 2VERN 1PW3A 4PRPE 3QULB 4RFNB 5BJTA 1BBJA 1CICA 4JVPA 3BQUA 1IRAY 3LKQB 4X6CF 4CUCA 3JTSB 5IEHA 4WU5A 5ILTL 1KG0A 1SHMA 2APFA 1AC6A 3ISWA 3QWOB 4G8GD 2A38A 3NVQA 5TDOB 4YPGB 4WVRA 3CH1A 5DQ9A 2DBLL 4X7EC 3UPCA 1Q0XL 3F7YB 1OLLA 4KKCC 3HE6B 3BAEH 3RVUC 1SBSH 5DEGB 3O6FA 4JQVA 3P4LA 1DBJH 1OGAE 5CBAB 3ZE2F 1T0PB 5C2BH 5INDA 1LEKA 1XAUA 1U41A 1YPZE 4MA8H 1JRHI 1NMCC 5T1MA 4R2GB 2XTJB 1U3HA 3LQAC 4X7SH 5D5MF 2VC2L 1FNEB 4FABL 3HE7A 3MLVH 2AI0L 2EE6A 4G9DA 4OD2A 2VXSH 4QYOA 4UOW0 1JPST 4XPGH 1CIUA 4TOYL 3FO0H 1P9MC 3D69B 3ULSB 3OKLB 2Z31C 1LO2L 3T0WA 3CZFB 3VXSA 4BH7B 1WV7T 1XCQB 3SE4C 3MO1B 3T1FA 1IAKA 1SJEB 1AFVH 2Z92B 4FQXB 5F3HA 5F88B 3HRPA 1FPTL 1RD6A 2AK4A 1DQTA 1B3JA 5FM4A 3QULA 2YMXH 4M7KL 2P4AB 3VMPA 1U8LB 3NFPB 3LKQA 1G7QA 3CUPB 3JTSA 4IHOB 2C3WA 2ZJSL 3QWOA 3SDAB 4AK1A 2ZUTA 4CU7A 5TDOA 4BQ8A 2OLDA 4YPGA 5I6XC 4ZO8A 4ZSOE 3B83A 3HE6A 1XR8B 3X14B 5DVLA 5C2UB 1KCSH 5DEGA 2A6IB 1Z0MA 4UOJA 1OF2B 3BPNC 4HF5L 4GBXD 2G75B 3WHE0 1A7PL 4MQXC 3FAWA 3S88L 1ITBB 5EA0L 5FCUH 1CLZL 1RULL 3OAZK 2KBGA 2YK1H 5CUSH 1FNEA 5D2LB 3O9WD 3K80A 4UZGA 1BBDH 2IMNA 2XI9A 5GRXG 4CVXB 4P9HL 3HUJB 3F12B 5IMLB 3D69A 3ULSA 4LVOC 4N8CH 3HMWH 1YY9C 4DEPB 3LN5B 3CZFA 1MCOL 4BH7A 1XCQA 1YEKL 3MO1A 2C3XA 4JG0L 4LPYA 4JPWL 1SJEA 2Z92A 4FQXA 1N0XH 4P99A 4O58H 1NGYB 1HK6A 5F1NB 5AWNH 3VG9C 3ZO0A 3SY0B 5D1ZB 3TT3H 1U8LA 3NFPA 5F93C 2J88H 4UBDD 3CIQA 3C60B 4FP8L 1I7ZB 3KJ6H 4M8QA 3D3VB 5D70H 3SDAA 3MLXH 4I3SH 5GJSH 3DV6B 2VISB 3WUWB 5T1DH 4DGIL 3GMOB 5I1HH 4U7SA 3HAEG 2ESVE 1XR8A 1NANI 3X14A 4UOW1 2MCG1 2OTUB 4L9LB 5C0ND 4JHAH 4KJPC 4ZFZB 4BUHA 3O3EB 3TYGH 1OF2A 2G75A 5DMYA 3LSOB 1TNNA 2HJKB 1L4IA 4OZ4B 4PJIE 3AU1A 4UILH 4D9LH 2GSGB 3KJ4B 1J0KA 3OJVC 4L1DA 2H2SC 5HGAB 3K3QA 1G7HB 2HVJA 3VXOB 2C7UB 2VXQL 4NO5B 3MR9B 1OWRM 3GRWA 3BKCH 4PJDA 5CSZB 4CVXA 3HUJA 3F12A 2CR6A 2DBLH 4NNYB 5IMLA 1JYXA 1Q0XH 2BSTB 3LN5A 4L8BB 5CCKL 3CSPA 2NW3B 2ZOKA 3MLUH 3TGXA 5F1NA 3SY0A 5D1ZA 1JF5A 4F9PA 4OBRA 1HH6B 1GC1C 3RX5A 3S96B 1XFPA 1CIDA 1I7ZA 1P7HL 2VR9A 1CFTB 1ZVHA 3W9EB 4KJWD 2VC2H 4Y4HB 4HSQA 4FABH 3DV6A 2VISA 2AI0H 3WUWA 3GMOA 5D4QA 5IUSA 4Y4FB 1T7ZA 3BFOA 4KI5E 4DVBB 4L4TE 3MC0A 2V7NB 3V4UL 1JYNA 2OTUA 3QCTL 4J7RA 3RTQC 1F58L 4ZFZA 1IGIL 3O3EA 4MHHG 3FKUS 2LAGB 3Q5OA 4OZGF 4R7NB 5I8CB 2HTKC 5B22A 3D6GA 5DJ8B 3LSOA 2HJKA 5DJDB 1P7QA 3X17A 3T3PF 2ZOLA 2GSGA 3SDXF 1FPTH 3DURB 5CEZE 4XNQB 1KCLA 3D18B 3T04D 3T0EB 4NN7C 3LY6A 1AKJD 5JR1L 2ZJSH 3VXOA 2C7UA 4NO5A 2DKSA 3BKMH 4IOIB 4RGNC 3MR9A 4X4ZA 2J8UB 5CSZA 2DM3A 4NNYA 4YHKL 1BHGA 3K7UA 2BSTA 4O4YH 4L8BA 4DUVA 1RUKL 1TVBB 1EGJA 1QBBA 3Q2CA 1F4YH 4HF5H 4HV8B 2EDLA 4FQJL 4P2OD 1A7PH 3OGCB 4KTYA 3S88H 4HWBL 1KCRH 1HH6A 2ICWJ 2VXUL 3EOTL 1RULH 5EA0H 3DETD 3JVGA 5GGUB 5C92A 5HI3C 1GOGA 1FAKT 1CFTA 5IVZB 1FBIL 1XGRA 4MD0B 3UROR 3UTTD 3W9EA 5J89A 3EZ8A 4JRXE 4NIKB 4Y4HA 4G43B 5F9WB 5EUKB 4Y4FA 1TVHB 2HRPH 1I7UB 4N90E 4DVBA 1N64L 4M48L 5IB3B 3ALPA 5F97E 2V7NA 4P9HH 1YJDL 1IAMA 4EQ3A 3F7PC 4Q6IC 4R7NA 5IG7B 3AROA 1A8JH 4JDVB 4ZS7L 1NGQL 4ZPTB 1HHKB 1MCOH 5DJ8A 2YUVA 1YEKH 5DJDA 1GGIL 4JPWH 2HA1A 3MRGB 1U8PB 3CDFA 4XNQA 1JZ6A 3D18A 1Q1JH 3QZWA 3T0EA 3ZKQD 5I2IB 2EDFA 2WBJC 4ZTOL 3PHOB 2ZCHL 4UNVA 4POYA 1CL7H 1UWGL 3WFZA 2J8UA 5BV7L 2FEDC 5H94B 4DGIH 4M4PA 1MWAA 5C08E 2OL3A 1A1OA 1INQB 1CGWA 3B2UC 4FS0A 2KH2B 5I66B 5CP3A 1TVBA 4N5UA 5T1LD 3VD5A 2F54D 4U1SA 4V2BA 4HV8A 2NYYD 3DHJA 1EPFA 3OGCA 1O7VA 4PJEE 4U1GC 1UJ3B 1JYWA 4QHLA 5IVZA 4MD0A 1WQVT 5L0QB 4XCCL 3EYSH 4KJYB 4G43A 4IRZL 3KLHC 2F9BT 4HWZA 5H35B 5LAXB 5EUKA 5C71A 5EORL 1X5HA 4R4NC 5D9SB 1I7UA 4K3EL 1HH9B 3G5VB 4UDTA 4Y19B 5IB3A 2BXYA 1R24B 1Q0YL 1YNLL 1MIEH 4H1LB 3CVHB 4JDVA 5IG7A 3V6FB 3ZYIA 3FHQA 1SJHB 4ZPTA 1DVFD 1IC4H 5DRXB 5CCKH 3I9GL 2P5WB 1ORSB 3MRGA 4GFTB 5JIHA 1R5WB 4WUUB 3V6OA 1U8PA 4U1IB 1DR9A 5DMGD 5FKAA 1GAFL 1IC1A 4YGAB 4YHYB 3P0VH 1PKQA 4U1KB 5I2IA 3MCLL 5L2KA 3BGMB 5I76B 1U42A 3PHOA 3S37X 3RY5A 2X6MA 1T1ZB 2NLJA 4WW2C 1QBLH 4YPJA 1UYWL 4KK6C 1HNGA 3FT3B 4GBXB 4HEME 4KROC 5H94A 4LSSL 4P3DB 5DO2C 4RRPG 4PRIA 3K4DA 4RMWA 5I66A 3V4UH 5JW3L 2XV6B 1FNSL 4V1DE 2YA1A 1RUQH 1IGIH 4NKIH 4YX2L 1N5YL 1K8DB 3EYOA 2CD0A 5KW9L 2EDBA 2YPVL 3EZJB 3O9WB 4GRWE 3AC0A 3U4EB 1KNOB 1UJ3A 1S9VB 4JFDE 5GRVL 4WHCA 2R2CA 2C3VB 4KJYA 3EDFA 1T1YA 4ZODA 5H35A 3P9LB 5LAXA 1PBYA 3LQZB 4W68A 4P5TD 1HH9A 3AB0C 3G5VA 4Y19A 1QPXA 1CDBA 2X4RA 2E7LC 1MRDL 1R24A 1CD9B 3AVEA 3GBLA 1JTOA 4YHKH 5FB8B 4JAMA 3SGJC 5DMJB 4GXUN 4H1LA 3CVHA 4PJ7B 5GJTL 3V6FA 4PGJA 3SO3B 4PUBH 1PY4A 2IPTL 1RUKH 4WHTB 5DRXA 4P5MA 1EH9A 1JRHH 3U7YL 2BVEA 2P5WA 3WHXA 1R5WA 2JCCF 4WUUA 3NA9L 1U8IB 3I50L 4FQJH 4U1IA 3UPAA 2JJUA 3LD8B 4HWBH 3CH8A 4JO3L 2VXUH 4U1KA 5K9QI 5GISL 3BGMA 5I76A 2ARJB 5C86A 5D7JA 2IAMD 2YWYA 1I9JH 1T1ZA 3F6LA 1FBIH 4UQ2B 1BQUA 1MFBL 1FLRL 3FT3A 4GBXA 43CAB 2R0ZH 3BGFC 4P3DA 3DX7B 1S5IL 1N64H 4M48H 4HIHA 4PJGB 1H8NA 5K9JL 1YJDH 4OFVA 2P24B 3DX9B 4RSVA 4QHUB 1K8DA 3WLWD 4ZS7H 4M93B 1X5XA 4JREB 2WQRA 3O9WA 1NDMB 2E9IA 1GGIH 3RL1B 3KYNA 1KNOA 5ALCH 5FUCE 3ABZA 1S9VA 1T04B 4E41D 3IXAB 3MLWL 3DNKA 3RIAK 5BQ7B 3RGVD 2C3VA 4OZHB 4ZTOH 1LO4L 2ZCHH 3KYMA 3P9LA 3LQZA 4MA1C 1MCPL 1T2QH 3L3DB 5IB1A 1UWGH 2DQEL 3V95A 2VR4A 4DKEL 5IBLC 3SCMC 4CJ0A 1JHTB 4KTEL 5FB8A 2HYMA 1T03L 4PJ7A 1MFEL 4WHTA 5DVNA 1H9VA 4YE4L 4U6XB 3V52H 5FDWA 3QUYA 3LH2L 1OP9A 3UYRL 1CE6B 2LU4A 4TRPL 1LK3L 4J2XA 5GRJL 5EU4B 4RGMC 3C09B 4RFEB 4FQHB 1T89A 4UQ2A 3MLRL 4XCCH 3FRUB 3SDCC 4IRZH 1E4XL 3PABB 3DX7A 4H0HB 5EORH 5B8CA 4K3EH 4S2SB 3GJFH 2NX5D 3GUTA 1VESA 4Y0GA 4PJGA 2HN7B 4I2XE 4BSJA 3GBML 4CVUA 3DX9A 1WCBB 4QHUA 3U79A 4LSVH 4Z7VF 2Q86B 1AKJB 2Z93B 5E2WL 1K9TA 1NDMA 3RL1A 3CK0L 3EKCA 3QISA 3IXAA 1S5HA 1GAFH 1KB5L 2C1OB 5BQ7A 5I15L 3MCLH 1NANH 4OZHA 4N0FB 2FSEB 1NC2D 3L3DA 5HI4C 4RAUB 1M1SA 2ZUQC 4I0PD 1LO0L 1UYWH 3UP1A 1FNAA 2NW2B 2ID5A 1JI2A 1SVZA 4LP4A 3S36X 1CQKA 3EJZD 3H42H 4U6XA 1FNSH 3UZQA 2EZ0D 3UTTB 4YX2H 1WBZB 1N5YH 4K2UL 5KW9H 1CE6A 2Y06L 5TDPB 1YN7B 3RNQB 1I3VA 4YXKL 5ERWA 5EU4A 4CBPA 3HN3A 5SWQA 3PP4L 1DCLA 2KQMA 3I2CL 1FG9C 4FQHA 2ICWI 4RFEA 4XCEB 3OJMB 4K8RL 1YEJL 4G8EB 3PABA 4G9FD 5GGTL 4NQVB 1YEIL 1B6UA 3ARFC 4S2SA 1LHZA 3M1BB 1MRDH 2Y5EA 4BH8B 3UTZB 4NQEE 4OCXH 1WCBA 5GJTH 3CDGB 1IVLA 2VL5A 4BFGA 1A3RL 2Q86A 2Z93A 3L3GB 3UO1L 4OT1L 2YA0A 3U7YH 3VWJC 3BWUC 4P2QA 1LMKA 3NA9H 3I50H 2Q8AL 1TIUA 4P46C 4JO3H 2C1OA 3DX6A 2XQYK 2DDQL 3UDWC 3JSSA 4N0FA 1OP3H 2FSEA 3TZVC 4F2MB 2DQFB 3FO9B 4PREB 4DCQB 5T1LB 1MFBH 4ORGB 1FLRH 2NW2A 4I77L 4JCMA 1VSCA 3LB6D 4TSAL 4R3SB 2DL9A 1S5IH 3I3BA 1FP5A 4FOMA 4HUNB 4OGXL 4P3CL 5E4IA 3UTTA 1WBZA 1HYSC 2KQNA 5TDPA 3UJJL 2W60B 4GRLD 4IJ3C 4ZNEA 1KLGA 1A64A 4OCYH 4HKBA 1UG9A 1NUNB 3MLWH 4PJFF 3U30B 3GFUA 4XCEA 4DFHA 5IT2L 2WBWB 4UIMB 4G8EA 1TZHB 1LO4H 1F6AA 5CJOL 3QIBD 3KPRD 4OBSA 4NQVA 1MCPH 2FHCA 2DQEH 3M1BA 3OV6A 5DI8A 4G6FD 4BH8A 1S9KC 5MENE 2HT2C 2XACC 5C0RH 4LRNL 3CDGA 3SE3A 5EU6D 3L3GA 1F6LL 4YE4H 1EHLL 2VXTL 3DMMC 1FFRA 2A74B 1ZV5A 4ONOA 3LH2H 4R0LC 3RHWK 3MGTB 5FGRA 5ECJE 4TRPH 3TA3C 2FEEI 3HLAB 5HGGS 3UTOA 3MUGB 3D5OF 4PY7A 5GRJH 2DQFA 3FO9A 4GG6B 1SYVB 4PREA 4DCQA 5T1LA 4GUPB 3MLRH 1DQDH 4ORGA 2HFFA 2IG2L 1E4XH 3D0LB 4R3SA 4EN3C 3ZKSD 2AJ3B 3QHZL 1T83C 3QEQD 2ADJB 1NDGA 4K94L 3N1PC 5BZDB 2CUHA 2NY3C 1NCWL 1IBGH 3SGDI 1AGCB 4HGWA 2W60A 1FO0L 5FM5M 4NQTA 1JHLH 3HB3C 1ZHLA 4WUKL 4CNIA 4I8DA 3D1MC 2QADD 4LBEB 5I15H 3F62A 4UIMA 1YEFL 4Y2DB 5ETUA 2ZCKL 1SEQL 3BSZH 1TZHA 3FCTA 4CMHC 3IGAB 3FFCA 4P3WA 4RDQG 4OGYL 1LO0H 2VZTA 3S5LG 3RWJB 4KJQD 5IGXL 4LOUD 4X9HA 1FN4A 1YNKL 3K1DA 4KDWA 1IGJB 1P84K 2WAHA 1D9KC 5B39B 5D7LE 3LKPB 3EO1B 2IAMB 2M26A 3C6LD 4LRIC 3S35X 4PG2A 2A74A 3RVVC 3LDBC 3GHBL 4XTRD 1P84J 4K2UH 3MGTA 4MA7H 1A6TB 3LN9A 3GHEL 2Y06H 3O8XD 2G60H 3HLAA 4J8RB 4JRYD 3MUGA 2AEWA 4BSWA 4HBCL 2HKFL 3KYOB 1JUFB 3H0TA 4K7PY 4GG6A 3PP4H 1SYVA 4OIAA 2VXVL 3I2CH 4M7ZC 7FABL 4X9GA 1XGPB 3CCHB 4K8RH 1YEJH 4BK5A 4MCZA 2VZSA 3D0LA 5GGTH 2YBRB 1XCTB 2AJ3A 2IALA 1YEIH 5KAQF 4AM0B 3KYAA 4JQIL 1T7WA 4YZFF 4QY8B 4E41B 5BZDA 3SKOB 1SJVA 4F9LA 1PG7W 2XNAA 1RZKL 3P4NB 1EA9C 3WXWH 1A3RH 4OI8A 1AGCA 1U95A 4RX4D 3UO1H 5A2LH 2X05A 4YAQA 3SE8L 4YDLB 5ICZB 4N1HB 3VXUB 3B5HA 1RUAL 4NQUA 4LBEA 4Y2DA 1ZA3B 2W9LA 2DDQH 1CI5A 3QXUA 5JMRA 2B1AL 3OG6B 1FL6B 1KPUB 4TSCH 4HK3J 5TE7L 1JZ4A 2FJGB 2VAJA 4AYFA 4N9GA 4P48A 2AXFB 4I77H 3RWJA 3O4LD 1FL5B 3O3UN 5B39A 3LKPA 2VDLL 3EO1A 5GGRB 2NTFA 2XOTA 2KUTA 4OGXH 3BMWA 2IAMA 1DQLL 1EIBA 2Y6SC 5DMIL 5B4MC 4FTVB 1A6TA 1M7DB 3O2VH 2DIAA 4X6CB 4G6MH 2P7TB 3UJJH 4J8RA 2DMBA 4PRAB 2HJFA 2G5RA 1ZGLP 3KYOA 1JUFA 2GI7A 3OAZH 2NX5B 2Y23A 2QV2A 4U7MA 5GXBB 5IT2H 1XGPA 2R2BB 1U9KA 3VXSE 2H41A 2YBRA 3MTRA 1XCTA 5CEZL 4J4PD 3T4YB 5HHPB 4AM0A 2AK4E 1FCGA 4CN6A 1CFVL 1BLNB 1CBVL 4LGRB 4QY8A 3KLAB 5E00B 4XPAL 2VLJD 4LRNH 2PXYC 3P4NA 4MNHA 2H2PC 3S9DB 3WIIL 4HJ0C 4FFWC 1EHLH 5E24E 2I9TA 2VXTH 1KCVL 1NC2B 2Q6WB 3SPVA 5ICZA 4EUPB 3VXUA 3TFKC 2B4CC 4XNZB 3WKNA 4I0PB 5D5MB 1G6RA 1ACYH 2IPKB 2I26N 5T1KB 2YD9A 1F3JB 1YEDA 1ZA3A 1VACB 1FL6A 1KPUA 3UAJC 4PB0L 3K74B 4UT9L 4XCFL 5DJCB 5EZIL 2FJGA 3HFMH 2AXFA 4JFED 1GVIA 2IG2H 4C83B 1FL5A 1GIGL 3C8DA 2FIRT 3ULUE 1HINL 3QHZH 4ZAKC 1JHKL 1ONQB 5KVEH 5GGRA 4K94H 1J88A 2XTJE 4JFFD 5DUPL 4FTVA 1NCWH 1LEIB 3W5NA 5IB5B 1JWUB 4X6CA 2P7TA 3LKRA 2UZIL 5BO1H 4FQ2L 1FO0H 4HC1L 4J3WA 4PRAA 3RWDB 2BERA 2NX5A 3BEVB 4P4RA 4HFUL 2R2BA 1YEFH 4PY8J 3V0WL 4JG1L 3TVMD 3C5SB 4NC1C 3UCRA 4QRUB 4J6RH 5F9DC 3NCMA 2BZDA 2NY4C 2FHFA 2ZSWB 5JA9A 5HHPA 1MF2L 4NO0D 4EBQH 4OGYH 1TZGL 2AAVA 1BLNA 3KLAA 5E00A 1QRNB 2E8YA 4MYWB 4NNXB 3VRLF 5E5UB 1NC2A 1MCWM 5GS1B 3GHBH 1QFOA 4ZQKB 3WXVL 5CINL 1NCTA 1I3UA 4I0PA 5D5MA 2IPKA 4OSUL 5T1KA 1F3JA 3I75B 5B38G 4JPKH 5IFHL 2HKFH 5IBUB 5KSAD 4JO1L 2VXVH 5DJCA 3HZYB 3B6SB 4C83A 3VXNA 2DICA 5E2UL 2VUOA 4GRLB 2VDKL 4YHOL 4JQIH 4Z7OE 3C8HA 4Q9BA 1S9XB 2MQ0A 2QR0B 3IU4L 5D2LE 4OB5L 5C7XL 2CDEB 1NFKA 5IB5A 1RZKH 1UEYA 1AIFB 1MAML 1JWUA 2DAVA 2X4TB 3PWLB 4KPHL 4YJZL 1GCFA 3LS5L 1MCFA 3QIBB 3KPRB 5ESAA 3WUWG 1WC7A 3NAAL 3SE8H 3VGFA 2C26A 3HAEH 3RWDA 4DUXA 5I75B 3BEVA 4G6FB 4PP1D 4YEFA 1I1AD 1H3TA 3HUJE 4C56D 5J11C 4I0KA 4G6AC 4JZOA 5D2NB 2DQGL 4QRUA 2B1AH 2YPLD 3HRZB 2VDPH 2W0PA 5EU6B 3TT1H 2ZSWA 5TE7H 4Z7UF 4M7LT 5IW3A 1RU9L 4OUOA 2NY5C 2N7BA 1MNUH 1CWVA 4U3HA 1AXTL 1QRNA 3UYOD 4NNXA 2VDLH 3F58H 4ONGL 2HT3C 3D3VE 1XGTB 3RVTC 5GS1A 3S36L 5DMIH 4ZQKA 2CR3A 1ZHBA 4XVUC 3UZEA 3E8UL 2Z91B 3I75A 3SDDC 5H37H 4MLSA 3QEQB 4LFHD 3HNVL 4JFXB 4ZYKB 1NCBL 5BW7C 1QSVA 2GK2A 4UI2A 4WNQA 2ZZUT 4ENED 5IB4B 4KZEL 3B6SA 4LHJB 3GI8L 4N8VB 3W0WD 5JOFA 4PJ9C 5IJKC 5ACMA 5CEZH 1XF4B 3CSBA 2DIJA 4GRLA 3GSVB 1CFVH 4JJHA 1CBVH 3NIDF 1S9XA 4HAGA 4LK4A 4XPAH 1H3XA 5SV3A 1MJ8L 2QADB 2CDEA 2X4TA 3PWLA 3WIIH 4PRHE 3O6ML 5CIPB 3WIHL 4KMQA 3THMH 1SBBA 3TN0D 4Z5RB 4LLDB 3EYQC 3VXTB 2A9NL 1UWXH 1D5XB 3ARTA 4U3XA 2J8OA 5EU6A 4PB0H 4XCFH 4IRJD 3C6LB 4OZIF 5T3XD 5E8DL 4OZGB 3O8XB 1HINH 3QZWG 5DD3H 4JRYB 1WZKA 3HMXA 4ZTPL 2VRAA 2GYSA 3SDXB 2VTFA 1XGTA 1IM9D 5EDXA 2QL1A 5DD6B 3E2HC 1KT2B 1MCNA 4KRNA 4NWUL 2BMKB 3O2DL 4FQ2H 1DLHB 2Z91A 4NHCL 4K07A 2RFXB 5I16B 3QEQA 2E7MA 1H5BB 4JFXA 4ZYKA 4LL9A 5HPMB 4HFUH 3QO1A 3V0WH 4ELMF 5IB4A 4JG1H 3ROLB 4N8VA 1PEWA 3ARED 2EDKA 2MSPA 4XP4H 4LVNC 1H3WM 1XF4A 2YXMA 5DZNA 3V8OA 1N8ZB 1W2KT 3GSVA 1LVEA 2C3HA 3DBXA 4YDVB 4PGEB 4Y8DC 5B3NA 4U3CA 2D7PA 3G6AB 4GH7B 4UIKL 5HHNB 1SQ2N 2QSCL 5F7MC 4G7YL 4NHUA 4M6OH 2J8UE 5CINH 1GHFL 5DJ2B 3OAYK 4Z5RA 3O4LB 3MRKB 4OSUH 2DKMA 4LLDA 2OZ4L 1D5XA 3ZDZE 5IFHH 4JLRB 4Z0BL 2ZP0T 3KXFD 4JO1H 3CFKB 2QQNL 1EO8H 3MMEA 3ZDYF 3M45A 3MV7D 5HJ3B 5DZOA 4L3CB 3SGDH 1FZMB 4OZGA 5FV2A 1R3LA 3I6GB 1XZ0B 4JKPH 4POZD 4JRYA 2VDKH 4CL7A 2JF1A 4YHOH 2D0HA 3GIVB 2IBZX 5CLWA 1ZLVK 3SDXA 3ME0A 1FGNH 2E3VA 5DRZB 2GTZB 5DD6A 3IU4H 2APBA 5C7XH 4GKNA 1U8KB 4FQLL 1MAMH 5CILL 2BMKA 4TYUA 5F7YC 3LS5H 3PIQB 1P4BL 1DLHA 3D9AH 2FH6A 3NAAH 5C0AD 3QI9A 3VFTB 2O93L 2RFXA 3K2UL 3LPGA 5I16A 1X5YA 2QBWA 4FFZL 3DX8B 3LEYL 1H5BA 4JY6B 5D1XC 4K7FB 4JM2C 1RJLB 1F4HA 2HFEB 2OXHA 3FO2B 2DQGH 3T08A 2VLJB 4WWKA 3ROLA 1NLDH 1AGBB 1PVHA 2CKNA 1IGYB 1MOEA 3V6OE 3AY4C 4YDVA 2FDBP 3MRFB 1MCRA 5HYJD 1AXTH 5F9AC 3IJYA 3SE9L 3G6AA 5GGVY 3KPNB 2IJ0C 3OXRB 5HHNA 4AIXA 5GS0C 1DP0A 4JFEB 5DJ2A 1P69B 5BXFB 2XZAL 3PWNA 3MRKA 3VU2A 4Z9KB 2MQ3A 3TC9A 4RIRB 4XP6H 4WU7A 4DQOL 4H1LG 2A6JB 5CJXC 3CFKA 1NCBH 5JDSB 1RIUL 3B9KD 4JFFB 4F7EA 3PL6D 5HJ3A 4GRWH 2XXMB 5DHYB 4KZEH 1MHHB 4XI5D 2KZ1B 1X5JA 4L3CA 1FZMA 5GGSB 5J1AB 1HEZB 1CGSH 3I6GA 1XZ0A 5J13B 3PUCA 2UYLB 5DVKA 3GIVA 4KKLC 5K9OB 4S1DD 3P0GB 4X9BA 5DRZA 4MGXA 4BELD 1A4JB 1MJ8H 2V6HA 4OGZA 1F90L 1U8KA 1YA5A 1BMGA 4KK8C 4X98B 2X89A 3TVMB 1NUDA 3PIQA 3QIUC 3O6MH 3QCVH 3T09A 3BZ4A 1U58A 3GSRB 4Y19E 3WIHH 1ZA6B 2IQAB 1MELA 2YPKB 4K9EH 4NO0B 2QLVB 3WJJA 2Q7NA 3DX8A 3QPQD 4JY6A 5IMOB 2NXZC 3SBWC 4OFYD 3VGEA 1KENH 4Y7MA 1RJLA 3TJHC 4HUVB 3VFSB 2A9NH 2HFEA 4TVPD 3FO2A 4NZDA 1AGBA 4MX7B 5E5RB 1N59B 3L7FB 2P5WE 3G5ZB 4PY8I 4NQXB 4QTHA 1QLEH 4G3YL 1WITA 4WTWA 5E8DH 5F6HJ 3MRFA 5DWUH 2VDQH 3EJYC 1B90A 1D5ZB 4UUJB 5F7KC 1ORQB 3OXRA 5E8OB 5KSAB 1QFWI 2CRYA 4Z18A 4PBXA 1IT9L 2M8XA 2VWEE 3O2DH 3U46A 4Z7QF 3VDBA 1AO7B 1FNGB 4NHCH 4DK6A 4RIRA 4Z77B 5D93C 4DVRL 1UB5B 1FC1A 4MQSB 3DVIA 5EO1A 2PYED 2Z9TA 5DHYA 1MHHA 4FG6D 5J1AA 1HEZA 5C9JB 2AJXL 3NPZB 3NFNB 2BNQA 3A6OA 5JXEC 5K9OA 4KRPB 2JCCB 5D8JL 5D7IF 1I1AB 4BZ1L 4C56B 4YO0B 1QYGH 1A4JA 4TNVK 4NZRL 3NN8B 4X98A 1JZ5A 3DYMA 4UIKH 4OGAD 1BD2D 2YPLB 2L7UA 3MRJB 2QSCH 2ZG2A 3GSRA 3HPLB 3K8KA 2IQAA 2YPKA 5D7SL 4W81A 3SKJL 4KKAD 1GHFH 4U2YA 5IMOA 2A0LC 3FFDB 3QEGL 2OZ4H 4HUVA 5HHXL 3VFSA 4PJ7E 5I1GL 4DW2L 1HZHL 4MX7A 3MRQB 4UNUA 2ENSA 1N59A 3L7FA 3G5ZA 3E1F1 5LBSL 3KHQA 3AM8C 1HYRC 1YYLH 1UJTA 3O6LL 3QDHA 1J1PL 4U1LA 4UUJA 3INUL 5E2JA 1J5OL 1ORQA 5F89B 5E8OA 3FMGL 3BN9C 4LDOB 4FQLH 2K1MA 4QCIB 5CILH 1RZJL 2DL2A 3W0WB 1P4BH 1AO7A 1FNGA 3U2SB 4K9EC 3K2UH 3IT8D 4XAKD 2A6DB 4Z77A 4PLKD 5TF0A 1LDSA 4PJGE 5EWIL 4FFZH 1SJXA 1G9ML 3LEYH 1WBXA 5FO8A 2JJWA 3WEXB 3CDCA 9CGTA 1BOGB 5AZEL 2AJUL 2HMID 4GMSL 3ZYOA 3MJ9L 1XGQB 3UC0L 3PDOB 3DUSA 4XH2B 3QA3A 5C9JA 5I71B 3NFNA 4OM0L 3U83A 4UB0L 1RUPH 1XEDA 1I1AA 3TN0B 4YO0A 3SE9H 3NN8A 4OZHE 3P3YA 2IAND 2YPLA 4WW2F 3MRNA 3HPLA 5GGQL 4IRJB 3EJJX 4IIQC 3R8BB 1IKNA 1FSKB 3VFRA 2EDQA 3TH4T 3FFDA 3WE6A 4Z95L 5EZLA 4DKFH 4L8SC 5CGYD 5FIEA 3P77B 3MRPB 2YSSB 3MRQA 2C4XA 2H9GB 1F5WA 1K8IA 1IM9B 1RIUH 1IMHC 5KVFL 1Z9SA 2NY2C 3MV9B 5FUCC 4OLYL 4ZFOB 4K8RD 1I3RB 1U92B 2W07A 4Z7VB 1OB1B 3EHBC 5FYKL 4HEPG 4LCCB 4XXCC 3RWCA 3QSKB 2Y5TA 4U0QB 3N0PB 5F89A 5DR5L 5CZKA 1F90H 7CGTA 5EOQL 2EXYD 4QCIA 4F33B 3AGVA 3A6CL 1V3KA 2NY0C 2CO7B 4APQC 3AREB 2I9LB 2DBJA 2A6DA 4YH6A 4LCUB 1PZ5B 1CXFA 3T8XB 3WEXA 1BOGA 5BV7B 1XGQA 3PDOA 4XH2A 5F3BA 4WI4A 4XWOC 3QUMB 1IKFL 4Q7DA 4G3YH 1C5CL 1IL1A 4GAYA 3PDGA 1EFXA 1RMFH 3TN0A 1WCQA 2V9RA 5HHOD 1VERA 4F58L 1LP9F 5IR1B 4MAUL 3FQNB 4NNPL 4RZCB 1UCTA 1QBML 3BKJH 3LS4L 3MV7B 2D7NA 4HUWB 2XICA 3P77A 3MRPA 2YSSA 1VFOA 4RBPK 4DVRH 3L3JA 4JVUA 2H9GA 3LZFL 2VO5A 1IM9A 3UTTE 2VLLB 4Y5XC 3VFPB 3MV9A 4ZFOA 1KB9J 1KLFA 2XQBH 5F8RC 1I3RA 1U92A 4Z7VA 2HLFD 4AEHL 1OB1A 4UQ3B 1CDJA 1TITA 2AJXH 4LHQB 3VFVB 4R96A 4LCCA 1H0DB 4LSUL 5DD0L 1FORL 1NCNA 1ITCA 3W11C 4NP4H 2YD1A 4OQ1A 2WWKO 5GHWL 4NZRH 4BQBA 1T1XB 4BQCA 4F33A 5J3HD 4MCYA 4BK4A 1QLFB 4XNXL 3AREA 5F9JA 2I9LA 3WSQL 4IMKA 4KZDL 3I02B 3IU3B 5D7SH 4LCUA 4R6UA 1ZHNB 4F9LC 4HK0B 3T8XA 3QEGH 5HYJB 1TQCC 5I1GH 4JN1L 4DW2H 4AMKL 3E6FB 2Y7QB 2DM2A 4JHZA 3QUMA 5LBSH 4HUMB 4HS8L 1U3ZA 2PR4L 1A3LL 3IF1B 4GAJL 4ODXB 2Y07H 4TNWK 3VI4E 5JZ7C 3O6LH 1SY6A 3QXDB 1J1PH 1J5OH 3INUH 2L0DA 3FQNA 3ZTNH 5L2JB 3FMGH 4RZCA 2EDNA 4WEBL 2F54E 1UVQB 4O00A 4PJFB 3V5HB 3ULUL 3MV7A 5ENWA 1RZJH 4HUWA 3RBGA 4EI5D 4CN4A 1UZ6F 5E2VL 2ADIB 1Z3GL 5EWIH 2DJSA 1MUJB 1G9MH 1C16B 2B5IB 4I5BB 2VLLA 5AZEH 3ES6A 2AJUH 2I60L 4GMSH 4M5YL 3VFPA 5I1KH 3RVUD 2IGFL 5FUOL 4UQ3A 3VFVA 4OM0H 1H0DA 2HKHH 4B50A 5F7LB 3VGAB 2O26U 3KGRA 4GAGL 5J12C 4XCYB 1ES0B 4FQCL 1QLFA 1I8LA 1PYWB 1WWAX 2UY7A 2ZUWA 1U8MB 5GGQH 3I02A 1JGDB 1NBVH 1ZHNA 3V0VB 3ZT5A 3QCUL 2ESVD 3S34L 1YC8A 5BVPH 1R3KB 3NIFF 4OIIL 3E6FA 2Y7QA 4QEGA 4EDXB 2E7HA 5AUMB 1XH3B 2JJSC 5KVFH 1G7PB 4OLYH 2FH8A 1JL8A 3B8SA 1S8DA 3QXDA 1C8PA 3RJDA 4GG6E 5F6HI 2AJSL 4YQXL 5L2JA 2ERJB 3SJVD 1UVQA 3T0DA 4PJFA 3V5HA 2PYEB 4MMXC 3VFUB 3FQXB 4X5XB 1G0XA 2EH7L 5IVNA 1WAAA 5B39G 2IC2A 1MUJA 4TTGA 4XC1H 4I5BA 1FZKB 3VI3E 3LAFA 4OZFA 4OKVB 4KY1L 1MJ7L 2GT9B 3GRWL 1BD2B 1J05A 4DJMA 3PQYD 2MNUA 2YRPA 5FGBA 3SDYH 4NSKB 4Y16C 3OKNB 2VDRL 3QP3A 1ES0A 5DGRA 4ETYA 4F58H 3RVWC 3HI6H 5DJ6B 4NBYB 1HDMB 3N85H 4NNPH 2IFGA 1X5LA 1QUNA 2J12B 1QBMH 3VXMA 4KKBC 1JGDA 3BOVA 4JO4L 3V0VA 3N9GL 4KI5D 1MCKA 4L4TD 3ARBC 4LP5A 1R3KA 1ACZA 1Y6NR 4QGTA 3NCBB 4ZUTB 3LZFH 4EDXA 1U0QA 5AUMA 3MBXL 2D7OA 1XH3A 1UM6L 2H32H 3R0NA 3VRIB 2Q8BL 1C5BH 1GGTA 4KMTL 1VB9A 2DI7A 1UGNA 4LSUH 5E1HB 3RWIA 1UKTA 3VDCA 5C0GB 3QQNA 5DD0H 4F15B 3RI5F 5GHWH 4NN5C 4Y1AB 3RUGF 1CFSB 4RDQF 2J8HA 1CGXA 4WY7L 3VFUA 3QIWC 4X5XA 1QSFA 1C5DB 1YYML 4KZDH 4NZJA 3TO4C 1CFNB 4E41E 2GJZB 4ZFGL 1FGVL 1FZKA 1ULVA 1HIML 1BVLA 3QHFL 4AMKH 3LIZL 4OKVA 2GT9A 2IANB 3VXUE 1L6ZA 1N6QL 1JMXA 4HS8H 5GRYA 4M1DH 2B20A 2QSTA 2W1NA 4NSKA 5IQ7L 2AERT 5E6IB 1TCRB 1A3LH 1UM5L 3OKNA 4X4MA 2DF3A 1EGJL 2FX8L 2GJ6D 5DJ6A 1D6VL 2VB5A 4HDIB 1HDMA 3L9RB 4WEBH 1N4XL 2H2SD 5TH2B 1R6VA 3ULUH 3ZKXC 2Y25A 4PRNA 2EYRB 2M2DA 5E2VH 1P6FA 3D39A 1XMWA 3ZE1F 2IH1A 4ZUTA 4XVSL 3NH7L 4FTVE 2VLMD 1KTLB 2I60H 2JB5H 3IDXL 4QGYA 4X6CE 5C0EB 3VRIA 4OQTA 3LPWA 2VKXA 5FUOH 4P4KD 1A6WL 1KFAL 4YC2B 1TJIH 2NX5E 5C0GA 4AEIL 1JJUA 1T1WB 4OCWL 3O4OB 1EEQA 2Z35B 1RURH 4Y1AA 1CFSA 2FO4B 3V5DB 4LLYB 1C5DA 4XCNA 1CFNA 1V05A 5C08D 3ZE2E 1JPSL 2N56A 1NEZB 3FTGB 1J0HA 2GQHA 1R5VB 4OIIH 4XMPH 5CGTA 2EKJA 4L3AA 5HHOB 2CKBB 4W4OA 3MYZA 3RTQD 3S6CA 2X4NB 1MWAL 5F44A 1Z6JT 3H9ZA 4XBPB 1Y6MR 2OL3L 5D5ME 4OIBA 2HTKD 5GRZA 1F4XL 5E6IA 1LNUB 3MA9L 4AH2B 1CGUA 4Y4KB 3PV7A 2AJSH 4HDIA 4YQXH 5GSRB 2VMFA 5CD3B 5ABDE 5TH2A 1CGTA 2FL5B 5KSVB 3WKML 3A67H 1EAJA 2EYRA 1MVUB 2EH7H 4ERSL 4RFNC 4HQQL 1TPXB 4RGND 2X2YA 3JWDH 1J9CT 3WFDH 4OCLC 1TJHL 2JJVA 1KTLA 1TDQA 2EYTB 5MI0B 5C0EA 4KY1H 1MY7A 3GRWH 5CSGA 2YD2A 3WNLA 15C8L 1JCKA 2Z35A 3RY4A 5I8OL 2VDRH 2FO4A 1NL0H 3MCG1 3SGEI 1MCWW 3V5DA 4LLYA 2FYYB 3RNKA 2HJLB 3ZLQC 1DBBL 1QRNE 2BVOB 4R2GC 1NEZA 3FTGA 3ZE0F 2CKBA 2D9QB 1LK2A 1Q94B 1BOYA 3R1GL 4KXZH 3MBXH 3MLZL 1UM6H 3NZ8B 2QSVA 1UZ8A 4AH2A 5D72L 2A6KA 4JFDD 4Y4KA 3MREB 5DFVC 5DUML 5GSRA 2EIEA 5CD3A 2EECA 1I1YB 1IGFL 3QUXD 2FL5A 5KSVA 1QSED 3MRHB 3Q0HA 2WBJD 4WY7H 4GQ9L 1MVUA 1G7MB 5F7UA 3KYKL 1YYMH 5IWLC 4JPVL 4Z7UB 2XWTB 4YUEL 1KEML 4HS6B 1FGVH 1HIMH 1JGLH 1YEHL 2EYTA 3QHFH 1B2WL 3LIZH 3HI5L 3B2UD 3KPRE 2UVEA 3MRMB 1NMCB 4PJDF 1N6QH 3DVFA 2AJVL 3CVHL 2X1OA 4TN9A 5IQ7H 2DQIH 1UM5H 1CR9H 1JGUL 5D2NE 1EGJH 3WNOA 4MNQA 1J8HB 1D6VH 1QFPA 5EU6E 3U0WL 2WUBL 4N8VG 1NJ9B 1PAMA 2CLRB 5EZOL 4NC0B 1N4XH 5FAAA 3UBXI 2HJLA 5I30H 4QLRA 4MB3A 3CXHJ 5L9DL 5D6CB 2UZXB 2BVOA 4IM8A 4D2NA 2R2HB 4R4ND 1O5DT 1QNZL 5C0FB 3JWDC 3CSYB 4BYHA 3GMLB 3BISA 4MQTB 1Q94A 2WK2A 1CD8A 1DBML 4RMRA 3D85A 3SJVB 3BWAB 4PFEA 3NZ8A 5F1IB 1A6WH 1KFAH 2WLYA 4DEPC 3QEQE 3MREA 4OCWH 2OR8A 2BJMH 3K81A 3MJGX 1I1YA 5I6XB 5J0BA 4LSQL 3L1OH 2LE9A 1RIHL 3EOAB 2XYCA 4GQPH 1G7MA 1WUNT 4TQEL 4LIQL 1ZSDB 1YUHA 2FATL 3PQYB 1J1XL 2XWTA 4PJ8C 5KANI 3C60C 4OZIB 3BPNB 3ZKMD 3JXAA 4HS6A 4KROD 3KVQA 5DO2D 2R69H 4HKJB 3ZKND 1T4KB 1KPVB 3CLFH 5CLTA 3BVNB 1A14L 1IJ9A 4U1HA 1RIVL 3GNML 4I18C 1F4XH 3MA9H 5CP3H 4L9LC 1J8HA 1OPGL 2FECL 4XVJL 2CLRA 4M1GL 4AG4L 1ZVSB 3QDMB 4L8CB 2XIDA 4N1EA 1P9MA 4ONFL 1T6WA 3WKMH 3SO5A 4OZGE 2Z31A 4HIXL 4ELMB 2EDOA 4JKKA 4PLOB 3CXDL 4L4VD 4JRYE 4ERSH 2R2HA 4HQQH 3MLYL 3SE4A 3CFJA 2NY1D 5BS0A 3T3PE 3CSYA 3SDXE 3GMLA 1EEUA 2N7AA 1TJHH 2A9ML 5F8QC 3SJVA 3BWAA 1G7JB 4NO3B 2A83B 5EIQA 3ARDD 2PF6A 4GMTL 4YWGL 3CDYA 5F1IA 5AG9A 3OX8B 4NM4H 4S1RL 2YD3A 1RZGB 2DOCA 1FFNA 15C8H 3KWWB 2F58L 2I24N 5I8OH 1P4LB 1EZVX 3EOAA 2CIKB 4DZBB 2YD6A 2UZYB 3Q5YA 3C8KB 3PQYA 1R3HB 4L8DB 1GOHA 4OZIA 1F4WL 1SYSB 3KDMB 2DRUA 4M1CD 1WWCA 4N0RA 2GJ6B 1T4KA 5I17A 3MPCA 1KPVA 1UQSB 3MLZH 5TF1L 3BVNA 4YLQT 1HHGB 1G7IA 3O4LE 4JFYA 4RCAA 2BY1A 5D72H 4P2YA 3GJEB 4XNYL 4KVCH 3BPLC 1OAYL 5DUMH 1ZVSA 1AGDA 1FVDB 3QDMA 4L8CA 2ADGB 2A77L 5E99H 4M43L 3FZUC 3T2OA 4GQ9H 4ELMA 2BDNL 2BVPB 3IFLH 3KYKH 4N5EC 3N1QC 3RPIA 4JPVH 1MIML 3SCMD 2EDXA 4CADB 2BOCB 4NQED 5CKAA 3ZTJH 3ARSA 1G7JA 1YEHH 2A83A 4NO3A 2VJXA 1B2WH 4M3KB 3VDAA 3UPRB 4HLZH 1VCAA 1RZGA 1FG2B 2LFGA 1WWWX 5F7WC 4H1LH 3CVHH 5FECB 3KWWA 4PBWD 3GMQB 1U2HA 4QXGH 1JGUH 1T6VN 1P4LA 2VLJE 3F7VB 1M6OB 3EO9L 3U0WH 3X13B 2CIKA 2WUBH 4DZBA 5EZOH 3RTQB 3OKKB 1R3HA 1GGBH 3SDCD 5L9DH 1SYSA 1HI6B 4GRMB 3KDMA 1QNZH 1S9YB 2DLTA 2GJ6A 1A6AA 2V9QA 3NACL 4JPIB 3TWCH 1HKLL 1XIWC 1HHGA 4JFEE 4NN7B 2R9HC 3KPOB 1A9BB 3GJEA 4U0RC 4RGNB 2DQDH 4JFFE 1FVDA 4D94A 4LSQH 3BRFA 1DSFL 2V7HB 2H8PB 5DZLA 1RIHH 2BVPA 4G6JL 5EPMB 4JHBA 4F7MB 4GKOA 5HI4D 3PGFL 1MI5D 4QXWA 2FATH 1J1XH 2Y36H 5E6YA 4CADA 3IVKB 5J57B 2BOCA 1I4FB 1X4YA 4GG8B 2CRZA 1C08B 3HHRB 5C0BD 4MB4A 5F7DA 3FONB 3EUUA 1I8MB 3UPRA 4WV1C 5BMFL 1A14H 1B0WA 1G6VK 5JNYB 3TNNB 1T3FB 3GNMH 4PJAF 3F7VA 3UTPD 3X13A 1CLYL 1IQWL 1VEMA 4XVJH 4NJ9H 2O5ZL 4M1GH 1VFUA 3BPCA 3RTQA 3GI9L 3OKKA 4Q6IB 1MRFL 3IFOB 4HIXH 3V9FA 3I3DA 3ULVC 3ARFD 1OAZH 1S9YA 1NUFA 2A9MH 5D7IB 2R8SL 4O02L 4HXAL 2RR3A 4YWGH 2WBJB 2XKSA 1AO7E 3KPOA 1A9BA 3ARQA 8FABB 5F71A 4S1RH 3B9EA 3MNVB 3MRCB 5C70A 1X7QB 3TIEB 2XA8L 4AL8H 4JM2F 3BO8B 1K4CB 4Z6AT 2V7HA 5A2IH 5LQBL 5HGBB 2BX5A 2H8PA 5EPMA 1PSKL 4F7MA 3QYCA 5F7FA 3MRIB 1ZAGA 1H15A 2NR6D 2JCCE 3IVKA 1H3VA 1I4FA 1UKSA 4C56E 1F4WH 3MRRB 5D7LD 4GG8A 1C08A 1DTUA 2YPLE 3FONA 5I1DA 1I8MA 4LPVA 1KPRB 4RISL 5TF1H 5E9DA 2ZNXA 5JNYA 5BZWB 1WZMA 3MXWL 3TNNA 1T3FA 4YR6B 4ZOAA 5HY9B 4BQ9A 1X3DA 1ZT4A 4EXKA 4XNYH 4K23L 4LAJH 5FYKD 1B4JL 4U6VL 2W9EH 4M02A 3QB7C 2PW1B 2A77H 4M43H 4Q6IA 5FXCH 4QOKB 2YUZA 3BUTA 3M8OL 2BDNH 4FQQA 2EH8L 3GSWB 3RJQB 4FZEH 3TH3T 4BUGA 3V7AG 4NGHL 3VGBA 1KXQE 1QHOA 1DL7L 2R0LL 2HT2D 1V7NL 4AEEA 2EIDA 5ESVB 1UXSA 5DJYB 1RPQA 3W0WE 2WBJA 1LO3H 2NZIA 2J5LC 1BZ7B 3DMMD 2ARWA 8FABA 4WW2B 1W0WB 1YMHB 4UAOC 3MNVA 1X7QA 3SO3C 3TIEA 4UBDC 4O2EB 1CT8A 4KDTC 3BO8A 1K4CA 4KROB 2X1WL 3TA3D 1RVFL 3HG1D 3EO9H 4MXQD 2Z8RA 3QDJA 2FBJL 2J1KA 2GFBB 3MRIA 1MCSA 3K4ZA 2YHGA 2FBOJ 1FIGH 4LF3B 1MSPA 3G6JF 3MRRA 4HAFA 4EN3D 2ICCA 4FXKB 1BWWA 5C0NC 4PG9B 1SEBB 3NACH 1U3HD 3NZHH 2O61B 1KPRA 3HE7D 1HKLH 4JCLA 4MZ3A 1AJ7H 1L9NA 5T3XE 3O81A 4YHPA 4L4VB 1FVCB 1W8OA 4WFEE 2NY1B 4HWEL 3AB0B 3MZTA 1EVTC 2FB4H 1A6VH 5T5NF 3ZZ1A 2PW1A 3MV9E 3QFJD 1D5MB 4LDLB 4QOKA 3ARDB 5KBNC 2GHWB 4Z7VE 4RWYL 4G6JH 3L95B 3GSWA 2AK4D 4XVTL 4YHNA 3HNTL 2NY6C 5M95B 4XAWH 2PW2B 1D9KD 3MJ8B 5J4MA 5ESVA 5DJYA 1LO5B 1U6AL 1BZ7A 1LP9B 1BVZA 4ZNCD 4WW2A 3RVVD 1YMHA 2P8PB 1V3LA 4O2EA 3TNMB 1XR9B 1C1EL 3BGFB 5I18L 4KJWC 4UU9B 1CLYH 1IQWH 2X4QB 1G6RL 2DI8A 1FNHA 2O5ZH 3GI9H 3VG0H 3MOAL 4LF3A 5JTWA 3GMRB 1AGFB 3IJHB 4DN4L 3C09C 3KPLA 4FXKA 4PG9A 2XN9B 1SEBA 3IYLW 2O61A 1OL0A 3L5IA 3MV7E 2R8SH 1T66D 4O02H 1J0YA 5T3ZD 5FM8A 5IBTL 2H1PL 5A1AA 4R90H 1LEGA 4L4VA 4MA1B 4EOWL 1FVCA 5EBMB 1L6XA 3T2PA 3PV6B 2GK0B 2J4WL 2E7LA 2XA8H 3SCMB 1ZANL 3RIAF 2CK0L 2RGSA 4P49A 4CN1A 3SGJA 5LQBH 1D5MA 3BXNB 1H8OA 3FHAA 4DWHA 4R4BB 4KTDL 1GH7A 4OLWL 1YZZA 4QTIL 2JELL 1VADB 1ZLSL 3STLA 4WO4C 4OFIA 1DLFL 1TQBB 1PG7X 4HH9A 2ED7A 2PW2A 1NMBL 4P2OC 4TUJB 4F8QA 1LP9A 1MEXL 4RGMB 4RISH 4ODVL 2Y6SD 5B4MD 3U36B 1JGEB 2P8PA 3WFHB 3MXWH 3G9VA 3R0MA 3SDCB 3TNMA 5HYJE 4U31A 1XR9A 3MOQA 5LCVH 5A40E 1UH2A 4IOFD 4Q9RL 3O6KH 3GDBA 4UT7L 3B2VL 1X6NA 4ZXBC 4OZFG 1F8TH 1VKXB 3P9MA 4X6DF 5DA4A 4R97B 3UTQA 3M8OH 3GMRA 1AGFA 2BHUA 3IJHA 1EEYB 5FGSA 5A3IC 2EH8H 3ARGC 1ZVYA 2GW5A 1WIPA 5JIIA 4X83A 4K3DL 2F8XC 2Y72A 2XN9A 3BYTA 2HVKB 1DL7H 5F96L 4PJFE 2IWGA 1K3IA 2FIKB 2PXYD 4CVZB 3BW9B 1E27B 5DD5L 4FFWD 3NABH 2VLRB 3OBAA 3TBSB 5EBMA 1NEUA 1MI5B 4LMQI 2GK0A 2ZUQB 4O51B 3NBNA 3SCMA 2NMSA 1RVFH 1I9IL 4I13B 3TPKA 2WMPA 3BXNA 1OTUC 5C0BB 3LKNB 2FBJH 6FABL 2VDOL 5DK2B 3UAJD 2X4PB 1VGKB 4JKMA 3U0PB 5CJ5A 4LLMB 5FUZL 4YIQB 1KJMB 1VADA 4KMLB 4LDEB 1M71B 2XZCL 3V8CA 4TVPE 4ZAKD 3QQ4A 5DEFB 1NCAL 3CFDB 3C5JB 4TUJA 1OGTB 3F5WB 3U36A 3CSGA 1JGEA 4JVWA 3WFHA 3SDCA 1NCUA 1K4DA 2V9TA 3WO4C 3QAZB 3ARFB 4HWEH 3FQRA 1P7KB 4UT6H 4X4YB 4Y2OA 4DGYL 1JTTA 2DQHL 1JWSB 1F2XK 1P7QD 3BP4A 4MXWH 1EEYA 4HZLB 4BA8A 1AR2A 3VWJB 4XVTH 3HNTH 5J6HB 3BKYH 1DVFC 1PY9A 2HVKA 3VWKC 2ARJQ 3GSNB 4P46B 2PYEE 1T5XA 2FIKA 4NPYB 4CVZA 3BW9A 1E27A 5KTEL 4EDWL 1MFDL 1U6AH 1M4KA 2VLRA 3TZVB 3F7RA 5DMGC 1A21A 3LKSA 2WWMD 4HGKC 3TBYB 4O51A 1WGOA 2HFGL 4WI8A 5GZNC 2PCPA 5ACZB 5KAQG 5MERB 2VDMH 2LVCA 1UXWB 4G8IB 1GSMA 1FHGA 1ROWA 4IMLB 5EC2A 2F5AL 1BD2E 3LKNA 35C8H 2X4PA 1JNLL 2X1PA 3QQ9D 3U0PA 2I5YL 4LLMA 3WFBL 4YIQA 1KJMA 3MOAH 3VFWB 4DN4H 1QACA 4IJ3B 1P4IL 1CTOA 2SEBB 4K3JL 5DEFA 1NGPL 5JUEL 3CFDA 3C5JA 2X4UB 3OJDB 3PWUB 1OGTA 3F5WA 3RL2B 3HMXL 3RUGB 5IBTH 3IFPB 5E8EB 3ARFA 5FEBA 3NTCH 2J4WH 1P7KA 3LN4B 3TPUB 1BBJB 4YZFE 4X4YA 3DXAD 5EOCL 4G6AD 4P5TC 1T22A 2X42A 4TPRL 3EYVB 1JWSA 4U1NA 1CDUA 5HYIA 4HUKB 4NDMB 1CXEA 4KTDH 4HZLA 5L8JB 4OLWH 3DMMB 4XAKE 3VWJA 1RV6X 1EBAA 4QTIH 2JELH 4R0LB 3T0ED 1ZLSH 2OXGA 3TBVA 4Y1AE 5HDQL 3TA3B 3GSNA 4P46A 3HG1B 4NPYA 1NMBH 2HT3D 3UDWA 2ZUXA 3TZVA 3RVTD 3OWEA 4QHKJ 3D2UA 3OPZL 3RHWF 3TBYA 4OF0A 4X7CC 5ACZA 1JN6B 4LPUA 4WEUD 2CGRL 1UXWA 4G8IA 2QQLL 4EN3B 4EUPH 4IMLA 4NQDA 4BFIB 4Q9RH 3GJFA 4I48B 2J3SA 5AAWA 2IANE 4UT7H 3ZL4L 1AGEA 4H0IA 1U3HB 4LU5L 3LCYA 1JE6A 4YFDB 1KTKE 2NY3B 4C55A 2FGWH 3VFWA 3B3IA 4OD2B 1YY8B 1BEYL 5B21A 4K3DH 5KSUB 2SEBA 5CZVL 2YN3A 1YMMB 3Q5TA 5IP4A 2X4UA 4M61B 3HNSL 2FJFA 3OJDA 3PWUA 5F96H 3LRGA 3TCXA 3QFJB 5DD5H 1QZ1A 5DJXB 2YA2A 3T1FB 3IFPA 5E8EA 5K93A 4HPOL 4CMHB 5DHVB 3BUYB 2H6PB 4GKZB 3RGVC 1NEZG 3TPUA 3LN4A 1JNNL 1P6AB 1I85C 1G7QB 2C3GA 2DKUA 1FE8H 3EYQD 1HXYB 4UTAL 1D9KB 3EYVA 3X11B 4NWTL 4JFZL 4NDMA 2VDOH 4OM1L 2AVGA 5DK0A 1GOFA 3T0XA 3DMMA 3ZMRA 3LDBB 5FUZH 5JORA 4R0LA 2WQ8A 2XZCH 5L2KD 3TA3A 3KPMA 3BD5A 3HG1A 3RWHB 1BGXH 1KXTB 1NCAH 3MV11 1CDHA 2O5YL 4NT6A 1G9NC 5IROC 4YGVB 4M7ZB 1T0NB 4FXLA 1JN6A 3CAFA 4PRID 3RX7A 2GEEA 2WWKT 1TJGL 4EN3A 5HHOE 4BFIA 2APWA 4I48A 1T83A 1P5UA 3GB7A 1E4WL 4OCNC 4H8WL 3MUJA 5ADPL 1IEAB 4DGYH 2ADFL 4URTB 2DQHH 3BPOB 3WUZA 5ADOL 1QFHA 2Y9RT 1YY8A 4YHZL 1DQML 5ELIA 1UCBL 4ISVA 3RAJH 3VD7A 5KSUA 1GZPB 3GMPB 2E9WA 3TEUA 1YMMA 4M61A 4JDTH 4FQIH 4JZJC 3QFJA 1V3MA 2VABB 5DJXA 3L3IA 3PDDA 1J87A 2QKIB 4Y19D 2VIRB 5KSBF 1ODAA 2GKIA 3BP7B 5DHVA 3BUYA 2H6PA 4GKZA 4ESKA 1A7OL 4GSDL 1HXYA 1D9KA 3X11A 2F5AH 4M8QB 4N0UA 2P5WD 3VRLE 2EO1A 3DGGB 1F3DH 1OQOA 3K2MC 4WUUD 5EG6C 4KUZL 1WIUA 4LRIA 4PRBB 1BREA 3LOWA 4KI1A 3WFBH 3MA7A 4EKXA