3OKDB

Crystal structure of s25-39 in complex with kdo
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
221
structure length
218
Chain Sequence
EVKLVESGGGLVQPGGSLRLACATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQSSLYLQMNTLRAEDSATYYCARDHDGYYERFAYWGQGTLVTVSAAATTPPSVYPLAPGSTNSMVTLGCLVKGYFPEPVTVTWNSGSLSTGVHTFPAVLSSDLYTLTSSVTVPSKTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords S25-39 Fab (IgG1k) light chain
total genus 42
structure length 218
sequence length 221
ec nomenclature
pdb deposition date 2010-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okdB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okdB01
5K9KB 5A2IH 3NCJH 5IHZB 5I1CL 1PX4A 5JR1H 5IHLB 5KN5B 3CC5A 2VZ1A 3SJVE 4WV1A 2D9QB 1AY1H 2KZWA 1WIPA 3QDGE 4ZUWB 1DQDH 3QDGB 5INCB 3EJJX 2IANA 3CXDL 2IADB 3WHXB 1KIQB 3CFBA 2VC2L 3CFJB 3BO8B 4MJ6B 1VFMA 5GJSH 2XZCH 3P11H 2BJMH 4MQ7A 4P5KA 2W60A 5F6IB 4PG2C 1PG7W 1K6QH 3DIFB 1JL8A 1S7VB 2QL1A 2CDEA 4X5WA 2VXTH 5C0IB 3RQ3A 1A1NB 1UM5H 1AD0B 1X5KA 1FJ1A 3O4LD 1AGEA 4R26L 5KSAD 4F7PB 1I1AD 4F7TB 5D9SB 4JFPB 2APFA 4R90H 1SEQH 2GFBA 2BNQA 1YN6B 1BQHG 1V3MA 2DQDH 2CQVA 1RZKH 2XI9A 2V5TA 3VDAA 5IFJB 3UPAA 4G8EA 1U2CA 5I8OL 5CZVL 4RMSA 1EIBA 3MNWB 5HPMA 4AL8L 4CVZA 1I7TA 3GSWB 4QWWC 4RZCB 4G6ML 1CLYL 3QUZA 1GSMA 5GGVH 1VB9A 1I1AB 5DMIH 1FPTH 1FGNH 4LCWD 5D7IF 1NH6A 1IGFL 4WIQA 1T7XA 3KAAA 3QAZC 2DD8H 3QCVH 3FQXB 3MRCB 2IFFL 3RA7H 1QFUL 4L4VD 5FM4A 3U9PL 5HXMA 2QADC 2GITB 1Q9WB 2NW3A 5IFAL 1A6PA 1IRAY 4PJ8A 5AZ2H 2XZQL 3FFDB 3LQAC 1F02I 4GO6B 15C8L 4KHXL 2APXA 4OQTA 4OCNC 5HDBF 2VO5A 4MNHB 1IMHC 4X6EB 3T8XB 2EKJA 1W72L 3B8YA 4MCZA 2EYTA 3ES6B 5F8QC 3U1SL 4AMKL 4LLWB 3VE0B 3FO2B 3BZ4B 4GUPB 3GO1H 3I75A 1HILA 2A6KA 3LB6C 5HHMB 3VXRE 2HYMA 1FRGH 2EDLA 3W11C 1H15A 1J10A 1OAYL 5D5MB 4NNYA 4BM7A 1UA6L 4TSCL 1T2QH 1AHWB 2IPKB 4HLZG 3ZYZA 5IOPB 2I07A 5E00A 4MNQD 3V5KA 4MX7B 1WIUA 3MJ6A 1NBYB 4LF3A 1MLCA 3MRPA 3I6LE 1W0YT 4NQXA 1BJ1J 2OZ4L 2R2BA 5C3TA 2Y06H 4LARL 5KVEH 3UTTD 1BQUA 1OP9A 4I0PD 5DJ0B 1OAZH 2VZTA 3HE6C 4L9DA 4NT6B 4PLNC 3TGXA 5CD3A 2I27N 5C2UB 4GAGL 1PY9A 1LO5B 1IGJB 5FA3B 5EFIB 2BXYA 1A3LH 4KTYA 2J6EH 5TQ0H 5DI8A 2ZOLB 3CDGB 4WWKA 3CUPA 1P4IH 2VDPH 1FNEB 4P2YA 2B1HH 3OBAA 1BFSA 5HHPB 2XICA 2YPLE 3WFEL 3JUZA 5EIIA 2HLAA 4XPFH 3V4PH 4DGIL 4UI2A 1NGZA 4PJXA 5DA4A 4XAWL 5TQ2L 5IMOB 1HQRA 2ITCB 4QRQB 1IC4L 2HRLA 3S9DB 1O5DT 3WNOA 5GSVA 4Q2ZB 4NCC2 5EU4A 1QPPA 4LLDB 4RGOL 3CH8A 2RHEA 2E7LA 5MERB 2HTLD 3V5HA 2VDNL 4BSVB 2YD4A 4CL7A 4H20H 3ET9F 1R24B 2IPTH 1AIFB 3U30B 4RX4D 5CZXC 3GRWA 2HTLC 1S7SB 4ZPVA 3TLRA 4I3RH 1XR8A 3LOWA 2X4OA 1OAYH 1G6RB 4UIKL 3MREA 3BAEL 4TSCH 3IXTB 5F9JB 2MWCA 3ARFA 2FRGP 4G7VL 4OF8A 4LHUG 4Z18A 5LGHH 3MODL 3W9EB 4UTBH 4PJHB 1WFNA 1CLOH 4CW1B 3MNZA 1PEWA 5KANG 2XZQH 2Z8RA 1UKQA 2ZUVA 1BBDH 3U2SA 3H3BC 1FDLL 3N50A 4U6HA 4X7FC 4QRRA 1GYAA 3P0YL 1OGAB 1XCTA 5CJQL 3TO2B 3IFNL 5EC1A 5BZDB 3SOBH 3D25B 3OPZL 5EO9A 1WSST 1JRHL 1QZ1A 4NM8L 3V6FB 3C87A 3I02B 1N5YL 1IT9H 3VI4E 1A7QL 4K2UH 1OCWL 2QTEA 4U1SA 3OKKB 5CFHA 1MIMH 4AIOA 1NUFA 5D6CA 1OHQA 2X9XA 3RGVD 2WQRA 4NIKB 1NAMA 3EFFB 1XMWA 4MNGB 4HKXB 4PBWD 1WZMA 2COQA 3H3PH 4MB4A 4OF0A 1G7PA 1E4XI 2VIRA 3O2WL 3BEWA 4RAHA 4EEEA 5IEKB 1P9MC 1RZKL 1UM6H 2QADB 3QJHB 4G7VH 4MJIB 2EH8H 1CGSH 2JJSC 4MD4A 2DJUA 5F88A 2BCKB 3U4EA 1T5XA 3QRGH 4HQQH 2GYSA 3Q6GH 4D2NA 1QFWM 3M1BA 5EA0L 4HZAA 5E5MA 2Z93A 2DIBA 4XVUD 2UZXB 3DURA 1SEQL 3F7PC 1ZKAA 1KIPB 4IDLA 3MRGA 1UB6A 4R26H 1A6TA 3Q1SH 2YWYA 3AROA 4POZC 4ZTPL 4BKLA 2KPNA 7CGTA 2NNAA 3H9ZA 4MCYB 1X7QB 5F3HA 3ROOA 3OG6B 4PJFB 5FIEA 3SO3C 1EFXA 4GKNB 3DVGA 4G8GB 3VG9B 2GK0B 5I9QC 4JO1L 1RK1A 3MV7D 1IEBA 3DTXB 4C56D 2HN7B 2XZZA 1TTGA 4ODXA 5DMIL 4WI8A 5BMFL 1MH5A 2Q76B 3ZL4L 2CIKA 3WD5L 3RVTD 3QHZL 1OTSD 3WNPA 4D9QD 2H2SC 1DQTA 4NKIL 5E2WH 4DKFH 1KSRA 2Z35B 3HB3D 4KPHH 1MHPL 1RZ7L 1RJLB 1CFTA 1MCFA 5KOMC 1O7VA 5SWSA 5HVWA 4K94C 2D7QA 3OAUL 1XF5A 1T1XB 1QLFB 4PJ7B 5IMMA 2XKSA 1K8IB 1A3LL 4UOW1 4QHMA 4TOYH 2B7DT 1T2XA 1NLBL 4P2RB 1H3TA 3KS0H 4HGWA 4Y5XB 4X6CB 2DM4A 4B7IA 4XX1G 1RUAH 5KS9A 2P48B 4YDIH 1IM9D 1I8LA 5TFSH 3MRJB 5TE6L 1YC8A 1ZLSH 1A6WH 3BGMB 3QPXL 4MS8C 2W9EL 2UWEA 3TP4A 5SWSE 2H32H 4H26A 3ES6A 4KJQD 1YPZA 3LMJL 1ED3B 3NZHL 5SWSB 3VRIA 4KUZH 2EC8A 4GAGH 5J9PA 2NY5H 4FTVE 1Y6MR 1MEXL 2OTUA 3CMGA 4DN3L 3L5WA 5BV7H 3QZWG 4PJ8C 3MZGB 4HUWB 4GRWF 4WFGD 3CFDB 1QFWH 2X09A 2YS4A 2XXCB 2DBJA 1CL7H 2J8UF 1OP5H 4N8CH 5CJXC 4V1DE 1DBBH 1NUDA 3MCG1 3SDCD 1GGIL 4N8VA 3AVEA 2NXZB 4E41E 3TBYA 3H3KA 3R8BB 3OKOB 4JFED 3WLBA 4E9LA 1VEOA 1Z2KA 1MJ7H 1IVLA 3RRQA 1AJ7H 4P2OC 1GGTA 4FTVB 1YNTA 3IDMA 4D3CL 2DQIH 1MAMH 3VFPA 3CZJA 4AEIL 3ME0A 4DUXA 4U1NA 3P73B 4QRPE 4NYLB 5I1LB 4QTHB 3F6IA 5I17A 3QIWB 3WE6B 1OGAD 3KPOA 2G5RA 4O51A 4S1DC 2NXZD 4R0LA 4Y4FC 5EZOH 3HE7A 1TZHA 4YZFF 4X5WB 1OTSC 2F53B 2ARJA 1HXMB 3MFFB 4MYWB 2XPGB 4Y19B 2JCCA 5DRXB 3PHOB 4QOKA 4P5TB 5SX4H 3LN9A 5F7EH 2NX5A 1J86A 4MD4B 3U4EB 5H35B 4JFXA 3NTCL 5IB5A 3E2HC 4NO3B 3HE6B 5GGSB 4N0CC 2V2WB 5KVFH 1BQLL 2A1WH 4YNYB 1KACB 2C3HA 5HYIA 2Y36H 3OKDB 4FQ2L 3MBED 4X6DB 2OSLB 3RAJL 3NCFB 2XQBH 1SJXA 4POZD 3PJSB 4Z0BH 3CAFA 2DBLL 5EG6C 4TOYL 1KYOJ 1X7QA 4MCYA 4MA1B 3E8UL 3IDXL 5I73C 4F7CA 5F1SA 2YXMA 1LP9F 3ILPB 5I1JH 4EBQH 4QRRE 3S4SA 4WU5A 1BLNB 3GFUA 1P69B 3F7YA 4U6HB 3DRQA 3C60D 3QUMH 4NN5C 1TJHH 1JZ2A 3JV0A 5F7MC 1L0YA 4BQ8A 1TQCC 4N9GA 2EDYA 4OZHF 4Y0GA 1UB5B 4BFEA 4Q58C 3VG0H 5J11C 3GI8L 1JHLH 3G9AB 1M7IA 4QEGA 2V7HA 4HX1A 4LEOA 1YEDB 5KSBA 4EDWH 3S5LB 4QGYA 4K9EL 4K7FA 1MAML 2X4OB 4ZAKA 1AR1D 1B88A 4J4PD 1UWXH 4NBZB 3VXRB 3HZVA 2ZUXA 4KK5C 3ZSTA 5AD0B 1KJMB 4P23D 1CQYA 3H0TB 2AK1L 3SGKA 3MLXL 1TJIH 2VUOA 3CU7A 3U7AA 4HC1A 4OAWB 2BNRE 5DHVB 4OZGA 4XXCC 1F6AB 3FRUB 4L8BA 3H0TA 4R2GB 3QG7L 3CMOH 4WHTA 5SWZB 1MI5A 1SY6A 4PJGA 3RY6A 3UJTL 4L5FH 4NPYA 1WBXA 4D0DB 3S5LA 1Z3GL 3HS0B 5F1OB 4ZFGH 5HD8D 2XWBB 3FT2B 4ZUUA 5LKNA 2KQNA 2ESVB 1QNZL 4I77H 1M7IB 3VXME 3PL6B 1A7OH 1K3IA 3S34L 1PVHA 1RURH 4QF1A 1HINL 5FF6A 2YK1H 2VITB 3CDFA 5SX4I 2QJDA 4NC0B 5HHPA 1Y0LB 1SJVA 1LVEA 5FYLL 5JHDB 5HDQL 5T3ZE 3C8DA 1HHHA 1DE4A 1KB5B 1VFOA 35C8L 1HKFA 3BEVA 3QIUA 3UBXI 3UZQA 3H7BB 4WU5B 1J8HE 4D0CB 4YGVA 5JOPE 4AIZB 1DANU 5B8CA 1BFTA 1TNMA 5H8DA 3HAEA 3BVNB 4P57B 2WWKT 4G6KL 2XRAH 3NIFE 1RIHL 4NQXB 5DJYB 5MERA 4JPIA 3WEXA 3MRHA 4K3EL 1NBYA 4LF3B 4U6TA 1T0MA 4M62H 1UCBL 3CNKA 2UWEE 4DUVA 4UILL 2LTQB 1NBVL 3BX7C 3B2UC 1WWBX 5D1XD 4S1RH 4LCYA 3GSVB 1JP5A 3V95A 2AABH 4OD1L 1S7QA 4I1NB 3RWEA 5C0CB 1KTRL 4IMKA 4P0DA 3TVMC 1DL7L 2I25N 4JDTH 1JGUL 4Z77A 2ARJB 4Y19A 1ZGLP 3KJ6H 4XP1H 1RAMA 2JJSA 1HHIA 1FZOA 4NWTH 1HKLL 1P9MA 2E8YA 4M4PA 2HJKB 1T6WA 5ESVA 1OAKL 1F3JA 1YPZB 3KPRD 7FABH 2NW2B 2DQTH 2UWEB 3HNVL 4NKOA 3GRWL 1F5WA 4JDZA 3EUUA 5ENWB 3CLFL 3VCLB 3KPQA 3FOMB 3QH3B 3OSKA 1A3RL 4KK8C 4HPYH 4AH2A 5EA0H 2VISB 3G04B 4PJAB 3TBVA 3TN0D 5CBAB 3KLHC 1QLEH 3LKOA 4HS8L 1CBVL 4MAYC 1U95B 1F4WL 3INUL 2A6IB 2VWEC 1INQA 1RK0B 4PRDB 5D5MA 4QOKE 3LKOB 2N7BA 3QUKB 4QRSA 4NNPL 3T0EE 3L3DA 4YXHL 4ZTPH 5AG8A 4UINH 4E5XA 5GJTL 3BZ4A 3L3GB 3K74B 2AJVL 1KCKA 2MFNA 4GRLB 1FFNB 1U58A 3TYGH 5L7XH 3T2NL 4XPBL 3SN6N 1NSNL 2CJUH 3V6BR 3QJFA 1F3JB 4CRPA 3QDJB 2F8XC 4OLVH 5EULV 2NZIA 4HUNB 1IGML 3T2OA 3P4NA 4GRWE 1OSZB 2FJGA 4C59B 1CDUA 1U8QB 3QIBA 4HWBA 4JZNB 4MXQD 2ZCKL 4XRCB 1F4AA 3CVHH 3WUWB 5J3HC 1NEZG 5IVNA 3SGJA 1L7TH 4TUJA 3QXAB 3DX8A 5ETUA 1LO0H 1J1XL 2JELH 3RA7L 2NY1C 1FFNA 4BQBA 3HNTH 4U1HB 5I0DA 5C08B 1TVHB 2PXYB 2DS4A 5ELIA 3SY0A 4OLEA 1F3RB 4QRSB 4M6NH 2FSEB 1IQDA 1QA9A 3SCMA 4M5YH 3QDGA 4P3CL 3O8XB 1C5BL 4OZHE 4Z95H 4HIXL 4OJFL 4TRPL 4Z7NF 3TH3T 1U8IB 1TZGL 3MODH 1KJVB 5GS1B 4H88H 1IC7H 5JW5B 1EFXB 4GKNA 3KYAA 4UU9A 4EQ2A 2A73A 2GAZA 2XTJD 3KVQA 3BKCL 5E24E 5E8EB 1Q0YH 1ACYH 3VFNB 4H0IA 4YE4L 2ZG3A 1BBDL 4J3OC 4S1SH 3IVKB 5KZCB 3IS0X 2FD6H 2CXGA 1U8PB 4FABH 4QHKI 5KSUA 1CXLA 1JK8B 1DUYA 1A1NA 3IYLW 2Y5TA 4ODWB 3DURB 4GG6B 2FX7L 3FQUB 1IT9L 2NY0B 4D0BA 3G6JE 1KJ2H 1XGRA 2VDKH 1I7ZA 1BHGA 3V5DA 1UXWB 3U0WL 3PWJB 3ORJA 4HCRA 5IVXA 1RUPL 1N6QL 1CTNA 1WZ1L 4M93B 1AC0A 4X0KB 1QSZA 2ESVA 3N85H 4JG0H 1S7RB 4FQIL 3CSYA 3HLAA 5CSBA 3T2NH 3QQ4A 1XZ0B 3KGRA 5CEXA 4Y4HC 3WEXB 1G9MH 3CC5B 3FRUA 2EE3A 1KCUL 1D6EB 3CFKA 4UTBL 3P0VL 4YR6B 3BVNA 4GG8A 2LTQC 1F4WH 4EI5A 3NFNB 3R1GH 3TN0C 5B8CB 3PWUB 4BKLB 2YPLB 4ONOA 5AD0A 1P7QD 2W0LA 2WUCH 4C56B 2ZCLL 3MLSL 4P9MH 2F74A 5I74C 1DJSA 3TVMB 4NNXA 2YBRA 4ONGH 1VERA 4H20L 4PGCB 4U6VL 1AHWC 2BCKA 1FFPB 3KYNB 3EHBD 4GMTH 1GRWA 3RKDD 5ID1A 4HIHB 4M61B 4EZMA 1RUKL 5FB8B 3HZMA 4OLZH 4OD3H 5KZCD 2G9HA 3LS5H 4XPFL 4XBPA 1FLRL 2ZNWA 4ORGA 2HKFL 1JGUH 1XH3B 5GPRA 4D9RE 1MI5B 4OLXL 2DM3A 3LPWA 4LVOC 3BUYB 4J3TA 4PJAE 4PTUB 1QBLL 5ISZD 5EZJB 2ICWJ 3DROB 2HT3D 1N7ML 4PG9B 4RWYL 2K9UA 4HK3J 1W0VA 3D3VA 2PYEB 3A6BH 3VGAB 5ESAB 3HZKA 4W81A 4OFIA 2QQKH 4JFEB 1DDHB 3TJHD 4BQ6A 2G60H 1XGQB 1FRGL 2DQCH 3CH1A 3K1KC 4N5ED 1J8KA 5DK2B 1BBJB 2JIXD 5MHSE 4F7MA 5KSBB 2FIKA 5CZXD 3WIIL 2AI0L 4L8SC 2B1AL 2BC4B 1NGZB 1OT1A 1BECA 4M6ML 1U9KA 1X5IA 5TDOB 3L5IA 3QFJB 4FQLL 2YPVH 3OR7A 1NDMA 3SDXA 4G9FB 5FECA 1QLRA 5E08L 1QRNB 1GHFH 2QSCH 4NRZB 1MCIA 1VACA 2AXJA 3REVA 4EIZC 4HT1H 4I48A 3TO4C 4R4ND 5DJ0A 2BX5A 3UX9B 2OMBA 4L8DB 3KDMB 4NFDA 2ADGB 1FCCA 3MCLH 2DF3A 3Q2CA 1NPUA 2F54B 4WV1C 4PJ5E 3RP1A 1T0PB 2ICWA 1JPSL 2N7AA 3HAEG 5GS1C 2AQ3A 3BSZH 5GSVB 1U8IA 3MYJA 5SV3A 1IGCL 2IPKA 1AHWA 1JYWA 3RDTA 2CH8A 5TPWH 2QQQA 3O8XA 3VXUB 3BKJH 5IKCB 5BS0D 2V2WA 2OTWB 3QCVL 4PD4J 3KWWB 3MA7B 1RULL 2CIIA 2QR0B 3HTLX 2Y1VA 2FWOA 1GC1H 4ZXBA 4DN4H 5ETUB 5BVPH 3JWOH 1XIWA 1CF8L 4NUJB 2NMSA 5L2KE 2NY0C 2QKIA 5AYUL 3B83A 3S36L 1ODAA 5H2BA 3CSPA 1IGJA 4WVRA 4KUCD 2APWA 3WIFB 3SGEI 4O4YH 5DMGD 4NKDB 4G6JL 2ERJB 5FYJL 3W0WE 5GSRB 3LH2H 1OAQH 4OQTL 4PJDA 4P2QD 1LO4H 4HS6A 3GK8H 1CE6A 3E6HA 1FVCB 2MPAH 4P23B 5CSZB 2ORBH 4NDMB 4KMQA 3OKYA 3WFHA 5INDA 4YWGL 3OR6B 1G84A 4JGJA 5I1CH 4FFZL 3UTTE 1I1FB 4ISVA 3SGKC 2AV7B 3SDXE 2IANE 1DSFL 5GGQL 3V0VA 3O6ML 4U1JA 5J0BA 2L7UA 5ILTH 4ZQKB 2OTPA 2ICWI 2D7NA 1IARB 4MNQE 1CGVA 1A7PH 4NRXA 5DZLA 2VDQL 4M7ZC 5C0ND 1RIUH 1T1WA 2FGWL 3K2MC 4JRWA 3FQTA 4P2OA 4U6YB 4XMPH 4KZDL 3JWOL 1A9EA 4LKCB 1FJ1B 1YMMA 1T66C 25C8H 3BP5A 5CIPA 5F7EL 3RI5F 1X44A 4TVPL 5A16A 3VG9C 3IF1A 3DIFA 5BV7C 3FB8A 1BREA 3BH9A 4MJID 5I6XC 1CE1H 3L7FB 5MEQB 1TCMA 1WWCA 3EOAB 2AEQH 1HWGB 3AXLB 5C07E 5DVMA 3FN3A 2IANB 3VFGH 3ZT7A 5CIPH 1SY6L 3WFZA 4ELKA 2P8LA 3HNSH 5E1AB 1MCCA 3HC0A 2R0ZL 3HCVA 2Z92A 5C0BA 3ZE0F 1EJOL 2GK0A 4G8GA 3QWOA 3DUHA 4NQUA 4YHKH 5E56A 5IROC 1KLUA 2MQ3A 3R06A 4P57A 4Y16C 1GXEA 4R4FL 2X40A 4O4YL 5J1TC 1DBKH 3F6LA 5LXGL 3WN5B 2W1NA 4OBSA 3VI4F 5KANI 3TNMA 3QEUB 3UZEA 1BQHB 4WI3A 2VUYA 2NY7H 4O02H 4YHLH 1IKFL 1I8LC 1K4DA 4D94A 1NBZA 2CMRL 2IPUK 4DN4L 4KKAD 4ZSOA 4NQEB 3GMLA 3O41B 2W60B 4Y1AE 2B8OT 2WMPA 1JZ3A 4NQEE 4ZUSB 4LCWB 3QJHA 3IRZA 4IIQA 3PL6A 5F72S 2MCPL 2AGJL 3DBXA 5IM7A 1J05A 5I66A 2NY2B 4OCXH 1EMTL 5BO1L 2YPVL 4IOFC 1ZLSL 4KQ4L 4U1KB 3OB0K 4JY6B 3SGEH 5JPNB 4M6OH 1BZ7B 4E41D 4PJFA 3ROOB 3DXAD 1BFOB 3LHPH 4H5SA 4PRBA 1U3YA 4K8RH 1ZA6A 1U8KB 4TNWK 2R56H 3O0RH 4UNUA 1GIGL 1RUKH 2BSED 4OTXH 1DEEB 4K7FB 3SDXF 1IAOB 4WUUD 3K2UL 3N1PC 1FFQA 5D72H 4I9WD 4B7LA 4O9HL 1VFBA 3OAZH 2NXZC 5C0CD 5L9DL 1KB9K 3TIEB 1HWHB 3F58L 1SBSL 3WIHL 4IOIA 3MMEB 4O58H 1QBBA 4X6DE 1RSFA 1NGPL 2X4RA 1C1EH 1BAFH 3T09A 4U1LA 3LRSB 2V2XB 4ZPTA 1YZZA 5IP4A 4AG4H 4HDIA 2D31A 3FQWB 3F5WA 1QHPA 3V7AE 5LBSL 4IRSD 2QBWA 1DLHA 3SDDD 1DL7H 1ND0B 5FGCE 3TBSB 2A38A 4L4TA 3GUTA 3SDYL 2KKQA 3LRGA 4KK6C 4O00A 3IFPA 3C2AL 1FSKB 5D1XC 5FGSA 4S11A 4Y4HA 3KYKL 1RUPH 1N6QH 1YECL 3MLTA 1MFAL 3BYTA 4PR5A 4MSWA 3IJYA 2VDRL 1NBVH 3MBXH 3FFCA 2YEZA 32C2B 3GJEB 4LEXH 2CLVA 3D0VA 2NY6D 3ARTA 3OB0H 5A43C 3GGWB 5F21B 5IB5B 4CGTA 4N5EC 2ZUWA 4UUJA 5DUML 5E70A 3KWWA 3PWPA 3PABA 4U05A 1IE5A 5GGRB 4GLRI 3UYRH 5IT2L 3QXWA 2NX5B 3KXFD 3ARUA 1T89A 2VTFA 2HLFC 3LQAL 3MACL 2JCCB 4FABL 2XPGA 1Q38A 1R3LA 4PR5B 2NY4B 5CJBA 1TZHB 1JWSA 2HA1A 4M9PA 3JTSA 4OUOA 4OZIF 1FL3B 3IFPB 5I6XB 2RBLA 1F11A 1JNHB 5DRWA 4FZ8H 3TWCH 1M05A 3NPSC 4K8RD 4PB9L 4DAGL 2V9RA 4E0RB 5C7XH 4ZFFB 2OP4L 4QTHA 1CFNA 4G43B 4TSBL 5T33L 4Z7WA 4IRZH 5BVJA 4JJHA 1Y6KR 4BSVA 5L8KB 1QRNA 2BOCB 4RFEB 1UVQB 4PJAF 4XWGH 4MX7A 1IAIH 4CADB 4LDOB 3HNTL 2NXYC 1JMZA 1DBAH 3K7UA 2HVJA 4JKMA 1NCBH 1JYNA 3VWJA 1NFKA 3TIEA 5JO5B 5F1NA 3U82B 5IEHB 1LO3H 3OJDB 4R7DA 1GJIA 4Z7OE 1Q9KA 2D7PA 3C8KB 2IALB 3VE0A 4Q97A 1N3NA 1G7MA 43C9A 4AENB 1JRHH 4L3EA 4TRPH 2CJUL 2I60L 5B38B 3JV4A 1Q72L 4C57C 5LAXB 3C2AH 2ZKHH 3QUMB 4LCCA 5HHOB 4YE4H 5J12B 1IFHH 4JRYA 4TTGA 2FX8L 2GITA 1HZHH 2ZUSA 4KKAC 3FZUD 3ZYJA 3V7AG 2BSRB 3F8UB 4XCCL 3OX8A 5DR5L 3MJ7A 4PJCE 4ZYKA 1T80A 5BW7C 1JPFA 4Z0XA 4LASH 1LD9B 4XBPB 5D1ZB 3T4AB 4YHNB 3FRPG 4IRJA 1LEGB 4K7PH 3KPLB 1HH6A 4OCSH 3BPOB 5E8PB 3QCUH 3QQ9D 3TF7C 1E4WH 3STZA 1A7RH 1CXKA 5C2BH 1LDPH 4KDWA 4HPOH 1ES0A 1NGXB 1AC6A 4DVBB 3VD3A 4ALAH 2EDWA 1ZLVH 3MLYL 3F62A 4ODTL 5A2LH 3FB5A 2F5AH 2EYRB 2C3XA 2XA3A 3BN9C 2W0FB 4KROB 1WBYB 1IC5H 5TQ2H 4N90E 4PY8J 3PIQB 3FO9A 4FQ2H 3VXMA 1F3DH 3UPRB 3PWVB 2CO7B 4ELMA 5J56B 4F7PA 3QI9C 4LU5L 2AJYL 1YQVL 3SE3C 1K4CA 1CS6A 1MRDH 4ZAKD 4CN6A 2VH5H 3QISA 2DKUA 4AK1A 1U3HB 4LPVA 2QSQA 4LSTL 3HC4L 3EDJA 3UBXA 4A6YB 1NMAH 4JFYB 3H9SE 1INDL 4WFHE 4PRHA 3DETD 4XVJL 4ODUB 5GGVY 5IB2A 2C1OB 3TPUB 5KAQF 1OB1B 1A4KB 5GRWA 3QNZB 1SJHB 5D6DC 5C07A 3MLVH 1DBJL 5EOTA 4WW2B 4J3VA 3SO5A 1WFOA 4FQQA 1GOHA 1UJ3B 2H2SD 2X4SA 5E6YA 2HN7A 5HGAA 2J1KA 4XHJD 1UQSA 3DRTB 5HYSA 4XPGL 4LCWA 1I3GH 3V5DB 4XAKD 1NEZB 3ULSB 3WIHH 5ALCH 2G5BA 3MUGB 5T1KD 1XAUA 3MLZL 4M6OL 2C3WA 1YEFL 4J1UB 1CDJA 3UBXB 3WDJA 3VXUE 4X83A 1NBZB 2EDDA 6CGTA 2VLRA 4FXGA 4WEBL 3G5ZA 4PBXA 2NXYD 1BX2B 5DLML 1UCBH 1GIGH 2D7MA 1KT2B 1FZMB 3OAYK 5MP6H 1OLLA 1KIPA 1K2DA 3C5ZA 4KKLD 3W5NA 3EO9L 1YEKL 1IILE 4J1UA 3HI5H 1BEYH 4N0CD 1ES0B 4OD1H 3G6JB 3UJTH 1XR9A 2X1QA 4I0PB 3K8MA 2RAMA 2X4SB 1U8OA 2J88H 4GAJL 4PJ5B 3VU2A 4K3HA 1QUNA 2BY0A 3VXUD 4DKEH 4PJDE 1G7QA 2AEQL 2DI9A 3LN5A 2IH1B 4KUZL 4Z7VB 3GSXA 3CU1A 4XNMA 5GSRA 1XCQA 1PX3A 4JM4L 4Z7VE 4K9EH 2EIZA 4P46D 4X98A 2BDNL 1OM3L 4FQ1H 3OWEA 4QHNA 3MV9A 1CLYH 5TDPB 5DDHB 1AGFB 1XGUA 1Z3GH 3T3PE 1JHLL 4H1LG 5M95B 4LPCA 4EUPB 3VXNA 3QJFB 2EDXA 3GSRA 1XF3B 3JWDH 4AENA 2Y7QB 5IV2B 3L3GA 4ZUTA 4GW1B 5BW7A 2E9BA 1FNAA 4G7YL 1LE9A 2O26U 1RURL 1I1FA 4YDLC 3V7MA 5IKCA 5K9JL 3GZKA 1AR1C 4J4PC 4KI5C 1RUQL 3VFVB 4N68A 4YEEA 2R0ZH 1A1MA 3VXQA 5IF0B 5J12C 5CMAB 3TCXA 5I1JL 3KYOB 1ZWIA 4XI5D 1NMBH 4NM4L 3C6SA 4RFEA 4L5FL 4HS6B 1RZFL 3P77A 3MFGB 4XTRD 1Q8MA 3VCLA 2P45B 4L8DA 4ZFOA 1MFBH 3T0EC 4OCWL 1X5AA 3O45A 5GJSL 3EYSH 5E94B 2DLGA 2VAAA 3RAJH 1BQLH 2A1WL 3I9GH 5C0RL 3PGCA 3ARYA 3TCLA 3ARBD 3N9GL 4KTDL 3WS6C 5E0QA 4MA3B 4U2YA 2R9HC 1ZT1A 5EZIL 3NCJL 3QIBC 4PUBL 4EOWL 4JO1H 1A0QL 1RY7B 1X5YA 5TGBA 4AEHH 1YYML 3IAQA 2L0DA 3O4LE 4RFOL 4CVXB 5EOQH 4NZRH 1N2RB 1MCQA 4JJ5A 5C92A 2D7OA 1OAXL 4NZTH 2CPCA 1GGCL 3MYJB 1U3HC 4P2QB 4PLJC 2EDKA 4Y2DA 5DMGC 3D3VE 3NA9H 5B3NA 1NDGA 2O5YH 5K93A 4JQXA 2D0FA 3MBEC 1GGUA 3ARDC 4NUGH 2PYFB 5EBWA 3MOBL 1AO7A 2HG5B 4Z7NE 1MFBL 5DD6B 3MX0A 4JLRB 2NCMA 4FQXB 5I74B 1XF4A 1C12A 4I9WE 3G6JF 4Y2DB 2M2DA 3MXVH 4HIIA 5CMAA 1JF5A 4AT6B 5FOJA 4OGZA 1CK0L 2HJFB 1RUQH 4N0FA 3OKMA 4NN6B 1FFOB 2GSIB 5IK3A 2GKIA 4LPUA 4KJYA 1CCZA 1F4YL 5ESQA 4ZS7H 4NO2A 3NMEA 3I3DA 3SDAC 3S36X 2X42A 3TVMA 4F15C 4OIIL 2Z31D 4BZYA 5DD0H 5ACZB 4NWUH 4WCYH 4PJBF 3U4BH 3NCMA 3BDBA 1ULVA 3ARBB 4PREB 4F9LC 4C56A 2F8OA 3AB0B 2C3GA 5FO9A 1G9MC 1MCWM 4FQLH 4L8BB 3QSKB 4JO2L 2ZJSH 1MWAH 1MCNA 3QWQB 2VN4A 5ACLA 4L1DA 1KPRA 1WZLA 3V0AC 3TBWB 2GJ6B 5IHUH 4RMQA 1K5NB 3JTTA 3VFUB 5I75C 4TNVF 3WIIH 4NQED 3F12B 3QEGL 1XH3A 1QPXA 2AJUL 3CX5J 5MP6L 3LS5L 1HOCB 4BSJA 4JHAL 5I66B 1KXVC 5F9OH 1ZWIB 1UWXK 4KZEL 4JFDE 3A67H 2HFFB 1PAMA 1VPOL 1KLGB 3MRDA 4Q9CA 4KGLA 3FRPA 3G6JA 1N59B 4JKLA 5DVLA 4M1DH 2Q8AL 1T21A 5DUBB 3Q3GB 5D96B 4YHYC 1OOAA 1KC5L 4PJIF 4Z7OF 3OJ2C 3AY4A 1B3JA 5FXCH 1U8KA 4NKIH 4P46B 3BPOC 5JXEC 1NGQH 3RY6C 3T2QA 3MNVB 1BFOA 4XPHL 4RA0C 4WUUE 4R6UA 3O2VL 4GXVL 1KPVB 2UZIH 2D7TH 1GGBH 4M43L 2D0GA 4ZNEA 1T89C 4UT6H 3EHBC 4ZAKC 2EIDA 3GKZA 3GSNA 1HDMB 1M71A 4QGTA 3UTTB 5JOFA 2AV1A 1NGYB 4HK0A 4K9EC 4UT7L 4XH2A 5I1GL 5MEND 3K1DA 3GMPB 4F9PC 4BZ2H 1A6AB 1ZANL 2IJ0C 1S7WA 1P6FA 2XQYG 5DD1L 4LASL 2J6EA 4IIQB 1AKJA 3MYZA 4MJ5B 3UTTA 4Z7QE 1SBBA 4I0PA 5FCUH 5EU6B 3SDCC 2AJSL 4NQCB 3C5JA 2FX8H 4N0RA 4L4JA 3ZT6A 3PV6B 3BJ91 4JM2C 4XRCA 3WUWA 4PY7A 3KPRB 3FT3B 4M1GL 3QIBB 2P24A 1JGEA 4H8WC 2ERJC 4GBXA 4Y1AD 1MJ8H 4FHBD 5FKPA 4LLMB 2HKHH 3DMMB 2C3VB 3EO0B 2HJLA 3MRBA 4JVWA 4G8FB 2VXQL 4GRLA 3VJ6A 1EXUA 4QXGL 3S88H 3MGTB 5HDBE 4Z7UF 3NN8B 4H25A 5HYJE 2A6DB 4G8IA 2FH8A 3A6CH 1T21B 4WWKC 4OCMC 2XFXB 2J8UB 5C2BL 3W0WD 2VLMD 3L5JA 4EUPH 2J8UE 3U79A 1CFSA 5E99L 2FD6L 1U95A 1ZMYA 3L95B 5FDWB 5IG7B 3V0WH 1QA9B 3SCMB 1LEGA 3P9MA 1NCCL 4FFWC 2FDBP 3PUCA 3FOMA 4F9PA 2ICEB 4RDQG 1HHJB 4NKOB 4XXDA 4E42A 5HGBA 3IFOA 3TM6A 3AM8A 1FDLH 1KG0A 2VLLA 4P4RB 1R3JB 1T0NA 2OTUB 4UQ2B 2QKIB 4XMLL 4Y19E 1OF2B 4G5ZL 4JN1H 1FPTL 5KSAB 4P2OB 1DQJA 3I50H 1I1RA 1WAAF 1B90A 5DQJB 3SDAB 2R4RL 4JFFA 1I3VA 3RL1A 4HUXB 1S7QB 2Z8WC 1I9RH 3DSFH 2AJSH 3QUXC 3Q6GL 3E6FB 3ARBC 4UV7L 1HSBA 2RB8A 3EOBA 2YUZA 2B4CH 3SOBL 1LP9B 5JIPA 3DX7B 1NCBL 1BVLA 4NC1E 5D1ZD 4RGNC 1T04B 5F7FA 4OLVL 5KSBF 5CBAA 1ZSDB 4Y16B 4K94H 2IAND 5I1DB 1S9XA 1IBGL 1JIBA 4RSVA 1MIML 5C09D 1NFDB 3C09B 5BQ7B 4TSBH 1I3RB 2W59A 4KJWD 4M7LL 2BSRA 1KCLA 5EBWB 4U7MA 3RGVA 4E0RA 1YEJL 4XCEA 1LO0L 4BFBD 5ALBL 5I19H 1H3GA 1TETH 2AJ3B 3LDBB 4PV9A 4MB3A 3DUUB 2DYPD 2X1PA 2X9YA 1N5AB 5D7SL 4CDHA 2OLDA 3DLQR 4HUVB 4M1CD 4TN9A 3MPCA 5D93B 4XC3H 4AZ8A 3BGAA 5D7JC 1BVZA 3KR3H 4JEGB 1MF2H 1GAFL 4FQHA 1B9ZA 5E03A 5L0QC 3GMMA 2P8MB 3RGVC 1MLBA 3QCTL 5DT1H 5JO5A 1Z9SA 3NGBC 5F7DB 4JZJA 4KK8D 5BRZE 3EJYC 5AUMA 3QG6B 5IR1A 2MHAB 4P46C 2HT3C 3Q48A 3RFZC 3DTXA 4PJGB 5GRUH 3LKQB 2GJZB 2MQ0A 4WUUB 2AK4E 2KBGA 3CFEA 4RMRA 3WKNA 5DJYA 4XP6L 3FHQA 5DHVA 4XCYA 5GGUB 3DUSB 3GUTB 2X7LB 3DROA 3B6SA 5IHUL 5B3JE 3QEQB 3CLFH 1BWMA 2EZ0D 1XGTA 5JTWA 5K9OA 4YX2H 4L4VA 4OV6F 4PRPD 4GKOA 4OFKA 4Z7UB 4X80L 4E41B 5CEYB 3W11D 5J89A 4ORGB 4PBVC 5FYJU 3TBTA 2Z91B 3X11A 3IJSA 2BOBB 4JRYE 2DIJA 1TITA 2J5LC 5J4MA 1YNKL 2A83B 1Y0LA 3AU1A 4MA8H 2HWZL 3F58H 2P5EA 3BQUB 2F19L 1FH5L 3PWPB 3GNMH 1MFEH 3QDMD 3QEQD 1J8HB 3ARDB 2FEEI 4HIJB 4TYUA 2QQNL 3S3SA 2EXYD 4UQ3A 1BPVA 4NZUL 5AZ2L 5F9OL 4KZEH 2DB8A 2W65B 5CS7A 1D7FA 3JWDC 4UB0H 5IESL 1C08A 4IHOB 5GRJL 1BFVL 4P59H 4C54A 5LGKA 1EPFA 3LPGA 4PTUA 2HRPH 5LG1A 4YBQD 1F13A 4LGSB 2VAJA 4YFDB 1DLHB 1E0OB 3AS3A 4LARH 1XCQB 1EAPA 2HH0L 3SCMC 5TDNB 1ORQA 3F5WB 4HWEH 4Y4FD 15C8H 4CKVX 2XWJA 3NCYS 2G9HB 1H3WM 1H8SA 4XNUH 4GBXC 2OJEA 4R9HA 4XP9H 1OAXH 4HIJA 1U8HB 5ISZE 3MOAH 3ZZ1A 4G9DB 4JAMB 5EBMB 4XP4L 3STLB 2R0WH 4ZDHA 5FHAH 4OZHA 1MCDA 2FHBA 3OAYH 2EDRA 4KVCH 5E9DA 4JGMA 3MGAA 2F53A 5EPMA 5BZWB 2GTWA 5DMKB 5HGDA 1U93A 1KFAH 5ICYA 3MJ8B 1WWWX 4LLYB 4Y5VB 4ZFGL 1N0LA 3OF6D 2O61B 2Q7YA 2P8PA 2IQ9L 1M1SA 3MUZ1 3OB8A 1QACA 4GQ9L 5D7LE 4IRSA 5E8OA 2FEDD 4I18B 1CDBA 1BOGB 1YNTB 2OR9L 2DBLH 1CGYA 1NGWB 5JXAH 1SVCP 1CT8A 4RGNB 4DCQB 4K8RC 2A74B 2UYLB 1I8IB 1WEJL 1YN7B 3MROA 2AXFA 1IM9B 5T5FL 1TXKA 4NO0D 3CFCL 1Q9OB 1M7DA 4FZEL 1BJ1H 2DMBA 4RGMC 2BVQA 3P40A 3ZT5A 4ELKB 3C09C 5DJZA 2WP3O 1IQWL 5ID0A 3EFDH 1RIVH 5KVDH 1BGXL 4OI9A 1X5XA 2JB6B 4A6YL 3EYOB 3RWGB 1KJ3H 2MJWA 4OM0L 1JZ6A 1OT2A 3CUPB 1RI8A 4HWUA 5D1QC 4H0HB 1N5AA 2EE6A 1XFPA 1E28B 2Y36L 4UIMB 2H41A 4PV9B 1ADQA 1U8QA 2FJGB 1KOAA 3WXWL 1KGCD 1AY1L 4HV8B 3QIBD 2NX5D 5CJXA 2XA8L 1WBYA 4JG1H 4U33A 3BGFB 3RGVB 4OKVB 4APQD 3QYCA 1JWMA 3DPBA 3U7YL 4KTDH 2ZPKL 3N1FC 3VFPB 2X70A 2CLRA 4OCWH 4ONFH 3VFMA 2BVYA 4W6WB 5EU3B 2FJHB 5CJOH 5IVXE 1QSEA 2D03H 1IJ9A 4X6CA 2Z92B 5C0BB 3HCVB 2H32A 3O4OB 3ZDXE 5JMOC 1FVCA 3BIAX 3CVHB 1IAMA 2XTJE 5T3XH 4DOHB 1FAIH 4IRJB 4OT1H 3BWAA 1CN4A 1HILB 2A6KB 3EOAA 1H9VA 5DEFB 1WGOA 4X4YB 4XNYH 4OFYD 4PJDB 3QO0B 4RCAA 3U83A 5FCSH 3ALPA 2JK5B 3JZ7A 3O4LA 1A6UL 4RIRA 1CDYA 2C1PB 4FFVD 2A0LC 3VXOA 1YEHH 5LQBH 1E6OL 3ROLB 3A67L 1KCVL 4XP9L 1MEXH 2L7JA 3WJLC 2ATKB 5H94A 3SE8H 4W6XB 4ZFZB 4RISH 5DK0B 5IMLB 4NUJA 5AEAA 1T4KB 1Q9WA 2O5ZH 2C7UB 4IM8A 1N3NB 4ZOBA 1TPXC 1HHJA 2WBWB 3BGMA 4XX1E 1LEKA 2B1AH 1PG7H 1U3HD 5E4IA 1A02N 3V4UH 3QUZD 3ZE2E 1EFXD 5DJZB 1PLGL 3MLUL 5T3ZH 5D1QD 4EN3A 3D39A 5DJDA 3HC3L 3IDUA 1AI1L 4GKSA 4R2GD 1RK1B 4X4XA 4CU8A 5I1HL 1I8KA 1YY8B 1J1OL 2LQRA 5DD0L 4DWHA 2FB4L 1EAJA 1YC7A 2UY6A 3T0ED 3V4VL 1LK2A 1LNUB 4QHUB 1KCRH 4LAQH 3G6DH 4JHZA 3WLWC 1LE5B 4M93C 4Y88A 5I1EL 4JDVB 5CSGA 3Q6FB 3B9KB 3TJHC 1SYSA 5I30L 5E95B 2AXGB 4HKJB 4OZGE 1DQML 4MZ2A 3F7VB 4K7PY 3QFDB 5T1MB 1AD0A 4PY7B 4JN2B 1U8MB 4RDQF 1VDGA 4G9FA 5SV4A 5E9DB 1WC7A 3AFLA 5HDOA 3KPRE 1FYTA 2JB6A 5KSBE 1CGTA 1FO0A 5FF6B 4ZDHB 1T3FA 5GHWH 4YAQA 1IAKA 2FR4A 1QBLH 4G9DA 3JWOC 3BO8A 1E4XH 4HW6A 3BP4A 2ADFL 3RZCD 5BMFH 3NH7L 4LNVA 4MNQA 4G6AD 1U8NA 2B2XL 2OXGA 3K4ZA 1IEBB 3V52H 3ESUF 3MZTA 4I18C 1NLBH 3DVGB 4DCQA 2VLKD 4G6AC 1EEYB 4XB8A 5D93C 1W0VB 2DLHA 3D3VB 5CILH 2EDBA 4B0MM 2ADGA 3BH8A 5D7JB 3BYYA 4Q9RH 4IRSB 4DQOL 4YFLI 5HHVH 5JUEL 5EZJA 4OFVA 3WDHA 4IHOA 2XY1A 2H2PC 3T2PA 3HI6L 5L0QB 2L4OA 3REVB 3DGGB 4AJ0A 1OARL 2R23A 4YO0A 1UG9A 1YQVH 3DV4A 3QIUB 3TIDB 1S7UA 4OV5A 1XF2B 2YMXH 1QLRB 1WAAA 5FECB 2FCBA 2I24N 5E6IA 1IL1B 4M61A 5C71A 3W5MA 3T3MF 3ZTNH 4P3DA 5FFLA 4TVSa 1Q0XL 4Y8AA 3UROR 2GTZA 3AU1B 3TH2T 4Y19D 4MDIB 1XT5A 4LSUL 4JM2D 1OAUH 1SJEA 2R1XB 5C1MB 1A7RL 1MCSA 5BCAA 3ARFB 3B9AA 3VRLF 1ZHNB 4M4RA 3QULA 3MREB 4R97C 5JW3L 1KPUB 1A47A 3ZHKA 1RUMH 4K3DH 3VFOB 1F6AA 4JKPL 2ZCHH 3KLDA 1B6UA 1BIIB 3GHEL 3VFWB 3VW3H 5FOBA 5E2VH 4HFWB 4DGVH 3BRGC 4Z8FL 2WWKO 2VKWA 4DVRH 3ARFD 1XCTB 1OGAA 3X3GL 3DX9B 4XVSL 1BD2A 4LVNC 3QULB 1EERB 5C70A 4ETYA 1N4XL 1HQRB 2ITCA 2PO6C 3QUYA 5F1IB 3FB7B 4RAVB 5IT2H 1WZKA 2R1XA 3O8XD 2BHZA 4XMKL 3RVXC 4Q74A 5H35A 3AMKA 5EIIB 3QBTB 4L3CA 4KJPD 4OQ1A 4KJYB 3ZKSD 4M48L 3GHEH 3VW3L 4YXLH 4HQQL 2YD5A 5FKAA 4N0FB 4LLQB 3B5HA 3PHOA 2BY3A 4ELME 1MNUL 3V6ZB 4ODVH 1TZGH 3DYPA 4U1MA 3VI3E 5DJ6A 3EW3B 5D7KD 3H8NA 1ZLUK 4O51B 3H6JA 2I5YL 4F7CB 1CZ8H 4ZPVB 3VFNA 4KK9C 3MJ9H 5I17B 1Q0YL 4J23A 3CZFA 1RJYB 1D9KC 1YEEH 4G3YL 4U1GC 2UWEF 5T33H 4YR6A 4MA8L 4OCRH 4ZO9A 4MQXC 4DTGL 5KVMC 1EGJA 2A73B 4FTVA 1PW3A 3UTSD 1EJ6A 4QRRD 3WSQL 3LKQA 5I1KH 4P2QA 1PGRB 3P4OB 2IGFH 1ZXQA 1LP9A 1ZA3A 4XCFL 3C60A 3C6LC 3AXLA 3QAZB 4DGIH 3GRWH 1OARH 2X44D 3FB8B 3HFMH 5HTSA 4KTEL 1L0XA 2QSTA 4MA3A 3KPPB 5HSFA 1KIUA 4CJ0A 4LP4A 5C3LD 3F7VA 3ULUE 1OSZA 3TCLB 3O2DH 1LO5A 2HLFD 4QRPB 1FORH 1YUHA 2AQ2A 1QQDB 2BRRL 3ROLA 3ZE1E 1FO0L 4PYGA 5D70H 5IW6B 3TH4T 3O4LB 5CGTA 3PDOB 4H26B 5IQ9A 3Q6FA 2H26A 5HHXL 3HZYB 3GBNL 2WIMA 3SDYH 3TZVB 4PLOB 5L9DH 4M7ZB 3QO0A 3F7RA 4X8JB 4O9HH 1QEWB 4EXPX 1CICD 5GS1A 4JFZH 5GGTA 1INQB 2JIXB 3D69B 4FQPA 2WAHA 5DJDB 4HBCH 1HKLH 5DHYB 2H32B 1S9KC 1JI2A 2ZUUA 2KL6A 3SJVB 1HSBB 3E6HB 4EQ3A 4HF5L 1W0WB 3GO1L 4MGXA 3ABZA 4JO3H 3ZSSA 2B2XH 4YHYB 1LEKB 4CU7A 1I7UA 1MCPL 1YEEL 3BGFC 4WTXA 4Z9KB 2BNQE 2GJ6D 3MR9A 2BY2A 1P7QA 2GCYA 2X4NB 3MV7A 2BVPA 2Z31A 5FGRA 5TH2A 5IW6A 1A4JB 3DO7B 2WWMD 4JR9L 4XBGA 2X4QB 4QRPA 1ZGLB 1KEML 3AS0A 3FT3A 2OQJA 1WLHA 3MRLB 2X41A 1MHEA 1S7VA 4N0UB 5I1HH 1ED3A 5EUOA 5IJKA 1DFBL 4Z76A 5I16A 1F97A 3RWEB 3MV7E 4QCIA 3WN5C 4X4YA 3U1SH 3JWNC 1ZLWK 2DL9A 3C60C 3HRZA 3MA7A 1G7QB 1F58H 4ENED 3BDYH 3L95A 3UXFA 4LCYB 4MA7H 5CEZD 1LO2L 3H9HA 4JVUA 4O2FB 1YEIL 3D2UD 1IM9A 5SWSD 4LKXA 5IWLA 2XN9D 5DTFA 5IFAH 5LWYL 5KG9A 2H3NA 1IGIH 4JM2B 3PV7A 1ZGLM 3D3VD 4OIIH 5E8OB 4S2SA 2OYPA 3RUGA 2VYRE 2IFGA 3GSNH 4ESKA 3MRRB 4PRIB 1VACB 1CD1B 5TE7L 2VZSA 4LSRL 5ESVB 2P24B 5EWIH 4M5ZL 3KLHD 2Y9RT 5ITBL 1E28A 4UIMA 4FQCL 5EN2A 5C0DB 3H2WA 3OXSB 2FIRT 1OGTB 4IRZL 1NDMB 3N1QC 1ZVHA 5DVOA 3SDXB 3LEYL 2PR4L 1K6QL 1YJDH 3RWGA 2DLTA 3C5JB 4MQSB 4KV5F 5F7HA 4HC1H 4MMXC 5K9QG 4TUKH 4YHKL 2E3VA 1OP3K 1UYWH 2BC4A 2MNUA 5KS9F 5C08E 4NO0B 1UZ6F 3SQOH 4F37K 3B9KC 2OJEB 3GMPA 5E5UB 2GUOA 1PG7L 1PDKA 4YLQT 3RU8L 4XNYL 1M71B 5EORL 3EYVB 3L6FA 2Y23A 2OMNA 3RVUC 2KZ1B 1KYOK 1KPVA 4I13B 4X99A 4KKBC 1BOGA 4G6JH 5DSCA 4OI7A 2W9LA 2DMKA 3RIAK 1C08B 4LVEA 3QEQE 2GW5A 4TUOB 2VQTA 3HZVB 3D25A 3UYPA 3TO4A 2CKBH 4R7NA 4HAGA 3KXFB 4F7EA 5K59F 1ADQL 2VL5A 3P3YA 4WU7A 4KQ3L 4YHIA 1EO8H 4NC1C 1HHHB 2RFXA 1DP0A 1T20B 3NIDE 4FZEH 2YD9A 1CWVA 3LH2L 1Y18B 1CFBA 5DXWA 3WL9B 4P3DB 3FAXA 4MAYA 4Y5YB 4XT1C 1CD9B 1CFVH 5EBMA 4NSKB 1GPOH 4IRSC 3QNYA 2ED9A 5DJCB 4FFZH 3RNKA 1A9BA 3S3JA 1P5UA 3TEUA 5SWZD 2P7TB 3ZKNC 4JREC 1BLNA 4C55A 1G6RA 1BD2B 3CDYA 1MCOL 3PHQB 4R7NB 3VXTB 2R23B 3HMWL 4BQ9A 3MJ7B 3ILPA 4FQCH 1G1YA 6FABL 4HMCA 1RPQA 2NTFA 5LJYH 3ULVH 3BN3B 4LSRH 3UTPD 1RFDL 1MREH 4OGXH 4HCRH 5HI5C 1J9CT 3KNBA 5C0GA 5I9QB 1KJMA 5C0EA 3IGAA 3HC3H 3JV4B 3MRFB 3T65B 3M45A 2JB5H 1YJDL 1ZHNA 2EC9U 3VGFA 1YEDA 3ARXA 3CSYB 3HLAB 5ACZA 1G7MB 43C9B 1OW0A 1N2RA 3NA4A 1JTOA 4OLWL 5F6HJ 4ZTOL 2IALA 2MOVA 5B39B 4FOMA 1J8HA 4OIAA 4LAJH 2IEPA 5F7NC 1J1PH 5FO7B 3ZKQD 1MHHB 1WC7B 2DTSA 3WFCL 2ZSVA 1A5FH 1U8MA 5C09E 4ERSL 4LHUA 3AAZB 3GB7B 2QQKL 3QWRA 2LE9A 4HH9A 4HKJA 1DQLH 2YC1A 5CD5C 4NRYB 1D5BB 3HAEH 5E8EA 4UDTA 1QBMH 1V7NH 3B6SB 3DXAB 5DWUH 5ISZB 2A9NL 4XCYB 1ZLVK 1P1ZA 4X6BB 1N64L 2BVTA 3IAGC 5GS2H 1ZHKA 3V5KB 4P59L 3OGCA 3QQ3B 2CR3A 2YN5A 2ATPA 1ZOXA 1NCWL 2GT9A 3HUJB 5JORA 3IU4H 4EN3B 2Q86A 4YEFA 1X6NA 5CJ5A 5F7DA 1P6AB 4FN0A 4ELMF 1FIEA 5IBTH 1G0XA 4JFXB 1A3QA 4XNUL 4QNPF 2JF1A 2EE2A 3IDNA 1M6OB 5CUSL 1ZHLA 1F58L 4DEPB 1T7WA 4HUMB 1MHEB 3L1OL 4W68A 5IROA 4ZFZA 2ZCLH 2OQJB 5CINL 2YA1A 1YY9D 2GI7A 4PJ8B 1T7VA 3OKNB 4U6XB 4WI2A 4XBGB 5BXFB 2VZ3A 4HCRL 3WNKA 1KN2L 3U7WL 1BGXH 1H3VA 2VLME 3ZO0A 4KK6D 4S1QL 3RVVC 2HVKA 3DV6B 5GGRY 4WJ5A 1W0WA 1S78D 4MXVF 4LPWA 4GKSB 4HXAL 5DO2C 3GI9H 5AG9A 4LU5H 3OKOA 4KGJA 5IOPA 2AS5M 6FABH 2FEDC 4Y5XA 4XNQB 5DZOA 3KR3L 3BPNC 5D7SH 4NNYB 1FO0H 5D70L 2HKFH 5E2TL 3LAFA 4C83A 5JA9A 4HULB 4OD3L 3H9YA 3O6MH 1YEJH 2CD0A 2VQ1B 3MLWH 3BT2H 5T1KA 1T1XA 2FO1A 1XF5B 1P7KB 3EJYD 3RWDA 4YHZL 2NW2A 5ITBH 3GMQA 4HG4J 1GZPA 1J87A 4RNRA 4Y4FB 5C86A 2HJKA 3ALWA 3MTRA 3S37H 3KPRA 4WHDA 4J8RB 2CO6B 4PRBB 5J9PB 2E7HA 3IKCB 4OCSL 5MENE 1EHAA 3ZDYF 2BVEA 5GS2D 4YZFE 3THML 1ZEAL 2OI9C 3I85A 3SJVD 1D5IL 3O6KL 1YNLH 4KAQL 3P9MB 3DBXB 5IM7B 4WW2A 3W0WB 4YH6A 1U8OB 5AYQA 5I8EB 4HK0B 3HPLA 5IB3B 2AXFB 3MJ9A 5GS0L 2CKBB 2A74A 4L4TD 3WLWD 3GIZL 5EO0B 1QSEE 1KENH 1K9TA 1EUTA 2IQAB 2APBA 1I8MA 4DJMA 1R0AL 5I1KL 3TNNB 3CZFB 5FKPB 1JNLH 4AIZA 5I2IA 5B4MD 1BX2A 2O61A 4L8SB 2JJVA 1T1YB 3QR2A 4P3CH 5DO2D 3QEHB 1MCWW 1U93B 3MCLL 3IXAA 1WFUA 4IMLA 3TYGL 1BEYL 5KW9H 4BYHA 4XZUB 3LKNA 5M94B 2M26A 8CGTA 4Y5XC 1UKTA 5K59E 3FTGB 4LIQE 4APQB 3STZB 4L3CB 5J11B 1A6ZB 4LPXA 4LSUH 3DI3B 5I8EA 3RBSA 2EYSB 2EDOA 5BS0B 3HPJA 1DQQB 1ORSB 1XGYH 3CVHL 5F1IA 1X5LA 3PP3K 1WTLA 1EHNA 4FZ8L 3TWCL 3NIFF 4WTZG 3MRKB 4UOJA 4K3DL 4Z5RA 2CDFB 2EH7L 2PKDA 4ZUWA 4TQEL 5FYKL 4QY8A 2YMXL 4JZOA 1TCRA 4OZFA 4WV1B 2RGSA 3RPKA 1KN4L 1FHGA 1VADB 3KHOA 3L9RB 3D9AL 4AEEA 2LAAA 4NFBA 1BFVH 1B4JL 5FV1L 4LCCB 1OVZA 3G08A 4WFEE 5FGBA 4EN3C 3OKLA 4LNRA 4DGVL 4WDIB 4FFYL 3TO2A 3ARBA 4GG6F 3JVGA 5F70A 4YDKH 1JV5A 2FO4B 3RHWF 3BAEH 5JW4R 4NZUH 5LVEA 4ZO8A 4XAWH 5B22A 2IAMD 1Q1JH 3EKCA 1NCDH 1TZIA 2FZ3B 4XWOD 5HGHB 4DEPC 2FH6A 5T3XD 1N0XL 5MI0B 1J5OL 1E27B 3QFJE 1B2WL 4Y4KB 3VFSB 3BXNB 4HWNA 4MJIA 1NKOA 3OKMB 4Y16D 3W9EA 1IAII 4PJFF 1QSVA 3LKSA 5E6IC 1HH6B 5C6TH 2J6EL 5TQ0L 3REWB 2GSGA 1C12B 1HCVA 4P9HL 5GZOC 3S4SB 2IBZY 4Z7WB 1JNNH 5TDNA 5SWQB 1BIHA 1CU4L 4OCRL 1KNOB 1MFDH 1XGTB 3V4PL 4H1LA 2PYFA 4F37F 4ZD3H 1J5OH 5D7JA 4U1SB 5GGUA 3U6RA 3QNXB 3O3UN 4GJTB 3F7QA 4GKZA 3D2UB 3PJSA 4GQPH 4GXVH 3VDCA 2IG2L 4P5TC 3LKPA 5JA8B 5T1LB 4XC1H 4MLSA 4JHWH 5F89B 2Y4SA 2BRRH 4QRRB 4QYOA 5GGSA 4HUUA 3RVVD 5CAYB 3WFBH 1X5HA 3HMXH 1A14L 2P8MA 5IEHA 2VXVL 4QT5A 1JE6A 1FYTB 4RMUA 2P5EE 1OQOA 3O6FD 2VLJE 4TPRL 1RVFH 2ATPB 4TQEH 5FYKH 1NL0L 4PV8A 1EVTC 4BELD 4PJIA 5F7KC 3BMWA 1T7ZA 4BSWB 1G1CA 2MCPH 3CMOL 5JLZA 4L4TE 2AXGA 2R1YA 4U7KA 4UDUA 4FFWD 2PW2A 2HMIC 4JY4A 3FN9A 1WQVT 4F15B 3T0EA 3DWTA 1OAZL 5DVNA 3U4BL 2J3SA 2R1YB 5E2UL 2BY1A 2R2BB 5C07D 3BPLC 2F15A 2XRAL 2QEJA 1KULA 4AMKH 2ARJQ 2YKLL 1IKFH 3CFEB 4LLDA 4PJIB 4MQXD 3TT3H 3QFJA 1AP2B 1OAUL 2MCG1 4JO4L 2CK0L 1OY3B 2K7PA 1VFBB 4S10A 2R1WA 1LGVA 1BP3B 1FGVH 4NP4L 3ZYOA 5C0AE 2VDOH 1CIDA 2PTVA 3U36A 4WY7H 4MSWB 3T8XA 3GM8A 4XHJC 5DI8B 4R3SA 1FG9C 5EFIA 1I3UA 4P48A 2P5WD 5E94A 5AAWA 3ULVE 2EIZB 4I2XB 4XVSH 3VWKC 2BMKA 4O5LL 4OLYL 3CK0L 1EGJH 4P2QE 3L5HA 5J13B 5ITFB 3RNKB 4WW2F 4NQCE 5BS0A 3ZKXB 3UMTA 4KKLC 4PP1D 4HGWB 1A6ZA 1J7VR 3N06B 4GBXD 1FNHA 2XOTA 4P4KC 3TJEH 4LCCC 5A3ID 4QHMB 1P2CA 3CFCH 2PCPA 5DYOB 2FJFB 1P5VA 4GW1A 2OL3L 3OMZA 3S88L 4WFFD 3RL1B 4WENB 3ZTJG 1LDSA 4LVHC 4P2CG 5DQJA 1QR1B 1UFUA 5EUOF 3GSRB 4KRPD 3KXFA 3J7HA 1ZTXH 4RRPG 1U6AH 4MNHA 5DHXB 1TLKA 2YPLA 2MPAL 2PW1B 5D7IB 4HPYL 1CGXA 5I30H 5MI0C 1F4HA 1KG0B 2YUVA 4J3XA 2CUMA 1G7LA 2IAMC 5DJAB 5JQ6L 4R96B 4MWFB 3NZ8B 3C5SA 3V4VH 1PYWB 4K3GA 3GSXB 4XNMB 3ZLQC 1X9QA 1XIWD 1FP5A 2CDGB 3KS0J 4PJ5D 3MRKA 5IFHL 2OK0L 1KIQA 2V6HA 3UTQA 3OJVC 5J6GB 3V52L 4A6YH 1GGIH 1YYMH 1M7XA 1WF5A 5JOFB 4C4KO 5GS0D 3QUYD 5KJRL 4LSPL 3NH7H 4LRNH 4NJAL 4N90D 5DFVC 1DN0B 3VGGA 1JGDB 4JFYA 5FM8A 2LABA 3SKJL 1K4CB 1MJ7L 3K4AA 1NFDE 1U0QA 3CK0H 3QHFL 5IVOA 3LV3B 1NANH 2YD1A 3AY4C 3HB3C 5D9SA 4BZ1H 2XKUA 4PS4H 4NHCH 2PTTB 5E5MB 1DANT 4FG6D 5EU7E 1F4YH 2A77H 4MQ7B 5T1DH 4FQ1L 4WY7L 5F88B 5D7LB 1FAIL 3VXPB 1AGDB 3DRTA 3KPSD 5HYSB 3HC0B 5E6ZA 4MJ6A 3H9HB 4O2FA 1OL0A 2BSSA 2XXMB 4JFQA 3UTPE 3VXSE 2B20A 4MS8D 5HY9B 1RZ8B 3MV8D 2HTKC 5FM5M 2ZUYA 5DJ2B 4L9LC 3IU3A 1LD9A 5FK9A 4PRAB 1G7HB 5IBUG 4J3WA 3WUWG 4DFIA 1S8DA 2XQYK 2XZAL 3OZ9L 43CAB 1V05A 2FATL 5AZEL 5SWZE 5HI3C 2GK2A 3TZVD 3QDAA 5IHZA 4H0GA 1JTTA 3P4MA 2ZJSL 3V6FA 2AEIT 3VXMB 1EHXA 3FQTB 2WLZA 4LOUC 5E7FA 1ZT4B 4HF5H 5DS8A 5CHNB 1P7QB 2C4FU 2VR4A 4PGEB 1JCKA 4PJ7F 4YDJB 2JCCE 2ZWLT 3MNZB 2NY3C 1FL6B 4XPTL 1A6UH 5CGYC 1NL0H 2GSIA 1OPGH 1KLGA 3K8KA 4LBEA 2CRMA 4NDMA 1YQ2A 5MENB 1HN1A 4OZFH 2HFFA 3O6LH 2BNRB 3KPLA 3HR5A 2J12B 4YDIL 4YHNA 2VDQH 1IC5L 1JPFB 4Z0XB 3SGDH 4E41A 3RVTC 5JDJA 4OI8A 1BQSA 4YQXH 4L4VB 5DQDL 3LD8C 2NZ9D 3JTTB 4FG6C 3KXFE 4GQ9H 4HKZB 5E1HB 5BXFA 3V6OC 3AAZA 2ORBL 2Z8SA 1DN2A 1INDH 1H8OA 3D9AH 1RZIA 4P4KB 2DQFA 2VLRD 2X4PA 2XA8H 3DX6B 4NJAH 1FAKT 4PJCB 4L3EB 5FYKD 5FA4B 3G5VA 3QG6A 2DQGH 5IR1B 3O11B 3WXWH 2YR3A 3GM0A 5C0CA 3STBA 1S3KL 3NFPA 5ADPH 2CIIB 3GMMB 3JVGC 5ESQB 3H42H 1MHCA 1TVBB 3O2WH 3SDDB 32C2A 2FIKB 1H8NA 4PJCA 1R3HA 4KTEH 1I1CA 2OM5A 1BBJA 1B2WH 1IGYB 2DQFB 4F57L 1DDHA 3OV6A 3MXWH 3MO1A 4YHPB 2GY5A 3D2UA 1GL4B 4PRID 1D3CA 4UT9H 3TN0B 5B8CC 4I4WA 4B53A 4K71C 3TBSA 3IDGB 3ARGA 3LSOB 4Y4HD 3U4AA 3PWLB 4NQDB 3CLEH 3GMOA 1GGYA 3VFRB 3MV11 2VJXA 4QKXB 1Z9OA 3BKYL 1MLCB 3P0YH 3PP4H 2DDQH 3DYMA 2FX7H 2I07B 1F4XL 1FLTX 4Y5YC 3DX7A 3SDDA 1FBIL 3HUJE 5J57B 1OTTD 1RMFH 4AEIH 1WIOA 3X17A 1H0DA 5J8OA 2X6MA 3BKCH 1CDGA 3E6FA 4PD4K 3TV3H 1QSFD 3GBML 2OP4H 1ACYL 4JREB 4HEPG 5I1AA 2QSCL 5E2UH 2B4CC 4HFUL 4DAGH 1Z0NA 4O5LH 5EDXA 2F53D 4D0DA 2A9MH 2ED7A 3M17A 4KRPB 4Y1AA 2OR8A 2FYYB 1VHPA 4M48H 3G6AA 5IJKC 3WNNA 3HZKB 4GRLD 3W81A 4F80A 5DEZA 4TPRH 1FBIH 2R4RH 4PG9A 5T5NF 2WIIA 4QRTA 5DSCB 1JI1A 2BERA 2F54D 4X4MA 1D9KA 3LQAH 1L4IA 1DFBH 4DVRL 3LZFH 3VXTA 1EFQA 3LN5B 3BT2L 2CDFA 4L9LB 1Z9LA 3ARGC 2DWDB 3R0NA 2P7TA 5EU7C 2F54E 3CXHJ 2GUOB 3OPZH 2GSGB 3HMXL 2IPUG 1ZS8B 4EXKA 3GIZH 4POYA 4OF6A 1UXWA 1N7MH 1U8LB 5D71L 1T7YA 3DVFA 2X9WA 2NQCA 1NMAL 4UZGA 2Q1EA 3NFSL 2A6DA 4G8IB 3I6GA 4ZUTB 1OSPH 1FE8L 3VJ6B 1RUAL 1SM3H 3MXWL 4NNPH 3P30H 1DUYB 1WWAX 1FLRH 5ANME 3TO4B 2QHRH 5CKGA 5A3IC 3WNLA 4FXKA 1CD1A 4W6YB 1RZKC 2YSSA 2V17H 3SGJC 5J06A 4YXKH 1AXTH 4IDJL 3WDIA 2E7LC 1FQ9C 4XGZA 1FG2A 5FAAA 4RRPA 4H8WH 1KLUB 3OHXB 1RVFL 4X6DA 3SDAD 4Z7VA 1MJJA 2N56A 1RZGB 4MJIE 5GHWL 1A7BA 3PGDA 4N8VG 4PJ7E 3IU3B 5FK9B 3UTSE 5HHXH 1FORL 2IADA 5DUMH 4HZLB 1ORSA 4LQ1A 4J3UA 1QP1A 4Y8DC 4IS6A 3QA3A 3PL6C 2PF6A 3S5LG 1PYWA 5D2LA 5HHMD 1J8HD 1JPTH 1CR9L 2H1PH 3IF1B 5K9QI 3QXAA 3ARSA 4XGZB 1E4KC 2Y06L 1U3HA 4LSTH 1R5WA 2Y5TB 3MRLA 4ODWA 3TVMD 5T3ZD 5I76A 1QYGL 4OF5A 1F2XK 2IBGA 3QFDA 4ONHA 4WNQA 3O6LL 3MCKB 3N85L 3C9NA 3QEUA 1A4JA 2QHLA 3DO7A 1UWGH 3PP3H 3WCYA 4PJBA 1SYSB 2BVPB 4HLZH 3RY5A 4RA3A 1JPST 5FUZL 1H5BA 4UU9B 5GGSY 1JGDA 4K3EH 4TNVK 3QWOB 4NCDA 3ULUF 1RU9H 3MV9E 3HG1B 3MRMA 1CVSC 4HAFA 3WFHB 3WS3B 5CUSH 4LOUD 1G0YR 4XWGL 5E99H 2XV6B 2FECI 4N1CA 2BNRD 2OZ4H 4PLJD 3D39D 4AEFA 5A1AA 3BI9X 4IMKC 4PRPB 1CG9A 5C6PB 1EMTH 1PJ9A 3G5XB 1NFDF 4YJZL 1QHOA 4PRHD 1K5NA 2CGRL 4XPAH 5FHBH 1BOYA 1KPRB 4LSVH 2VR9A 4P49A 3QEGH 5HHQB 4J8RA 4QO1A 4N1EA 5F1KC 1PKOA 2X4QA 4JN1L 3PIQA 4Z77B 4UT9L 4OT1L 1HQ4B 2F9BT 4OB5H 4OGAD 5IJVA 4QXUL 1P7KA 4KAQH 3RWDB 5DWUL 1DQLL 5J3HD 1I7UB 3IDIA 3BHBB 5EOCL 1DBKL 2AERT 3MLUH 4JPVH 3VRJB 3X14B 2W91A 5EC2B 3VXUA 1NFIB 4HXBL 1MREL 2I9TB 5JXEA 25C8L 3DVIA 5GQBA 3U0TB 3HE6D 2PETA 3QH3A 4JGUA 5HJ3A 2HVKB 1CLOL 3PWLA 4NQDA 4RISL 4JDZB 1JZ7A 3BD5A 3ARGB 5DFVD 1J88A 5ILTL 2WANA 3KPSE 3SPVA 1A7PL 1QFOA 5C8JA 3DMMD 3B9DA 4K07A 2X1WL 2M1KA 5CEZH 1U92B 3B43A 4R3SB 3RDTD 4JFFE 3MO1B 1W8OA 4O2CA 3L3HB 1CBVH 4MAUL 5E8NA 5L8LB 4M1GH 3LEXA 1A3RH 1MHHA 2NLJB 5MHSD 5E7BA 1I7RA 4PRNA 4F58L 3RWFB 1MQKH 4YBQC 4QF1B 1UWEL 3RWCA 2NTSP 1B0RA 3T77A 3D0VB 2WM0A 4OZIA 3MRNA 4KRLB 3FFCB 2BVQB 4MHHI 3DJ9A 4OTXL 2HVJB 3O8XC 1KJ3L 5E5RB 3RDTB 5DK2A 2ENYA 2UYLA 1U3JA 1CFVL 1NGWA 2W38A 4JG1L 1WJ3A 3VFWA 2BVOA 1GGBL 4M43H 4F2MB 3NCEB 1NCTA 4ZFFA 4PP2A 4XVUC 5H37H 4MZ3A 3PDGA 1M05B 3SQOL 1KTLA 4S1QH 3QO1B 4OLYH 1X4YA 3WHE0 5JR1L 2DQHL 4X6FB 5HYQB 2CSPA 3VWKA 4HXBH 4WUKL 2B39A 3BZFB 3KYOA 4Q9BA 4JB9L 4U1MB 5HGDB 4EI5C 2Z93B 1R3LB 3PG2A 3RNQA 3V6ZA 3RWIB 1BF8A 1T1ZA 4NSKA 5EOCH 5FO7A 5FKAB 2FLRT 4XNZC 4ZO6A 4PGDB 5KVEL 4HWEL 5B21A 2ZUQB 2YBRB 1T03L 1T20A 4FTVD 1IL1A 1FL5A 3LQZA 2A9NH 5J6HB 3W39B 4OGYL 2Q87A 4F7MB 2I9LB 1Z6JT 1IAIM 1A7NH 4PJ9C 3MLTB 3RTQC 4WDIA 3HN3A 4MVBD 2N1KA 4Y4HB 5GRVL 1AI1H 4PLKD 1WBZB 3SKOA 2PO6D 3PQYD 4H1LB 2NTFB 3RVWC 2IWGA 4JZOB 3EJZD 4WW1B 5EC1B 3UTSA 3PHQA 2O5ZL 4M5ZH 4PRAA 5DURB 4CUCA 2XIDA 5IVZB 2DJ4A 5TE7H 3UAJC 1J0HA 3ESVF 2XKNB 4NHCL 4EI6B 4QHLA 4NO3A 2DYPA 4U1GB 4BZ1L 1IGIL 1AGDA 3I6KA 4UB0L 4KK5D 2NX5E 1BJ8A 3KLAB 2XWTA 3LQMA 5IMKB 1DUZB 3BD4A 1G7IA 3EO1A 1HE7A 2FZ3A 4D0BB 4NNXB 4ZXBC 2HH0H 1YDPB 4P5MB 3WKMH 3IXTA 3NCBB 1T03H 1IAOA 1MWAB 2E7MA 4DGYL 3EDFA 2FGWH 1A8JH 3FB6A 1ZLWH 3KJ4B 5DMJB 3DGGA 4OLWH 1HH9A 4PJEF 2AJYH 4LRIC 5GRUL 1LE5A 3BH8B 1FZKA 3DUSA 3R06B 2UY7A 4QHUA 1JTPA 4P99A 1WVZA 3MA9H 1SYVA 1CDIA 1VGEH 3GJFA 5D1QA 3UP1A 4EN3D 1TJHL 3QCTH 4X4ME 3K4DA 2H9GA 3MLYH 3BIBX 5GIRA 5HVHC 3ARED 2VZVA 4LP5A 2UV3A 2MHAA 3I2CL 1J05B 1GAFH 1S7RA 1OWRM 3ZDZE 3HPJB 1R3KA 5DJ8A 3HRZB 1ADQH 3TZVC 4W4OC 3PWJA 5L6YL 1A4KA 5DRZB 4NZRL 4FMKA 4U3CA 1EDQA 1HSAB 5IB2B 4PRHB 4WGWB 4NQEA 2P5ED 2NY5C 4HMEA 4HUWA 3OXSA 4JN2A 1K4DB 3ALXA 4DTGH 2V5SA 3O6FA 3EJZC 4WO4B 3IKKA 1TTFA 1U8PA 1ZGLA 2ZP0T 4PUBH 5DC4B 3TNMB 1SM3L 2IH3B 5I15H 3B2UD 1EO8L 1BZ9B 3GIVB 3LKRA 4XP6H 1QSFB 3O3BB 3HMWH 2C9AA 4HKBB 4GRWB 4FQJH 4MAUH 4JM4H 3QIWD 5D71H 1NCDL 4YDKL 3RZCA 3QT2A 3MUHL 3MRJA 3FQNB 1F6FB 4NP4H 3GEWB 3MRPB 1PQZB 4S1DD 4LCIL 4XXCA 1I8KB 1YY8A 3U0TA 2DAVA 5E00B 4LKXB 1D5ZA 3W9DB 1KJ2L 2C4FT 2A6IA 3MOQA 2H8PB 5C0JA 4F58H 1F45A 2Q6WA 1QOKA 2Z4QB 1K8IA 4YBLB 3IDIB 2BSTA 4KROC 3KPTA 5F7UA 5GRYA 1MQ8A 4G7YH 5JPMA 1BJMA 2FECL 4OCLC 4GXUN 1KIRA 2R0WL 1EGJL 3GIVA 1BZ9A 4TUJB 2VLKB 4HV8A 3ARZA 3EZJB 2WINB 2Y25A 5E9DD 1REIA 5JW4N 1NC4D 4HIXH 2JJWA 4OJFH 5F9AC 1RUML 4KVNL 1G9ML 3VRIB 1CFQA 4XXDB 1MOEA 1YEFH 4XP5H 2QR0A 4KHTL 5CCKH 5DRZA 3PWPD 1WT5C 3MJ9L 3RWJA 4FQIH 2Z8VC 3MRIA 1UJ3C 1ZLUH 2WBKA 4HHAA 2B5IB 3FL7A 2Q6WB 3C2SA 2OTWA 5IIEA 4DN3H 3GJFK 1F90L 2OL3B 2WQ8A 5JOPD 2DQCL 3K8LA 1L7TL 1YN7A 5DA0B 2XACC 5DJXB 2CK0H 1CE6B 4AH2B 4XMKH 3MBXL 1UWGL 4QXUH 2XTJB 2DICA 1SEBA 3KPQB 1JGVL 4FQJL 3C08L 2C3VA 1YN6A 3PDOA 4KRNA 5SX5K 1MRDL 4GBXB 1N4XH 2Q7YB 1QQDA 1F11B 4HWZA 3MRGB 2CGRH 3VGDA 3D48R 1MAJA 2YPLD 2ZSVB 4PB9H 1IC7L 1LEIA 1EO5A 2VDRH 4NO5A 3D6GA 4ALAL 2R39A 4ZXBB 5D2LB 4PY8I 2X5PA 1JRHI 1LDPL 3UEZA 2VB5A 2R0LL 1AGBB 2ADFH 4QHLB 1A6AA 1Q9LB 4MXWL 3UYRL 2Q86B 4N0YL 4UTAH 2ZG1A 2CRYA 2JTDA 3P9LA 2AV1B 5DC0A 1IEHA 5EO1B 4QXTB 1NAMB 4OM1H 3P4OA 3UTSB 1AR2A 3T65A 2IF7A 1EAPB 3IS1X 5SWZA 4P3WA 5FUZH 1EZVY 5D6CB 5C0GB 4HFWA 2X2YA 5KN5A 1P1ZB 4X6BA 3QNXA 1FG2B 2ZCKH 4KC3B 4OD2A 8FABA 3O3EB 5FUCC 5I75B 3L3IB 3PWNA 3FO0L 4NRYA 4XVJH 5SWQA 1AGCA 4J7RA 3C08H 2OZ4A 1YPZF 2YD6A 1V3LA 5DJ6B 2I60H 3WUZA 3BEVB 5IB1A 1P4LA 4P5MA 3U2SB 1FL5B 3LQZB 4YGAB 5IW1B 4FQXD 3L7EB 3QWRD 2WSKA 3EO1B 4NFCA 4MDIA 1URLA 4PJHA 2XWTB 4Y4KA 5CILL 3VFSA 5D8JH 2MKWA 2EC9T 3I6KB 4I0CC 2DYPB 2RFXB 4Z78B 2AEWA 3Q1SL 1HOCA 1I75A 4X6FA 4LQFL 3DV4B 3I2CH 1O7SA 5J1AB 3VH8A 1VSCA 4GAFB 1AXTL 1WICA 1Q1JL 4WHTB 5BO1H 5K33A 4IJ3C 4EIGB 4EI5B 5B39G 3SKMB 4OZGB 2X7LA 1CGSL 4M62L 5HYFA 1R3IL 4NWTL 3S35X 3BUYA 1Z5LB 3KJ6L 4PJEE 4XCCH 3IJHA 3O9WD 2E6JA 4KUCF 4ZAKB 3VXRA 1FE8H 4IRJC 4ZS7L 2VSDA 4KFZC 1UACL 3P9LB 2HT4C 2Z0BA 5IMOA 1JN6B 5GS0H 3I50L 1MLBB 4PJ9B 3RTQB 3ARDA 3WHE1 2FR4B 2CUIA 5FGBC 4OCYH 4PJXF 4PPTA 2ZCHL 5ERWA 1OGAE 3LKNB 3O2DA 5HDLA 5J1SC 5CD5D 4LCIH 4QRPD 4X7TA 4HJ0C 3RIAF 4O2EA 2Q20A 1R5VA 3DRQB 3TIDA 1KENL 3TV3L 3LIZL 1FGNL 5LCVH 5EBGA 1TPXB 1QNZH 4JFEE 2DQEH 4FQXC 4FP8H 1TFHA 3QEQA 4S2SB 1R24A 2WLYA 4KWUA 2YA0A 4NZTL 5GRVK 1LK2B 3ZE1F 1NAKL 3L5XL 4P9HC 4YHPA 3H42L 5JW4M 3QQ4B 2CRIA 3VGBA 2Q3ZA 4CMHB 4M02A 5I8CA 1V3JA 5IB3A 1U8NB 1PSKL 4W70A 3EIFA 2APTA 3EOBB 4TVPH 2ZPKH 3MRNB 1TVBA 1QO3A 1RMFL 3BHBA 1X3DA 2BFVL 1T3FB 4LLWA 5MEOB 1UZ8B 3CFDA 4Q9QH 5I8KL 1ZT1B 2HFTA 4MCZB 1CDHA 1LEIB 3IKCA 3P4LA 2ZOLA 1HYRC 5EN2B 1J0JA 1YMMB 2Q8BH 2ADJB 3GKWL 4JZNA 1T0NB 2Q7NA 2X05A 4M03A 2WINA 5E2TH 5HVHB 3SPVB 1S78C 3MRRA 4PRIA 1KIRB 5F6HI 2O5YL 2UVEA 5C9KA 3EDDA 2RCSL 4DGYH 5I1GH 3FO1B 1YECH 2RIKA 4U1NB 3BZEB 1MJUH 4CN4A 2AJVH 4LK4A 2BSTB 1KFAL 3UJJL 3ELAT 3P77B 2Z4QA 5JW5A 3T3ME 4RBPK 5KG9B 3SJVA 3OR6A 2OL3A 2NXYB 4XNQA 5AWNL 2I9TA 4LBEB 4FMFA 1D5ZB 1FYTE 4KJWC 2YZ8A 1S3KH 3UPCA 5ADPL 5IQ7H 1FFRA 4CVUA 2VISA 5HYJA 4HHAB 4MJ2A 5CINH 3FQNA 3FKUS 4U49A 3RWJB 3NN8A 4H25B 4KU1A 1U41A 4HMDA 2HJLB 3MRBB 5DRNA 1QSFA 1MUJB 2HAZA 2AW2A 2NY7L 3U48A 1GC1L 1P84J 3T1FA 1RJZA 5DD3H 3C9NB 4AM0A 1FV1A 3GBLA 5TDPA 1CGWA 3MJGX 1VGEL 2P47B 1RJZB 3PV6A 4Z0BL 3IETB 5L88H 5F9DC 1XIWB 1BM3L 2H2PD 4C58B 3WMSA 3L5XH 4YC2C 5JPMB 2AXHA 1UH4A 1JUFA 5M7QA 3LHPL 2J88L 3C5ZC 4GAJH 4PJDF 2IH1A 1G7HA 2QQNH 1NLDL 4KDTA 5LGJB 3ZHDA 4R97B 2VR5A 5HYJB 3T0BA 1QO3B 1RK0A 4PRDA 1ZA3B 1UXSA 2FBOJ 2GJJA 5GIRB 3W2DL 4EDXA 3PHSA 4PS4L 4ZTOH 5FHAL 4OFYA 4X9GA 2EZ0C 5GGTL 5HPMB 1EO7A 5EB9A 3UTOA 1A5FL 1FZKB 1EXUB 2WV3A 2W9DL 5C08D 2H26B 2QSVA 4OGYH 4LLMA 2BNQB 5CP7A 1AQKH 1L7IH 2YC1B 5D2NB 2GFBB 3V8OA 2E9WA 2W9EH 1YUHB 1W72A 2B5IC 4CMMA 1X5FA 3MCKA 4KKCD 4MA7L 3MJ8A 1QBML 1V7NL 2VERN 5I76B 1NAML 4LSPH 3KPPA 1V3KA 4I0KA 2FGZA 5I8OH 5DGRA 5DUBA 1DN0A 4PFEA 5IMKA 5MEOA 4PJHF 4P5TD 3VA6A 1BM3H 3CVIH 3FZUC 3I3EA 5J7CC 3BPCB 5D7JD 4DK6A 5IEKA 1MY7A 3WHXA 2VDML 4GRMB 1JN6A 3GSVA 4HZLA 4WW2C 5TE6H 4LQFH 1WBXB 4NPYB 4YUEH 3F12A 4PJFE 3MRFA 4AY0A 3CH1B 4ODUA 1SYVB 4A6YA 2ADIA 2PN5A 5CEZE 3MNVA 4K7PX 1GPOL 3UAJD 5CGMA 4GMTL 4P9HH 5F96H 4UNVA 1HH9B 3VD5A 2OL3H 4HJGA 3KLSA 4WO4D 4D0CA 5DT1L 4U3XA 5KTEL 3C6LB 3G5YA 1N6VA 3VH8B 5J1AA 4ENEC 4Z7WF 5FO8B 2W0FA 1TMCB 3HG1D 1CF8H 3QUXB 3GBNH 3GMRA 3TFKC 1H3UA 2Q3AA 4OLXH 5ID1B 3IDYC 1NC2B 3M1BB 1UB5A 1DCLA 2P5EB 3BQUA 3KLAA 2A6JA 5DD5H 5HVFB 3I9GL 1KELH 4OZIE 3FOLB 2OK0H 1HNGA 2BOBA 2DKSA 2GJ6E 1DLFH 4XBEL 3TA3C 4Q9QL 2V2TB 1AFVL 4F7EB 4JLRA 3C6LA 4MXWH 3AREB 1KB5H 3IJHB 4HJGB 1FYTD 5BRZB 4HBQA 4GAYA 5JZ7D 5DQ9A 2A2QT 3PNWB 1FNSH 1A64A 1G9NH 5IBLC 5CEZL 3V6OE 1EEYA 4YXKL 5DMYA 1Z0MA 5FO9B 5FDYA 1KPUA 3EYVA 1UT9A 5E6ID 4RGMB 5HI5D 3NBNA 4MNQB 5F8RC 1MHCB 2IQ9H 2R9HD 5GRXG 3BP4B 5SX5H 3WD5H 3ULUD 3C8KA 2SEBB 5C0AB 3NIGF 4K3JL 4IOFD 4FP8L 3BPLB 3NFPB 4K7PL 3P0GB 5T5FH 5F44A 1F4XH 3LEXB 1HXYB 1WEJH 2X4PB 4UV7H 4UV4H 1NJ9B 4O2CB 3CPLA 3S96B 1BWWA 1D6VL 4LIQL 1T5WA 4HK3N 1VEPA 1JNLL 1NCAH 5LWYH 4Z7UA 5C6WH 1R0AH 3IAPA 3P9WB 1CIUA 1MFNA 5I71C 2XNAB 3IDGA 1JFQH 4JDVA 1MPAH 2E7CA 1BD2E 1NC2D 4UDUB 3JTSB 1I9EA 1R6VA 5EU6E 2VXVH 4KVCL 4M8VA 1JZ8A 3ECBA 5LGHL 3LN4B 4NGHH 2BP3A 5I0ZA 4HSQA 3BQUC 1A2YB 5IESH 4WHCA 1RZJC 2VXQH 3PABB 1H3PH 4HFUH 4PJXB 1ERNA 2EIEA 3S6CA 2HLAB 3VMPA 4U1HA 3OAUH 1FO0B 4X80H 1FNSL 2Y7QA 2ZNXA 5IV2A 4JQIL 2GIYA 5J13C 3SEPA 1KXTB 5ALCL 1JUFB 4JFFB 2NLJA 3MACH 4QOKB 2HFGH 4U2ZA 1T22A 3DX8B 3IJYB 4EUPA 4P4KA 1RU9L 4LGPB 3VWJC 4ZFOL 4XPGH 3BKYH 2G60L 1UZ6E 2VAAB 2C1PA 4EVNA 5IGXL 5D8JL 3X12B 3S7GA 2HT4D 3BIKB 2DQUH 4LMQI 3P30L 1A6WL 3WBDA 3F65A 4X9HA 4BH8A 3IDMB 3RY4A 1CG9B 1WCQA