3OKDB

Crystal structure of s25-39 in complex with kdo
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
221
structure length
218
Chain Sequence
EVKLVESGGGLVQPGGSLRLACATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQSSLYLQMNTLRAEDSATYYCARDHDGYYERFAYWGQGTLVTVSAAATTPPSVYPLAPGSTNSMVTLGCLVKGYFPEPVTVTWNSGSLSTGVHTFPAVLSSDLYTLTSSVTVPSKTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords S25-39 Fab (IgG1k) light chain
total genus 42
structure length 218
sequence length 221
ec nomenclature
pdb deposition date 2010-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okdB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okdB01
4AM0B 5DVLA 3OKMA 5BCAA 3UYRL 1FQ9C 1H15B 5CD5D 4JLRA 1XGPB 2EH7H 4JFFD 4MX7B 4Q97A 1RJLB 1EK3A 1IC1A 5F7NC 5L88H 3W0WB 2FHBA 1N59A 3O6KH 1RK0A 5C0IA 3MV8A 1N59B 1SQ2N 2R0LL 3UDWA 4TPRH 4HX1B 4YDKH 5DUMH 1LE9B 4FQJL 1FAIL 4PBXA 3GSQB 1NQBA 4JO2L 4K2UH 1FLRL 4YE4L 1S7UA 2LAGB 2DQHH 4JFDE 2UWEE 1MAJA 4KVCH 3VFTA 3NBNA 2P43B 3SDXE 4OF5A 3CPLA 3N06B 4FQXD 3CPLB 3AB0C 3Q6GL 5D71L 3X13B 4F8TA 1D5BB 3JXAA 1OW0A 3OKDA 2X4TB 4HEME 4MXVE 3E2HC 3GGWB 4JLRB 3TFKC 4AJ0A 1K8DB 1T7WA 4LIQE 4HXAL 3E3QE 3NVQA 2CIIB 2CDEB 1DQQB 3Q0HA 5CS7A 1JHLL 3VWJD 5J11C 4FABH 5T1LD 3LS5L 1GSMA 5IB5A 5E0QA 4WEBL 2R29H 5E2WH 1CLOL 3MFFA 4DZ8B 3IJHB 5IVNA 4I0PD 1RQ5A 3WIIH 3T1FA 3MGAA 2W9EL 2P5ED 2UY7A 5HYJA 4NZUH 4PJGB 4Y4HD 3GHBL 2CO6B 1JNHA 4NGHH 5FOBA 1AR2A 1GAFH 2BHUA 4I48B 2LABA 3SDAC 4HKZA 5ENWA 4GUPB 4PJ9C 4ODTH 5CEXA 1U8LB 5CHNA 3HE7C 1U8MA 2A6DB 5JR1H 1FL6A 2OL3A 5I1LB 3GMOA 4K3JH 1ZE3C 3ELAT 4DEPB 2FWOB 3ECBB 2AAVA 1GGBH 1LE9A 2BOBA 4UNUA 1G7MB 3DX9B 4XMPL 1QYGH 1F3RB 5C0RH 3GSOB 4PJDA 3HZYB 4ZUVB 1AGFB 2AJSH 4PJ8C 5LVEA 3WSQL 2XRAL 5DMYA 3FRUB 4GBXC 1DUZB 5EOCL 4LHUB 4RDQG 1IGIH 4EI5D 4YNYB 3DBXA 5HY9B 1EO5A 4U1MA 2AEQH 3U48A 5I1JL 4ZDHB 4GMSH 3D39A 1LO2H 4NN5B 1OVZA 1RZKH 4PJCB 5E5MB 3OG4B 4J23A 5KTEL 4LU5H 4ODVH 2EDYA 5FA4B 3P4MB 3QZWA 2ZJSL 1S7RB 3GO1H 4G43B 1T5WA 1UVQB 5GS0H 1XEDA 4P2QA 5IJKA 4YHYB 4DWHA 2BXYA 2DMBA 4MA7L 4NM8H 2ADGB 1TJHL 4CGTA 3CFIC 5J4MA 3H0TA 4U6HA 2OL3L 5FXCH 5T5NG 3TA3A 4NQDD 5DC0A 2HJLB 1QFWM 4WI2A 4LSVH 3X14A 3DNKA 1HOCA 2V5RA 1CXKA 4QHUA 3UP1A 1OWRM 4RMWA 4F57H 3U4BH 3VXQB 1MCRA 2DM3A 1NUFA 4HK3N 3TJEL 4EKXA 3FO0H 2NLJB 4Y4HA 1T21B 5TFSH 5HYQA 5BS0D 4XB7A 1F97A 3PUCA 4MXQC 1U6AH 2DM4A 4I18A 1S7XB 3RDTB 4CNIB 3ULVL 4P5TC 1NAMB 2NY5L 4JDZB 1FFRA 1ERNA 3R8QA 1IGCH 5CP7A 2VC2H 1BFVL 4NO3A 3L7EA 5JOEA 1L9MA 1JIBA 4WFEE 2J12B 5JORA 4WO4B 2HFGL 1YPZB 3GBLA 4HDIB 4DCQA 3BW9B 4WUUA 3RVXD 3HMWH 4WUUB 2FBJL 4NN5C 3W11C 4QRSB 3SGEH 4UDTA 4OCYH 3B9KC 5LGJB 2L7JA 3UJIL 1S7QB 3W0WE 3I75A 3KXFE 4J7RA 1ZS8A 5CBAA 1YEFH 4D0CB 2NXYB 4AEFA 4F33B 1DSFH 3CLEH 4PS4L 2IFFH 1HH9A 3VXUD 1NAMH 3EDFA 3FO1B 1F6AA 3P9LA 4YPGA 1NAMA 1N8ZB 4OZFH 3LDBC 1X7QA 4HWZB 4JFEB 4F7TB 3M8OH 4WW2C 4DEPC 3KGRA 4I3SL 4QLRA 4G6FD 1QEWB 4P2QE 4DUWA 1WZ1H 1MHPH 1NDGA 3DYMA 5HTSA 3WFCL 1KB5L 4LKXB 1NCBL 4ONFL 5DJYA 2H32A 4PJAA 3UJIH 5IFJB 3ZO0A 1OCWL 4MD0B 1CQKA 1KCUH 3MV7E 4LCUB 4ZUUA 4HUVB 3OGCA 2AK4B 2DYPB 3X14B 5C2BL 1QG3A 1Q72L 4M1DL 1BD2D 2EEDA 2YWYA 3BP7A 1R3IH 1AC6A 2XZZA 1A1MB 4PGBA 1NFDA 2MKWA 5KG9B 1JK8B 1Y0LB 5I76B 1AHWA 4N68A 4K3EL 2OZ4H 2PYFA 4OIIH 4N1HB 2Q3ZA 5INCB 1WCQA 1JWMB 1UM6L 5FUOL 1J1OH 3QNXA 3S35X 2XACC 1HSBA 5KANI 2NR6D 3VCLB 1NEZG 1ZLWK 3UJTL 2EYRB 4P23D 3U4BL 2FGZA 3CXHK 5DK0A 4WCYH 1OT1A 1BFSA 3P4OA 3G6JB 4ODBD 1UACH 3EJZC 3GJFK 4GMTH 2IWGA 4OF8A 4YWGH 3UEZA 3TVMD 2PETA 1R3LB 3DUUA 3QP3A 1FP5A 2DBJA 4PJFE 4LSTL 2X09A 2AQ1A 3HPLB 1RI8A 1XGUA 3JVGC 3U7WL 3SN6N 3IU4H 4WGVB 3QUMA 1AGBA 1H3XA 2N1KA 1MLCB 3KPTA 4YXHL 1UQSA 2N7AA 4K23L 3VA2C 4ZFOB 4E41E 2BP3A 1IEBA 2YZ1A 4GT7A 1NPUA 4XBGA 5K9QI 4XXCA 4Q2ZB 4X6BA 3WNLA 4LLMB 5DUBB 5F1IA 3LH2L 3IJSB 4RFNB 1QVOA 1JPFB 3BJ91 2Z8RA 2GIYA 4OJFH 2VQ1B 5DFWH 2G5RA 3B9DA 5JW3L 4BKLA 4KHXH 3EDEA 3R8BB 2XA8L 1DP0A 4NO2B 4HUKB 1MCNA 3N1GC 1AC0A 2AJSL 1CGSL 1J0IA 4I0PC 4M6ML 3V52L 4L3EB 1G7JB 3B8YA 4MLIA 3VWKB 4GS7B 4JPIA 1T0NA 2DQJH 2X40A 1FJ1B 4EBQH 2VXVL 2NY1C 1CDHA 1FNSL 1IT9L 1MY5A 1J0KA 5DF0A 1I3GH 5IP4A 1XZ0B 1ZVHA 3HAEB 5TF1H 1P69B 2KDGA 3FRPA 1FIGH 3F7VB 3O8XB 3TYGL 3V5DA 3KXFD 3HI1B 4P59L 1NUDA 4XZUA 2BNUA 2F53B 2AEPH 4F33A 3BN9C 3VMOA 5GIRA 3VRJB 3BZ4B 1FPTL 1NUGA 5E5MA 4Z7VE 4MAYB 5GJTH 4UT6L 4MNGA 4LLVB 4OLWH 3PWLB 2O61A 3X3FL 5A16B 5HPMB 3QXDA 5EZIL 3PNWB 5E4IA 4HWUA 2MPAL 1B0RB 2QKIB 4N0UB 1YN7A 2LTQB 1X5IA 3MLTA 1F11A 2H2PC 5FYKE 4X6FA 1KLFA 1MRFH 2FD6L 2VDLL 5T1KA 4LSPL 1RZJH 2J5LC 2XZAH 3OAYH 5F7DA 4KHTL 3ES6A 3W82A 4K3HA 4P5TA 5KBNC 1AP2A 4NP4H 4M6AA 1ACYL 3O6MH 4WEUD 5FV1L 1VA9A 5GHWH 5JTWA 1Z6JT 3QUZB 2BNRD 5JOFA 2J8HA 1CE6B 3FHAA 3FQRA 5GZND 2ZCKH 3QPXL 5EUOE 2ORBL 4HZLA 2DQFA 4M7LL 4WU5A 3VI3E 1IGFH 1LEIA 2Z92B 5LGHH 5KVEH 5D7IB 3CFDB 4OI9A 2Z4QA 5I8KL 2ID5A 4M1GL 1FLRH 5JXAL 4JG0L 3SKNB 2CQVA 5DRXB 4XNMA 4GKZB 3O8XC 3QULA 4YDKL 2DS4A 3HE6B 1UKSA 3DX6B 1WSST 4IRJC 3SJVD 4LLUA 4OQ1A 4QYOA 5F1KC 2VZ3A 1UB5B 2FZ3B 3QRGL 4PY8I 2HJKA 3ZKMC 4TSCL 2FJHA 1J1PL 1IM9D 2NW3B 2ADIA 4J3XA 2XKNA 3EGSA 2ZUXA 4LVHB 3QEHA 4LQFL 3S3PA 4I0PB 3VGBA 5JXEC 1T04A 2FX9H 4LRIA 2WIIA 5I8EA 3BSZL 4Z7VA 5C07A 3L95B 5ITFA 5B3NA 1UWXK 1B0WA 2FX8H 5EZJA 4I4WB 5DVMA 1ZT7B 4PR5A 3BKMH 4RFNC 2JIXA 5AAMA 3JWDH 3DRTB 1XR9B 1ITCA 4RMUA 5SX4H 2VLRD 4U6VL 3GNMH 3H9YA 3TBYB 3MXWL 1WTLA 4NUGL 4F9LC 3J8F7 5GSRB 1EA9C 2H2SD 3KLAA 2XWTA 3UBXI 5DD3H 2XYCA 1TMCB 4OFYD 2E9IA 4LGRB 4EOWH 1PAMA 4WWKD 4R97C 5DRZA 5HHQA 4RCAA 1S7TA 1U8PB 2Y06H 4X7SL 2CRIA 2PXYC 2VLJA 4QGYA 4YBQC 5JOFB 1KENH 5HYFA 2GSIA 2R8SL 2A73A 2VDMH 1S3KH 7CGTA 2H2PD 4XZUB 3N50A 4FXKA 3MLRH 4L8SC 1OTSC 1OWWA 4X5XA 2Z4QB 3JV6B 5DHVB 3HC4L 4JHAL 1CDCA 4HJGB 2MCPL 5HHNA 1M05B 4ZFGH 4OF6A 2YZ8A 3T0EE 4TNVF 5IM7B 2DQFB 4WU5B 2Y25A 4CADA 1IAOA 2VXTL 2QSQA 3F7YB 5EWIL 4WHDA 1I4FA 3C5ZD 3LKPA 3KS0J 3VGAB 4UB0H 4X6CA 4JJ5B 4YHNB 3MA9H 4HIJB 5DJZA 2A73B 1P4IL 4HKXA 3VW3L 1CDJA 2VISA 2HJFB 2X4TA 4NN6C 1RUAH 4M43L 3MRMB 3R06B 3BT2H 1SMAA 4K94H 1G7HA 5GS1C 4ZFOA 4E42B 2P5WD 2Q8BH 3QQ4B 4NQCB 3VFVA 3TC9A 3PHQA 3H7BB 1MRDL 1IKNA 2NY1D 4YIQB 1FL5B 5FYKH 5FCUH 3V6ZA 2VAAB 2NY4B 1EVUA 3MV8E 5C07D 4UT9L 5IV2A 3EJJX 1XGYH 2V9TA 1AGCA 3SDXB 4U6XB 5IJVA 4UU9A 1FCGA 3QDGA 1OM3H 4I9WE 1PEWA 3KPSA 1AQDA 1I9RH 1CGXA 4ERSH 4QHKI 1MF2L 3ARSA 1C5BH 2VQ1A 3QI9D 5IBUG 4RAUB 3DVNA 3Q5OA 3TN0B 1UFUA 1QFPA 3QEQB 4X5WA 3WHE1 3VXSE 4XPFH 5JZ7D 5L2KE 4ODWA 4X6DA 1YEDB 2YSSA 2VUOA 4BQ8A 4YR6A 4HK0B 3PQYA 4PLNC 2H8PB 3IDMA 2WANA 1AHWC 3RWGB 3B9KA 3SGJC 2ZSWB 5IF0B 5LKNA 1K8IB 4D0DB 1YUHA 4HS6B 2GJ6E 3QWQB 1FZMA 4K3DL 2A6KB 2VDQH 5EN2B 5SWZD 4XPBL 3QCVH 4KI5D 3ZTNL 4XPAH 2IQ9L 1HNGA 2ZSVB 5D1ZB 4EN3B 1TZHA 4FNLL 5HYSA 1CFVL 4MSWA 2WINA 2JELL 4OLXL 2HKFL 4QXUH 3O3AA 4MNGB 5HYQB 1XR8B 4JFYB 2OCFD 3BYTA 3QI9C 3O6FC 3Q48A 4UDUB 1JWUB 2AQ2A 3U1SL 4PJ7E 5EA0H 4YGVB 3BXNA 1P2CB 4KKLD 5C0AA 1H0DA 2VDPH 1MCCA 3N9GL 3W39A 3GFUA 2ICWI 1FNHA 1QQDA 4NQVA 4G6MH 5D1XA 1MIML 1R3LA 3AS1A 4NZDA 3IDJA 1N3NB 2GEEA 5JNYB 1KCRH 1MCQA 3CNKA 2X5PA 1AE6H 3MCLH 2OJZH 1TTUA 1W0VB 3BMVA 3RFZC 4S11A 2B8OT 3QXTA 4PPTA 4OGYH 4G8EB 4QT5A 2O26U 3L3KB 4PRNA 1WISA 1N6UA 1EXUA 3JTTA 4L4TE 4IS6B 3N0PB 4Y5XA 4S1SH 1XCTA 1RU9H 3VXSA 3QEQA 1TXKA 1ES0B 3N85H 2B0SH 4DGVL 4HGMA 2UV3A 2VL5A 4HKBB 3BP4B 3RNKA 4L8CB 3NIDE 3BIAX 1WC7A 1S78C 2AABL 2VDNH 1QSFB 3QFDA 1S5HA 3T0WA 1AFVH 3THMH 2VMFA 3IFOA 2M2DA 2DICA 3B9KD 4LHJB 4BM7A 3QUML 4GO6B 1ZWIA 2GJJA 1XGQB 2Q76A 2PXYA 4KK5C 2W0KA 3SQOH 4RAVB 1WVZA 4FMKA 5DJAB 1BOYA 1UM4L 1AHWB 1X7QB 3OPZL 5GJSL 4LSRL 4QRPA 4YHMH 4BZ1L 2B0SL 2FB4L 1N5AA 1FSKC 1MJ8L 1BVZA 3SE4C 2VL5B 3X12B 1FNGA 5CSGA 2X4UA 3OKYA 5IT2L 3FQNA 5IHLB 1EX0A 1KFAH 4PJCA 2D31B 3QQ3A 1B4JH 4Z7OF 1U3ZA 4Z7NF 2G75A 3SGDI 5HVWA 4CVXB 5EBGA 1B4JL 3MBEA 3RTQB 5HHVH 4KTYA 4PGBB 1OAXL 2D0FA 3HNTH 3KXFB 4DGVH 5FYLD 1IM9A 2JLLA 5DJAA 5B8CA 2FECL 3FRUA 1T3FB 4U1SB 1FN4A 5I1DA 1IL1B 1QP1A 5B3JE 1Q0YH 2DI7A 1G0XA 1V8HA 3AB0B 4NBYB 4NN6B 1I75A 1IMHC 4IRSA 3GSXA 3CSGA 3C8HA 4DTGL 4HXBH 3FO9B 3ZE0F 2QR0A 5DS8B 5C0ND 4KV5F 5BRZD 5CJOH 1VGKB 2E7BA 3GB7A 1OOAA 2AXHA 2I25N 4PJBA 1AFVL 2QADB 3STLA 4LQ1A 1EJOH 4KJQC 3VXSB 2IQ9H 1T7VA 3OF6A 3HB3D 5H37H 2HT4C 4ELMF 4P49A 1DUYB 1XF3B 3RX8A 1U9KA 2JB6B 1RU9L 2B7DT 3NCBB 3MOQA 1CTOA 2O5YH 3L3JB 1H3PL 4L9LA 3SDCD 1A9EA 4NNPL 4KRPC 4PJXB 3P0VH 1NFDE 3IKCA 2PTUA 1IBGH 2WWMC 5J12C 3EO9L 5AZ2L 3NTCH 3CX5K 1UZ6F 1O0VA 4KZEH 5IR1A 2NX5A 4PGZA 5C86A 3QNYA 3GIVB 2C3VA 3C9NB 3PL6D 2EO9A 1S7XA 3RDTA 3K1DA 1M6OA 4NQED 1Q9WA 1XGRB 5LCVL 4DFHA 4RA3A 4KXZH 1KYOK 5IMOA 1G9NC 3TBSB 4JY6A 1XF1A 3SKNA 4HFWA 3EFFA 3MYZA 2C7UA 2P7TA 3O3DB 3CVHL 1M7DB 1UT9A 5ICXA 1Q0XH 3BRGC 4U1HB 2EDFA 4UTBL 2W1NA 5ETUB 1IKNC 4HBCH 5CGYC 3VXOB 4KC3B 2AK4E 3REVA 3QFJE 2EICA 4MS8C 5DK3A 5GRXG 1MI5E 4FNLH 5TJWK 3G5YA 1SM3L 4U3XA 3W9EA 1MFDL 1LP9B 4NQDA 1NUNB 1HE7A 2EZ0C 4XC3H 3MBXL 4B41A 2WIIB 5I8EB 1YQVH 2DN7A 5KVFL 1K5NA 2LAAA 4XGZB 5L7XH 1GGCH 5JQ6H 5GS0C 1JCKA 3I50H 4OZGF 4YDIH 1J18A 1QUNA 3QB7C 4HWEL 2AKRA 2FBOJ 4GXVH 3C60B 4QRTB 5M94B 2H2SC 2PTVA 1P7KA 4L3EE 3TNNA 2QQKH 4HKJB 1EEUA 2IPUK 3IFPA 1RUAL 4R3SA 3BWUC 1E4JA 5CLTA 5TE7H 1ONQA 2NTFB 5DD5L 9CGTA 1TZIA 4D3CH 2ZP0T 5IQ9B 4IDJH 5FM5M 1K8DA 5IW3A 5HDLA 4HMEA 3UTZA 2Q8AH 3TH4T 2QQNL 3QUYB 1B0GB 3S88L 1G7PA 1TCRB 4L4VA 5FKPA 4ZFGL 5IOPB 5GRYA 4Q9QL 1B90A 1NCWH 5F8QC 1FE8H 2DIBA 1XGTA 4R96B 5DD3L 3VFGL 3ALWA 1ZSDB 1CXLA 2FHFA 2X1WL 1Q38A 3GNML 5I66B 1DJSA 5C9KA 4XPGL 2J5LB 2MWCA 3VXTB 3IGAB 1UADC 4NWUL 3ZLQC 4XH2B 4GAJL 1FZOB 4KK9D 3S36L 1AQDB 1ZT1A 3H9HB 4N5EC 4OZHA 4PJAE 4XP1L 2PO6C 2P8LB 2QHRL 3REVB 3MA9L 3PWVA 4PJIF 5EO9B 5GRVK 1HHHA 3V0VA 3U9UA 5BXFA 4KUCF 3M17B 3LKSB 3PIQB 5KAQG 5GS3A 1BFOA 4S1DD 5DD0H 4F7MB 1T66D 3MRJB 1FFOB 5HGBA 2V5YA 2NY4D 1WWWX 2E9JA 2P8PB 2VITA 3CMOH 3L5WA 4P23C 4U7KA 3K0WA 1OGAD 4MDJA 4NQSA 2H9GA 3IU3A 2VERN 2B2XH 4MCZA 3ULVF 3BFOA 3QEGH 3QG6A 1VADA 2HFTA 2R69H 2GY5A 1XGPA 4J3UA 1HQ4B 4GG8B 5J6GA 4AK1A 5E8PB 2C3VB 1OAZL 1NGYA 1TQCB 3GSVB 3MTRA 1GRWA 4XBPB 1A3LH 4JB9H 4ALAH 4LQFH 3QEQD 1KJ2A 5KVEL 4OZIE 3GHEH 1DTUA 1U95A 4KY1L 1T2XA 1XT5A 4H0HB 1S7UB 2Y07H 3RZCB 1RVFL 1EAPB 1ZA3B 2IQAA 5IWLC 1L7IH 3RAJL 3VU2A 1E6OH 4OFYA 2NY7H 3RGHA 5I0DA 3DVGA 4PJEE 4HKXB 2XXMB 5FKPB 3QUXA 2V2TB 2V2WA 4YFLI 3KYNA 3S37H 2IG2L 4HUXB 3ZE2F 4JG0H 3U4EB 4MJIE 4U1IB 2YD5A 1NEZA 2XFXB 3BVNA 1IGML 3KHOA 1OP5K 5B39B 1ED3B 2WIMA 1A1NB 1YMMB 1KCSH 5EOQL 4O4YL 2D9QB 4N0CC 5GISH 5IOPA 2BNRE 4LHUD 1JRHH 2B4CH 5FUCE 5EZOH 2P8LA 3TJHC 1QRND 1P7KB 3LOWA 1R0AL 2J8OA 5ESQA 3U46A 4NRXA 3LS4L 2A38A 4XNMB 4P2RE 2D7QA 4FFVC 1JPSH 5CIPB 3TGXA 3U83A 4KHTH 4ZD3L 3DI2B 1IQDB 3KYNB 3NPZB 3ZDXE 3C09B 4TVSa 5DO2C 4TUOB 2H9GB 4H88L 3KYKH 1R3JB 4HJ0C 3B83A 2A1WH 4MJ6B 4EI6B 4ZTOH 5ABDE 4J1UB 1A7QL 2P5WA 4KUZH 5HHOA 3RL2B 1OGAA 1FSKB 4KZDH 5BOZG 4FS0A 1TCRA 4L4VB 1IGFL 2DQJL 4EBQL 4D8PA 2ZCKL 2IBBA 4MNQD 4R7DB 3B6SB 1Q9WB 1XGRA 2YPKB 5IVXF 1RD6A 3K74B 1MCOL 1ZT7A 4GXUM 3BKCH 3PDDA 1CBVH 3MYJA 1KB9K 3KPSD 4FP8L 3O9WB 1L0XA 3O6ML 3DXAE 3P73B 3EO1B 3FL7A 4PJHF 2OSLA 4KJYA 2IADA 5FGBA 1ZKAA 5CSZA 2HG5A 1K6QL 3T09A 1BLNA 3MUGA 3FONB 3RZWA 1PSKL 1BZ7B 2EC9T 3R0MA 2VTFA 1WQVT 2P47B 4LEXL 4Z6AT 3E0GA 4OCWH 1IEAA 3QUXD 5I75C 4G6AC 5C0DA 4UQ2A 2VDRH 4PYHA 1MAMH 2R9HD 1J05A 1HILA 1YDPA 2HH0L 4OJFL 3F7VA 1YPZF 1NGZA 1C5DB 4ZFFB 4ONGH 4XCNB 1FGNL 1QO3B 4JRXB 1Q9LB 3TNNB 3Q5YA 4P2RA 2WBJA 2Q7YA 4KU1A 4LLVA 2X10A 1QRNA 3BGMA 1J8HE 1J86A 1FNSH 4QXGH 1UM6H 2XN9E 3SDAD 2R1YA 4WV1C 2APFA 3ULUE 2IPTH 4NSKA 4OIIL 4NDMB 1LD9B 1JN6A 3CH1B 4NQVB 4RIRB 3V52H 5DK0B 2OXGA 25C8H 5DTFA 2RBLA 1D9KC 3O6LL 3FQTA 2CUIA 2WWKT 4P46A 1R3IL 5EU5A 4JPWL 5DD6B 3VH8G 1Q72H 3W9DA 4H26B 5CEYB 1BD2B 4F15C 4ZNEE 3GI8L 2E9BA 3WL9B 2WK2A 1QBMH 5FUOH 3DARA 4R2GD 1ZVSB 4TULH 4NJAH 1H5BA 2X6MA 4WWID 1MHPL 2YUZA 5K59E 2XKSA 3K4ZA 1PX3A 4EDXB 4IOIA 4NNYA 1AY1L 4N9GA 4LLYB 4PJ7B 1U8LA 2FX7L 3QFDB 2C5DC 2AJZA 1SMOA 2ESVE 5C2BH 5JW4R 3GMPA 5ICZA 4PY7A 3AAZB 4KTEL 3O2VL 4HS3B 4UI2A 1T0NB 3CDGA 3RNQA 3CC5A 3MRNB 5GRUH 2CK0H 3G6JF 4NRZB 2JB6A 4JEGB 4X0KB 3NH7H 3ARED 5F88A 3MRDA 3KHQA 4UDTB 4H5SA 3U79A 1U8HB 1CXIA 1FO0H 2EYTA 3MROB 1AH1A 1IGYA 4J4PC 1T3FA 5I1DB 3FZUC 3BP6B 4D0CA 4NNYB 2ZSVA 2XN9A 3F5WB 1DSFL 4S1DC 1JGLH 4NC1E 4PYGA 3QNYB 3IFNH 4IJ3B 5TPWL 1HH9B 3RRQA 2ERJC 4I8DA 1T0MA 1ROWA 5I1HL 3GI8H 5E00A 3HLAB 4PJ9B 2HTLC 1U3HB 3GDBA 3TO4B 3G9VA 4AYFA 5LQBL 1NCBH 4F57L 4MJ5B 3LD8C 3IDIB 4LEOA 4EQ2A 5L8KB 3P4LA 3BDBA 4P46C 2WUCL 4E5XA 1I1FA 1H5BC 4FOMA 2R4RH 4GJTB 5CMAB 1NEZB 5C0CE 3SGJA 3PDOB 3EYOB 3CFJB 1J05B 5CZXC 4S10A 2Q3AA 3QDMA 3VFUA 1ZGLA 2N4IA 2JJUA 3P3YA 4FQIL 5J11B 4HLZG 2R1XB 2W92A 1L9NA 2D2OA 2EDJA 1PW3A 4MSWB 4LU5L 3C60D 3SGDH 4ZAKB 3NA9H 2J6EH 4KTEH 3QDJA 4Y5VC 2C3GA 4TNWK 3U0WL 5EIVA 3UC0L 3VGDA 4K3GA 5A2FA 3EJYC 1OSZB 1RK1A 1T1WB 3GMPB 4YHKH 4YXKL 3FT4A 2E7CA 2VLLA 5IWLA 4MZ2A 2VL4A 3GZKA 1ES0A 5ENWB 4R97B 2X4RB 1BFVH 4PRHB 4YZFF 4RWHA 1S7RA 1TVBA 1WAAE 4YFDB 6FABL 1L0QA 5E6YA 5E8DH 4P2QB 1FFNA 3FMGL 4BFEA 5E2TH 3MXVL 2BOBB 5EG6C 3LKSA 3PIQA 1OP3H 3EYSH 1CU4L 3NPSB 3TA3B 1T89C 1PVHA 1H8NA 3PHOB 3EKCA 3ET9F 2DQGL 3FO1A 5MP6L 4QTHB 4M61A 4G8FB 4ZO8A 4ELKA 1ZTXH 5EZJB 5EU6E 4PRPA 2EXYD 4HWBL 1DQDH 4MA7H 4NM8L 4NGHL 3FO2B 4GG8A 1BP3B 2VRAA 4DOHB 3BAEH 4Y4KD 4QNPF 2W9EH 2Y72A 4R6UA 3F12A 4O5LL 2EDBA 2F5AL 4P2OD 3DLQR 4H88H 2FIRT 3OSKA 3C2SA 3OKNA 3ROOB 5KTEH 1XCQB 2R39A 4NRYB 1T4KB 3R1GH 3SJVB 3U7YH 3MLSL 3GMNA 3MJGX 4XP9H 1EAPA 5D9SB 1XIWA 3EZ8A 1LO5A 2F54E 3NFPA 3CK0H 5EN2A 3VWJA 1KJ2H 1U92A 2XWBA 3W0WA 1Z9SA 3V0WL 2L4OA 4Y1AA 3SKOA 2F74A 1S7SB 4AG4H 4XNXL 4HUUB 1KIRA 3WIFB 3MFGB 3PGFL 4XVJL 5D1QC 4R8WH 4WFGD 2CRYA 1CGWA 1SJXA 4LEXH 4Y2DB 4XMPH 5DJXA 2WINB 2F8VA 5ISZA 1F3DJ 4JCLA 2Q7YB 3V6BR 3WXVH 1JHLH 3EYQD 5GGTL 1T80A 1G1CA 1BMGA 2YWZA 2PR4H 4RGMC 5JR1L 1G6RA 4PJBF 5DUML 2ZOLA 3TCLA 5FCSH 3WLBA 1DZBA 5LG1A 1G7QA 5EU4A 1U91B 1MI5B 4RISL 4MCYB 1I3RA 3LEVH 3S7GA 3MV7A 1LP9E 4NQXA 5AUMA 4UNVA 1ZMYA 4PREA 5JLZB 1FFOA 5HGBB 4MAYC 5D71H 3L3IB 5A43C 1MJJA 5KZCB 3ESUF 2VAJA 1A7QH 3E8UL 5JXEA 4DAGL 1C08A 3BPLC 3IDGA 4U1GB 3VD3A 1CLOH 4NQEE 3H6JA 4KK6D 4E0RA 2XKNB 2V6HA 5TE6L 1TNMA 4J4PD 4ODSH 3OL2A 4ZSOA 2GJZA 4FABL 3C60C 3HS0A 5CFHA 1GGYA 3S3JA 3K81A 3ARDB 1CT8A 2K7QA 4FQCL 2A77L 2EH7L 3WO3B 4KDWA 4MGXA 2G9HB 4HMDA 5EZOL 4GKZA 4XTRD 5DRXA 1EFQA 4GS7C 5FYKD 3BHBA 2IQAB 1SEQL 2IADB 1QBLL 5CBEB 2P46B 4A2MA 3TBYA 2LU4A 3IRZA 4N0UE 1FNAA 2R2HB 3E8UH 1KIQA 4U1HA 5F8RC 1JHKH 2DLFH 1VKXB 4BK5A 1D5XA 3RQ3A 3EW3B 1NGXB 3KPOA 2ADIB 4P9HH 3PGDB 1I8KA 1QLRB 5B39G 4OD1L 5IHBA 4OF0A 3WJJC 2ZUYA 4E41A 2R4SH 1FVEB 1CT8B 3WLWC 5F9OL 5I74C 5C07B 5IIEA 1JV5B 4U49A 1MJ7L 5DMGD 1EHNA 2HVKB 3KVQA 4JVPA 2NY7L 5ID1A 2BFVL 3MV9A 2FGWL 1QLEH 4UAOB 1YY8A 3SE8L 5BVJA 2D4FA 5GGTH 1IQWL 5J1TC 1F5WA 3ARGB 1GVIA 2UWEF 2XZQH 4M02A 3MCKB 4KTDH 3BPOC 3LN5A 5BZDB 4YGAB 5D5ME 5CBEA 5BZDA 1RZ7L 2R0KL 4JB9L 3A0OA 4LRNH 3MRFB 4LCIH 4NYLA 4D3CL 4XNXH 5AUMB 3RUGA 3DUSB 4Y5VB 2IEPA 3QDHA 3RVTC 2XFXA 2MFNA 2NTFA 3H3PL 3OJDA 3GMLA 2ZCHL 2V7HB 4HGKC 2FNBA 4LSUH 2FJGA 1RZ8A 4V1DD 5BVJB 1H3WM 3MJ9H 2XQBH 3MR9B 1ZEAH 1RAMA 1XGTB 2F5AH 4HCRH 3TIEB 1AQKH 5ESAA 4NC0B 1OAQH 3JV6A 1FNFA 5H37G 1NC4D 3RDTD 2FO4A 4BSWB 2W9DH 3QUXC 4OZIA 4DOHE 2OQJA 1KJVA 1ONQB 2OQJB 2ERJB 4FFWD 4S0TD 3L5HA 2YRZA 4JGUA 4XBEL 3IRPX 4CBPA 4FTVE 4CN6A 4OLEA 5HGHA 4QKXB 5IBUB 4ZFZB 3EYSL 3OR6B 2Z8SA 3ROLA 4LOUC 4Q9QH 3KJ4C 2COQA 2CLVA 3MRJA 3MMEB 4P9HC 5EPMB 1W72H 1WBXB 1KIUA 3CVHB 3T2NH 4MVBC 4OCXH 5TF0A 4F37K 4XBGB 5IIEB 1P84K 4KI5C 4MJ2A 3HZMA 5K9OA 4YHIA 4NKDA 4P5KA 3V4UH 3ARBC 1N4XH 3OZ9L 3DRTA 4AG4L 4YO0B 4M3KB 1CF8L 3BQUB 4JR9L 3CU7A 2RCSH 5DGQA 3RGVD 1GGIL 2APXA 3NTCL 1PKQA 3MV9D 3W2DH 5CILH 1DL7H 4ZYKB 4PTUA 3B9AA 5D6CB 4KJPC 4YHLL 5IMMB 5IW6A 5DJ8B 5L2KD 5CGTA 4G8IA 3FN0L 1KTDA 2XNAA 2KQNA 1CD8A 4U31A 5GGSB 1CWVA 3A67L 4P23A 2J6EL 1T1XA 4ZPTB 2CXKA 2P7TB 3GRWA 5MEND 3WFDL 4YEEA 3E6HA 1QSFD 3KYMA 4O5LH 3TT1H 2GJ6D 3FQXA 4YJZL 3QWRD 1EJOL 4XCYB 5BZWB 1YC8A 3T3PF 3U0PB 2B1AH 3WDJA 5E9DD 5DDHB 15C8L 1DVFC 3DSNA 3HI1A 1MCEA 3QAZC 2P5WE 3CCHB 5B22A 3PV6B 5D96B 2W60B 2WMPA 4WHYH 3IVKB 2LVCA 1NLDH 2R4RL 1FG9C 4WNQB 1X4XA 4IRSC 3S97C 1PLGH 2HRPL 5A16A 4Y4HC 4JDTL 5LJYH 2HKHL 1J10A 5DQDL 2BCKA 5I17B 1IC4H 3JV4A 4GRWH 3EDJA 3C5ZA 4QHLA 2YKLL 5CCKL 5GXBB 3OJVC 2AJ3B 4WIQA 4U33A 5CMAA 4LK4A 1U0QA 2J6EA 3VWJC 1N2RA 5FA4A 4ZPVB 4NRZA 3B9VA 4X8JB 2WBJC 2CK0L 1AI1H 4F80A 1AJ7L 3SO3B 1MLCA 4ZQKB 3W0WD 1DE4B 3NA9L 2UZYB 1E27A 4D0BA 1GC1H 2B20A 2ZPKH 3B2VL 5I16A 1T1YA 2W0FA 1ZWIB 1WF5A 2BOCB 4QT5B 1UJ3B 1JPGA 1QNZH 4DN3L 4XCEA 4JFOA 4OCNC 1CVRA 2HJLA 2CLRB 5IMLA 4JQIL 2DF3A 5CAYB 4Q6IB 4R90L 1LGVA 4Q6IA 4NHCH 3ZYZA 1VESA 3O4LA 1OL0A 4ZTPH 1J8HA 4HZAA 4D2NA 1KPUB 1MQKH 2Z31B 3C5SB 4MMXC 3GKWL 2DDQH 5AZEL 4XRCB 5T3XH 5F3BB 2XZCH 2Y5TA 4DGYL 3U4AA 4AIZA 3DXAD 4MJ5A 5BJTA 2PO6D 3RWDB 4NN7C 3BZDA 4POUB 4LFHD 1CGYA 3QQ3B 1E4KA 5CD5C 5D7JC 2GSGA 3PQYD 1CFTA 4JPKL 4XP4L 4PY7B 2AGJH 5IBLC 3GBNL 4WNQA 3D85B 4ODWB 5LAXB 5LAXA 4FMFA 1MHCA 4XPTL 2FHCA 1MCJA 2J88H 2XXCB 1YPZA 2AJUL 2BNRA 5HGAB 3BUYA 5MI0B 25C8L 2CK2A 3TN0C 4GRWB 5E2VH 5HHVL 5FO9B 4TTDC 3KPPB 2EC8A 1AGFA 5E00B 4WW1B 3P4NB 4J4PA 2Y6SD 3KWWA 3QDGE 1EDQA 1VFUA 4L29B 5EC1A 4L29A 2WLYA 1TITA 4HS8H 1JZ3A 1JWMA 1BZ7A 1NDGB 1KCLA 2XN9B 2G60H 2YPLD 3ZZ1A 4ENED 3BE1L 2ESVA 3HNVH 5I1EL 2OL3B 2NY4C 1F58L 2VWEE 1WTGT 2D3VA 3N9GH 2CO7B 3GSNL 3OB0K 3JWDC 1XF5B 3OQ3B 5DTFB 4PLJD 1RY7B 1UVQA 3DUUB 3PABA 4H8WL 5DC4B 3G6AB 4GBXA 5IFAH 5ADPH 4IOFC 1AY1H 5DA0B 5DFTA 1BQSA 3ARTA 5I6XB 1ZLUH 5DJYB 3FZUD 5ESAB 4OCWL 4Y2DD 2JELH 3D3VE 3MRQB 3EOAB 3SKJL 4Z7QF 1HOCB 4P48A 3O4LB 1RUQL 4X9GA 4OLUL 3V4VL 5KOMC 5TE4L 4UQ3B 5C09B 5JO5A 3C6LB 2AV7A 4JM4L 1A7OH 4WI4A 5FHBH 1GJIA 1FGVH 1WJ3A 1AKJB 3RNKB 4L8CA 1NCAH 3T0AA 1WLHA 3ZSTA 3LD8B 2K1MA 4JPWH 2R2EB 1A4KA 4LCWE 3G08B 3I85A 3NABL 3NGBC 1XF5A 3D48R 1KIPA 3RKDD 3HG1E 4S1SL 2EH8L 2ZZUT 1A6UL 1U3HC 3BKCL 1MCOH 2BNQA 1IC5H 4YGVA 1RULH 3OMZA 3REWA 1C16A 1X5XA 1IVLA 3V9FA 4XWOC 4Z78A 2OR9L 1OB1B 1JMZA 3E6FB 5E56A 4HT1H 3PHQB 3K1KC 3U6RA 1U8QA 3ROLB 4QXGL 4ZXBC 3RWJB 3GJFH 4HC1H 3GMOB 5DZOA 4P4RB 2P4AB 1BBDH 3WO4C 3X17A 4Q9RL 1I7ZB 1B6UA 5T3ZL 1R5VA 4QCIA 3L6FA 3KS0H 5H94A 3MNZB 5TDOB 2HH0H 5GGSA 4Z7VF 3A6BL 4LARH 5KN5B 3QCTL 1RJYA 5IMMA 2YPLA 4QXUL 4OLXH 3BT2L 2XICA 3T0DA 4YEFA 4XMLL 3UTPE 4FQPA 4XNYH 2FDBP 3CLFL 5J9PA 1DFBL 3OX8B 4X9BA 3U36A 1AIFB 2WLZA 1I7RA 2H32H 5BV7H 5I18H 2BDNH 1A9BA 3ZTNH 5CEZE 3LMJH 4JHWL 1J5OH 1D9KA 5JHDA 1H3GA 4HX1A 3WFZA 4BUHA 3DX9A 1GXEA 2YUXA 2AV1A 4EDWH 1W0YT 4F15B 5EU6B 2JCCA 2CKBA 3FFCA 1R24B 3VGEA 3ARGD 1A64A 3PL6C 4KJQD 1U36A 3MO1A 3VI3F 4I5BA 4KMLB 1HKLH 2WP3O 3DECA 5LWYH 5B4MD 3R0NA 2Z92A 5MEOB 5DJ6B 4U2YA 2MJWA 4M6OH 4QHUB 4KUZL 1BQHA 1H3UA 2A1WL 4YLQT 2BMKA 5IQ7H 1OY3B 4Z18A 3LEYH 3QHFL 4PRBB 1RUPL 3QUKA 4PRHE 1CD9B 2NY0B 1I9RL 4HIJA 4RBPK 5IVOA 1WBYB 1BECA 4EOWL 3F7YA 5FGCB 1FFPA 5I8OH 2EIZA 5IESL 1T6WA 2AK4D 1UXWB 4NUGH 1VKXA 1MRDH 5IGXH 2ICES 3IDNB 4U6VH 4A6YL 4UV4H 2UVEA 3CH8A 4OTXH 5T3XE 1JPTH 3NACL 5GGRA 3MRMA 3R06A 4NCC2 4Y1AE 3RY6C 3T1WA 3GMMA 4IM8A 4JFQA 5F9JA 1T20B 3X3GH 4NQTA 1NBYA 5K93A 2QSTA 5DLMH 4LCCB 3RIAK 5IB1A 2DWEB 1R3KA 1XH3A 1A21A 3HPJB 1JPFA 4PRBA 3W5NA 1R3HA 1ZK9A 4JKLA 3KDMB 4QGTA 5KSBB 3DX6A 3S37L 4A6YH 3OB0H 1NSNH 1ZV5A 5TH2B 4AEIH 1V7ML 1ND0A 3ZT6A 4JM2C 4FQQA 1KELL 4EN3C 1ODAA 5GSRA 1QFWI 4RWYH 3ARXA 1CIDA 1FE8L 1U95B 2X4SB 3M17A 1P9MA 2CUHA 3MRPB 4TSAH 1QLRA 5JA8B 2IPKA 5KS9F 3V79C 5D4QA 5DRWA 1I1AA 1K2DB 1I1AB 5F7EH 2DMCA 1S3KL 3MZTA 4I4WA 5DLML 4HPYH 4UIMB 1A9BB 5ANMB 4BZ2L 5IB1B 4NKQB 1E6JL 1KT2A 3V6OE 4P5KB 5LWYL 4M8QA 4M8VA 4M6NH 1EEYA 4JFXA 4ZSOE 4XXDA 4I0PA 4OCSL 1ND0B 4QOKE 2YA1A 4CVUA 5ISZB 1MWAH 2YC1B 3MXWH 1JV5A 4HWEH 5JW4M 1A02N 1Y18B 3VXNA 1WAAA 1VACB 5DD0L 1EMTL 2BVYA 1AO7D 1LHZA 4YDLB 4IMKC 1E4XH 4D9QD 2QKIA 3CMGA 1X9QA 3PNWA 3UPAA 4LNRA 2EIZB 4Y0GA 4OZ4B 3GEWB 1DR9A 1Y6NR 1XAUA 4XC3L 1RUPH 3QHFH 3X3GL 2VZTA 3NFPB 3CLFH 1NH6A 3MUJA 4ORGB 3FTGA 4GAJH 4PGCB 2AK4A 4NOFA 2HMID 2MPAH 3QCTH 5DRNB 1RUKL 4FQ2L 4OM1H 5EU6A 4X98B 5B39A 2F53E 4YUEL 1OAKL 1SJEA 4Y8DC 1DVFD 2RFXA 3KAAA 1DQML 3QUYA 5T3ZH 3WDIA 3ZHKA 5INCA 4Q9RH 5TQ0H 4P2RD 3HMXA 1NGWA 5I1GL 3MGTA 1NBVL 4POZC 1C7TA 1FIGL 1WZLA 3STLB 3LMJL 1ZSDA 5TF1L 4HC1L 4L3EA 3UROR 3QISA 1M71B 5BV7L 4W6YB 4NRXB 4U05A 3ESVF 1MCPL 4WTZG 2C1PA 5EIIA 5EBMB 3IGAA 1KULA 4L8SB 4P2OA 1HKLL 4X4XA 5GSVB 4XMLH 3P0VL 4GSDH 3IDXL 4G6AD 1OQXA 2Z0BA 5C6WH 5J6HB 4OIAA 1CE6A 4HDIA 1G7JA 1PDKA 4MNQE 4DCQB 4YDJB 2O5XL 3EUUA 1I7ZA 3SE4A 2PYEB 1HQ4A 3T65A 3MA7A 1WCBA 3VRJA 4L4VE 5EU3B 5CZVH 5T3XD 1J9CT 1FVEA 5DJDB 3JTSA 4JM2B 1M6OB 3CFBA 3UTSE 4MDJB 3MNVB 1H9VA 5DWUL 1IARB 5ITBH 1X5HA 1UJTA 2VDLH 4X6BB 3P30L 5K9QG 5F3HA 2I9LA 5EZIH 2DJUA 2PO6B 4FZ8H 3ZKSD 4F7CB 2G5BB 1M7DA 4NKIH 3I6GB 2YXFA 5GJTL 1KGCE 5IFJA 1DANT 2X4UB 4H1LA 3VWKA 3IFLL 5D1QD 1LVEA 5MENA 3NZHH 1FPTH 4JY4A 1A22B 3O3EA 2FYYB 1VFBA 4Y19B 1P53A 1F58H 1QKZH 1IM9B 3CFJA 1KBGL 4G8GD 4HUVA 4WO4C 5LCVH 1RFDH 2HN7B 3VXRD 3NCCB 4MCZB 1SY6A 4FN0A 2R23B 4L8BA 4MQ7A 3QUYC 4HPOL 3BZFB 3Q3GA 4GKNB 3TF7C 2AJVH 4FFVD 2X70B 3C2AH 3VA6A 3VH8B 4LGSB 1QPXA 5F1SA 5IB4A 2XN9D 1R6VA 3MO1B 4WFFD 3S5LA 5FHAL 3EOAA 5DYOB 4MAYA 4PJGE 5IVZB 4YNYA 3BPLB 1JGUH 4N0CD 5DSCA 1MWAB 5KVMC 1MJ8H 1ZT1B 5HD8C 1S5IL 4FQLH 4N0UA 3MACH 5CLWA 1JN6B 4JPKH 4XP4H 3TCLB 4APQB 5FM4A 5FHBL 3TIDB 1MJUH 3B5TA 5CEZH 2AXGA 4PJIA 5C0AD 1I7TB 1PQZA 7FABL 3G04A 4S1RL 4CVZA 4NO5B 4R96A 1P2CA 1EVTC 4MJIA 4JFHD 2R1WB 4LLWA 5JORB 4ZG1A 1EV2E 3OKKB 5ANME 3SDCC 4GAGH 1MFAL 1A0QL 2OTUB 1A4JA 3OXRA 1I8MA 2XG5A 3UZVB 4FG6C 1UYWL 3D2UB 2DL9A 4PJDE 1HWHB 3D2UA 4QTHA 3TZVB 4P4KB 4GMTL 4YWGL 4Q7DA 3VFPA 1YEFL 1KLGB 2EDQA 5DMKA 3C6LA 3FKUS 4PG2C 4EDXA 1K9TA 3RUGE 1D6VL 1FVDA 5MENE 3DETC 3F62A 4JRXE 4JPVL 5D2NA 1I8IB 3BEVB 3V0AC 4JJHA 1PQZB 4HFWB 3L1OL 4I18B 4Z7OE 4OGAC 1CFTB 1DQLL 4OFKA 4PTTB 4Q9BA 4M9PA 1U3HA 1PZUB 1DBMH 3D9AH 5CP3A 4YX2H 3ARBA 3GSUB 4XAWL 2UVFA 3BEWB 3QXAA 2E7MA 3PABB 2VLJD 1SBSH 3SBWC 4PRDA 5T1DL 2VZUA 5HVHB 4X80L 1A7RH 4H5SB 3U36B 3RJQB 3UAJC 1D5MA 4XPTH 4JQIH 2A6KA 4M5ZL 2NY1B 1MFEL 5H35B 1N64H 1JTOA 3PWPE 5B3JF 4U6HB 5T5NF 3OGCB 3TJEH 4B0MM 1ZS8B 1NMAL 4AENB 3U1SH 4GLRI 1GC1L 4IRJD 3SQOL 4RQQA 2R1YB 4L8BB 4MQ7B 3D39B 4RQQB 3WFEL 5H94B 5TDOA 3ZE0E 3QUMH 3BPCB 5J8OA 3KPPA 5F9DC 3TA3C 1IC7H 3HC0A 3QZWB 4KV5E 3RIAF 4Y5YA 4FTVA 1S9KC 2X4NA 4PJ8D 1YYMH 4ZTPL 1A2YA 3D69B 3THML 2IAMD 4NPYA 4OZGA 5JIIA 2B1AL 4DKFL 2VWEC 1I1FB 5TDNB 4OSUH 2YKLH 3CCHA 4C54A 4I13B 2AI0L 4F7EA 4ELME 2VR5A 4K3DH 2ZPKL 1LD9A 5C0DB 3UZEA 3V5KB 1DBKL 3SPVA 4WUUE 3EYVA 3PXHA 3EYVB 4AEHH 1AJ7H 1DLHB 4QRSA 2YRPA 4L9LB 1NL0H 5EU5B 4L9LC 1S8DA 3B43A 5EBLA 4Q74A 3G5XB 1BM3L 3LPGA 5B8CB 4LLYA 3VFTB 4JRXA 4YXLL 4X4MA 5FYJL 3H0TB 3M1BA 4LF3B 2CLRA 4CU8A 1N4XL 1TFHA 2NY5H 4CU7A 3D69A 3P73A 1B4RA 4PY8J 1MWAA 1KCVL 2MOVA 2NY0D 4K7FB 5KSBF 2Q1EA 4G7YL 3ZL4L 3MLUH 1RURL 4GG6F 4XAKE 5FM5O 2CRMA 2W07A 3Q1SL 2NLJA 1A6ZB 1BEYH 3ARWA 5IEHB 3RWGA 4C56D 1EZVX 1QSFA 1U3HD 2DKMA 1OGAB 3WNOA 1PKOA 2EXWC 4P46B 1FC2D 2J2ZA 3CSYA 4MS8D 1FRGH 3UTTD 5E2UH 5BW7A 1DN0B 1CFVH 3NOIA 3SDDB 4ZNEA 3PWUB 4N0FA 3CFEB 2DQCL 3HZYA 4ZUVA 1BWMA 3VFSA 3QDGB 4XPAL 4YK4B 3I6GA 1B6DA 4OT1L 4OCXL 3BD4A 4OZGE 3T2NL 2J8UE 5D1ZA 1G7IB 3RVUD 3P2TA 3W81A 2MCPH 2D31A 4YHLH 1ORSA 3H3KA 1ZT4A 3W39B 5FECA 3V8CA 3AAZA 5CILL 4PG9B 3ULUH 4JFEE 5EC2B 8CGTA 4KVNL 1EGJA 3OGOE 4Z95H 4N90E 3U0PA 3RJDA 2ICWB 1C5BL 2BVEA 4OCMC 4RAVA 3BN3B 1KENL 3KPMA 4PLJC 3L3KA 2DLTA 1GC1C 1NC2A 1A7NL 1U58B 1RZ8B 1AXTH 1AQKL 3RL1A 3TVMC 2EDLA 3SGKC 5J13C 1REIA 3MJ9L 1T83A 1KB5A 3L9RA 5C0NC 4BQ6A 4X5XB 1AXIB 1FVCB 5F9OH 3U7AA 5C71A 5E08H 1YEIL 2ZG2A 1S9XB 4LSUL 3WEXB 3EYUH 4IOSD 5HYEA 3O81A 1KTKE 1WC7B 4JKPH 1TVHA 5DSCB 1H8OA 4QXWA 2VZ1A 2W9DL 1FZOA 3V7MA 4UDUA 5C2UB 1WT5A 2ZOLB 3H8NA 1T2JA 1MSPA 4HJJL 1S9YA 2BMKB 3QWOB 4UBDD 2R2BA 3I02B 2X4OB 4J3VA 4PJCF 1PY9A 5E2WL 1E0OB 1ZEAL 1BGXH 4EIGB 4L8SA 4P2OB 2PTTB 1MJJB 1WUNT 4WV1B 3RVVD 1IQWH 3L5IA 4DZBB 4KK8C 5E1HB 3ULVE 4BFBD 1K3ZA 1MCLA 4FQCH 3KPSB 2VH5L 1MJ7H 3O9WD 2XTJB 3H3PH 2HA1A 3KPOB 1A5FH 3OHXB 4OBSA 3PP3H 2R0WH 2F58L 3VWKC 2DJSA 2WBJD 4M1GH 4Z7VB 4AH2B 4HC1A 4LPYA 4MNGE 1NBYB 4OZIF 2ILLA 3FRPG 1XCQA 4NRYA 1YY8B 4LSQL 2VXSL 3ZT7A 2E27H 4M7LT 2GT9B 4W68A 4V2BA 4K2UL 1NCNA 3P0YH 3U9PH 3IAPA 1ETZB 5CUSH 2CKBL 4PJEF 4TPRL 5HJ3B 2R4SL 2GCYA 3LKQB 4JKMA 4PGCA 4B50A 4CU6A 3ZE2E 1IFHH 5F71A 5E4EB 2APVA 3G5YB 5J6GB 2DLIA 2XTLA 2RHEA 1MVFA 3T4YA 4KQ3H 3EDKA 2ICWA 3KPQB 1C5CH 4BFIB 2FX8L 3P9WB 3UYRH 2GSIB 3L3GB 5TE6H 2XV6B 2YC1A 4YBQD 2ITCA 4R8WL 4DAGH 1SEQH 4HZLB 5HPMA 3WXWL 3MV9B 1F3JA 4DQOL 3MR9A 4M8QB 3V0WH 3T3MF 3HCVA 2C7UB 4UT6H 1EERB 1AO7A 4TNVK 4WTZA 1W0WA 1JNJA 2I5YH 3ZKXC 1YEIH 4ORZC 1TVHB 3ES6B 3MGOA 1JWSA 2OI9B 4Z0XB 3ZDXF 4P59H 4N8VA 2ATPA 2Z35A 5F7KC 3JUZA 2HVJA 4L8DA 5KSUB 4P9ML 5D7KE 3MLZL 1CFSB 1HIMH 5AYUL 1YY9C 3MV7D 4G9FA 3WBDA 1M7IA 1YJDC 3D25B 1FYHB 1I9JH 2C26A 3UYOD 4ZAKA 3FTGB 1E4XI 4PB0H 2XIDA 3V2AR 1G7HB 4YHZH 1Z9MA 2V5SA 4WU7A 3WE6A 1INQA 3FB7A 1U93B 4LCCA 4KDTC 4P5MA 3MODH 5MP6H 2DQGH 3M1BB 2P49B 1R3HB 1F4YL 2X4RA 1R3KB 1XH3B 3HPJA 1ACYH 5E4EC 1NLBL 4GW5A 4PJHE 3BI9X 3CDFA 3LH2H 3MXVH 4WI6A 5I74B 4GQPH 2WBKA 3QIWA 1BJ1J 4YDLC 2OYPA 2NY6B 4BUGA 5F21B 3V6FA 3K8MA 5IEHA 4U0RC 3SJVA 2WP3T 3PGFH 1Z3GL 4MVBD 3ILPB 1U8QB 4QHMB 3BHBB 3IU4L 1RJZA 2GAZB 1XIWB 2HT3C 4XP6L 3VRIA 5JDSB 1Q1JL 1DLFH 2P24B 1BWWA 5JZ7C 5GS2D 5ETUA 1ZTXL 5I66A 1KCKA 5C70A 5CJXC 3IJSA 43C9A 4Y7MA 3MC0A 4ZSOB 2EYTB 1KEMH 3HR5A 2X44D 2DL2A 1QSED 5E7FA 4JZNB 1Q9KB 2C1OB 5JOPD 1SY6L 4HF5L 3T0BA 1ZT4B 3HC3L 2VLKE 3Q1SH 4TUJA 3CXDH 4H8WC 4PBWD 1UC6A 5C0BE 3P40A 1CN4A 1DQDL 3DO7B 4K71B 4L5FL 3LN4A 1EHXA 5K33A 2YUVA 3HAEG 1MLBB 5C6TL 4LCCC 5ERWA 5SWQA 3EYOA 5IHZA 1K4DB 4KHXL 4LDLB 4G9FD 2IAND 2X1XR 4UOJA 1A6VL 4NQCE 2YBRA 2FEDD 3PP3K 1A7BA 3VXRA 1GHFH 4HIIB 4ZAKD 4DW2H 5E2TL 4V1DA 1DBKH 1UG9A 3TFKD 1QFWH 5E8DL 5AG8A 3S37X 4NBZB 4KRPD 3VMPA 1N3NA 1VPOH 3UTOA 2F5BL 4PRPD 3O3BA 2R1XA 4XWOD 2H6PB 1YA5A 5E6IC 5HYSG 2VLLB 2FECI 2NZ9D 3TIDA 1ZAGA 1KG0B 4XC1H 1OTSD 1NEUA 2DQUL 2IH3B 2ESVD 4PS4H 4WUKL 3WHE0 4PJBB 1JWUA 1JZ5A 4XMKL 4NO5A 4P3CH 5A3IC 4ODUA 2IGFH 1EH9A 3ZYOA 3F58L 5DT1L 1EGJH 2I60L 5F96L 1YEJL 1D5ZB 3U6RB 1A3QA 3V5KA 5I1HH 4FQIH 3OJMB 1QOKA 4X8JA 2O93L 3P9MA 3BOVA 1A7RL 1GL4B 5H35A 1HWGB 1NCCL 2A6IB 2Y7QB 1IGYB 4HGWB 3L5XL 5DD6A 4QRUB 2EIBA 3DTXA 1G9MH 2IBGA 3DTXB 1G6RH 4YX2L 4FFYH 1T1YB 2W0FB 1OF2B 3ZMRA 4NJAL 1DQLH 3O45B 1KUMA 3GIZH 1OD9A 4JFDA 1KB9J 1KCUL 2ZOKA 4JPVH 1U3YA 1OCWH 1MFNA 1XR8A 4JFYA 5EC1B 2MMXA 4XRCA 4Q0XH 4NZTH 1N6VA 4WHTA 1FVDB 2D03H 4PJ7A 1WZ1L 1MCHA 5F70A 3WKMH 5CZXD 4A6YB 1MFAH 3F7PC 4OZFG 4K7PH 3UO1H 1F4XL 1X3DA 3D85A 3OKNB 3CFBB 3ROOA 1A7PL 5FUZL 1KEGL 5GS0L 1G7MA 3CDGB 4L1DA 3SE3A 4YHIB 5EO0B 4P3WA 7FABH 2H26B 4G7VL 4MNQB 4HLZH 4CN1A 1MREH 2EDEA 1HHJB 1Y0LA 4TULL 1I7UB 1HN1A 5CEZL 3AY4C 1F90H 3KWWB 4DJMA 5EZLB 4ONGL 1ZVSA 5I1JH 1UEMA 3HKFA 5HY9A 4NT6A 4NM4L 1CXEA 2VXUL 5DZNA 2NQCA 1M1SA 1XCTB 4TOYL 4ODUB 4X4ZA 1OARL 5HBBA 2EDOA 1DBBL 4NFDA 1PY4A 4WI3A 3BP4A 5FHAH 3LQAL 4FQ1L 3HC0B 5HHPA 1G9ML 5D7JD 3MOAL 5JUEL 2G75B 4U4BA 3ARFB 1RPQA 2Q6WB 1FZJB 1GGBL 4D8PB 2BHYA 2ITDA 3G04B 1RJCA 2VR4A 4WU7B 3WE6B 5FKAB 4Y19E 5CWSA 3QUZD 1KEML 5I1CH 5DA4A 5IVXB 4JRXD 2OSLB 3VDBA 1T5XB 4BSJA 2A6IA 1T5XA 5ADOH 2DQUH 3IFLH 3CIQA 3NFSH 3NCYS 4IJ3C 1Q1JH 4JFPA 3HE7A 1CLZH 4WHTB 3GHBH 1NGQL 2VDRL 3LKRB 2VLRA 1UWEH 3MUY1 2Z8VC 1TDQA 3FFDB 2XNAB 4RX4D 4TRPH 4WEMB 4F2MB 4O2CB 3IETB 2MCG1 2GTWA 3SE3C 1KJ3L 3V6FB 4KJYB 1VFAA 2GFBA 3HE6D 3KLDA 4NWTH 4WEBH 5E24E 3QHZH 1KF9B 3SKUD 3VFVB 3DMMA 4HKBA 4YQXH 4GMSL 4HIXL 5CZVL 2AEQL 5KS9B 3LS4H 4KKBD 1L6ZA 1RJLA 1R0AH 5EU3A 5I30L 4KWUA 1MAML 5A2IH 3NA4A 1YNLH 1I3VA 1VADB 1CD1A 1KJMA 2FH8A 4OGXH 3S98A 4FQXB 1CLYH 3FT2A 2CRZA 1OP5H 4KZDL 4JO3H 3RZCA 5E5UB 2EE9A 2V5MA 3V4PH 4NFBA 3P77B 1MCPH 3K4DA 1RIHH 3O4LE 4KVCL 4MAUL 2CR6A 3VG0L 4HFUH 4ZTOL 1HHGA 3HC3H 5C09E 1G84A 4K3JL 4ONOA 1YEDA 3U82B 3ULSB 3DO3A 4P9MH 3GKZA 4Z7WF 3KPLA 5BOPA 1AKJD 4X6CF 2Z31C 4PJBE 3AS3A 3IXTB 3LB6D 4Y5VA 4OZ4A 4MXWH 1K8IA 4B53A 4D0DA 2W60A 4ZMAT 4L4JA 1IGTA 5C08E 3RAJH 5KSAC 5SV4A 4QHKJ 4U1NB 3STZB 4LHUG 1DLFL 1LP9F 3T77B 1IAKA 4FQ2H 1FG2A 4M00A 4MQTB 4PP2A 2RIKA 3LAFA 4MNHB 4PP1C 3RP1A 1MQ8A 3MNWB 3EJZD 1F3DH 5DRNA 5GISL 4DVBB 1QFHA 1NBQA 3IDGB 1M7IB 4B7IA 2ADGA 1NKOA 4W81A 1B0GA 2NX5E 4D9RE 3FCTA 5FDWB 4ZD3H 5E6IB 4ETQB 3IAQA 4PV9B 5ISZD 4U6YB 2HTLD 2OS7A 1T20A 4UNTA 3IXTA 4ETQA 4C56E 5L8JB 3QIUD 4OIBA 5GS2H 1EMTH 4Z77A 3KR3H 3SGKA 4WRLA 2DWEA 4QXTA 3ILQD 1H8SA 1N0LA 5IB3A 4GW1A 5IG7A 1J0JA 5HI4C 3BKYH 4O4YH 2Y07L 4ZFZA 3DMMD 3QPQC 5I75B 1T03L 1KIQB 4BZ2H 2FZ3A 3LQMA 4OLYL 2HJKB 1JHTA 1IGMH 5FK9B 1NFKA 2F19H 3FQUB 3IDNA 5FB8A 1HHHB 5HHMD 1MCDA 3VXMA 4YE4H 5EFIA 3D0LA 4LAQH 5I71C 4K71C 2GITA 5F9JB 3O9WA 1K2DA 4PV9A 4LPXA 3WJJA 1HXMA 1S9VB 1DVFA 5GQBA 4K7FA 1DVFB 2VH5H 5D1ZC 3B9EA 2GK0A 1C08B 1L7IL 2RAMA 1KNOB 4P4RA 1ZA6B 1RVFH 4GRLD 2GT9A 3OTTA 1SBBA 3G5VB 2KUTA 4AEIL 2GW5A 5D5MF 3RWHB 4FRWA 4ALAL 3CFCL 4URTB 1ORSB 2BNQE 4LKCB 1DBAH 5C8JA 3ZSSA 3P11H 3BIKB 3ULUD 4OFPA 5ICYB 3PWUA 1S7TB 5FIEA 3QXVA 4CDGC 4NQDB 5DRWB 1PG7L 5EUKB 3QEGL 1IFHL 1QA9A 1LO5B 1D9KD 5JHDD 5HHOD 3ZDZE 3DPBA 2R2HA 4NIKB 5L9DL 2Z91A 4ONHA 3QFJB 4OQTL 5DUPL 1LNUB 5DQ9A 4E41D 1I8LC 4HUUA 3ARGA 4JM2D 5IMKA 1S7SA 4WFHD 4EEEA 2MHAB 1TQBB 1AXTL 4QRTA 1OSPH 3MCKA 4NZRH 5TGBB 1BOGA 3KPQA 3PE9A 4OB5H 4M4PA 2ZUVA 3PF2A 3OXSB 2Q8AL 3JSSA 1RJYB 5K9KA 5KVGH 5IQ7L 1CK0H 4G6JH 3CVIL 5L8LB 1VGEH 4OZHE 3SDYH 5TE7L 2R0WL 1JPST 5HVFB 3DVFA 2IANB 1AD0A 3QPQD 5I15L 1B88A 3I3DA 1NJ9A 4W4OA 1YN6A 2NW2B 5FKAA 1G7PB 1OPGH 5EOTA 3HNSL 3RGVC 4GW1B 5GRJL 5IG7B 5DQ9B 2F74B 4N0RA 3L3JA 3VD5A 4YDIL 3I50L 3VXMD 5C0JB 3EOBB 3NFNA 4JQXA 1LEGA 3MLXH 4LPVA 5F9WB 5L7XL 3DGGA 3HI5L 1MFCL 4XCCL 2EE2A 4HHAA 2D7TH 2X7LB 4XVTL 4H25B 3D0LB 4LOUD 1DFBH 4RGNC 5E8PA 3ULVD 5H2BB 2DQEL 2H41A 1LEIB 1KLGA 2GK2A 1J8KA 3LCYA 1J11A 1EHLH 4R26L 4NNPH 2QQQA 5E2UL 4KPHH 4ELKB 1D7FA 2CKNA 4OUUB 1LK3H 5D7LE 1U8JB 3PJSA 5DHYA 1G7LA 3TBSA 1EFXB 4RAHA 1F4AA 4O2CA 3OJ2C 4F7MA 1ZXQA 4GAFB 2EDKA 3ARGC 1BEYL 4X5LA 3NCYP 3O11B 5FUCC 4GG6A 1P1ZB 2RJMA 3BO8B 4PJEB 5C08B 5KVFH 5GGVH 3GMRA 3MBXH 1CD0A 3T3PE 1RURH 3K8KA 2MTPA 3MLUL 1MFDH 1TPXC 3NCFB 5CGMA 5D8JL 1CIUA 3PWJB 1NGXA 1QSVA 3UZQA 4N0FB 1TNNA 4JVUA 5C0CD 3P9MB 4MX7A 3WDHA 3S9DB 3GSRA 4KVNH 3FT2B 4Z95L 1Z5LB 2ZCLL 1GPOH 3PHSA 4AMKL 1HDMB 5DJCB 3IDUA 1TZGL 3D2UD 3HAEA 1CE1L 4FQHA 5F89A 2YPLB 1H3PH 3G5VA 4TUKL 4CKVX 3QA3A 1KTLB 3PWNB 3H9SB 4M93C 4OT1H 4LLDA 4U7SA 2QBWA 4FXGB 3TO2A 3L7FA 1UH3A 5FECB 2XTJC 1NGPL 2BNQD 1BBJA 4KRNA 1A7OL 1ZVYA 5EBWB 1J12A 3V4VH 2FATH 3QDMB 4DN4L 4LHQB 5CJOL 3PDOA 1V5JA 3INUL 3MJ6A 2VIRA 2A0LC 1JGDB 4RMQA 3VJ6A 1DDHA 3CUPA 3C6SA 1CDUA 2K7PA 4IDLA 2A9MH 3PGCB 3WIHL 1I3RB 3VFWB 2C3XA 1S8DB 4FFZL 2C3HA 2FB4H 4NKOB 5C07E 4MJIB 5IHUL 1EAJA 2XWJB 4H26A 1BZQK 1JZ4A 1ZGLM 2GUOA 4LLMA 1BIIB 4XCEB 4M5ZH 2KPNA 1J87A 5K9JH 1RIVL 3HNVL 2CPCA 5IVZA 3BE1H 4PJHB 2Z93A 4PLKC 3EHBC 2D7MA 1L4IA 1A4KB 4L3ED 1JBJA 1UB6B 1BF2A 3O11A 4GG6B 3ZKQD 5C0BA 4Z7WA 1AKJA 1RZJC 4YXLH 4LCYB 3C8KA 1D5ZA 1I9EA 4HWNA 5HHPB 4JFHE 5HDBF 2ICEB 1I7TA 4FA8A 2VDNL 1GZQA 1DUYA 5GGQL 3ARFA 4U6TA 3K4AA 4WFED 1KFAL 1LEKB 1SYVA 3QXUA 2OXHA 1FFNB 5D1QB 2DIAA 5EULV 5SX4I 2AJ3A 1N5YH 2BSRB 1JI1A 2QTEA 4X4XB 3N85L 4HS3A 3W9DB 3VXRE 5ILTH 3VD7A 5GZOD 1PYWA 2AGJL 4JRYE 4PGEB 2BNUB 1MFBH 2F53A 1JL8A 2PW1B 4JFZL 5F88B 1LO3L 4X7DC 3PV6A 1MY7A 3BQUA 4R4FH 3LPFA 4J3OC 4GRMB 3PDGA 5CBAB 1I8LA 3GMQA 2AQ3A 3EO0B 1N6QH 5B21A 2XZCL 3EO0A 5IK3B 5F6HI 5BJTB 4S1RH 4DVRH 1MQKL 5C0EA 3VI4F 1MIMH 2A6DA 4JPIB 4RMRA 3K80A 1S7WB 4I0KA 2N56A 4XB8A 3OR6A 4XVUD 4D94A 3C87A 5LBSH 2PO6A 4LSRH 1QNZL 1F42A 1WFOA 2BVUA 4S1QH 4XCYA 4ORGA 2W38A 4NO0A 3VXOA 3LSOB 4F9PC 1UKTA 4MD4B 2IF7A 4X80H 5GRZA 5C0AB 1L7TH 4NCC1 1ZLSL 1ZHNA 3E1F1 3O41B 3NPSC 1M4KA 4NNXA 3CSBA 5I2IB 5I2IA 4U0RB 2VNCA 4Z7QE 5D6CA 3TM6A 4PJHA 4OKVA 3LPWA 4ZDHA 1A1OB 1NKRA 2DTSA 1W8OA 3EHBD 3S6CA 4EI5B 1W0VA 1MFBL 1Y6KR 4C4KT 2V2XA 3QCVL 3DURB 5E8OB 1KTRL 4O51B 3CH1A 1QKZL 1CZ8L 4JFOB 5FO7A 5B8CC 2X4NB 2BCKB 1FO0B 1HI6B 5CIPA 5ERWB 1YC7A 3ARUA 5MENB 4R4ND 2CUMA 5EA0L 4OZIB 5DMIH 4R2GC 1VEPA 3L3OB 1MRCH 4LCYA 4FZ8L 4LSDA 3KG5A 4LL9A 4PRIB 3RL2A 1SJEB 1A6PA 3AMLA 4AQOA 12E8H 1CL7H 3FQTB 5IB2A 5D8JH 4G6ML 4GKNA 5D6DC 3WNKA 3ZKNC 3WNMA 1MJUL 3MGTB 2R1WA 3L3DB 2VDPL 5AWNH 1ZLUK 1FZKB 4XPBH 4N8PA 1EXUB 5H2BA 3FAWA 4PJGA 3AUVA 5HYJB 1H5BB 1JNLL 4H20H 1YEGH 2A9ML 3WIHH 3H9SE 4KKAD 4UT7L 1HZHH 1G0YR 2FEEI 4CADB 4GXUN 1Z9LA 4WWKB 4KPHL 2NY3D 3O2DH 4D9LH 4MQXC 2Z9TA 1YECL 5IW6B 3UTTE 1B9ZA 2OR7A 4L1HA 4WO4D 4CNIA 4V1DE 1MFCH 4DKAA 4AL8H 3LKQA 4WUUD 4G43A 5IW1A 3O4OC 2HT4D 1MF2H 1U8NA 2CSPA 3QNZA 2DRUA 4JFFB 4CW1A 4UIMA 5ANMA 4F58H 3Q3GB 5I0ZA 2NZIA 4OD2A 3SKMB 3I3BA 1O7VA 3ISWA 3SDXA 3DROB 5DFVD 3UTQA 2YD3A 4FQHB 4XPFL 2NXYC 5FYKL 4KRLB 1P84J 1T7ZA 2ZWLT 4LHUA 1CDBA 1LNUA 2ZCLH 3LKNB 4AMKH 5J7CC 2EDHA 2WBJB 5GGUA 1KJ2B 4G6JL 5FFLA 4JY5H 2J8UB 2Z31D 4OFVA 2QSCH 5DMJB 5D2NE 4FTVD 1PG7W 1I4FB 3LKPB 4G80B 2R8SH 3VG9C 4G6FB 1P4IH 4HQQL 3DXAB 2HT3D 5F7UA 4YAQA 2BY1A 1TIUA 4UQ2B 4MQXD 3OKOA 4TYUA 4ISVB 3ULSA 4UB0L 3BDYH 3V6OC 3GSUA 5GS1A 4O58H 4C4KO 3PQYB 1D3CA 1G6RB 5IEKA 2V2TA 4UILL 5KOVC 2DYPD 3QJHA 1S7VB 4E42A 2X70A 1UXWA 5L9DH 3JBG7 2PCPA 2EKSB 1J7VR 3N1MC 1VFOA 4U0QB 1DDHB 3CUPB 2XQYG 4W6XB 2FJGB 4K94L 4NKMB 3MLWH 5T1LB 4HJGA 1HHKB 3IT8D 4GRWE 1JYVA 4Z0BH 3TPUB 3EAKA 3TESA 1YNTB 3BZEB 3DETD 4P5MB 3KYOA 4XWGL 4QF1B 3MLXL 2GKIA 1J8HD 3CFCH 3QIUA 4PRNB 4X7TB 4KMQA 2CXGA 2QV2A 3C5ZC 5TQ0L 4PUBL 5GRJH 5EIIB 3VFOA 4YHYC 3QRGH 3H42H 2AXFA 3SE8H 2XKUA 4CVZB 3DV4B 3TVMB 1KELH 4BH8B 2CH8A 3PJSB 5DO2D 2C1PB 1U91A 2VXQH 4MJ6A 3ZE1E 1YYLH 5KS9E 3SDYL 5EUKA 3KLHD 1PG7X 2YK1H 5JXAH 4QYOB 4YO0A 3OAUL 1AGEB 5BQ7A 3AVEA 3BX7C 2WW8A 4YDJA 3V5DB 4X7SH 2EKJA 1TVDA 5EO1A 3NACH 5C09D 4QRPD 3BPNB 3RWHA 3JZ7A 4BFIA 3IYLW 2BVPA 2LU7A 1RIUL 4OZFA 3V7AG 3KPRB 4GFTB 1U8IA 3PWLA 2O61B 2IBZX 4OCRL 4Y4KA 1KC5H 3HG1B 4P2CG 4NP4L 1NDMA 5HDQL 1PG7H 1JNNH 5FGBC 3JWDL 2CD0A 3HTLX 1GZPA 1A14L 3S35L 4LLDB 3H7LA 5TH2A 2AJYL 4ODSL 1IGJB 3LEXB 3O9WC 1LO4H 1AGEA 4Y19A 1IGJA 3LEXA 4U1NA 3STZA 3VFMA 2OTPA 4AM0A 5F7DB 4CDHA 3OAUH 3QUXB 4M62H 1CFNA 1XIWD 4OM0H 1CFNB 5JW4N 5L0QC 2A6JA 5AD0B 5IEKB 4Y2DA 1J1PH 1CG9B 3QUZA 3QPXH 3NIFF 2BVPB 4RISH 3T2PA 5J1SC 5DQJB 5DHVA 5FGSA 3G08A 5E6IA 4IRSD 1V7MH 2X89D 3NZ8B 5M7QA 1FC1A 4Y16D 3C09C 3ARDA 3T2OA 4FZEH 3MRIA 3LZFH 1NCDH 4OD3H 3QQNA 1CLCA 4D9RD 3VG0H 3RVVC 4HKJA 2E3VA 4UINH 1G7LB 2OP4H 1OTUC 4QWWC 1T1ZB 2DQIL 2D9CA 4KKNA 2XG4A 1CQYA 1RUMH 4MNHA 1NCUA 2YR3A 3MQIA 4WY7H 2ITDB 3D25A 3REWB 4JCMA 4IRZL 4OLWL 4MZ3A 4G9FB 5GZNC 3AREA 1Z2KA 1I1CA 2ZUWA 4BFGA 4HBQA 5EU6D 4Z7UA 4TN9A 5GGRB 3PGDA 2WUBH 4HH9A 4TQEH 3BDYL 1IM3B 4YQXL 4XP9L 4KKCD 4M7KH 4EI5C 4UQ3A 5C09A 1JTTA 1A9EB 2FLBT 2NXZD 1ZA6A 5F1IB 1EHAA 3AROA 1QR1A 4WW2A 4MB5A 5IBTL 1IT9H 2NX5B 3ME0A 4LVOC 3ARVA 5EUOA 3RZCC 3CSYB 4LSTH 1WIPA 2YHGA 1KSRA 2YD8A 5FB8B 4F7TA 1U8NB 3GBMH 4JN1H 2CIKB 2Y36L 1XF3A 3OKEA 5MEQA 3QULB 5T1KB 2VYRE 1NCAL 1IEBB 2I26N 2NY3C 4M7ZB 2EXYC 4YBLB 4BELD 5I18L 3DIFA 4YPJA 4IRJB 3HE6C 3D3VB 3MV11 1YMHB 2QQLL 3FMGH 2Z91B 3S8WA 1A6WH 5ESVB 1IKFH 5HHOE 5BS0E 4U1GC 3S96A 4HIIA 1HHJA 4D9LL 2Z8WC 4YXHH 4XXDB 4M6MH 4KROB 3LQAH 4NO2A 3CJJA 4PJGF 2WWKO 3IXAB 1XF4B 2X1PA 4PJ9A 2EO1A 3P4OB 3VXSD 5IFAL 5HHXL 4KGJA 3RBSA 2R0ZL 4M1DH 4NM4H 1VSCA 3RTQA 4YHKL 4Y4FC 3DO7A 4P4KC 5E8OA 3DXAA 3UC0H 4WCYL 1F90L 4KRMB 4WJ5B 5FO8A 3QHZL 4RGMB 2P48B 3DYPA 3WFCH 3MJ8A 1KJ3H 1CL7L 2EDNA 4N0YL 1SYVB 1LEKA 4JO4H 4TRPL 3RL1B 5DURD 3W5MA 2AV1B 1NGQH 2PXYD 3U7WH 1CLZL 3IKKA 2LTQC 3B2UC 1UCBH 4G6KH 4J6RH 1LK2B 4W70A 4PJDF 5ADOL 1IC5L 4APQC 1MAKA 2W0PA 3VD4A 3C9NA 2WUCH 1LE5B 1QSEE 3VFPB 1D6EB 2YD9A 2Y5EA 2BJML 4QRUA 5I19H 1D5IL 4W4OC 2H6PA 3RUGF 4OCYL 5ALCH 4YHPB 2MNUA 1BJ8A 5SX5H 4HWBA 4IS6A 5C0BD 3JV4B 3UBXG 2VLKB 4OLUH 5B38B 5TPWH 5INDB 3I6KA 5ICZB 2OZ4L 5HI5C 1EO8H 5EPMA 3HZKB 5D7LD 1MCBA 1IGCL 4DGYH 4KK6C 3BYYA 1G1YA 43CAA 1YMHA 2YD7A 2IANE 4WI8A 3Q6FB 1DBBH 2IAMC 2PW1A 4ODHL 4NQCD 4LAJH 1JGEB 3IS0X 1TTGA 1VFBB 5AAWA 2VXUH 1NC2D 4CJ0A 5BV7C 1JF1B 5I9QB 4MLSA 5GRUL 4G5ZH 1F6LL 2BSRA 2OTWB 5F96H 1L6XA 4KK9C 4QEGA 1BD2E 4ONFH 2YPKA 2PF6A 5C0EB 4OKVB 1KB5H 4P3CL 5DK2B 4OGAD 3O45A 1HEZB 1QBAA 4Z5RB 4JY6B 4G7VH 3VH8A 5EOCJ 2OL3H 1FORH 1N8ZA 4HS8L 3TH2T 5BRZA 1KPUA 3C5SA 3FONA 1HYRC 1WBZB 4PV8B 4K7PL 4RZCB 1JE6A 2KZ1B 3WO4B 4BQ9A 1F00I 5DDHA 1XMWA 4PRDB 1Y6MR 4JFZH 1QTYT 2X1QA 4FG6D 4CRPA 3OJDB 4NO0D 2JCCF 2JJSA 1RJZB 5BVPH 4UIKH 4PTTA 1LO2L 2PYEE 1DCLA 1N5YL 3RPIA 5ACMA 2ITCB 1DLHA 2R15A 5JNYA 1TZHB 4JRYA 4PJXF 2BNRB 5HGAA 4Z5RA 3BZFA 3STBA 2HFGH 1ZHLB 3O6LH 5EOCH 4ZFFA 5DJ0A 1MCWM 5L2JA 4LFHG 4HK3J 3O3AB 3IJYA 3RWFA 1NLDL 3WSQH 4YHPA 5TDPA 5C0FA 2NZ9C 1Q9KA 2C1OA 3OXRB 1A1NA 1I8MB 1BFTA 4PV8A 4U7MA 5KSBE 4X6EB 3GK8L 2N7BA 15C8H 4JANA 5GRVL 1JNHB 4GG6E 3O3EB 4KI1A 2HTKD 4JJ5A 3A6OA 3HFML 5J1AB 4FFZH 3O6FA 2IGFL 3X13A 1RMFL 4TNWF 2ICEA 5HGHB 5DVOA 1QLFA 1UA6L 1C16B 4WUKH 5D1XD 2XTJD 1BD2A 5J3HC 1ED3A 4KK8D 4LPUA 5LGKA 1GGIH 4DN4H 5CWSB 2NCMA 1FLTX 5A1AA 3DRQB 2ZJSH 4XX1G 3HS0B 1X5YA 5KW9L 2I24N 2X89A 3L3HA 3T0XA 4EVNB 3ARDD 1CFBA 2J8UF 5DJ2B 4RAUA 1BFOB 2ED9A 5JPNA 4ZPTA 1Q9OB 1T89A 1IQDA 3ULVC 3WN5A 3G9AB 4RGND 1YJDL 5F97E 3VRIB 5E8NA 4CMMB 3A6CH 5FEBA 3JV5A 1NMBL 1G9MC 5CJQH 1A3RL 2FL5B 3ORJA 43CAB 4GUPA 2CMRL 3OKEB 2IPKB 5D7JB 4U1IA 2EDWA 2X41A 5ESVA 1OQOA 2GY7B 2E7HA 1P7QB 1J0ZA 3HI6H 5I1LA 5GPRA 4XXCC 1T04B 3D3VA 2DLGA 2Q86B 1P9MC 4JO2H 3MLZH 4ZOAA 2B1HL 1FL3B 1RHFA 5AD0A 4JFXB 2LFGA 2R0LH 4JGMA 1E4WH 1Z0NA 3FN0H 1L0YA 4LMQI 3U30B 3L3GA 2ED8A 5HYSB 1DEEA 2I5YL 4N8CH 5D2NC 4GRLB 2NXYD 3H9SA 1P4BL 4RIRA 5I71B 1SJVA 2QSVA 2BSSA 4LCWA 5FYLL 3HG1A 1D5BA 2RCSL 5C0GA 1F2QA 4Z9KB 2ZSWA 5IF0A 3IDYB 3HI5H 4PJCE 5EOQH 4LLWB 5I1KH 3QJFA 3C08L 2YMXH 3J7HA 3IFPB 2VLJB 3MJ8B 2VKWA 4WTXA 2V5TA 3UJJL 2CDEA 4KQ3L 1KXTB 4PB9H 2DQHL 3H2WA 2HMIC 3MLVH 4QHNB 1NGZB 5BQ7B 3FB6B 2LV4A 2ZUSA 2ZG3A 2EEAA 1HINH 4AQ1B 3VG9B 4RRPG 3MODL 3O6KL 2F54A 3E3QC 1JPGB 2AEWA 5FYKU 3U9PL 3D1MC 4P9HL 3T1FB 3G6DL 1XF2A 3NZ8A 5A2KH 1RHHA 4HIEA 5E8EA 2AXFB 4LSQH 4RBPH 3Q6GH 1TETL 1BVLA 5L2KA 3CFDA 4X6DE 3SE9H 2WAHA 1JHKL 3KPRA 4X9HA 1U8KB 3QI9B 1MPAH 2EYSA 3FOLA 2M1KA 5T5FH 3HE6A 1FAIH 2XQBL 2CIIA 1FIEA 2PNDA 2PTTA 2XQYK 3H9HA 4OZHB 4ELMB 4MA1C 3RI5K 1S9WB 4IHOB 2DMKA 2LE9A 2LQRA 3JTSB 2B2XL 3B6SA 4BH7A 4KDVA 5C9JB 3BKJH 5IW1B 2DBLH 3VXMB 4XNZB 2H8PA 3IDMB 3UBXB 3W9EB 4W6WB 5CZKA 4N1CA 2DQDL 3AGVA 3RWJA 3P11L 4G8GE 3L5WB 3AS2A 3GJEA 4WWKC 1SJHA 4LCIL 3QYCA 2NMSA 1A6AA 4LRNL 4DGIL 2G5BA 1P4LA 1JMXA 4L4TB 1IE5A 4KGLA 4NQEB 4NQEA 3T3ME 32C2A 4XP1H 1T66C 2E7LC 3MRIB 3MRHA 2VLRE 3IS1X 3L6FB 3LEVL 1GGTA 2HYMA 4WFFE 3WLWD 4C56B 2NNAB 3MRKA 3DMMC 2FWOA 3ECBA 1DBJH 5DD1H 4P2YA 1T4KA 4IEFB 5HHQB 3MRPA 3VFGH 3EFDL 3KJ4B 1CFSA 1T7XA 3UTTB 3ARRA 1MHEA 1BJMA 1F02I 3QWOA 1H3TA 4F3FA 1RZFL 1TETH 3NN8A 3BKYL 4PREB 3QFJA 1AP2B 3K2UH 3SKOB 3U4EA 3OAZH 5ACZA 1ZLWH 3QDJD 1F2XK 4GH7B 4PRPE 2DBLL 4QF1A 2NYYC 4YHOH 3MLVL 3SHSA 2BC4B 2EE6A 2X2YA 3BP5A 3GB7B 1VGKA 4JREB 5J1AA 1NJ9B 2OMNA 3ARFC 1YNKL 4BSVA 3TVMA 4G3YL 4M5YH 1OB1A 4HJJH 2XY1A 3CC5B 3MRNA 4JN2A 1A6ZA 2GITB 3BAEL 4KI5E 4MJ4A 1F4WL 1GYAA 5I6XC 2HFEA 3PV7A 5I1AA 4G8GA 3FB8A 1TJGL 1ETZA 3KPNA 4RSVA 1I1AC 2HT2D 3TT3H 5HDOA 3FB6A 3FHQA 1EJ6A 4IBLT 3UCRA 3WN5C 3AM8A 5D70L 1JRHI 1P7HL 4K9EL 1E4WL 2VLMD 4CMHC 4WFHE 4OAWB 1HINL 3ABZA 4QRRD 1ZLVH 3RWIA 3D39E 3SEPA 3WS3B 2B1HH 2CGRH 2FR4B 1T0MB 2VDOH 3MJ7B 2GTWB 1CFQB 2WSKA 4XGZA 1V3KA 5D7LB 4OGXL 6FABH 4XVJH 3KDMA 1TVBB 4BJLA 1KPRA 5EORL 3T2QA 2IMNA 1RZIA 1U8OB 3NAAH 4MA3B 1HQRA 5AZ2H 1N0XH 5KANG 4LKCA 5DR5H 5AYQA 3CK0L 2D4DA 1NL0L 4C83B 1RV6X 4YXKH 4N8CL 2NW3A 5E6ZA 4DKEL 5FYJU 5I9QC 5MERA 3T8XB 5SWZE 1ZHNB 3MLSH 2Q7NA 1FDLL 2YD4A 1C8PA 1Z0MA 5C3TA 3O0RL 5KW9H 3BESR 3UTZB 4H1LH 3SCMC 2AK1L 3G5ZB 1F4HA 4MDIB 3RKDC 4ODXA 4IOFD 4OI7A 1CICD 5I73C 3DHMA 3FQNB 4WHYG 5E99L 3CD4A 3BZ4A 3LQZB 3NFSL 4HEPG 3U0TB 1NFIB 1IC7L 2M26A 4KUCD 5EZLA 4FHBD 4PJAB 2OM5A 1NMBH 3A6CL 4OLVH 5INDA 4NHUA 1CR9L 3WUWA 1WZKA 5CKAA 3I9GH 3S36X 4ZNCD 5LQBH 3D0VA 5HGGS 3HFMH 2IJ0C 1ACZA 1Q0YL 1EO7A 2HT2C 1DN2A 4N5UA 2JJWA 2M8XA 3LKOA 5JA9A 4JHBA 4G8EA 3MOBH 1FFQA 4AIXA 3VWJB 3RWEA 1LE5A 5IB2B 2ICCA 1UZ8A 1YMMD 2CDGA 5BMFL 1C12B 1MHHA 3MOAH 4M61B 4XI5D 4WV1A 3NCJH 1YEHL 3EYFB 4Q2ZA 2P5EB 5FF6B 1FO0L 2X42A 3VXUA 5CD3A 3V5HB 4IMLB 2QR0B 5DUBA 3LIZH 5DYOA 4LGPB 3D6GA 3LKRA 2FIKA 2YEZB 5D5MA 5GSVA 3U0WH 1SHMA 3GMQB 3C8KB 4AIZB 4HULB 1MREL 4YH6A 3D5OF 2RQ8A 3OPZH 5GJSH 4O00A 1DN0A 5DHXB 1M71A 3OKLA 1MI5A 3BJLA 3FT3B 5ID0B 3GSRB 4EUPG 1PGRB 1A7PH 4GW4B 4A6YA 2FX7H 5T3ZE