3OKGA

Crystal structure of hsds subunit from thermoanaerobacter tengcongensis
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
398
structure length
390
Chain Sequence
MTEGPYKLPPGWRWVRLGEVCLPTERRDPTKNPSTYFVYVDISAIDSTVGKIVSPKEILGQHAPSRARKVIRSGDVIFATTRPYLKNIALVPPDLDGQICSTGFCVIRANREFAEPEFLFHLCRSDFITNQLTASKMRGTSYPAVTDNDVYNTLIPLPPLEEQRRIVAKVEALMERVREVRRLRAEAQKDTELLMQTALAEVFPHPGADLPPGWRWVRLGEVCDIIMGQSPPSSTYNFEGNGLPFFQGKADFGDLHPTPRIWCSAPQKVARPGDVLISVRAPVGSTNVANLACCIGRGLAALRPRDSLERFWLLYYLHYLEPELSKAITKKDLQNVFIPLPPLEEQRRIVAYLDQIQQQVAALKRAQAETEAELKRLEQAILDKAFRGDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HsdS subunit from Thermoanaerobacter tengcongensis sheds lights on mechanism of dynamic opening and closing of type I methyltransferase
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Dna binding protein
molecule keywords Restriction endonuclease S subunits
total genus 119
structure length 390
sequence length 398
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01420 Methylase_S Type I restriction modification DNA specificity domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.220.20 Alpha Beta Alpha-Beta Complex Adenine-n6-DNA-methyltransferase TaqI; Chain A, domain 2 DNA methylase specificity domains 3okgA02
3.90.220.20 Alpha Beta Alpha-Beta Complex Adenine-n6-DNA-methyltransferase TaqI; Chain A, domain 2 DNA methylase specificity domains 3okgA01
1YF2A 1YDXA 3OKGA
chains in the Genus database with same CATH superfamily
1YF2A 2IH2A 1AQJA 2NP7A 1G38A 2IBTA 1AQIA 2IH4A 2NP6A 3OKGA 2ADMA 2IBSA 2JG3A 2IH5A 1YDXA
chains in the Genus database with same CATH topology
1YF2A 1YDXA 3OKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YF2 A;  1YDX A;  3OKG A; 
#chains in the Genus database with same CATH topology
 1YF2 A;  2IH2 A;  1AQJ A;  2NP7 A;  1G38 A;  2IBT A;  1AQI A;  2IH4 A;  2NP6 A;  3OKG A;  2ADM A;  2IBS A;  2JG3 A;  2IH5 A;  1YDX A; 
#chains in the Genus database with same CATH homology
 1YF2 A;  1YDX A;  3OKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...