3OKLB

Crystal structure of s25-39 in complex with kdo(2.8)kdo
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
EVKLVESGGGLVQPGGSLRLACATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQSSLYLQMNTLRAEDSATYYCARDHDGYYERFAYWGQGTLVTVSAAATTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSTGVHTFPAVLSSDLYTLTSSVTVPSKTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords S25-39 Fab (IgG1k) light chain
total genus 44
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2010-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oklB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oklB01
2XFXA 1I8LA 1QO3B 4HUUB 1OP5H 3EYOA 2ED7A 4URTB 3D9AL 5CEZH 4OF6A 1JMZA 1T3FA 4YEFA 1DVFB 5F7MC 2GUOA 4FRWA 2D31A 2R1YB 3A0OA 4YDJB 4MMXC 4Y16D 2A0LC 1MCIA 3AB0B 4XNXL 3L95A 1LWRA 3ZHKA 1O7SA 2WAHA 5BZDB 5C09D 5DJAA 5HHME 3EYQD 4IOFD 1JNLH 3RU8H 1A7BA 3V4PH 1M7XA 3CFDA 2F58H 1N6VA 1A4KA 4XVJH 3B9KA 1SBSL 4ZTOL 1CIUA 1MCJA 4JFEA 4X4ME 1O5DT 3VG9C 2EKSA 4APQA 2UZYB 3VDBA 1EGJL 1IVLA 1CGVA 3DTXA 5DURB 2YA0A 3UTSB 1JNLL 4QKXB 3MV11 2H26B 4WY7H 4KJYA 4H88H 1BFOA 3FQUB 2A83A 4Z0XA 3WIHL 3EJJX 1A4JB 1YEJH 3CFKB 2FEEI 2VDLH 3GIZL 4LHUB 1S3KH 3LKQB 5CUSL 3VFPA 3KLSA 4LMQI 4JFDB 3WBDA 4HUVB 5CILL 5I1LB 4Y16C 2R2HB 3X3FL 1MCOH 5DRWB 3IU3B 2VXTL 1WIOA 3ZE0E 1MF2L 5JO5A 1VB9A 2VDLL 3H9SD 4O2CB 2FECI 1MSPA 1PLGH 3LQZB 5DJ2B 5T33H 3G9AB 4G9FB 5D5MB 2AXFA 5DFWH 3UROR 4LSSL 3KPLA 3X14A 1NMCC 5K9JH 4R7DA 5ECJE 5ID0A 3TFKC 3S36X 2VC2L 2C4FT 1IEBB 5HI4C 4PS4H 5DURD 1ITBB 4N0YH 4QXUH 5IHUL 3UBXG 4AG4L 2FB4H 1PEZA 5EZIH 1FFRA 4XNQA 4OJFL 4TQEH 1X5FA 5BW7C 1KNOB 3CC5B 5I17B 1V3JA 4HMDA 4MAYB 5T1KB 4YK4C 2FX9L 4U3CA 3FFCB 5DJ6B 3B2VH 1FO0L 3MA7A 4OFDA 5FCUH 5SWSE 1CE6B 5C0JA 4JRYA 1F11B 1HSAB 4WWKA 1MCNA 3TGXA 4Q74A 3U46B 1FVCA 2YD2A 4OCLC 3CDYA 4X5LA 3BD5A 3DECA 3LDBC 2WM0A 4N68A 4Z7WB 1TPXB 4OLZL 4HW6A 5JDSB 4ZUSA 3DSFH 4NQCB 4JPWH 5CCKH 4YHLL 3HZVB 1EEQA 2X4TA 5FYKD 4QRRD 2X1QA 4ZODA 2VE6B 5HI4D 1XF3B 4OD2A 4XCCL 2Q7NA 1OTTD 4O5LH 4E9LA 2B20A 4U6XB 2OJZL 5BV7B 4TTGA 4NKDA 1NLDH 3H7LA 5DRZA 1IQDA 2OS7A 1QYGL 1Z9MA 3GRWL 5C0CE 2QEJA 1IGMH 2FBJL 3R8BB 3H8NA 1KBGL 4JRXD 5E8DH 4P9HC 5EZLA 3PGDA 4OZFA 1NUDA 4LSRH 2APVA 4MA3B 2W0LA 3OZ9L 3FFCA 5GGSA 3BW9A 5KZCB 1RAMA 5JHDA 1WWBX 5T1MA 1OW0A 2WP3T 2NY5C 3BT2L 3E6FB 3RL1A 2VN7A 3K0WA 4G9DB 2XTJC 3GM8A 4AEHL 3VD4A 3U6RB 3EKCA 2FIKB 3HI6L 5IBLD 4LIQH 2WIMA 3BQUA 5KSVB 3DO3A 3KYKH 4EOWH 3E1F1 4PJDE 5DQ9B 3LQAL 2AK4B 4KY1H 3QUZA 9CGTA 3FONA 4LIQL 4W4OA 3AS1A 3INUL 4G3YH 5GRYA 1JGDB 4GRWB 3MUJA 3RWCB 5ILTH 1VDGA 3L3GB 3SKNB 1NGXA 4FFWC 3DMMB 4POZC 5D7SH 5CMAB 1QO3A 3LS4L 3BKMH 2H1PH 4WUKL 2ZUXA 1KC5H 3HI5H 4ZUUB 5C0GB 4ZUVB 2EIBA 1C7TA 2JIXD 3CDCA 3TA3B 1RZKH 2JB6B 4R0LC 4WUUA 5H35A 1U92A 2R69H 5LCVL 1BLNB 1QRKA 3IU4L 1MCQA 3V0WL 1ZVSB 3VXUE 2OMBA 1G7HA 1MLBB 1WFUA 3VFSB 2DQHL 5GSRB 3JWDC 1RZKL 3GEWB 4DGYL 2PYFB 4O51A 3HZKA 3RBGA 1REIA 3VFWB 5SWQB 2XG5A 4K7PY 4M6NH 1P6AB 5EN2A 4LVNC 4P3CL 5D7SL 1G9MH 4CN6A 4XNUH 5I6XB 2NY1B 5DWUH 1RK0B 2IGFL 3OJDB 3P9MA 3CSYB 1NDMA 3C5ZA 4LLYA 1IGJB 1MFNA 5DVMA 1KNOA 2CJUH 1N2RB 3MV8D 1ERNA 1I9EA 4H8WL 3F12B 4Y4FA 3AAZA 2AP2A 2AJYH 2B4CH 2EKJA 5C86A 5IW6A 1LDPH 4XCEA 2BNRA 4CGTA 4XNUL 3K1DA 1OPGH 4NQED 2PTTA 4AEHH 5F7EL 1JRHI 3WFCH 2BVEA 4GG8B 2DLFL 4HAFA 4X7CC 4NKIH 4F7PB 3OG4B 4P2RD 4HAGA 1ETZA 4LHUD 1CE1H 3OKEA 4QF1B 1I7TB 2GUOB 4M1CD 1QLRB 2XICA 1R6VA 3KYOB 3W11C 1A7PL 3LRSB 3RNKA 4XVUC 1UB5A 2DQCL 3IDNA 1F8TL 1AE6H 2NXZC 4U1IB 1RFDH 1JGUH 1N0LA 1F6AB 2L7JA 2W59A 2DM2A 5EUOF 4OCSH 4LNRB 4RGMC 4U1HA 4FFVD 4NQDB 3P9LB 1WT5C 4WGVB 4BK4A 5DJYB 5GIRB 1DBBH 1UWGL 2J8OA 3W9DB 1ZANH 4DTGH 5GIRA 4G7YL 3MA7B 3WMSA 5C0ND 1NCWH 1G7JA 1PSKL 2P5WE 1KG0A 4Q2ZB 1MLCB 4Y19D 5ESAA 1UM6L 1XEDA 1FO0H 5IFHL 1JP5A 3ZO0A 3WE6A 4TSCH 4IDJH 3T4AA 1WGOA 5D93B 2XRAL 5EUOE 3SCMA 3KPNB 1AP2A 1F2QA 3O2WH 1U2CA 1NMCB 3D39A 3MA9L 1H15A 4CADA 1XGRB 4YBQC 2YD1A 2PUQT 4L29A 4UZGA 3SCMC 1LO0L 5IFHH 3EO0B 2HKHL 4QGYA 3G5ZA 2XOTA 3KNBB 5ESVA 2APWA 1U3HA 5I8KL 4PV8A 1MCWM 1UH4A 4AT6A 2C3GA 3KAAA 5D1XC 2I60H 2FYYA 4PJ5A 1F90H 3VFTB 3MRJB 3AY4A 4NKOB 5ITFA 4LHUA 5L2JA 3O6FA 4JO4H 3G08B 1RZGA 1FYTA 1HINH 1YY9C 4ZOAA 2EDBA 1WT5A 5E2UH 2VDPL 1TPXC 3D39D 5AWNH 4BKLB 3NZ8B 1QUNA 2IBGA 2A6JA 2DL2A 1AHWB 3Q1SH 1CFQA 4WHYG 3QQ9C 1A7RL 3SCMD 4M5YH 3MRGB 1OGAA 1QR1A 2GFBB 3MNVB 1RZ7L 4Y5VC 4E41B 5BV7C 4G8IA 3OKKA 4NUGH 2FH6A 3H3PL 1CE1L 2ORBH 3DUSB 5JW3L 1OSZB 1A6TA 1GC1L 3I6GB 4OIAA 5C3TA 5C0BA 4RMQA 2XTJE 3TT3L 2IPTL 4PJEE 1XMWA 1KJVA 4UILH 5BMFL 4I18B 1K3IA 1ACZA 4GKOA 2GYSA 5EZOH 1X5GA 1UACL 1F00I 3OKNB 5IF0A 4LIQE 3VMOA 1DQLL 1FGNL 4PREB 2ID5A 4DQOH 1MCLA 2HJLB 3G6JB 3RWHA 3OAYK 3U6RA 2PXYD 1EPFA 3O3DA 2DL9A 4P4RB 4JPVL 3OJVC 1U91B 3NN8A 1KTLA 1TENA 4LHQB 1AGEA 1BGXH 4X7SH 1D9KA 3QH3B 5D7IF 4M7LL 4BH8B 4EUPG 2R0WL 1QOKA 3TH2T 1RVFH 5ALBL 3LY6A 2HLAA 3BH8B 2WBWB 2V5YA 3RVXC 3L5JA 3J7HA 1PKOA 3PDOB 4Y2DB 1I8KB 5E56A 2VN4A 1KB5B 1I8IB 5E7FA 5T1LD 5DJ0B 2X4QB 3BWUC 2H1PL 2Z92B 3DGGB 3GMLA 3FAXA 4NQEB 2FWOA 2GIYA 1JE6A 4OCMC 3X3GH 2C7UB 4FP8L 5GRUH 3O9WC 4M7KL 3WL9A 4KKLD 4PJEF 4Y1AE 4N0RA 1DVFC 1R5IA 4JM2A 2QHLA 2VZOA 4KUZL 3GBMH 4KK8C 2FSEA 4X5XA 4G42B 1S78C 4RGNB 4S1SL 3ARBA 3GB7B 4PRHA 1AGEB 5L7XH 2XN9E 4H1LG 3S35H 5D96B 1IAKB 4W70A 1FFOA 2WIIA 3VDCA 4NKMB 5IB1B 1HHHB 3V5KB 1RZFL 4XRCB 1X9QA 1IGCL 3FN0H 5I1HH 1W72H 4JFFB 4HX1B 3LSOB 5EOQL 1AI1H 1RIUH 1U8HA 2CIKB 4M7LT 5IMLA 5AEAA 5HHMD 1FRGH 1A1NB 4UT6L 4Y5YC 3T77A 5CP7A 4M3KB 2WLYA 3H3KA 4XX1G 5DMIH 5AUMB 1AI1L 1RIUL 4H0IA 3DBXB 2AJXH 3TPUB 5J4MA 3GJFK 4NRXB 2BRRL 1DVFD 4U1NA 3RI5F 2Z4QA 3WFCL 2BX5A 1ZLVH 4Q6IA 2Z92A 4Z8FH 1JYWA 3D87B 5D1ZD 4JM2F 3S35L 2OI9B 3DPBA 1QBLH 2AJ3B 2XA8H 1Z9SA 3BP4A 1KXQE 4M48H 3ILPB 5C07B 1QFWH 1E4XH 2F53B 2CLRA 3U2SB 1FIGH 3BP5B 2VKWA 1G9ML 2DM4A 4QGTA 3MRLA 3QZWG 2ICCA 5I75C 1CFNA 5I1EL 1QRNE 3O3DB 4UNTA 1HNGA 3NPSB 5AG8A 4KVCH 3L1OL 5L2JB 3KYNB 1M71B 3G04A 3I02A 1G7QB 4NO2A 3MV9B 1OAYL 3LEXB 2H9GB 2A0LD 5IQ9B 4JFFA 1P4IL 1M71A 3PGFL 5DTFA 1J0HA 4F7MA 2ZUYA 3D2UB 3EYQC 5ALBH 3HC4L 3BKJH 1BECA 3GJFH 2EE6A 3DLQR 2QKIB 4YLQT 4HGMA 2A2QT 5DZNA 1KCRL 5C0BB 4NCC2 5ISZA 1XCQB 4LL9A 1AD9A 1JV5B 3D39B 3MGTB 1LVEA 1NGZB 1QSEB 4OV5A 4RAHA 5GRVK 3LKSB 3WKNA 1W8OA 1OOAA 4GS7B 2YD7A 4ZPTB 4R2GD 1T5WB 3RY5A 1QR4A 1QLEH 4MXQC 3ILPA 2X4SA 2LQRA 1C8PA 1ZGLP 1LO3H 3I6LD 5GRWA 2VITA 2ZUQC 4RISL 2H32B 3TN0C 1I9JL 3L3HB 2G60H 3ARYA 3O6FB 3C9NA 1RJZB 3C6LB 4P2RE 4PJFB 3KLAB 2J12B 3RP1A 3GUTA 1YQ2A 4P4RA 3CSPA 4HGWB 4K71C 3VMPA 2NY6D 3L3DB 2DS4A 5C07D 3O2VH 5DXWA 4D9LL 3B9KB 4KI5D 1KJ2B 3EOAB 1D9KB 4ZXBD 1B0GA 3TFKD 1IJ9A 3DO7B 3MQIA 1EVTC 3HMXH 3B9KC 3SE4A 3H9YA 3LSOA 5DHYA 4UTAL 3ZTNL 4RGOH 2XACC 4MWFB 4BFEA 1CLZL 4K9EH 4Y5VB 5FHAL 3BRGC 4JGMA 4MCYA 3NZHL 3PV6A 1IE5A 4J1UB 4IRJC 5IMOA 5I8CA 4HCRL 4F58L 4CRPA 4HULB 4U0QB 3EO1A 3CU7A 1CXFA 3TN0D 3FCTB 1IM3B 3MRHB 3PABA 1TVDA 4X5XB 1I8LC 4PJIE 4HBCH 5J9PA 4I18C 5BV7L 4BFIB 4PJXE 2X1XR 4Y4KC 2DLHA 3JV4B 5LQBH 3OKLA 5BQ7B 2NY6C 5DLML 3MBED 2EYRA 4YAQA 3BRFA 4Y4KB 4JFEE 3RIAF 5KG9A 5ALCH 1OB1B 3T0ED 5GGTH 5F7HA 1JF6A 1DDHB 1S9YA 3U4AA 4Q9BA 8FABB 1ONQA 4L3CA 4M62L 3RWEB 3F7RA 3ZDYF 3PNWB 4O9HL 1TQBC 2I9TA 1A7QH 5JHDE 2NLJA 3GSOA 3O4OC 2J8UB 3EZ8A 4XP9L 3REVA 4LSQL 3VXUD 5D70H 2APXA 1TJGH 1PG7H 3BUYA 3C60B 5HHVL 3CMOL 3P4LA 3O4LA 1R3IL 1RJYB 4MNQB 3QFDA 3PP4L 3IFNL 1HKLL 2DJUA 1L7IH 5E2VL 2AQ1A 5HGHB 1HXYB 1AY1H 2XN9B 5HYJD 1MNUL 5TDOA 3TBYA 4GKSA 3UYRH 2N7BA 2RFXB 4GSDH 1DQQB 1UZ6E 5IHLB 1GVIA 2Q6WA 1LO5A 5CJXC 5L2KD 2ZJSH 2E5EA 5TDOB 3ORJA 5TDNB 1JK8B 4NBXB 3Q5YA 2YXMA 5BVPL 1J8HB 2YA2A 2KL6A 3FQTB 3TVMA 5JXAH 3IS0X 5CZVH 4MA7L 2NXZB 3WNOA 1CVSC 4Q9QH 2PO6D 3TO2A 2E27H 5ESQB 4U1LA 3RPIA 5GRJL 4BA8A 5CS7A 5IP4A 5SWSA 2IAMA 1IKFH 1Q9OA 2VYRE 2UZXB 1YEIL 1XIWA 5CJ5A 3K46A 3LRHA 3V6BR 3VW3H 3ZL4H 3VFWA 1NFIA 2DI9A 4XPGL 3C60A 1G6RB 1CZ8H 1OCWH 4FQLL 3SDCA 2YC1A 4JVPA 4J2XA 4Y7MA 3I9GH 2OL3H 4EDXB 1H3UA 3QUMB 4LSVH 4PJ7B 3WUWG 3N85H 2Z8RA 5JMOC 1XGTB 2PR4L 2AXJA 4N0UE 4GG6F 5D5ME 2X4SB 2MHAB 1KELL 3VXSE 3RWIA 1NKOA 2A74A 5C0DB 3UYOD 4WFED 1OTUC 5BQ7A 4H25A 3KPRE 1FL3A 2VDOL 5E8NB 3BVNA 1LO3L 2UUDH 1URLA 4S0TD 1YY8B 4MNGB 4ZQKA 5I9QB 3EYUL 5I1JL 1NCWL 3PL6A 1EJOL 5FB8A 1GPOL 5CZKA 3OGCA 4ZYKA 5EU7E 4XWGL 1E4XL 1NCAL 5EPMB 3VXME 1UM4H 1HZHL 2JJVA 1XF2B 1BQUA 2QR0B 1HQRA 3MLPA 4WFGE 1H3XA 4HX1A 4OD3H 2GSIA 2BP3A 3G04B 4YK4B 4EKXA 1V7NL 3QEGL 3K4DA 3O8XA 2AVGA 5I17A 5DMKA 2R2EA 3EIFA 2MPAH 1ADQH 2VDML 5C71A 3C5ZD 2W38A 1Q9LA 2R1WB 2ERJC 2DAVA 2YK1H 3WUZA 3WLBB 4P2YA 3PWPD 1FGVH 5CKAA 2RIKA 4FQXA 5MERA 5D7KD 3HC0A 2VERN 4I0PA 4TSBH 1YMHA 1G9NH 3QEQB 1NDMB 4EQ2A 3P9LA 1OTUD 2QTEA 1HQ4B 3FOMA 1QACA 5J0BA 1FIEA 3K80A 2AJ3A 3ARTA 1XF3A 3T3PE 2J2ZA 1OAUL 2R56H 2VOTA 3NCMA 1FZKA 3V8OA 5C0NC 3V6ZA 2GY7B 4I0CC 2AK1L 3DMMA 2ZCLH 1MJ8H 5FCSH 2MNUA 5J9PB 4HZLA 4JN2B 3GSWA 4M5ZL 1AFVL 4XPHL 5C0RL 5FO8B 1JWUA 1WC7A 5E8DL 4KPHH 1TETH 3BPOB 5C07E 5I8OH 1WEJL 5K9KA 2BC4A 1GZQB 1TZIA 1U95B 3BMVA 3HI1B 1D5ZB 2WINA 4NRZB 2A9MH 3LMJH 5DTFB 5I2IA 4QTHA 1IGFL 4QLRA 5JW4Q 1MJ7L 2VXQL 3UAJC 5LGKA 2XIDA 5CD3A 5CJBA 5EUKB 4YBQD 2IPKB 5GS0H 1EAJA 1NCCH 2CIIB 1ZA3A 1AXTL 1BM3H 3WIHA 4KPHL 1PKQE 1NCDH 1ZWIA 2OM5A 5HYSB 3UZEA 1X5HA 4XC1L 3D69A 3EYUH 3FT3B 3RGVA 1MCBA 3VXMA 3BX7C 4LCUA 5BS0B 3RA7H 2EYTB 4LP4A 4WUKH 5DT1L 5D6DC 2KPNA 1A7OH 3JTTB 4TN9A 4HZLB 3WEXA 4BUHA 3ARFD 4IS6B 1A6VH 3CJJA 4TVPL 3NIDE 5FECB 2R2HA 3O3AA 4LFHG 5JOPE 1KCLA 1DE4A 1LO4L 3O6MH 4WO4C 4DFIA 1JJUA 4TUOA 4HEPG 4JFPB 3FRUB 5IQ7L 4JY6B 4L8SB 5GRUL 4JPIB 5INDB 4K2UH 4ENED 5IV2B 1DQMH 3ARED 4JG1L 3QNYA 2VABB 3S98A 5DEFB 1BJ1H 1KPVA 3WLBA 4H20L 1PG7L 5EDXA 3ARZA 5F72S 1H8OA 4YO0B 5HDOA 1X7QA 3WNLA 3OKOA 5GRJH 3C87A 4PRIE 4P59L 1JNNL 3IT8D 1RIHH 3ARFC 3S9DB 1CE6A 1HWGB 2P4AB 2R0KL 2Y7QB 4LLDA 1MAKA 5K93A 1NDGA 1PQZB 5KSVA 1IKNA 4G8EA 1SJEB 2LAGB 3L7EB 1FL3B 2P8LB 4OCXL 5MEND 1FLTX 2QV2A 3VXRD 5I1AB 3ROOA 3B5TA 4X4XB 3SDDD 1MLBA 3VFSA 5FGBA 4G8GB 2JJSC 3Q6FA 5D7LA 1FZMB 1RI8A 1KIRB 3QQ4B 5D5MA 4OSUH 1TQCC 1M1SA 4FQ1L 4JO3H 5J56B 1EIBA 3MNZB 4JN2A 1S8DB 1T2JA 2MQ3A 4ZFOL 4Y1AA 4K7PL 1T7VA 1CQYA 4NFDA 1KIRA 3QQ4A 4MB3A 4NQDE 5J3HD 1D5XA 4PRBA 5BRZD 2PCPB 3P4NA 3BEVA 4J8RB 4X5WA 3ISWA 5J1TC 2DQTL 2IH3A 4MD0A 4O4YH 3KPMB 4LGPB 1OLZA 1HSAA 3RVTD 4ZSOB 5CKGA 3UJJH 3K74B 3GSNH 2R39A 2HYMA 3BJ91 4X99A 1MELA 1J1XL 2O5YH 3QXDA 4ELME 2P1YA 4D0BB 4P2QB 3HZMB 3E6HA 3BP6B 1PY4A 4I5BB 4BFGA 5T5FH 1NUFA 5EC2B 3BDBA 5MP6L 1RIHL 1ULVA 3FJTA 1CFBA 4U7SA 3EGSA 2R0KH 1SJVA 4YFLF 1J1OH 4FMFA 3BH9B 3W5MA 1A0QH 1YPZA 3L3KA 1KF9B 2NR6C 3BEWA 1ES0A 1WBZB 1FVEB 4WW2C 4OGZA 3K4AA 4DKAA 3FQXA 4I1NB 5INDA 3HE6D 3RVTC 3HFML 4LVOB 4GRMB 4HK0A 1P53A 5D7LD 1H9VA 4RZCB 1MWAH 1J8HE 2OYPA 3RZWA 4QXTA 3WS3A 4E42A 4F3FB 5EO0A 5LG1A 4KK9C 2AJVH 3VA6A 4KKAC 5J6GB 4A6YL 4XPAL 4FQCH 1EBAA 3SBWC 4YQXL 2AEWA 3QXDB 3FOLB 1QRNA 1G7JB 2A83B 1UZ6F 43CAB 1FDLH 2IQAA 4AIOA 5EA0H 2D9CA 4QHUA 5AWNL 2VISB 4NC1C 2GTWB 1WIUA 4DGIH 2YR3A 5BXFB 4J7RA 5DT1H 1IT9L 4UV7L 4ODHH 1J0ZA 4WDIB 2ATKB 1A3RH 3SHSA 1XGYH 3JTSB 5LWYH 3V52L 5HY9B 3C08L 3KPQA 1R3HB 3RL2B 4JFOA 3IYLW 1JN6B 3MROA 5A43C 1NBZB 3W9EB 1TCRA 5GS0L 1O0VA 4ZUVA 5B39G 5I18L 5IVZA 5AZEH 3OG6B 1RUMH 3ME0A 1AXTH 4KK5D 4N0UB 4U1MB 4V1DA 4KK9D 1SY6A 2C9AA 1FORH 2BJML 4KKAD 1TJIH 4WEUD 1OF2A 4KFZC 1ZAGA 3IJYA 5F96H 1RUAL 3FQXB 1XF2A 5ACZB 2OK0H 5HDQL 4HS3A 2NQCA 1KJVB 2Q8BL 3R0MA 4PB0L 5IK3B 3S4SG 4ZTPH 1F45A 2A73A 3SGDI 5D7JB 1R3KA 4O2FA 1A14L 5GRXG 3U7YH 1JTOA 3AXLB 1S5HA 4DK6A 2VXUH 4KKCC 4K7PX 3D25A 4KI5F 3WN5C 4UV4L 4CKVX 4LLYB 1A6WH 3EW3B 4GMTH 4PRDA 3F5WA 4YDIH 1YN6A 3TBWB 3A6BL 4NM8L 5IHZA 1H3PL 5BXFA 4G9DA 3FN0L 3NBNA 2OLDA 4UT7L 3LEYL 4OIIL 4RGND 4EUPB 1B9ZA 1KB5H 2YHGA 1G1CA 2J6EL 1KG0B 4NJ9L 5H2BB 1CFQB 4U1JB 2R29L 2BVQA 3B9AA 4FFZH 3VFGH 4YDIL 1KJ2L 2HVKA 2B1HH 5IMMB 1T83A 4XC1H 4P2OA 1CYGA 3KLAA 1NSNH 1AO7B 5T3XD 4XAKE 3IDMA 3UTPE 3SBWA 3MYZA 4CMMB 4EOWL 3PWLA 5HI3D 3MRBB 3BE1H 5CMAA 5HDBF 3X3GL 3ARUA 2BVTA 4Y1AB 3MGAA 1R3KB 5IESL 3TA3A 5EH1A 1A6PA 3L95B 1I7TA 1F42A 3GHEL 5F21B 5FUCC 2ESVA 4LCWD 3Q6FB 3UBXI 3QCUL 1VGEL 3OWEA 1MPAH 1HH9A 2VLKD 3L3KB 3GBNH 2X4NA 4PG9A 4J23A 3EYVA 5KOVC 4BM7A 5C0AD 3PF2A 4IRJD 1G1YA 1PDKA 2WWKT 3QWRA 3MRRB 2G2RA 4B0MM 2BY3A 3P0VL 5C0JB 2ZSWA 1C5DB 2OJEA 3QHTC 1PZUB 1ZS8A 3ARXA 1CF8H 3FB6A 3PP3H 5BVPH 1JGVH 2G9HA 4PGCB 4JFFE 4RSVA 4CVUA 1AQDA 1UWXK 1LP9A 1F3JB 2V17H 3QFJD 1MIEH 4HIXH 4XRCA 1N3NA 4JPVH 2CMRH 4O2EA 4Y4KD 4U1GB 3AAZB 1J1PH 2FECL 2LV4A 1KPRB 2XY1A 4UOW0 4BKLA 5F7UA 1BIHA 1TMCB 3DX7A 4NN6C 2ZCHH 1TTUA 5FGRA 5JXEC 3RY6A 4XZUB 2PXYB 1K6QH 4HK3N 4NSKA 5BS0E 2QHRL 5DWUL 1ZHKB 3U4EA 1WBYA 3KPPA 5F7DA 3FHAA 2AXFB 3BIAX 4MZ2A 1L0YA 5HYJE 2EH7H 2VH5H 5T1LA 4OCRL 5IM7B 5C0AB 4HWZA 3SDXE 5DRZB 3LKSA 1A2YB 2R2CA 3HR5B 3QUXD 4U6HA 5E08H 2JB6A 1JTPA 4YHZH 2X6MA 1T5WA 4OB5H 4JFDE 3MCLL 5DVNA 2WQRA 3VFMA 2PKDA 2OQJA 4Z7UF 3D48R 4X6CA 4OZIF 1L4IA 3QIBC 4HK3J 2ZJSL 4PJHB 3KDMA 4N0CD 5EO1A 5IMKB 3ZTJH 2W65A 1JMXA 1XF5B 4L8CA 3PXJA 1PQZA 1I1YB 1F11A 4X6FB 1FNFA 1MQ8A 5GGUB 4ETQB 1XGPA 2QQQA 3H9SE 2Z8SA 1D7FA 4PJBE 4JKLA 1WFNA 1U8PA 3KPSE 3CUPA 1VGKB 4HEME 5GGVY 1FBIL 5E6ZA 1T7XA 3MREB 3O45B 2B2XH 3RVUC 1U8JA 2VWEE 4K3JH 4UAOC 3QIBD 4WW2B 1ZA6A 2DWEA 4X6EB 4EIGB 1HH9B 1EFXA 3MA9H 3MCKA 3GK8L 5EZLB 5EN2B 1U92B 4GRWH 4WU7A 5DJ0A 1CD8A 5I8EA 1E4WH 2X05A 1RZ7H 4XXCC 3CD4A 1NAKL 5D1QC 2VITB 5EBGA 1MRDH 2AEQH 4GLRH 2CO7B 3LS5L 4OF0A 2NY3C 1E4KA 4X98A 3CMGA 5KSBF 4HUXB 4RISH 4DUWA 3EHBD 3BPCB 1G7MA 3AU1A 4DGVL 3VD9A 4QHLB 1NAML 3TESA 1ZLWK 2IBZY 4EDWH 4ZMAT 1H3WM 5KVEL 3CPLB 3P2TA 5J7CC 2PTTB 3PIQB 5HGGS 4R90H 5HGAA 5FOBA 1QP1A 1D6EB 1DBBL 4K94L 4RGOL 2WWMD 3S4SB 3SN6N 5KN5B 2AXHA 3SKJL 4OCSL 3ZYJA 4PRID 4ELMB 2IADA 3I75B 4PLOB 1KJ2A 2PYEA 3EOAA 2EYSB 3RDTD 1NAKH 1K6QL 4XPFL 5D1QD 1KEGL 3P4OA 5TDPB 2HN7B 2NY3D 1A9EB 4HZAA 1F58L 4PG9B 4LSUH 4PYHA 5HGDA 2P24A 1JGEA 4PJXB 2FO4B 1P69B 5IT2H 4O4YL 3QWOA 3MLTA 5DLMH 2X4NB 5DO2D 2OZ4A 4ERSH 1IBGH 1LP9F 5DFVC 3UTQB 4RCAA 3T8XA 1JRHH 1N4XL 3SY0B 3MRKB 1XFPA 1I9IH 2VLMD 2WANA 4PJGE 4NJAL 5F1NB 2WWMC 2ADFH 3MLYH 2EZ0D 2NY1D 5DR5H 2EDYA 3N0PB 4Q2ZA 5MI0C 3PL6D 1FYTB 3CFIC 1NC4A 4XPBH 1QHOA 1S7XA 3PP3K 3TNMA 2HFGL 3R06B 4G6AC 3CFBA 3NACH 1CTNA 4GRLA 4ZFZB 5TQ0L 3QRGL 5E2TH 4P5MA 4IOFC 4I3RL 4DKEL 4MJ2A 3UTZB 1NFDF 1C12A 2EH8L 3CCHB 1DQML 5IW1A 1U42A 2CKBL 2FRGP 1NLBH 2I9TB 2ZP0T 4M8QB 4PJHF 3VMNA 5EIIA 2CUMA 4M6OH 4PGBB 5E95B 5GJSH 1DQJA 1IC4H 4X9GA 4M6NL 3HRZA 5DD3H 3B2UC 5ADOL 3ZE2F 1VSCA 2X4OA 3O8XC 4P57A 1G7PA 2EDJA 3QPXH 1I7RA 4UTBL 1F6LL 5DFVD 4MCZA 1S9WA 1WZLA 4NZUL 3OJ2C 3KNBA 1LO5B 3S36H 5JW4M 2MWCA 4IBLT 2VDOH 5T3XL 2WBJD 1C5BL 3EYVB 3GHBH 3PL6C 3N06B 4GMSL 3FCTA 1A6TB 1OSZA 3I6GA 4JJHA 2HKFH 3RGHA 4KI5E 2CDFB 3W81A 3RTQA 4YDKH 4ZS7H 4G6AD 5E5UB 3ULVC 3RNQB 4P4KB 1JZ3A 1MCRA 1HOCA 4HUUA 2ADGA 1LDPL 3FQWA 2OQJB 5AYQA 1GOFA 1OWRM 1I7ZB 1G9EA 3UCRA 5I74B 3QJFB 4JHWL 1KCVL 5LGHH 4PJAE 1A6UL 1YECH 4HPOH 2APFA 2XA8L 4ODXA 3P4MB 1R3LB 3BQUD 3BSZL 5CEYB 2HH0L 2Y5TB 4P9HH 4MZ3A 4QRTA 3VW3L 2PW1A 4PTTB 1YUHB 3W82A 4WHCA 1M05A 2VLLB 3HCVB 2DLGA 3H2WA 4ENEC 4QY8A 3O3BB 3OJMB 1F4HA 1JI1A 1NFIB 1XIWC 4MJ5B 4HIEB 4BJLA 2BVYA 5ICXB 1JNHB 1LEIB 1CTOA 4JLRA 3KJ4B 1F4WL 4OAWB 2B8OT 2NTFA 5GJSL 1GXEA 3FL7A 1FLRH 3TVMC 5I1CL 1CT8A 5ESVB 1VFAA 3ES6A 1YY8A 1BEYL 4YHML 4NGHL 4FQJH 1ZS8B 3R0NA 2VDRL 5DA4A 3TF7C 1CXKA 1FL6A 4FS0A 4QT5B 5MEOA 2CJUL 1JWUB 2Y06H 5E8OB 3QQ3B 3O0RL 1EZVX 3PWPE 1RJLB 3NCCB 3VGEA 4I4WA 3X17A 2L0DA 4R97C 5A16B 1MWAL 1U8OB 2E7MA 3VCLB 1W0VB 1UA6L 3AS3A 4Z8FL 2IEPA 2XZCL 2ICEB 3FO2A 4OLWH 1XIWD 2KQMA 4GQPH 3ZL4L 3UJTH 4JRXB 2RCSH 1PKQB 2YC1B 4WIQA 1DQJB 5F3HA 1ODAA 4LPTA 4JZJB 4OJFH 4C55A 4IOSD 4RWHA 3BH8A 1B4RA 1RURL 4WCYH 5EOQH 1F2XK 1VACA 2YRZA 1RMFL 4JB9H 2XTJD 4K3DH 2MCG1 1WIPA 2PTVA 3GDBA 3QZWB 4MJ6A 4W4NA 1HK6A 4L8DB 2L4OA 1HINL 4K9EC 3HLAA 3ZDXF 4G8FB 5HYFA 5CCKL 2VZSA 5DD1L 5JTWA 4Y4KA 2R8SL 4LU5H 2GI7A 1DEEA 1XF4A 1M7DB 3F62A 4YDJA 1D3CA 3DNKA 3V7AG 3SDAD 2QADC 3Q3GA 3RGVD 4IOIA 4ZQKB 1JWMA 2QSQA 4OM1H 3TNNB 1NAMH 4L4TE 4IRSD 3HHRB 5FK9A 1OM3L 4HIJA 4RFOL 4FMKA 3TBTB 4LHJB 4UI2A 5IROA 2OL3A 1T22A 3IVKA 5DJZA 4BSVB 2ORBL 2H9GA 5EU6A 5CP3H 4ZPVA 4FQQB 4Y2OA 5IT2L 2BVPB 4EVNB 1U8PB 2UUDK 2P7TA 1G7IB 5ICYB 1RZIB 3QUML 1BVZA 2J6EA 3QA3A 2DQIL 1CLCA 1JHTB 4PJEB 1G7PB 2XWJB 1AKJD 3L3JA 4BZYA 4JHZA 3DOSA 4N1HB 3S3PA 3BIBX 4YHYC 4NFCA 4YUEL 1VEPA 4XCNB 5J11B 4JREB 3RIAK 3Q1SL 3UJIL 4XHQA 2IMNA 5E4EC 4PJDF 1IC7H 4JQIH 4HJ0D 4PD4J 2K7QA 4K3HA 3MLUL 4PFEA 1ZLVK 3TN0A 1WAAF 2Q86A 4UQ2B 3MLWL 5GZOC 2AJZB 3WFBL 3QEQD 4Z5RA 3V5DA 2IG2L 2PW2B 3U4BL 4JEGB 2VE6A 1UACH 4AQ1B 5FEBA 4GBXA 4GAYA 1O7VA 4KZEL 2HTKC 4AH2B 4RA0C 5FYLL 1B4JH 3OXRA 3MRKA 5AG9A 4P4KA 1A1MA 1IM9D 4OLYL 3MLWH 1D5BA 1ES0B 4M1CC 5I1IL 1I7ZA 4D8PB 5C08B 4Y0GA 3GSNB 4F8TA 2V9RA 2IH1A 3W11D 1CFVL 1QVOB 1S7RA 5I1GH 1M7IA 4KHTH 2MFNA 4X80L 4ELMA 4RMRA 1A1NA 4Z7VA 5IQ9A 5SWZD 3FT3A 3RGVB 2IPKA 2I27N 1ZHNA 3HUJE 4APQB 3BKCH 3AMKA 5GZOD 2FL5B 1M6OA 2BCKB 5FIEA 4U1GC 4MCYB 5AZ2H 4FFVC 1UKTA 4N9GB 2OXHA 2YN5A 3K7UA 4Y5YB 1N59B 2HTKD 4A6YA 4ODTL 1Q0XL 4FQHB 4UB0L 4CU7A 3VWKB 2GTWA 3V6OE 1YPZE 1VCAA 2B4CL 2W07A 3W0WD 3G5YA 5FO9A 3HG1B 3LQZA 2VZUA 1A1MB 3NCBB 3WSQH 1KTKE 2DQDL 2ZCHL 5DGRA 4LRNH 4TULL 3QHFL 4GAYB 3TBVB 2A74B 3QISA 1S3KL 4LHUG 1MFAH 5DD1H 3WHE1 1Q94A 2CMRL 3WIHH 4ONOA 2C1PA 5C0GA 3PWVA 3O2DL 2FX8L 1FLRL 3S6CA 5E94B 4JZNB 3OAZK 4G8GA 3QFJE 1G7LA 3NFNA 3OX8A 1BJ8A 5HI3C 5INCA 1F4WH 1PZ5A 3MCLH 3BPNB 4DOHB 1A47A 3RWFA 4WU5A 5CINH 3ULVL 1U41A 4E5XA 2DQCH 4GOSA 4NN7C 4ELKB 1MVUA 4UU9A 5E2WL 5C7XH 1IAIH 3MLRL 2VSCA 1FRGL 2XRAH 3WDIA 3VI4F 4ZNCD 1EUUA 1QSVA 3CFKA 2DLTA 4YC2B 5J8OA 4GKNA 4GW4A 1Q9LB 2R1WA 2CPCA 5HYSA 4M9PA 3WO3B 3IKCB 1GHFL 4Y89A 1BQLH 1XCTA 2Y7QA 3FB6B 2ADJB 4ZO8A 1PSKH 5HJ3B 2BDNL 4XPTH 3UBXB 4C4KT 1KJMA 3HMXA 4G7YH 4XP6H 4KGLA 1Y6NR 2Y06L 1TZGL 2X4UB 3A67L 2F54E 4P23B 4JZOB 1G9NL 3ARBC 2C5DC 4YHMH 4ZFOA 1SEBA 3ARDD 3S96A 3U2SA 2QSTA 1WC7B 4GXVH 4MSWA 5M95B 1I1AB 4ZS7L 3RWDB 1LO2H 4Y8AA 5JXED 1MHPH 5HPOA 3NIDF 4JFPA 2XTLA 3V5HB 4DN3H 1OT2A 3GMPA 3QUYC 4L9LB 1RUQL 4ODBD 5EC1A 5E94A 1CI5A 4IDLA 5DHVB 1N6UA 4QRUA 1HZHH 2YS4A 1HHIA 3QCTL 4FZ8H 4TUOB 4Z76A 3X12A 4M4PA 1HDMA 4PRNA 4WV1C 5I1JH 1C5CL 1XGQB 3L9RA 4KVCL 4QNPF 5DRXB 4R4FL 4WV1B 4JZJC 3QUXC 4NQUA 4PY8J 4PRPD 1ZVHA 3KWWB 5HHQA 2A9ML 4PJ5B 4O00A 1D9KC 5FF6A 4I0KA 5HHXH 43CAA 4LLWA 5E00A 3SKMB 2H26A 1X5AA 2EECA 4I0PD 1CBVL 4NOFA 4N0CC 4OLEA 3GJEB 3QUYD 1DBJL 1FN4B 1QSFD 2VAJA 3PGCA 2KDGA 5IBTH 4FHBD 1FL6B 1HNFA 4F9LA 2NYYD 1QLRA 3RVXD 4R7DB 5ID0B 1MH5B 3ZKMC 3IAGC 2EDXA 2W60B 4OBRA 1A9BB 2ADIA 4U1MA 1NC2A 4NFBA 3MACH 5DJ2A 4LVHB 2VDKH 1M7IB 4BQ8A 2R4SL 3RWFB 4MNGA 1TNMA 5A3ID 3S7GA 1GJIA 5A2KH 2WQ8A 4FQCL 3QNXA 3VFOB 4JZNA 4C83A 5EBMB 4F15C 3TO4B 1HHJB 4P48A 4GW1A 2JLLA 4ORZC 4TUKL 3U30C 2DTMH 4JFZL 1RHHB 4GRWF 4GXVL 4XH2B 1NMBH 4X99B 4OCWL 3C60D 3PQYD 2GJ6D 4F37K 2HFTA 2QBWA 2VLRA 3QFJB 5MERB 1BIIA 1VFMA 1UCTA 1D5MA 3GSVB 5FV2A 3O6FC 5E99H 4XPBL 4FQHA 3WFBH 3IFNH 1ED3A 2EEDA 5D8JH 5C0BD 3SO3C 1I9IL 5D1XA 4JQIL 1OAKL 4ODTH 1S7QA 4ODSH 2FZ3B 3TYFA 2V9QA 3WN5A 1CN4A 2BNQB 4OZFH 5D70L 2E7LC 3TV3H 2OTWB 2YKLH 5DEZA 4AENB 4X9BA 3CXDL 4JFHD 4D94A 4LCWB 3ZDXE 3VU2A 1K3ZA 3BHBA 1I85A 3CVHH 4WFHE 3AXLA 3MV01 4HH8A 1N6QL 1IL1A 4OGYH 4PJ7F 5HYSG 3AB0C 3KYAA 5CBAA 4JRYE 3BEWB 4M5YL 1JGEB 4FFYL 2XQYG 2YWYA 35C8L 4NRYA 5GGTL 2FJGB 2C7UA 2Y9RT 5EO9A 4PGDA 5KW9L 2NW2B 2GJ6E 2X70B 1QLFB 3HAEB 5TJWK 3O6FD 1U58B 3OQ3B 3GKWH 4M93C 4EN3B 3D3VE 1OY3B 3DVIA 3CSYA 1KJMB 2J88L 4K3EH 4R26L 3U9PL 3AROA 2F53D 1AO7A 1N2RA 4KKBD 3VXUA 1Z9OA 5JIIA 5HHNA 1VPOL 2IQAB 3O4LD 4ZO9A 2BVQB 5C0CA 2FJFA 1Q9KB 4KV5F 5F9OH 5FF6B 2NY1C 5JIKA 3VXOA 3D3VA 5HHNB 2BSRA 1MFEH 3GMOB 1SMAA 3BYYA 3DX7B 4MQTB 5CEXB 1MJJB 3SDXB 4J3SA 2O5YL 1G6VK 1V3KA 1BBDH 4U33A 1SQ2N 1AE6L 1BQHB 4ZUWA 3RFZC 1OAZL 1KPUA 1JF1A 1LE9B 3FFDA 5DFTA 4O02H 4V2BA 5ACLA 4L5FH 3FB7A 4HXAH 4BQ6A 1JPTH 5CGMA 1YYLL 2B4CC 1HHIB 3KXFB 1CFSA 1YEEL 3DSNA 1I4FA 3D85B 2J4WH 4Z7QF 3MBEA 4ZUUA 1ZTXH 4GAGH 4LCIH 5EC1B 5L6YL 4QRPA 4K55A 4TSCL 4QRRB 4EN3A 4RAUA 4N8CH 4NKIL 4LSPH 3IJYB 4IHOB 1IM9A 3QDJB 4YDLC 3MRNA 2VNCA 3B6SA 4ZAKD 4WW1B 3CZJA 3D9AH 1ZT1A 3VRJA 4YPGA 5I75B 4MXQD 1Q0YH 4ODWA 5I66A 4I2XA 5J12C 2A38A 3MO1A 3QUZB 3QEUA 1N59A 4QWWD 1DQTA 1EO8H 4U0RB 2ED9A 1ROWA 1AJ7H 4WDIA 2JE8A 5IB1A 3ZT7A 5E1AA 4XNZC 5GHWH 4CJ0A 1DR9A 1NFDB 1QFHA 3BN3B 3W9EA 4G6MH 1F4AA 4Y5XA 4OI9A 3DROB 4WY7L 3ZKSD 4ZNEE 3LS5H 2F19L 1CDUA 2A77H 4JG0L 1OGTB 3MJ9H 4EBQL 4JO2H 3G5VA 4RFNB 3B9KD 2BFVL 3TBSA 3O3BA 4CW1B 5F93C 4S1RH 1INDL 5EBLA 1AXIB 3M1BA 5HYQB 2X4RA 4J8RA 1GGIH 2AJSH 1UVQB 3MLTB 1MHPL 1C08B 2LFGA 1BX2A 1DANT 5F8QC 3LN9A 4JR9L 4E42B 3BD4A 3LV3B 5I8EB 5TGBB 5DMJB 3H42H 4WFFD 4PRAA 4TVSa 4OZHB 1YPZF 4C83B 3MNWA 5T5NF 1VFOA 5E5MA 3HNSL 1FFQA 2R2BA 4X4ZA 1KT2A 2VDRH 2GITB 3RX8A 3NCJH 3FZUC 1CBVH 5EOTB 3T0EC 5EU4A 1ZE3C 4LLDB 5FYJU 3BP6A 1TJHH 4GG8A 4F7PA 3F12A 3QT2A 4Y4FB 4PJ9C 4MVBC 4ZAKB 1K85A 2GEEA 5CJ8A 2CKBB 4FG6C 1IGIH 5FOBB 4G6KL 4XCEB 4YHYB 1TVBA 2VO5A 1H3PH 4ZAKA 4I77L 1ED3B 1EV2E 1XAUA 5IJKC 3S4SA 1FNSH 3C09C 3VH8A 5C2BL 2GCYB 3KPRA 3QJHA 3WCYA 1IEBA 1NGQL 3I2CL 5L8LB 4NUJA 5D9SA 3VXRA 3HR5A 2OP4L 1RPQA 2OJZH 1HYRC 4QRPB 5HDQH 1AHWC 5LXGH 3S37X 1LO2L 1I4FB 5LGJA 2MKLC 1BZ7B 1JPSL 4KRPC 2V2WA 4YHLH 1A2YA 4NQCD 5MENB 5JQ6L 1MOEA 3JV0A 1YECL 2E6PA 4G6FD 1P1ZB 1BZ7A 1FG9C 4TYUA 1HCVA 2IQ9L 4KJYB 4MQXD 3MYJA 4X6DA 1R3JA 4BH8A 5ENWA 3JWOH 1NBYB 4KMQA 5D6DA 3U0PB 5D2LA 4BH7B 2J6EH 4IRSB 4U1JA 1D5IL 1OAUH 3EFFB 3RGVC 3MCG1 1BVKB 5KVDH 2JB5H 1FZJA 4F7MB 5F6HJ 1A02N 2CO6B 1J0JA 4I5BA 4JRXA 2NY7L 4LPYA 3ZT6A 3FONB 5KN5A 3MRMB 2O93L 2FHCA 5BW7A 3L3IB 3ETBF 4NZUH 1EHAA 3PWJB 4JHAL 4JHBA 2EYSA 4RWYL 1UG9A 4BQBA 5JQ6H 3KHQA 3C5JB 5CWSB 1QBLL 2CKNA 1QKZL 3IETB 1KYOK 4RMVA 5LBSH 4MA3A 2Q87A 4JM2B 1OCWL 4FQLH 4DKEH 4QRQA 4WWID 1UEMA 1NLBL 1W8NA 1LEKB 4Z9KB 5C07A 2CRMA 2AK4D 1TJIL 3QDGD 4RMWA 2EEBA 5I8OL 1G7HB 5IFJA 2V9TA 3I2CH 2BSED 3MNWB 2JCCE 4LGRB 5EORH 4HJ0C 3BN9C 3QG6B 5FM4A 3DMMC 4GUPB 2V7NB 1CK0H 4CN4A 1OQXA 3ZYIA 3P11H 3MLUH 4MXWL 3GIZH 1DUZB 3OXRB 15C8H 3WIFA 4LAJH 1RD6A 4C54A 5FV1L 5HI5D 5ADPH 2OXGA 4WEMB 4YXLL 1D6VL 4WENB 4PJFF 2I07B 1CD0A 4QY8B 4LLMB 3W0WB 3KR3L 1BFVL 4TNWF 5C6WH 1U91A 3NTCL 5C7XL 2VXUL 4LVNB 1IQWL 5LAXB 2PXYA 3IF1B 4XVJL 2BVOA 1JHTA 4PJEA 4JE4B 3W39A 3KJ4C 3FRPG 3MJ8A 1NGYB 5L2KE 1CZ8L 1LE5B 1IZJA 1HKLH 4ZSOE 4HS8H 5J6HB 4YPJA 2XZQH 5T5NG 3DMMD 4R96B 1XGRA 4XMPH 2P47B 3HFMH 4GRMA 4HK0B 5FGSA 3MRIB 3BKYH 3O41A 3BO8A 4CVZA 1SY6H 5HHMB 3IGAA 1YEKL 1UM5L 2Y4SA 5MEOB 5DUPH 3G6DH 1DEEB 3X3FH 2HJFA 2IAMD 1XZ0B 4UV7H 5TE6H 2R4RH 3ES6B 5FCUL 3SDDB 2ATPB 4CAGA 5CUSH 3FB8A 3EO9L 4KHXH 3PHOA 3KJ6H 3UTSE 2HLFD 3HZMA 1AXSB 3DUUA 4XVUD 1RUPL 4HGKC 3UZVB 3WJLC 4Y88A 2V6HA 4LCCC 3FN3A 1JYVA 3ZYZA 4WCYL 4MJ5A 4NSKB 4RX4A 5FYKL 3SDCC 4GQ9L 5BJTB 4JGUA 2B0SH 4ZTOH 4X0KB 3SGKA 2HRPH 4P5MB 3KPPB 2PYED 2W9LA 3O6KH 4KTDH 3RDTA 3QDME 2VLJD 1YEKH 4MJID 3O3EA 1BPVA 3FMGH 2CGRH 4HWUA 4ZG1A 1OT1A 2IAMC 3HS0B 2V7HB 4LDOB 4L4VA 2OX5A 1CD1B 1YQVH 3HRPA 4C56E 3FB5A 1IGYB 1XZ0A 4NQVB 12E8H 5DVLA 3FKUS 3V4VL 1JPTL 5GGVL 4HKZB 4YPGB 3QWOB 1AQDB 2WMPA 3OR6B 3KDMB 4NO0B 4PV9A 5JHLL 2AS5M 5I76B 1X4ZA 5IGXH 1NMBL 5E8NA 4TVPH 2G2RB 1WFTA 4MQ7A 1M7DA 3T3MF 2VUOA 4Z18A 4ZYKB 5BOZG 1QD0A 1MCEA 2XA3A 3UPRA 3HE7B 5JHLH 3C8KB 4I13B 4KXZH 4H1LA 2Q76A 5F9JA 4JDTL 2WWKO 3CAFA 3AM8C 1L6ZA 2GFBA 3DO7A 4MAUH 2ZOLA 2V7HA 1NCCL 2E8YA 2HTLD 4X6DF 1T7YA 4KUCF 4OZHF 3VDAA 3SGKC 4GRWE 3KWWA 3CLEL 3IJSA 3JZ7A 4NOBA 4DVBB 4OM0L 2X4PB 1A6ZB 4XP9H 1YEFL 1WZMA 1WZ1L 4D9LH 5SWQA 3NABH 4R4NC 1RK1B 5C0IB 3D6GA 2GK0A 5EUOA 3ZSSA 1OLLA 5IVXA 1D9KD 2DB8A 4ZXBB 3STZB 1HOCB 1U2HA 1CWVA 3D1MC 2NCMA 3GNMH 3DXAB 3HE7D 2JB5L 4I18A 5ESQA 4XCFH 1JK8A 1KIPB 4OIIH 3C8KA 5IEHA 4PP2A 5C9JB 3LKPA 4U7KA 1UYWL 4PTUB 2AGJH 4YHIA 2EIZB 3QWQB 4Y4HD 2V2TA 3IAQA 3VRIA 1JGLL 4QXGH 2R69L 3FHQA 3ZKMD 2C3XA 1NL0H 3MBXL 1KLGA 1SM3H 4HLZH 5J3HC 3BXNB 3FQNB 4OGXH 4G6JH 4K8RH 4GXUN 5JW4N 3BKML 4PGBA 3M07A 5KS9B 1FAKT 5A3IC 1ZA3B 3F6IA 1CDGA 5LAXA 4TUKH 1SHMA 2Q1EA 1IGFH 3CFEB 1IAMA 1HCFX 1Q9WA 4MNQA 3BE1L 4WHTB 2PXYC 3RI5K 1PEWA 4L4VB 5E6IA 2EDQA 3NMEA 2BRRH 4KTEL 2Z0BA 5SX4H 4L3EE 3SKMA 5B38B 4YDVB 2IANA 2Y23A 4Z78A 2NXYD 4LRIA 2KKQA 2BSSB 4PUBL 2ENYA 4X7FC 3IJHA 1R5IB 3SDYL 2FR4B 4WI8A 1HXMB 5GGTA 4ZDHB 3IAPA 4Y4HC 1Z2KA 1AC0A 1A1OA 5JUEH 4MNQE 4YDKL 3O4LE 2EYRB 5T1DL 5FECA 2ZG2A 1S5IL 4Y4HB 2OCFD 5F7EH 4L3EA 5J1AA 1KXTB 1YN7B 1LNUB 3T8XB 3BZEA 1Q94B 2RHEA 1I7UB 2IQ9H 3QIBB 5HVHB 1WCBA 1OP3H 2BVUA 1UWEL 4HXBL 5IMLB 3O9WD 4Z7UB 5IVOA 1U8QA 4DKFH 1WZ1H 4HFUL 2DICA 3AMLA 3RRQA 4LGSB 4JPKH 2Z9TA 1I1FB 4HBQA 3T04D 4F57L 1S78D 5IB2A 4ONFH 1AO7E 1L7TL 1QFOA 2YSSA 2D7PA 3D69B 3MRFA 5F7FA 5FGCB 3BOVA 3S97C 5HGBB 5L9DL 3F7PC 2UYLA 1CDYA 4YWGH 1NCAH 3T08A 3I6KA 1NDGB 4OGXL 1ZHBA 1Z9LA 1WISA 2ADJA 4PB9L 3UX9B 3C08H 3GJEA 5HPMB 1JZ6A 1NFKA 4QXWA 4CU6A 5HYJB 3CXHK 1HE7A 2XWBA 3U1SL 3RAJL 3UPCA 2F53A 2JJTA 3RUGB 5TF1H 3QP3A 1YN7A 4JG0H 4QTIL 1JWMB 4IIQC 4X98B 4L8BB 3S36L 1GC1C 2JTDA 3QEQE 3SDXF 1KIPA 2YD8A 5L0QC 1E0OB 1J8HD 3TJEH 1CVRA 1PW3A 1MRCH 3ZTJG 1JZ7A 4F7EA 4JPIA 4YAQB 3MUZ1 1NBVH 5B8CA 5GGVH 1Y0LA 5I1DB 3B5HA 4PS4L 4M48L 3FB7B 2ZUWA 4XPAH 3GMPB 5B3JF 3ULUL 3DV4B 3BWAB 2P44B 5LKNA 1AHWA 5C09B 3DBXA 3IFPB 1UZ8B 2EH8H 4PBVC 1HYSD 4XBEH 3VFNB 4LSSH 4HFWA 2VLJE 4MJIE 4OT1H 5I1KH 3HR6A 2QJDA 4R6UA 4C56B 3TT3H 5D7JD 5E24E 3LB6D 5E9DD 4F7CB 2NZIA 4Z77A 4LCIL 5L6YH 1UM4L 4S10A 2JKXA 1GCFA 1RULL 4ZAKC 4P57B 4ZFOB 1WWAX 4YXHH 2VRAA 5JLZA 2D03L 3N1PC 4D0BA 3TPKA 4UDUA 3TWCH 3H7BA 5GGRA 4DGIL 5DVKA 3TJHD 4XXDB 3ZHLA 2P8PA 1U8KA 4LSTL 2OMNA 2NX5A 5D71L 4CDHA 2WP3O 4JFYB 3QPQC 2GJZA 4JCLA 1XGUB 5TDNA 1DVFA 2DKMA 4YXHL 1LNUA 3S34L 4OLZH 1VENA 4QHMA 1KXVC 2J8UF 3O9WA 1G7LB 3NFNB 3OX8B 2UV3A 5D7JC 4PP2B 1J5OH 1D5XB 4PRBB 2DBLL 2C1PB 5FM8A 4ONHB 3H9SA 4M61B 5ERWB 4HWEH 1NC2D 3SGJC 3UTTB 2VLKB 3EAKA 4HIEA 5CEZL 3I3EA 1GIGH 5DD6A 1P4LA 2IAND 5D2NA 3N1MC 3QEQA 3GSUA 4FTVB 4AG4H 5AD0A 3K8KA 4YNYA 5F3HB 5I30H 1BIIB 1X4YA 4YIQB 4KHTL 2B0SL 1XR9B 3QPQD 2VR9A 4Y5XC 4LLVB 1MRDL 3H7BB 5GGRB 5A2IH 5JQHC 5B39B 4ZXBC 1C7SA 2I9LB 4ZS6C 3IRZA 3FN9A 3S35X 4PRHB 2COQA 1X5IA 1JNNH 1BOGB 2VL5B 4Q0XL 1DP0A 5CIPB 3CFDB 4PJ9D 5H37G 3K2UL 5JORB 4U05A 3ULUD 2WIIB 5HD8C 1HQRB 3O2DA 1L0XA 5EU6D 1KB9K 5IIEA 1MPAL 2YUVA 4P5KB 5E8OA 4PG2C 4S1QH 1PFCA 1NC2B 1Z3GL 3ZYOA 2PETA 1MVUB 4UU9B 2WINB 5JHDD 4PGJA 5SX5H 1MFBL 1OWWA 4JG1H 3J8F7 4M93B 3UO1H 4EN3C 1MJ7H 2VXQH 4ODVH 1IL1B 5INCB 2NY0D 6FABL 2EC9U 3OPZL 1P4BL 3CDFA 2QHRH 2A6IA 1G9MC 1P2CB 1JGUL 2F9BT 1E6OL 2VZ3A 4LLAA 4Y5VA 2H32H 3REWA 4PRAB 3O6ML 2X4OB 3D85D 1TITA 5KZCD 4D0CB 1FO0A 3QFDB 1T0PB 1P5UA 4Q6IB 1J88A 1IGJA 1A4JA 1CICA 3O4LB 1D6VH 4NN6B 1Q9KA 1DSFH 1OAXH 3EDFA 4UIKL 4DW2L 5H2BA 2XWBB 2Q86B 5HD8D 3OKDA 1MCFA 4P5TB 1MCPH 1EK3A 3A6BH 1J0YA 2IJ0C 4GAJH 2FJFB 1HSBA 1EHLL 3AY4C 2D7OA 4LPXA 1OAQL 4U1KB 3M8OH 3P11L 2JCCF 4YHPA 4BFIA 2HVJA 5IVXF 4WUUB 3LIZL 3OAZH 4KJPC 2X7LB 4YXKL 2DKUA 4RMUA 5D5MF 2A6IB 4P5KA 3TYGH 2D31B 2ZPKH 3AREA 3V5HA 2IALB 5IESH 1VERA 1TVHA 2F53E 1S7RB 5F6IC 2WBJB 3S3SA 3DARA 3VJ6A 1OHQA 4HXBH 1LEGB 1YNKH 1P7KB 4NT6A 4OZHA 3MUGB 3S3JA 5LGHL 4WI7A 3V4UL 1I85C 1YMMB 4IJ3B 1VA9A 1FYTD 1JUFB 1SM3L 1UWEH 2BOCA 4WI3A 4HHAB 2E7LA 4KK6D 1PYWA 1CGXA 3D18A 1IT9H 3MV8B 1MIEL 2D0FA 4P49A 4LCCB 1T89A 2PO6C 3V79C 2VXVL 4B7IA 2AJZA 2ZUVA 1D5MB 3GSVA 4G9FD 3SDCB 2VLJA 4MJIA 4LLVA 1A6AB 2FR4A 3RJDA 4LQFH 1YZZA 3RWJA 1UA6H 3EFFA 4KJPD 5EWIH 3QUMA 1QFWL 3FFCE 5F70A 1OP9A 2P46B 1FIGL 1KYOJ 4H8WH 3LKOA 1A7NH 4M7JH 1EEZB 2OL3L 4LLUA 1UJ3B 1PX3A 1NQBA 4OZ4A 2GQHA 4RX4D 1AGBB 3DRTA 3RNKB 4JY4A 4L9LA 1VFBB 3PDGA 3QIWD 4W6WB 4X4XA 5B8CB 3LRGA 5BZDA 5D93C 5KANI 4A2LA 1FP5A 3H3BC 4BFBD 4HLZG 3SJVD 4ZO7A 3QG7L 4EI5B 1GPOH 3BO8B 4GKZB 4CVZB 4M6ML 3IDJA 2X1WL 1R5VA 5DR5L 4AQOA 1C16A 1MAJA 1H3VA 3M8OL 2I25N 5DS8B 1KBGH 3C8DA 2AV7B 4JRXE 3L7FA 1I1RA 1TJHL 5ELIA 3MLZL 4N9GA 2X4UA 1SVCP 3UMTA 1BVKA 4Y4FC 3CZFB 4UDUB 2R9HD 4CMMA 3D39E 4B53A 3TYFB 1XR8B 3QDMA 3C5ZC 2RJMA 1R3HA 1DBAH 1F6FB 3CVIL 4QRRE 5DUMH 2HLFC 4YHPB 3D0LB 1ZLSL 2Q8BH 3CDGB 4QYOA 3EUUA 3HI6H 3GI9L 2BXZA 4JKMA 1MWAA 1SJHB 4DCQA 2PYFA 3P77B 1INQB 3LCYA 3B3IB 3QUXA 3B2UD 4L3CB 3SDCD 1FG2B 4PJGF 3BZFA 1BLNA 1JBJA 3CLFL 2AXGB 3CMOH 2F5BL 2O61B 3TP4A 2WK2A 2YUWA 4NQEA 3O6KL 3L6FB 4Z7QE 2XXMB 4XNYL 4GH7B 1QNZH 4PBWD 3V95A 4GUPA 1IGML 3GGWA 4S2SA 2ICES 4XC3H 3V8CA 5KSAC 4K07A 1KTDB 3EOTL 4NM4L 2E3VA 1U93A 4XCFL 2ATPA 1CXHA 4OCYL 4JDZB 5DJ6A 2AK4A 3ARVA 2RAMA 5FYKU 4LARL 4OUOA 3OR7B 5FYJE 1T1YA 4G3YL 1MNUH 1ZHLA 4Y5XB 3KG5A 5L2KA 3BQUC 3MRMA 4GSDL 1FGNH 4MX7A 4DQOL 2BSTA 3UXFA 4OBSA 5DQ9A 3VGGA 1ZHLB 4Y19E 1SJXA 3UAJD 1T6WA 3QO0A 3WKML 2DQEH 1Y18A 5AYUL 2EE3A 3WUWA 1OW0C 4P99A 3LZFH 4RQQB 3KPLB 3X14B 3PV7A 3L5IA 5DJXA 4D8PA 1CGSH 2VIRA 3TLRA 3NIFF 4JO3L 1B90A 2ZCKH 3FT4A 4IHOA 2KBGA 1TQCB 3LN4A 2XQYK 1YYLH 5ERWA 4M62H 3H3PH 5JW5A 4JJ5A 1R3JB 2V7NA 3TVMD 5I1GL 1EJ6A 1NMAH 1UCBL 5IFAH 1C08A 1CG9A 5IFJB 5FUCE 3WNKA 5EOCJ 3KLHC 4WO4D 4NZRH 4YHOH 1R5WA 3QDAA 3UJJL 4M9OA 2DLIA 5DD0L 3NGBB 4WI6A 2H8PA 3LOWA 3WUWB 5I15H 3NA9L 5E2VH 2ARJQ 4WWKC 5E1AB 5EORL 5TE7L 2CUIA 3OBAA 4XT1C 4HUKB 3FT2A 5IKCA 3BKYL 1K8DA 1XF1A 4F57H 3FT2B 2CRZA 2DIAA 4PY7B 4FXKB 5JOFA 5KS9A 4PIRF 1KCRH 1T20B 5B3JE 1V8HA 2R1YA 5DGQA 4PY8I 4YX2L 1KENL 4XI5C 2EDNA 4U6YB 3Q48A 4AIZB 2OTUB 4CN1A 1P7QD 1ZXQA 4L29B 4K3DL 2FX7L 4PRHE 3DX9B 5A2LH 2OZ4L 4LDEB 3BPLC 4GKNB 5L0QB 1KT2B 4NO0A 1BX2B 4PV9B 3MRDB 5HDLA 3TT1H 3P4NB 1CT8B 4J3UA 4UUJB 4N8PA 1CGSL 4OZFB 4Z7VE 4BSJA 5ETUA 3SDDC 4HUVA 4QHKJ 4GBXC 3SDAC 4MDJB 4UINH 5CHNA 2HRLA 2RQ8A 4I3GA 3SDAB 3QBTB 2Y07H 2DYPA 4JFDA 4RGMB 3U46A 1QRND 3NAAH 5IG7B 1MJJA 5CP7B 4WVRA 3T09A 1YEHH 1M05B 1OSPH 2VLLA 3HCVA 1CU4H 3P77A 2E6QA 2HLAB 4XTRD 3EDJA 2VDMH 3HG1E 4JPKL 4LDLB 3MJ7B 1W0WA 1NAMA 2A6DB 2NY4C 3VFVA 5KVGH 4U1IA 3HC4H 3GMMB 5HHOE 4PR5B 4D9RE 4PJ5E 3VXTA 2FH8A 1IAOA 2VDKL 5I19H 3LRSA 4LF3B 1W2KT 1HKFA 4MXVF 5IROC 1UXSB 4LVHC 3PABB 2E9WA 4NRYB 1FFNA 3ZT5A 3BP5A 3AC0A 1OPGL 5DUBA 2D7TL 2X10A 2R56L 1WK0A 1MFDH 2DLFH 1UXSA 2FSEB 4RDQF 1BZQK 3K81A 3MRNB 3QO1B 3K8MA 4YFDB 3CU1A 3U48A 2CRYA 4QOKB 1QLEL 2DI7A 2DLEA 2PF6A 2H3NB 5IBTL 1KCUL 1ZLSH 3HE6C 2BHUA 2NX5D 1FN4A 3NCYS 1A22B 3B43A 4NGHH 4KV5E 4P2QA 3HAEH 4JFOB 1WVZA 3G6JE 3UZQA 4ZUSB 1KCSL 3GMRA 3TZVD 4R7NB 3CCHA 2A9NH 5C0CD 2V5SA 3JVGC 5DC0A 4KKNA 4MA1C 1Q9WB 5A2JH 4OD3L 3UP1A 1VGKA 1GAFH 3CH8A 4JFXA 5H94A 4QXTB 1AFVH 4JM4H 5FDWB 4RAVB 4YZFE 5LWYL 3I6KB 2ZUUA 3PJSA 1UKSA 1BHGA 5FYKE 4ODHL 3S5LG 1RUQH 2AJUH 3UTOA 3IRPX 3G6AA 4GW1B 2FJGA 2A77L 4X7SL 3VFUA 1PGRB 4OLXH 4L8CB 1U3HB 2IC2A 1FCCA 4O5LL 2E6JA 3OSKA 3B6SB 3L5XH 1G84A 4P46D 1GGUA 4M1DL 3RNQA 2QQLL 3Q3GB 3QHFH 1J8HA 1FNGB 5FYJD 1CGTA 1XGUA 3TZVC 3VRIB 4HH9B 3KYKL 1Q1JL 4NO3A 4PJCB 4N0FA 5F1IB 4WJ5A 1J10A 1J0IA 2XQBL 4RIRB 4P0DA 5EIVA 4M1DH 5JO5B 5MHSD 5A40E 3MRGA 1I3RB 4POYA 3RZCA 5LXGL 3X13B 5KSUB 4PJGB 3TEUA 3UO1L 2A6JB 3WN5B 2O5XH 3BT2H 1A64A 2DDQH 4JAMA 3V9FA 4LSQH 3NVQA 1JN6A 1LK2A 4NM8H 4DVBA 5C8JB 2A1WH 5IG7A 2LVCA 3W39B 1PD6A 2J3SA 1BJ1J 2IANB 3DVNB 2VL4A 5DQJA 1W72L 4P46C 1F97A 5BZWB 3PGDB 3THMH 1MFCL 1RVFL 1S7UB 2R23B 4X6BB 4HJGB 3PHQA 3IXTA 4H1LH 3QRGH 3ARBD 3GFUA 5E2TL 1G0DA 5L7XL 4U6VH 1S5HB 2MMXA 4F80A 5J06A 3EO0A 1CGYA 2IWGA 3QO1A 3WYRA 2BNQD 2HJFB 1B4JL 5GS0D 5DK3A 2KQNA 1FFNB 1TZGH 5DDHB 3PL6B 4CDGC 4UINL 2HWZL 1AR1D 1X6NA 4JVUA 3C2AL 3KPOB 4TVPD 1X44A 4ISVB 4QCIB 3T77B 5FM5M 2DMKA 1YNTA 1NBZA 5SX4I 4N8CL 2NY0B 1AGFB 2M8XA 2CXGA 1EHNA 1OGAB 1TVBB 1B0GB 1U6AH 4EN3D 4TQEL 2X09A 4Z77B 1X6LA 2IADB 4MNQD 2NPLX 2NY0C 3LKRB 4LPWA 4M8QA 2NTFB 4GW4B 3VXTB 4YFEA 2XPGA 4JFXB 2AJVL 1SBSH 5E9DB 2NX5E 1J11A 3H6JA 1MRFL 1BBDL 5C9KA 1KENH 1N5AA 2YKLL 4G80B 2BMKA 3PE9A 5FA4B 5GS0C 2V5MA 5GGQL 1R0AL 5KSBB 4U1HB 5L88H 1FBIH 3MR9A 4ZO6A 2CDEB 1TLKA 1UM6H 1AR1C 1ITCA 4JKWA 4X9FA 5LQBL 2UZIH 3OKDB 4J3TA 5F9OL 5L8KB 4F7EB 1QSZA 3V2AR 3RWEA 1KIQA 5EZOL 4F2MA 2SEBB 5J1AB 1WAAE 1XT5A 1VADB 2NTSP 5JW4R 1MCOL 4LQ1A 4DGVH 1SY6L 5DK2B 2FIRT 3RHWF 4XWOD 3T0DA 3NOIA 2DN7A 4D9QD 5GGRY 1UWXH 7FABL 1KLUA 1UENA 5FHAH 5ANME 2BOBA 1BD2B 3CUPB 1T4KB 2O5ZH 1QZ1A 3EOBA 1YC7A 4HV8B 1WAAA 5CWSA 4GAFB 2BNUA 4HC1A 4MCZB 1E27B 4PY7A 4PJFE 1OTSD 3L3IA 4JFQA 5JNYA 2R4SH 2YSSB 3MRFB 3SE9L 5JLZB 5L8JB 2EIDA 1KEGH 2X1PA 3RVVC 4L1DA 4KJQC 2EXYC 4OF8A 5JMRA 5J13C 4KK6C 2XKNA 2K3TA 1CFTB 4MD5A 4QOKE 5TF1L 1ZT4A 3BP7A 2YBRA 4JO4L 3WD5H 2AI0H 1I1CA 3OMZA 1B88A 2DBLH 5HVWA 1P6FA 3NPZB 3TBTA 1PG7W 5F6HI 2GITA 1F90L 4ODUA 1KGCD 1YNLL 4CNIB 2HFFB 3S34H 3QDJE 2VZTA 1KIQB 4F2MB 1MVFA 2NNAA 1DE4B 4KRPB 1UZ8A 3QDJD 3EYSL 5DSCB 5CLTA 3VGHA 3CK0H 2NNAB 3FRUA 1LO0H 4Q7DA 4M7ZC 1T04B 3QIWB 3K3QA 4PRIA 4NNXB 4PJDB 4I3SL 1JPFB 1TETL 2DQHH 4DGYH 4ONHA 3QIWC 2HT4C 3NZ8A 2KZWA 2DD8H 3QH3A 4FN0A 4ZUTA 3SPVB 3HC0B 1MQKH 3VH8B 2Z35B 2LAAA 4O58H 1ZGLA 1ZA6B 2DM7A 2DWEB 1HQ4A 3EHBC 2XKNB 1J9CT 1WV7T 3PWPB 4G6KH 5JA8B 2Q7YA 2QQKH 1N5AB 3NA4A 1IAOB 3VXMD 3BGMB 4C56D 5EU6E 4B41A 2MSPA 3P4OB 3RIFK 4TOYL 5ACMA 1BFTA 2XPGB 3VE0A 1OARL 4KZDL 3BGMA 4G8EB 2ZWLT 1HILA 3UDWC 5AYUH 1ZKAA 1HWHB 3EJYC 3WXVL 4F9PA 1WF5A 1KULA 4JDVA 4Q9RH 1EH9A 2DWDA 1R24B 3IFLH 3MFFA 4I4WB 5HHXL 3VXSD 3FQRB 4Y4FD 1SBBA 1N8ZB 4H25B 4PJFA 5F3BA 4RBPH 4QT5A 3RIFF 4G42A 5TFSH 5I76A 2UVFA 4NWUL 3P73A 4P4KD 4V2CB 5I71B 4NPYB 5C0AE 1GH7A 3GSNA 3BHBB 3U7WH 4J4PA 2SEBA 3THML 1ZLWH 1A7PH 3C2SA 1MREH 3W2DL 1AC6A 3QHZH 4S1DD 1BREA 4L8SC 4AEIL 2C3HA 2X9WA 4JY5H 3U4EB 1ZK9A 4Z7VF 4K7FA 4EXKA 4RNRA 2AGJL 1G6RA 3QHZL 3U7WL 1H5BA 1WQVT 5KVDL 3AS2A 5C0AA 5IM7A 3GHEH 4JANA 1QG3A 3EJYD 1I8KA 4ZTPL 4XAWL 3B83A 5F1KC 1CGWA 4YGAB 4LCUB 5BS0A 1KCSH 4QRQB 4KQ4H 3H9HA 1RZJC 4QWWC 2HN7A 4P2QD 3MLSH 2A9NL 2ZNXA 5KSAD 3FOMB 1PX4A 2DWDB 4I3RH 4NWTH 1A8JH 2P8PB 2W91A 2NY5H 1BD2E 3DV6B 2VLME 1BF2A 3P3YA 5BRZE 4MX7B 2VKXA 4NQDD 4MD5B 4ZFFB 3ARFB 3QXAA 3OKLB 2RR3A 3GSRB 1FNGA 4S1DC 3ZE0F 2HKFL 3O8XB 3VWKC 5FB8B 2D4DA 4UB0H 1GZQA 4KMTL 4PTUA 1MAMH 4LSPL 3FQTA 1DN0B 2F54B 5MEQA 2QQKL 1P7KA 4NT6B 1RQ5A 1C5BH 3GHBL 1QPPA 2BK8A 2WBJC 3HAEG 4MB5A 5GSVB 2PTUA 3DV4A 4GG6E 1TIUA 4CU8A 4RAUB 3ULVD 4MA7H 4YBLC 4A6YH 4G5ZL 3QIUD 5JZ7D 1S7VB 2FX8H 1ACYL 1I8IA 4XP5H 4BZ1H 5T3ZL 1A6ZA 4KWUA 3DIFA 2EDRA 4MS8D 3BPNC 3GMLB 3QFJA 4K94C 3MOAH 3HS0A 3JWOC 4QHUB 1BD2D 5EUOB 3MXWL 3GIVA 5D6CA 4P2OC 2R23A 4X6BA 3VWKD 1T7WA 4YIQA 5ICZA 4ZDHA 2VXTH 3Q6GL 2Q3ZA 3NPSC 4TNVF 1BQHG 1A3RL 1GRWA 4FG6D 1NCUA 4IMKC 4KZDH 4FP8H 3F8UB 4N1CA 2ICWI 4LEOB 4XBPA 1JFQH 2H32A 2ZZUT 3MUY1 3RWHB 2FX9H 4R4BA 5T5FL 1HH6A 2AJSL 3BFOA 5D1ZB 1U36A 3HUJA 3MNZA 3WFEL 1DQDL 5ISZD 1A6WL 1DN0A 2F54A 2VSDA 3OGCB 4YQXH 3HB3D 4YHIB 5IIEB 3SE9H 1U9KA 3KPTA 3LN5A 4JO2L 3DRQA 3GSXB 4KROD 5EO9B 4BUGA 4JVWA 4XI5D 1BD2A 5F71A 2AV1A 1EUTA 3V4UH 1F5WA 3CX5K 4MNHB 1T0MA 1RUPH 2CLVA 4KRPD 1MUJB 3V0VA 3MRPA 5D7IB 1AKJB 3HE6B 5K9JL 2D7NA 4GKZA 4OLUH 3SQOH 1MEXL 4HQQH 3LH2L 4OI7A 2N1KA 4MQXC 3IU3A 5TE6L 2F5AH 3RY4A 4WEBH 3GO1L 2UWEB 5D1XB 4IMKA 2AI0L 2E8ZA 4GBXD 3C6LC 3B9VA 3DRTB 3QZWA 4MJ6B 2X2YA 1KGCE 1NCTA 4PJAF 1FNAA 1JRHL 3VI4E 1F4XH 4HJJH 1P9MC 1FZOB 3L3OA 4P5TA 4KROC 2EEAA 4NKQB 1FJ1B 4ESKA 5H35B 4WU5B 3QJFA 5E7BA 4H5SA 3IFOB 4OF5A 2QL1A 35C8H 3PNWA 5FKPA 4X5WB 5D7LB 2R2EB 4RZCA 1IC5L 5GJTL 2AQ3A 4ONGH 1NGPH 2P7TB 4LSUL 1F58H 4AL8L 4FZEH 4M7ZB 2QR0A 1AKJA 2VQTA 1PVHA 2P48B 5EU5B 3RTQD 1L9MA 3I6LE 2YA1A 5MEQB 4JKKA 2WBJA 3QXUA 3EZJB 1NCBH 3MRPB 5D7IA 4NZTL 3BN9D 1A3LH 3IB4A 4L3ED 4LCYA 4XBEL 4RFOH 4IRSC 4MWFA 3WNMA 2P8LA 3MLXH 5HGHA 2DM3A 3C5SB 3IXAB 4OM1L 1DBMH 5DA0B 5FKAB 4JZOA 4B5EA 1XCTB 4J3VA 5I8CB 3VD3A 5IMOB 1SVZA 5KVEH 4C57C 4XP4H 5HI5C 3JTSA 1DBAL 2QSVA 5E00B 3SQOL 1C1EL 2I9LA 2WBKA 4W6YB 4EXPX 4U6VL 5IKCB 4JM2D 4KQ4L 1CIDA 1HHKA 4N90E 1AGDA 1HH6B 5ICZB 2EO1A 1FZOA 2YPKA 3L3OB 8CGTA 4OZGE 5F9WB 3V0AC 4HIHB 4YHZL 4OZGF 4HBCL 4DFHA 3SEPA 4UDTA 2CDGA 3X12B 1IILE 4UIMB 3REVB 3QNYB 1WCBB 4XMLH 3VFNA 3GGWB 4S2SB 1D5BB 2PW1B 1MREL 4LASL 1KC5L 2PNDA 3HI5L 3PWUB 3TO4A 4JY6A 3OF6D 2HG5B 4L8SA 4PJAA 4U6HB 4Y2DC 2X42A 2B7DT 2OBGA 4R0LB 1DUYB 1FFPA 1DL7L 2V2WB 5HVHC 2HG5A 3P9WB 4PJAB 4YHNA 3DURB 5FUZL 4J4PC 4HS8L 5FGBC 1Z5LA 1YMMA 4K2UL 1P7QB 1AD9B 4FQ1H 4NQXB 2J5LC 5DRNA 4PGEA 4JRYB 4WWKB 1GOHA 1NBQA 3RX7A 4F7TB 4TVPE 3TCLA 4FQ2H 3WFHB 1J1PL 1JHLL 1Q1JH 3KPSA 3TJEL 1HXYA 4G9FE 4LK4A 5I1CH 2V17L 5IVZB 4F9PC 1IKNC 3TH4T 1K8DB 3WDJA 2NW3B 4QTIH 5GXBB 5IVXE 5D96C 2C26A 4KAQH 4PRPB 4GMSH 1T20A 4U31A 4XMKH 1MJUL 3ARFA 4Y1AD 2R0LL 3IDXH 1UGNA 2AJXL 2C3WA 4Y2DD 4BZ2H 1BWMA 1X3DA 4KDVA 1ZSDA 1RURH 2L7UA 1OD9A 1NCDL 3BD3A 5DJ8B 1I8MA 5T3ZD 3LV3A 2ZSVA 3GSWB 3FRPA 2FLBT 2DDQL 4M4RA 3BWAA 1YDPB 5HDBE 4KAQL 1F13A 5MENA 1FNHA 1X5JA 2X89D 2Y25A 4OT1L 4QO1A 5I1KL 2C4FU 2O61A 1EXUB 5JOEA 3PHSA 1NCNA 1HHGA 2ZPKL 4WO4A 4YHNB 3VFPB 1WWCA 1YA5A 4HCRA 1P2CA 1KN2H 3ZKXC 4NP4L 1A7NL 3H0TB 5F1OB 4JKPH 2EXWD 1BFOB 3FQUA 1LO4H 2ZG1A 3L5WA 4FFZL 1CL7L 5E8PB 5IB4B 4I0PB 1E4XI 2XKUA 2EE9A 5HYJA 4N5EC 3GMOA 4YJZL 4XAWH 5FGCE 5J12B 5FO9B 3SKOB 1N5YL 5GISH 3TC9A 1AIFA 1BOYA 3DHMA 4CBPA 2F8VA 5D7KE 1G0XA 1H0DB 1QHPA 3LD8B 3JUYA 4MXVE 3TIEB 2HTLC 4S1RL 2BHYA 4Q97A 1JHKH 4TUJB 4L4JA 4XP1L 5DQDL 3DETD 4P3WA 3FAWA 3VD5A 3GBNL 3GKZA 4HKJA 1D5ZA 1HEZA 4J3WA 1CXLA 1VHPA 4OFVA 2BVPA 4EVNA 2O5ZL 4HF5H 2A73B 3DUHA 3MUGA 1ADQL 4R4ND 3WL9B 3IKCA 4ELKA 3MBEB 3DURA 4N5ED 5H8DA 4PRNB 1YEGL 1CDCA 5DRNB 3OKMB 4Z95H 2ADFL 2N7AA 2IG2H 3HE7C 3JV5A 1J1OL 5C09E 4EDWL 4M43L 3NFPA 2YZ8A 3IDYB 3V6FB 3B4NA 2H2PD 1OVZA 1RV6X 3RKDC 3VXQB 3TN0B 5JPMA 4X83A 1XGTA 1CGUA 2ATKA 3ZMRA 5IMMA 4Z0XB 5FHBL 4NNPL 4Z7OF 5AAWA 2GJZB 1GYAA 5C8JA 3KGRA 3EFDH 4FZEL 4UTBH 3RUGE 3NABL 1NJ9B 3LHPL 2JELL 3LKRA 3NCFB 4U1LB 5KVGL 2YPKB 5BOPA 4LLQA 3HNSH 4TUJA 2JK5B 1Q9OB 1YQVL 4XPFH 1HI6A 3PP4H 2OJEB 4JFEB 5FDYA 5EBMA 1MFBH 1NEZG 4K94H 3A6CH 2NXYC 3D25B 5I73C 3A6OA 1LP9B 4HS3B 1Z3GH 1IMHC 2LU3A 3RVVD 2H2PC 3G5ZB 4PREA 4ZFGL 1LK3L 5AZEL 5AAMA 2XV6B 5CD3B 3OR6A 1C5DA 4ZOBA 4X6FA 2V5TA 3BPCA 4XMLL 2ICWJ 4HH9A 5GRVL 3VFUB 3V52H 2ESVD 2CLRB 2ITDA 1JWSB 3U4BH 4X6DB 3DXAA 1N7MH 5EO1B 4R26H 3U9PH 5CSZB 1EHLH 3IDJB 1Q0XH 1SYVA 5FAAA 5DK2A 2R2BB 5DI8B 4ERSL 4LARH 4ELMF 3DWTA 1VESA 2ENSA 4XVTL 5DYOA 5FXCH 2ZG3A 1UFUA 1UCBH 3O3AB 5IFAL 4OGAD 4FTVE 1C1EH 3U7AA 1DSFL 1EEZA 3CXHJ 1KSRA 2LTQC 3TBSB 4NQCE 3RDTB 4P5TD 5DMGC 4RAVA 5E08L 3QYCA 1T1XA 3F6LA 1FJ1A 3HMWH 4P59H 3C60C 5H37H 4FABH 3OGOE 2HT4D 1FPTH 2CK0L 3CFEA 4OTXH 2CK2A 4WUUD 1MCSA 3DVNA 2IBBA 5FA4A 1F4YL 2WUCH 1J18A 1VKXB 2CK0H 4XNMB 4Z76B 4PJBA 3STLB 3WIIL 3HAEA 5JOPD 4EEEA 3BISA 3WXWL 2MQCA 1S7TA 3FB8B 3OKMA 4MQ7B 4AMKL 2AEPL 1F3JA 3G6JF 4J3XA 3QEUB 3QUZD 1YEDB 5JR1L 2DQJH 3MODH 4X9IA 1UQSB 2K9UA 1LMKA 3QQ3A 3BJLA 1KTDA 5CJXA 4U7MA 2I24N 5EZJA 2FHBA 2DQFB 1NGYA 3GSNL 4XNYH 5KAQF 3T4AB 3D2UA 1MLCA 3SGEI 1FH5L 4LPCA 1A3QA 1LE9A 1NGWA 1S7QB 1KACB 2BNRE 4XNMA 4UDTB 5ICXA 3LB6C 3DVGB 3MJ7A 3OF6A 1UH3A 2XZQL 4KKBC 1SYSB 3MV8E 4HPYL 1CICD 3BSZH 1UJ3C 2DQUH 5D2LF 3HNVH 5DC9B 4AK1A 2AJYL 2WV3A 4KTDL 5D2LE 4LU5L 4JHWH 3O0RH 4NNYA 2I5YL 3QIUA 4L4TA 4WI9A 1BFSA 5ITFB 4UUJA 2V2XB 1RHHA 2PYEE 4KRNA 4WFGD 5B22A 4FQJL 1OAYH 3SY0A 2AV7A 4N0FB 4BQ9A 3QG6A 5GISL 4NBYB 4DN4H 3RAJH 3DI3B 2V2TB 4UT7H 1DBKL 5DJDA 2XI9A 4FXGA 4NPYA 1QFWI 1SJEA 4PYGA 1IGTB 5DJDB 2D7MA 2YUZA 4NO3B 4PJCA 5I19L 1CL7H 5EC2A 2VAAB 4IRJA 3U9UA 4RQQA 4YHKL 4K23L 2QKIA 2RCSL 2CXKA 5CJQH 3KXFA 5SWZE 3RL2A 1YNKL 1Y18B 2VR5A 2EDDA 1WTGT 3SE4C 3N1QC 3FFDB 2BVOB 1L7TH 1RK1A 1YEHL 2HFEB 43C9A 3QSKB 3ARSA 3GB7A 5I18H 4XP1H 5DQDH 2GTZA 3GIVB 3ILQC 3LHPH 4KI1A 5D6CB 5E8EB 3QB7C 1FV1A 1ZEAH 2ZKHH 3JBG7 3V6OC 3ULSB 1DEDA 1DUZA 4KQ3L 4RBPK 3RKPA 4DUVA 4YZFF 4HWNA 5TGBA 3B9DA 2VXVH 1MIML 4DEPC 1IGCH 4POUB 3F5WB 5BO1H 2Y5TA 4HWBH 3VGBA 2HJKA 5I1DA 3SDDA 2RGSA 4X7DC 5T3XH 1RU9L 4LSRL 5D1QB 2P5EB 5HHPB 3VH8G 5F1IA 4C58B 2F8XC 1B0RB 4UNVA 2W0PA 1P7HL 2FBJH 2EE2A 3T2NH 3DRQB 3GSXA 3BH9A 1AD0A 3MREA 3LPFA 4U6YA 3MGTA 4PB0H 4M1GL 1I3VA 5B4MD 4EIZC 2UYLB 4K71B 4XCNA 1U0QA 1M6OB 2BCKA 3FZUD 3CFCL 4NC2B 4OLVH 4PR5A 3EO1B 1A6UH 4AZ8A 4FNLL 2JK5A 5GS2D 4M8VA 3T2NL 4LRNL 3VRLF 5M94B 1NAMB 2Q7YB 1K2DA 4CVXA 3DX8A 2EDHA 4R96A 4MVBD 3WSQL 3D3VD 5J1SC 3F7VB 1FNSL 2GJJA 3GMMA 2FO1A 1DZBA 1T66C 4ZSOA 4B7LA 1G7MB 3MJ9A 1MCPL 3KYNA 2DRUA 3LS4H 4NO0D 3BZEB 5IMKA 4NZRL 4YHOL 3FFCD 4HUXA 4DW2H 1CR9H 5E1HB 4JN1H 4R3SB 4L3EB 5CGYC 4LKXB 2CUHA 3MODL 4NQTA 3IDIB 4UV4H 4AJ0A 1QBBA 1KLUB 4NCC1 3MYJB 1MCWW 4PJ8B 3GBML 3HPJA 1WICA 3O3UN 4LMQE 5DYOB 4AMKH 4Q9RL 2M2DA 1P5VA 1GZPA 3V7AE 3AFLA 3HZYB 2X4QA 4TPRL 4PP1C 1KPUB 4Q6IC 1T5XA 5I6XC 2BDNH 4EUPH 3ZE1F 3UEZA 3IDMB 2F74B 2P24B 3WFZA 1WLHA 3OXSB 3SE8L 3ARGD 4CUCA 2B5IB 1WFOA 2KZ1B 3O4OB 1GHFH 1U8JB 3LPWA 2HFGH 1UXWA 1FYT