3OKLB

Crystal structure of s25-39 in complex with kdo(2.8)kdo
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
EVKLVESGGGLVQPGGSLRLACATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQSSLYLQMNTLRAEDSATYYCARDHDGYYERFAYWGQGTLVTVSAAATTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSTGVHTFPAVLSSDLYTLTSSVTVPSKTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords S25-39 Fab (IgG1k) light chain
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
total genus 44
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2010-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oklB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3oklB01
1M71A 4PG9A 1Z9OA 1XEDA 3V5KA 1B0RB 5EFIB 3ARFB 1WBZB 3O45A 4QOKD 1RVFH 3PABA 4P2RD 3L5HA 3K2MC 5I1JH 3L5XL 3ARBB 4LCWD 3F5WB 4EZMA 1C7TA 1UA6L 5HYJB 3P73A 2BNRD 1RULH 2YKLH 3GSNL 4BUGA 2WIMA 1QRND 3ARDA 3BDXA 3SCMA 5AUMB 1PQZA 1XR8A 3H2WA 3ZSTA 4JFYA 4Y16D 4Z7VE 5FECB 1XGQB 5I74C 3UZEA 1I1AB 3CVHB 2Q76A 2X42A 4NFBA 3MX0A 3WHE0 1B3JA 5EWIL 2AK1L 2Z31A 1XF3B 4M8QB 5CIPH 3S34L 3QCTL 5DMIH 1IAOB 4EEEA 4MS8D 2XWTB 3DVNA 4AQ1B 3QNXA 1CLOH 4PTUB 4JFZH 1QSFE 5TDPA 1WBYB 4J3UA 2NY4D 4V1DE 5GGQH 4EDWL 1MJ7L 5CSZB 5GGRY 1YYML 3DYPA 3OKEB 3V0AC 2EKSB 4MQSB 4U1SA 5JOFA 3WS6C 2V17H 1S9XB 3M17A 5AAMA 5L8KB 1IMHC 4JFDA 3KPSE 3LV3B 2XNAB 3RNKB 1MCWW 3L9RA 3VFSA 4YAQB 5ANMA 1JHTA 1F58H 4KK6D 5MEOA 3HZVB 4OFKA 1RY7B 2EXWD 5JR1H 5SWZE 1TJGL 2VLJD 2QQQA 4L3EA 4PYGA 2EXYD 1T89A 4GAJH 4EN3A 3BKCH 1RZJL 2VLLA 3BQUA 2GJ6A 3S4SA 3LRHA 4M9PA 4MD0A 2AK4A 5J6HB 1E4WH 3BDBA 4KK9C 4ZXBD 4F3FA 4QXTB 4NQVB 1FDLL 2XY1A 4FTVE 5HHOA 2RR3A 2XTJE 1MIML 5CJOH 1MHPH 1WAAA 5CZXD 3PWUB 5IBUB 3WIHA 5CD5D 5SX4H 3GI9H 5ESAB 3J8F7 4RISL 2AGJL 1ZE3C 4K7FB 1RZ7H 3ARGB 3SO3C 2D9QB 3IU4L 1OY3B 4KKNA 5C0RL 3BN9D 4U05A 1KPRA 3MMEB 4PV9B 3WUWB 4WCYL 4OUUA 1XIWB 1AR2A 4J1UB 3P0GB 4O58H 4MA3A 5E5RB 1F8TL 1WFUA 5GGVY 3VDAA 1FIGH 4GRLC 4FQCL 1MHHA 5IK3B 5F7DB 4L4TE 3ALWA 4P5KA 1NBZA 1Q94A 2BP3A 4QXGL 4DQOL 2H1PL 3J7HA 4WI9A 3RBGA 5DEFA 3RIFK 3EOBA 4P4KB 2OI9B 1EO8H 5CKGA 5F9OL 1OQXA 3MGAA 5BO1L 5IW6B 1ITCA 1MCBA 4ONHB 1YC8A 3BP5A 5JIHA 4MNGE 2NY6B 4D9QD 3EHBD 4K8RH 4DFHA 1QSVA 2KPNA 1CD0A 3EDKA 4UAOB 3TBVB 2DQCH 5C07E 4NKMB 1F45A 1KCVL 3BP6A 5A16A 5ICYA 4LBEA 1RIHH 1S7TB 1T2QH 3BXNA 3QEHB 5D7IF 1FFOB 2X40A 3CSPA 2WK2A 3VXSE 3CDYA 4OZIB 4AMKL 2W0FA 4LDOB 3KYNA 3BZFB 3QFJE 3LQAH 4UQ2B 5D7LD 1BQUA 1JTTA 1HI6A 1OGAE 1JPTH 3PDGA 4ERSH 4OZFA 3BW9B 2NXZB 1U8HA 1A4JA 1T83A 4QHUB 5FAAA 3WIFA 2GQHA 4R90H 3SE9L 4OZ4B 3FHAA 4YDKL 3EYOA 1QFWL 3OHXB 4WEBL 3TEUA 2OZ4H 1I8LC 3EOAA 3GBNL 5TFSH 1VFBB 1K5NA 1IGJA 4W4OC 5D1QC 4DOHB 4WY7H 4ZOBA 4G6AD 4PBXA 3K4DA 4WNQB 5KVDL 4XMLL 4HK0A 1KJVA 1U8QA 2YUXA 4L29A 4XNUH 1URLA 1XF4B 4X5WB 3ZDXF 3ARFC 3U0PA 1DJSA 5DJXA 3ARBC 4XB7A 2R39A 5GRJH 1T03L 1MI5A 2BVUA 2KDGA 1OSPH 1T1XA 4HFUH 3RX7A 3RHWK 2G75B 4FXLA 4BZYA 1YQ2A 4NPYA 3TCLB 4WW2A 4XPFL 5GGUA 3NTCL 5CGYC 1U8NB 1I1AC 4YFLF 3QT2A 2R2HB 1BOYA 1OP3K 2YEZA 2XACC 3V5DA 2ZZUT 3BO8B 2AEWA 3IETA 1QLEL 2R2EA 3LQZA 3F12B 5JW4Q 4N1EA 2NCMA 2R56L 5BS0B 4N1HB 2WM0A 3GHEH 5DC4B 4YHML 4JO4H 2VMFA 4HUWB 3DX6B 2V5MA 3HE7D 5HVFB 1GH7A 4F9PC 4IEFB 4NNXB 4AQOA 4DKFH 5E5UB 5DVMA 4NZDA 1DLHB 4YGVA 5B3JF 5M7QA 3FB8A 1F4AA 2B2XH 3HMXL 4HX1B 43CAB 5I8EA 5JW5A 1RUKL 3STZA 5J8OA 1NEZA 3DV6A 4O9HL 1HINL 4JG1L 4AM0B 4OI9A 3L6FB 5DURD 1WC7B 4NUJA 5IBUG 1DDHB 1MCKA 1Q38A 4DUWA 1TZGL 1GIGH 1AD9B 3RVVD 1BBJA 5BMFH 2RJMA 2JJWA 4OLUL 4KDTC 1MRCH 5IEKA 4G7VL 2F54B 4ZO7A 2HP4A 3I3BA 1DEDA 4PJBA 3LEXA 3B5TA 3WUWG 5IM7B 2XTLA 4Q2ZA 3GMQA 4K55A 2R0ZL 3DVIA 2CSPA 2X1QA 4ELKA 3T08A 5DR5L 3TYFA 2PNDA 3WSQL 1FO0B 2PO6B 4M5YL 5E8PA 2P8PA 3ARGC 4OCWH 5I1EL 4R0LB 4A2LA 3PP4H 1ED3B 3F7RA 5EDXA 3UO1H 1XIWC 4QHKJ 1YEDA 3WJJA 3KPLB 3L5WA 2XFXA 3BP7A 4FQLH 5K9JL 2A1WH 5D5MF 4F7MB 2X2YA 5IQ9B 1RMFH 3BVNB 4HWEH 2DKMA 2MJWA 4UTBH 1QA9B 5E99L 3BKYH 4F58L 5D7JD 2VXSL 4P4KC 2OI9C 1I9JL 4R3SB 4YR6A 2BY2A 3KPOB 1AR1D 3NA9H 1YC7A 3SE8H 4CBPA 3L7FB 2K9UA 4X4ME 2FHCA 2NY6C 3MRMB 4P9HH 1P7QA 5EUOE 4UAOC 4N0FA 2MNUA 1I1FA 4LRIC 3LN4B 5HGAA 2PTUA 2WP3T 5GSRA 2FATL 2GJJA 3HPLA 4QKXB 2EC9U 5GSVB 4I3RL 3BMVA 1K4DA 1FRGH 3MYJB 4G9FB 4YXLH 5CILH 4I13B 4HUKB 3P4OA 3L3OA 5D1ZB 5DYOA 3GMLB 4MNHB 1DSFH 4TVPL 3V4UL 3QEGL 2IAMA 4IIQA 4CDHA 1ZA6A 4UOW1 4UT6H 5IIEB 1BZ9B 3CC5B 5FHBH 3RWFB 3SKNA 4LLMB 3OAYK 4LHJB 5MENB 4Y4HA 1KEGL 1VEOA 5L2KE 1FIEA 1A6AB 2MCG1 2G2RB 2NXZC 4Y4KA 4OFDA 5L6YL 4F7PA 5C2UB 1CIUA 4LSRH 5DS8A 4U1MB 5D96B 1F3JA 3HMWH 4J3XA 3SDAA 3RAJH 3IRZA 1VPOH 2GW5A 1Z9SA 5T1KA 4ZYKA 3FO1A 1C5DB 1E27A 1KOAA 1X5YA 4N0CC 4WI5A 3SPVA 2XICA 2QQLH 4M61B 2D0HA 5HPMB 1JVKA 4M4RA 1G7LB 4JB9H 5CGMA 5F93C 3NZHH 3LRSB 4FQHB 4RNRB 4PB0L 4W6XB 1U92A 2GT9B 5DD5L 4PTTA 5D70H 2EYTA 1XAUA 4UINH 2W0LA 2YRLA 2NY0D 2YPLA 1KIUA 4Z0XA 3U0WH 1BQSA 5BW7A 4O51A 3QQ9D 3IDGB 3NOIA 4OLWL 4NP4L 2VAAA 3OXRB 5HYJE 4N0UA 1UEYA 2EDYA 4NJ9L 4P2YA 5INDA 3IAQA 3OXSA 4EXPX 1A4KB 35C8H 1IAIL 3BOVA 4U6HA 4IDJL 4PP2B 5CP3H 1OSZA 1I1CA 3T3ME 1MJUL 4ZFOB 2QKIA 3EFFB 4IMLB 4XP9L 4XTRD 4ESKA 4F7CB 5C2BL 4LOUD 1IVLA 4BH8B 1FZJA 2RIKA 3HLAA 4LGSB 4M48L 4TNWF 5K59F 1KSRA 4XMPL 3MRCA 3VXPA 5FYJD 1DR9A 3ET9F 4UDTA 1I9IL 1GGBH 5L7XL 2OR9L 5JPNA 2OX5A 2R69L 1U3HB 4JRXD 4Y4FD 3SDDA 2GJZA 1YY8B 1ODAA 3ZDYF 2RCSH 1C5CH 2AABH 4M6ML 5KZCD 2DBLL 1JN6A 4N1CA 2CH8A 4G8EA 2ZUQB 4HMDA 4YO0B 5GRXG 1J87A 2DLHA 3E0GA 3LKRB 5ICXA 3U9UA 2FSEA 5IMLB 1T3FA 1A7NH 3W81A 3FB5A 4KVCL 4YPGA 2ZJSL 4OKDA 3T2QA 4OQTA 4APQA 1I8IB 3BWAA 4OZHF 12E8L 4PJHB 5GJTL 2C1OA 1E0OB 2DQFB 4TUOB 3P4MB 1B4RA 1G9MH 1MCWM 4UTAH 5IB2A 2K7PA 3D3VD 1N64L 2GHWB 4ZPVB 4JFEA 4MXVF 4XP1H 4NWUH 3PWPD 1ZLVH 4Z7WF 3IS0X 2PO6C 2PYEB 1X6NA 5HHMD 5INCB 1UACL 1FORH 4R0LC 3WE6A 2HMID 4X7DC 4HKZA 3BUTA 1AI1L 3GIVB 5CHNA 4HS6A 4GO6B 4PRID 4YUEH 1X5JA 1F4YH 1T20A 3QEUB 4JZJB 5HHVL 4ACPA 1NCWH 4LLVB 3VH8B 3P77B 4PD4K 3D69B 1AGEB 2FDBP 3GSXB 3BESR 3JTTA 5AYUL 2DQEH 4G80A 1Q0YH 1Z0MA 3K8MA 2H8PA 4MNQD 1MFDL 3LEYL 4ZSOA 4U3XA 5E6YA 1RQ5A 4NQSA 4EI5D 1TZIA 3S9DB 4IOIB 2W9DH 1BOGB 1MQKL 4C56D 2JE8A 1LP9B 4S1RL 4CVWA 1A9EA 3OKNA 3FQWA 4G8FB 1CT8A 2BX5A 3ZT6A 4XPTL 4DTGH 1O7SA 4LSVH 5E00B 5HHME 3LKNB 3ULSB 2IG2H 4K9EC 5D1ZC 4ODHL 4QCIA 4DZBB 4XNQA 4XC1H 5KVMC 4OSUH 3CMGA 3SGJC 1FNSL 4JPIB 4ZAKB 1G7IB 2H2PC 3UC0H 3ZHDA 5GZND 4CVXB 3SDCB 4Y5VA 1MFBL 4H0HB 3BIAX 3FFCD 3G04B 4POZD 4OZIE 1J1OH 4OD1L 5E8OB 4CN1A 2YRPA 2VN4A 2WBJA 1FPTL 2AJ3A 1B90A 1CFQB 2H9GA 5D96C 3M1BA 2DL9A 4HDIB 4HK3J 2F8VA 4G8GD 3IDJB 1XGTA 1S7UA 4LSUH 4HJGA 5MEPB 3HI5H 3T65A 3FQTB 4HIEB 4MSWB 4GKNA 5BZDA 1KENL 3FB7A 3WXVL 1XZ0A 3CD4A 5DLML 1P9MC 4V1DA 1F4WL 1CICA 5E24E 1HILB 1RUML 3NZ8A 3MACH 4FP8H 3D85B 5IGXL 4JY6B 4OJFL 3NH7L 3EJZC 4QOKA 1FNAA 1UQSB 4P2RA 1EAJA 3GSQB 4DOHE 1YZZA 4LCWA 1CG9B 2EH7H 3KPMA 2BNRA 1JTPA 5ITBH 4KJWC 2VN7A 1QRNA 4LCYA 2F8OA 4Y16A 3UTTD 1BIIB 2P8LA 1KEMH 1KPVB 2ADJB 3I50H 1CGXA 3WIHH 5C08B 3VG0H 5J9PB 3VWJB 2VDLL 4K3JH 1UWGL 4AK1A 2I9LA 4ZUSB 5DJ0B 3E1F1 3IKKA 4FMFA 4YQXH 4OFYD 1RUQL 2HTKC 1OP5K 3VI4F 2CDGA 4JDVB 3QA3B 1T2JA 1U8KB 2HT2C 3MV9D 1J05B 1F6AA 3KPRD 1L7TH 1N7ML 1AGFB 1EH9A 4UT9H 1CGVA 3OB0K 3S3JA 3EW3B 1U3HC 1S3KL 5BS0E 1GZQB 2A9MH 3FAWA 4PYHA 5JXED 1ONQA 5H94A 1LO5B 5D8JH 4N90E 2VQUA 5JQ6L 1ZT7B 3VFGL 2QADB 3BJ91 2ZUQC 5DVKA 2HA1A 2Q8BL 4JKKA 5D5MB 3T4YB 4U1HB 3H0TA 4NQCD 4O5LL 4UIKH 4H25B 3G6DL 1FG2B 4Z7QF 2VLJA 3BEVA 4WTXA 1WZ1L 2R4SL 2Z35A 5FK9B 2AJXL 3OKDA 4B7IA 3AU1A 3MRFA 3FO2A 4ZXBA 3DX8B 1YDPB 4HK3N 1CE1H 4YGAB 1RZKC 2WUBH 3SKMA 4U3CA 2C4FU 4DJMA 4OD3L 1CGUA 1BM3H 1KIRA 3MC0A 1DEEB 2R1YA 3L3DA 1DUYB 1Z3GL 4MXWH 3VH8G 4BFIB 3NFSL 2F54E 4FS0A 1DQDH 4CL7A 3L3HB 4QNPE 1CLYL 3ECBB 4F15B 4J8RB 4Z7NE 3T09A 4U1JA 1AQKH 3RVTD 3F58L 4LEXL 3HN3A 2HVJA 5B39A 1HH9B 4Y5YA 3X3FH 4QHNB 4WHCA 3JV4B 4JZJC 4MLSA 4EXKA 5CCKL 2DQJL 3DUSA 1RJLA 3MRHA 3O6KH 2JCCB 3LKSA 4LKCA 4HW6A 1JPSL 5EULV 3MLVL 5I16A 4JFHD 4LFHD 1UZ6E 1CTNA 4PJ5D 4RAHA 1G6RA 1ORQA 2CR6A 1I9RL 1B6DA 1VADA 1Q9KB 4HIHA 1WWAX 4F57L 1C16B 3EO1B 4JFQB 3ORJA 3RU8H 5T1LB 1P4BL 3IB4A 4AG4H 2F53D 1YEIH 3QISA 4ZDHA 5DEGA 3RI5F 1HXYB 5FO9A 1N5YL 4TPRL 2Y06H 4FG6D 5ERWB 2BCKA 1BJ1J 1VGEL 5DD1L 3QIUC 5IQ7H 1DE4B 4FZEH 5I17A 4ZAKC 5D7LA 4PREA 4G9FE 1T0MB 4X6FB 4MXQC 4UUJA 3BGMB 1ACYL 1VFMA 3SDCC 2CQVA 1IZJA 1IGYA 5GXBB 4KH2A 1BFTA 5J57B 3OTTA 4U4BA 4OCXH 2J8OA 1J5OH 3ULUH 5IEHA 4UILH 4LLDA 1NGXA 3KLDA 3HA0A 3LN5A 4JJHA 4IHOB 4M1GL 5EO1B 1F4XH 4KWUA 4X80L 4G7YL 1EK3A 3DV4A 2JJTC 2VDKH 3ZTJH 1T22A 5HDQH 1RD6A 3TLRA 4ZOCA 1I85C 2ZCKH 3QIBD 3CMOH 4S1QH 1HKFA 3VGDA 3WNNA 1BFOB 1GHFL 3WLBB 5CWSB 4KJPD 1ZLSH 3AM8C 1OT1A 2D0GA 2FIKB 4NZUL 1I7UA 3WNMA 1NAMA 5MEQA 4XPHL 2J12B 3CLFH 4MQTB 2IANB 3CVHL 3GMNA 2F5BL 4GAGH 4R8WH 1BPVA 4Y88A 3CDGA 2ATPB 3QDHA 1AXSB 2WBKA 1S5HB 3F6LA 3P2TA 3ULVC 1B9ZA 1LK3L 3WS6A 3NA4A 3P30L 2VWEC 4PJEF 2VKWA 1HHKB 2ZOLA 4ZO6A 3SGKC 2PTVA 5A3IC 4IRSB 1OF2B 2DMBA 2BDNH 2EIZB 3UJIL 1YEEH 1GVIA 3VWJC 4E0RA 5EB9A 1FGNH 5HGDB 3C6SB 2A6IA 5D7SL 1T1WB 1EGJL 4XAWL 3TIDB 5B4MC 3OJVC 4NO3A 3PWNA 3VFRB 5MP6L 3S88L 3QDMD 2Y25A 3EOTL 2ICWB 3BD5A 4WUUB 4ORZC 4PJGB 1J1PH 3ES6B 1IKNC 3LQMA 3HE7A 1EHNA 2VDML 3VFOB 4XHQA 2E8ZA 4JFXA 1WCBA 1J18A 4ZUWA 2JB6B 4AEHH 3D9AH 3T8XB 5F8QC 3SDXB 1MELA 1VACA 2UY7A 3GMRA 1S8DB 2R4RH 4XVTH 4X6CF 4QWWC 5C8JA 5JHDD 1JWMA 5LCVH 1A0QL 2QADC 2XKNB 2MMXA 1IEAA 1IGFL 3WN5B 1ZHKA 3QULA 1UM4H 5DQ9A 3VD3A 2XKSA 2BERA 5IWLA 4X83A 3FQNB 2GCYA 3O81A 3GJEA 3MNVA 5CZKA 3OB8A 1FAIL 4PBVC 1G7QB 4Z7OE 4WDIB 5JLZA 2M1KA 2L7UA 3U48A 3EJJX 2D4DA 1KLGA 4X4MA 1WJ3A 1NGQH 1NMAH 5EO9A 1R3LA 5C09B 4Y89A 2HJLA 2I9TB 3H7BA 2CO6B 4N8PA 4NC2B 1LE9A 1H9VA 2X1OA 1MCOH 1A47A 1XF1A 1I7ZA 3RY5A 4KU1A 4F15C 4GKZB 4P9MH 3BH8A 5EA0H 4J23A 5D6CA 3MLRH 4M1CC 5HTSA 1J0KA 3RPKA 2V7NB 4LPTA 1BQLL 2QR0A 4ZTOH 3U83A 3T1FB 1RHHA 4LVNB 2PYEE 4WHDA 1DBML 3PDOB 5D7IE 1JK8B 3PWVB 2E27L 3S3PA 4LKXA 5TDNA 2YS4A 1JI2A 5L2KA 4NRZB 4HBQA 1OTUC 3N50A 4ZNCD 5F3HB 3QI9D 4MA8H 4HGWB 3BPCB 4TVPD 2QQKH 1KLUB 1F90H 2PW1A 2YD6A 4LGPB 4Z78A 4PJ7B 1IGCL 2OTWA 1GGTA 3MODL 4NC0B 1DVFB 2OTPA 3UPRB 1H0DA 3MLYH 2A77L 2IGFH 4ETQA 5JDSB 2GTZB 3JVGC 1EPFA 4CNIB 4K7PH 2CUIA 4P3DA 4LPCA 3FO9A 3UDWA 3HFML 1FN4A 4F80A 4E42A 5C0CD 3CH8A 4I4WB 1JHKL 4F7TB 3D39B 1R6VA 4OF0A 3VXRD 3PV7A 1MVUB 3VGHA 4HS8L 4N5ED 5C6TH 3LD8B 1F6LL 1RPQA 1NMBL 4JFPB 1W8OA 3I3DA 3ZMRA 4BSJA 1F11B 3W0WB 3T0VA 4FZ8L 3ARFA 4JVPA 4WVRA 2W92A 4XCYB 1I7TA 5T3XH 2VZTA 4ALAL 4FQQB 2VJXA 3ARED 5D1XC 1X4YA 2YD7A 5E0QA 5LVEA 3S8WA 3MRPB 2CLRA 3G6AB 1AE6L 2Z92B 2GK2A 2XQBL 1NGYA 1CR9L 3QNZB 1FZOA 1UM6L 3LKPA 4ZD3H 1YJDL 4GSDL 1R3IL 3WFDL 4GAYA 5T5NF 3NABH 2IPTL 2C3GA 4KTEL 1MJJA 2ICWI 5E8DL 1JUFB 1UENA 3UJJL 3K2UH 3IJSA 1EBAA 1KCRH 4OQTH 3HC0B 4KXZI 5C0CE 5DC0A 1MIEL 1B0WA 3BT2L 1WBYA 3S36H 1K2DA 1VERA 5K9KA 2BJMH 2CIKB 2Y5TB 5FA4B 3MJ9L 1S7SA 4WFED 5E8EB 1SM3L 3VXOB 4JO2H 3UYRH 4G42B 2PYFB 3FONA 4QRTA 1MWAB 3LEVL 5JHLL 2O26U 3C60D 4IRSC 4RX4D 2MFNA 4TN9A 3D0LB 4IJ3B 3ULVE 4JHAL 3RTQD 4OCYH 3IJYA 1HSBB 4A6YL 3AS2A 3WFCL 1KN4H 2V9RA 4GBXD 2VWEE 2EDXA 2R0KH 5ITFB 1CU4H 1TVBA 3EYQC 2G60H 2VC2H 1T04B 2X05A 3KPNB 4ETYA 3Q3GA 4M9OA 3CCHB 1TJHL 2J6EA 3X12A 1UADC 4D9LL 2GTWB 2EC9T 4Y4FA 4ODXA 4ONFL 1PGRB 3SKOB 5IBLC 3MBXL 2P5ED 4PJCA 5L9DL 4F7EA 1J12A 1PX4A 3IDMA 4MDIA 4GS7B 4HCRA 5KVFL 3B9DA 2FWOA 2EEDA 1E6OH 3C2AH 5GS3A 3S96A 3MCKA 2CUHA 4WFEE 5IJKC 4GUPB 3BAEL 3NBNA 3G6JF 3QB7C 4G6FB 1RUPH 3TM6A 4ODUB 3WN5C 5CBAA 4NOFA 1A1NA 1F13A 1DN0A 5EBWB 3WEXB 3CPLB 4TOYL 5FOBB 3R1GH 4X7SL 2F8XC 2UWEA 1A7PL 5D5ME 3GMMB 5IF0B 4P4RA 4JPKL 2B1HL 3VMOA 2I07A 1CD8A 3O3BA 2WWMC 3D3VA 1JV5B 4HJ0D 1A6VL 3MRJA 4YHOH 1IC4L 4X7TB 4PRAA 3NCBB 1FE8L 3V4VL 2I24N 3PWPA 4NQXB 4PJFA 5KSBF 3WIIH 5I1IL 3QNYB 2ORBH 3KYKH 3WUZA 4YWGL 4BK4A 1IC7L 5IHZA 2P44B 2AP2A 2ITDB 1A5FL 2VLRB 1CGWA 3FFDB 1B2WH 4PRIA 4LVNC 4JPWL 4JJ5A 2M2DA 4GQPH 1RK1A 3MV8B 3FCTB 3SBWA 4N9GA 1OAXL 1IILE 3MLUH 2ZUTA 2EIDA 1U41A 5A2LH 4MD5B 1AGCA 1IEBB 1U9KA 3PL6B 3UZQA 3W39A 5T1MA 2YA0A 3L3KA 5GRUL 4MNQA 3A0OA 3BH9B 1T2XA 2E9BA 2GEEA 3HUJB 1UXWB 1DVFC 2JCCE 4EI5A 1NCCH 3FTGA 3NMEA 3QDJD 4ISVA 3SE3C 3VD5A 4WU5A 4HPOL 5EIQA 1XGRA 4HJJL 1U2CA 4R7NB 3U2SA 5FDWB 2WQ8A 3O41A 4FXKA 2W60A 3WJLA 4Z8FH 2VXQH 4TTDD 4UU9A 4HZLA 1UZ8A 1AKJB 5KAQF 3N9GH 3V6FA 3VFWB 2OS7A 5IKCB 5L0QB 2EDLA 3STLA 5IMOB 1VA9A 2C3VB 3H3PH 4X4YA 1RURL 4RFEA 2O5YH 5D72H 5DVNA 3UPCA 5F89A 3LD8C 4FRWA 2BSSA 4POUB 1C5BL 1NC4B 4RGMB 4BJLA 4KY1L 4EQ2A 4F33B 1RIUL 1JZ6A 1BFSA 1F5WA 4MQXC 3V7AG 3FFCA 4HT1L 5JORA 5LQBL 3JWDC 4U6VL 5H2BB 2HYMA 4M1DH 1JF5A 3O6MH 2VDNH 1FZKB 3GSNA 4KK8C 1EEYB 5L88L 3TCLA 4G8GA 3R0NA 4AIZA 1BLNA 3MUGB 1GC1C 3QHZL 4OAWA 3RZWA 4PB9L 4S1DC 3TT3H 1I1RA 5I1GH 4G6KL 3D87B 4MCYA 4Z7UF 2FH8A 1ITBB 3GUTB 5BS0A 3O2WH 3I84A 4N0YL 5IB1B 4RAUA 2X70A 4M03A 4F9LA 3HRZA 4OB5L 4YHKH 1PSKL 4KTYA 4RSVA 5EZLA 4C58B 2OK0L 3IF1B 4QTIH 4QRSA 5HVHB 4NKIL 3HZYB 4C83B 2NTFA 5SWSD 5CJBA 3U6RA 3MRBA 4O2FB 3U4EB 4RCAA 4FQPA 3UTTA 2IANE 4JZOA 4ZFOL 5HPOA 5TJWK 1WWWX 1WK0A 3T0ED 3SOBH 2IC2A 3TN0B 1SHMA 3PGFL 1AFVH 2IFFL 4IJ3C 4HKBA 1C08B 2HVKB 3VI3F 3O6LH 1KIQB 3FO0L 1A6UL 5FO7A 4S10A 3X13A 5ICZA 1EFQA 2D03L 4HXAL 1KJ2H 4JHWH 5I1DB 4OFYA 2FLBT 3FJTA 1CK0L 4EDXA 4QTHB 2HWZL 3VD4A 2ERJB 3IJHB 4PJXF 5IB3A 5DGQA 4XPAH 1UB6A 3MOBL 3RGHA 4KDVA 3MV9A 4G5ZL 2Y36H 5TE6L 3I75B 2LQRA 3KGRA 1HOCB 5H35A 3P9LA 4RFOH 5EH1A 3O0RH 3BJLA 4R4BA 4WUUE 5JXEA 2E7LA 4P3CH 4F37K 4PJGE 3UTQA 4GS7C 2HKFL 4U6YB 4KJYB 2QLVB 5SX4I 5B38A 1FFNB 3QPQD 4WHYH 1G6RH 5F7LB 3V0VB 2HFGL 1HHHB 1GZPB 4ODSL 3FQUB 4XCCH 1OB1B 3GMOB 1LDSA 2VYRE 1Z6JT 4NZTH 2HT3D 5FKAB 3G5XB 4NQCA 4MD4B 4CKVX 3LCYA 1CE6A 4YNYB 4HGMA 1JPFA 2AV7B 1WISA 5KG9B 3FQXB 3PNWA 2PKDA 3V6ZB 4ODVL 3DXAB 4NNYB 3RL1A 3BSZL 3TNMB 3HR5A 3KJ4B 4MMXC 3P11L 1NBVL 2CMRL 1YECH 1I4FB 2CK2A 4WI6A 4WUKL 5EO0A 1ZTXH 3JV6A 3RY6C 5LGHH 4FQIL 4HIJB 4HH9A 4NO5B 1KN2L 2ZNWA 1Q72L 1ND0A 4R3SA 5E9DD 5E6ZA 5EUKA 4OGXL 1A7OL 4B7LA 4BA8A 1MRFL 5EU4B 2A74B 2K3TA 2J4WH 1KCSH 4XNMB 5FF6B 2AJVH 5C09E 2DTML 1MJ8H 5JTWA 5I1CH 4P23B 2PXYD 4HUVB 3DWTA 2Y6SD 1AQDB 3VCLB 1LEKA 1BFVL 2R1WB 4AH2A 4XHJC 3GFUA 3RZCB 2I26N 3BZDA 1JPST 5IV2B 2QSVA 1I3VA 1IGIL 4XCEB 4D3CH 2VQ1A 2RHEA 4C57C 3PL6C 1NAMH 3CX5K 3LSOB 1NLBL 5IVOA 4C55A 4HIIB 4KRPB 4PJ5A 4LLMA 3RWJB 3ARZA 1IT9L 4NUGH 3T04D 3HI6H 1X5KA 4LSSL 3GSRA 2FX7H 2VH5L 3AXLA 5EU6D 5JZ7C 2F74B 5DJYB 5L2JB 2DQTL 2W9EL 3V0WH 1A64A 3EYUL 3RWEA 4K8RC 2F53A 4KFZC 4PJ7E 2ZSVB 1BREA 4NFCA 3TJHC 1ORSB 4Z5RB 5LXGL 1KELH 1C5DA 3I2CL 3OZ9L 3VXQB 3QUZD 4UZGA 2ADFH 5L0QC 5CLWA 2OJZH 2ED9A 5DJ8A 5FV1L 4PY7A 4X6EB 2MSPA 1N59A 2E7BA 4DN3L 3RWIB 4DWHA 1FJ1B 4L9LB 4D0BA 3ZKSD 4RGMC 4I3SH 5F88B 3D39E 1OM3H 5IHLB 2ZOKA 1I1AD 3CH1B 3LQAC 3P9MB 5IESH 2OTUB 3L1OH 4WO4B 4M6OH 3TIEB 5C9JA 1RZGA 3AFLA 2AJSL 5JQHC 5CGTA 1QNZL 4LCCB 3W0WE 3MTRA 1LNUB 1YEFH 4NM4L 4H5SA 5EU6E 2BXZA 3O8XD 3WHXA 2AW2A 1N2RB 4IDLA 1R3KB 2IF7A 2W65B 2X10A 1KTLA 3WFEL 3QDGD 4JO1H 5DRNB 1EEZB 1KTDA 4KQ4H 4KKLC 2KQMA 3VI4E 1J0HA 3O3DA 4QRRD 4P48A 3O4LD 4DKEL 5HVHC 4HFWB 4NC1E 2FZ3A 1A14H 5DGRA 3X14B 4MDJB 2AI0L 1HH6B 3G6JB 3LVEA 5IOPB 4WEMB 3V6OC 2OSLB 4KMTH 5GGRA 5GJSL 1YEKH 4KI5F 3K1KC 4MJ5B 4MX7B 3TN0C 1Q1JL 5CEXB 1VDGA 2IPKA 5DJAB 1NLDL 4MVBC 1I1YB 1PLGL 3NCJH 3RA7L 4FQ1L 2Y4SA 3I6LE 4ZUUA 2FJHB 5JNYB 2QQNH 3QDMA 4NM8H 5FV2A 3E6FA 4JHBA 2ITCA 3OGCB 5BOPA 1MCHA 4WWKD 3LMJH 2JIXB 2ERJC 3HZMB 5FA3A 2X9WA 3MJ8A 2V2XA 2I60L 1J0IA 1AC0A 2NY2D 3X11A 3MR9B 1A3RL 2CK0L 5LWYL 5IFHH 5JHDA 5DD3L 4X98B 1T7VA 1KIPB 4TUJB 1ZVYA 1D6VH 1LEGB 5D7IA 3MNZA 1RHFA 2DQDH 1NGZA 3QRFM 5IVNA 5I1AB 4YHLH 4NO0A 3BEWA 5EPMA 1IQWL 5HDLA 1PBYA 4H1LB 2CRIA 3DI2B 3MZTA 1QBMH 2HFEB 4HLZH 3ZZ1A 2GITB 4JZJA 3IVKA 2CJUH 4J6RH 4JFFD 1N0XL 3KJ4C 3WKMH 4QYOB 2ENSA 5DDHB 5I8KH 4R96B 1X5AA 5JW3L 4MCZB 1F3DH 4KI1A 1MCRA 1YQVH 5LBSH 3CXHK 4OTXL 4U1IB 5IFJA 5IVXB 4MQ7A 2V2WA 5AWNL 1CDIA 3H9ZA 3QQ3B 4GW1B 4ZS7L 5I19L 1R0AH 1BOGA 2ZCLH 3I02A 4NZRH 1NCAL 1QYGH 4XBPB 1BVLB 2N7BA 1BD2B 3VXMD 1OARH 2J1KA 4KHTL 1AXIB 1OAKL 4NRXA 3A6BH 1OGTB 4P23C 3WD5L 5BJTA 2DDQL 4U31A 4Y8DC 4HV8A 2AKRA 1VGKB 3S35X 3RIAK 1ZS8B 3RZCC 3I9GH 4X8JB 2B39A 1HKLH 4ZNEE 6FABL 4WTZG 2VLRE 1NDMA 3QIUA 4QT5B 3QI9A 3ZKNC 3H3KA 4JANB 4ZAKA 1G7IA 3DUUA 4PJ9D 2EDBA 4JFFE 5ETUA 3MV8E 1LEIB 4KRPC 5SX5K 2HJFB 1YPZF 1M71B 1UWXH 4PG9B 1C1EH 1IFHL 3V5KB 3G04A 4DKAA 1NJ9A 3O45B 3PABB 3IXAA 5E8OA 4BZ1H 1NUDA 1FZMA 3NIDE 3P73B 4KAQH 2E7HA 4X7CC 5GZOD 2XV6B 4D94A 4ZFFA 5DD0L 4P9HC 3ARDB 2DQGL 1H8OA 3SCMB 3U4BH 1PQZB 1XR8B 3LS4L 4JFYB 4JDTH 5C0CA 5A2JH 5F1NA 2NX5D 4M7JL 4OIAA 3VXRA 5KVGL 2Q76B 3MLXL 5ID1A 5EZIL 4AL8L 3GNMH 1J10A 2DLFL 2F15A 4NHUA 2Z31B 3IDYB 1IJ9A 4X8XA 2CPCA 2NMSA 1XF2A 2KZ1B 4NNPH 4L9LC 2J6EH 5ESVA 3DVNB 1CXIA 5J13B 3AREA 3H9SD 3QNXB 4LHQB 4R26H 5T1DH 3U30B 5FCUH 5DFVD 1VB9A 4WO4C 4NN6B 5TDPB 2A0LD 3LS5H 3QQNA 5CEZL 4Y8AA 4LCCC 4HCRH 5F3BA 1NCDH 1YEJH 2EYRA 4OZGF 4PJEE 5DHYA 2PW2A 4UB0L 3C5JA 3SGKA 4U1SB 5JOFB 3V4PH 3M17B 1CF8H 1QD0A 3QRGL 3THML 3CDCA 5SWQA 4JFDB 2EDTA 3VFSB 3L9RB 5EBMA 1JGDA 3VFVA 3GKWH 5ANMB 3KLHD 5M94B 1JHTB 3QXVA 2P46B 5MEOB 4KKCD 5GS1A 1JWUA 5AZ2L 4XP4L 4L3EB 4F8TA 4HF5L 4EN3B 3NIGE 1MCCA 2VLLB 3BQUB 2GJ6B 3S4SB 1ZT4A 2R9HC 4QO1A 5TPWH 4MD0B 5GGSY 2AK4B 4F3FB 3L3JA 3LPFA 4LHUG 4LASH 4DGVH 1XGYL 5A43C 3CJJA 4XVUC 3G5VA 2GSIA 4ZFGH 3BD3A 5HHOB 3C60A 1QO3A 2X1PA 4RX4A 4YX2L 2NY5H 3ZE0E 4NQED 3G9VA 4P2QD 1FNEA 4GBXA 4BKLA 4OCSL 4PGZA 4WU7A 4JLRA 3S35L 2Q86A 1AD0A 5DRXA 1E4XH 1H3PH 1KPRB 5EU3A 1HN1A 3UMTA 4OUUB 2V9QA 1QSED 4LPUA 4NHCH 5CJXA 4MA3B 2HT4C 2P5EA 2ZCHL 4ZS6C 1D5ZA 4D2NA 3BRFA 2NY3B 2WNGA 1KFAL 1MHHB 4P5KB 1NBZB 1Q94B 5DUML 5J7CC 3B9EA 2DQUH 3DETD 5DEFB 5T33H 3EOBB 3RY4A 4K23H 2DBJA 4J8RA 3BP5B 3OWEA 4L8BA 5DUPL 3HNSL 3FB6A 2GSGA 4NGHH 5CINL 4TRPL 1ZKAA 2M8XA 1QOKA 4C54A 4CN6A 2NLJA 5A16B 2X4OA 2LU3A 3BP6B 2B4CL 5ICYB 4LBEB 4XBEH 1W0YT 3GSWA 3BXNB 4TUKH 3BZEA 4NO2A 3TT1L 5GHWL 2D7PA 3ROLA 1ULVA 1INDL 1Y18A 1HZHL 3DXAE 1ZVHA 4GRWF 4HXBL 1G9MC 2W0FB 3LIZL 3D2UA 3KYNB 3AS0A 3E8UL 4PS4H 2MPAL 1HI6B 5EOCL 1K6QH 1INQA 3EDEA 3QG6A 1YN7A 1KPUA 1WFNA 3GSNH 4OZFB 1PG7H 2EECA 1U8HB 2X7LA 1A4JB 3LZFL 2FLRT 2FB4L 5KJRL 3WIFB 4AJ0A 3EYOB 2VDRL 3IYLW 2P24A 1PYWA 4C4KO 1SBSL 3EOAB 5BVJA 2YUWA 2APBA 5L8LB 1K5NB 1TQBB 1IGJB 2XG4A 5EG6C 1N6QL 5EWIH 1A21A 4PR5A 3RPIA 3QCTH 1BVZA 1MFNA 4HK0B 5D6DC 1KJVB 1LDPH 1U8QB 3VRJA 1KACB 4NZJA 1CQYA 4L29B 2H3NA 2YPKA 5D1XA 5J1AB 4DVRH 3QDJA 2IQAA 3U0PB 1T1ZA 5DJXB 4LCIL 3WXWL 2BC4A 4KK5C 1YYMH 1MI5B 5DQDH 3CX2A 1U3JA 2XZAL 1T1XB 3MXWL 5TQ0L 5J11B 1WQVT 4LIQL 3ARDC 4NPYB 4YIQA 3SCMC 1JNHA 1W72L 4WW2B 3KYMA 2BFVL 1IKFL 3IKCA 5GGUB 4JY4A 4E9LA 2I27N 4V2BA 2YEZB 4UNVA 1FG9C 2J8HA 3V5DB 5EZOL 3H9HA 2Z31C 3IDYC 4S1SL 5GS0D 1TJGH 3F7PC 1QFUL 2PETA 2XA8H 5KSVA 2R2EB 3LQZB 4KJQD 4HSQA 5FOJA 5J13C 2CXKA 2J8UF 4JDZA 3U30C 2DLGA 1QEWA 3HC3L 4NN6C 1F6FB 4GQ9L 3EYFA 1MFAH 1KXTB 4X0KA 3Q6GH 4YHZH 1MIMH 4QLRA 4WI4A 5EOTA 3S4SG 2EIZA 5J1TC 4B0MM 1CGSH 4XZUA 4YGVB 4OZHA 1RVFL 3FB8B 4JQXA 3QUMA 5I8EB 4GMSH 3UAJC 5I1JL 3FN0H 5JW5B 4RISH 3CX5J 4L8SA 3STZB 1NEZB 3DV6B 4PRDA 2YKLL 2AXHA 3GBML 3SEPA 3QQ4A 1HYRC 4NUJB 4NQTA 1S7RA 2VITA 4TSBL 2IJ0C 4WCYH 3CXDL 1T89C 4EN3C 1BBJB 1GPOH 3MPCA 5SWSA 3BQUC 3GIZH 1F8TH 4Z7WA 4H0IA 4FQCH 3IFOA 5BRZD 4PJBB 5DMIL 4DQOH 3CUPA 2H1PH 3LEXB 1A1OA 3T0EA 3CZFA 1A9BA 3GMQB 4Q2ZB 4R4NC 2NYYC 2VL4A 2EZ0C 5F9OH 1CLOL 2R2BA 2IQ9H 4XXDA 4S0SD 1S7XA 3CSGA 4M7LH 4ELKB 4FFYL 3G6JE 5K33A 3TYFB 2VLMD 5GGQL 4JQIL 5E8PB 4GRMB 2P8PB 1NAKH 1KCVH 3K74B 2YMXL 1CLZH 4K9EH 2SEBA 3CIQA 3L5WB 1FVCA 2XFXB 3BP7B 3PGDA 4CVZA 4RBPH 1R3HA 4TSAH 1BVKA 4XH2A 4AMKH 2NY3C 5FCSH 3ZE1E 1N4XL 2AXFA 4PRBA 2C3HA 1CBVL 2HTLD 1V3MA 2CDEA 5KSBE 3BKCL 1OTTD 3GO1L 4YR6B 3K80A 2H26A 1WCQA 3QO0A 5BRZE 3IDXH 3AUVA 4KUCF 5GPRA 1P7QB 2VNCA 4N0FB 3N85H 1QFWH 1AGDA 3DGGA 1I1FB 1QKZH 1MHPL 2NY1D 5HGAB 1EIBA 2VLME 5GSRB 4P2CG 3HPLB 3DBXA 1QSZA 1K4DB 3VGEA 2C1PA 1W0VA 2YPVL 5E2TH 1RIVH 3L3OB 5DYOB 3DX7A 5F3HA 3H42L 4FN0A 4X9HA 3MSPA 5E9DA 1UB5A 2IAMB 4IIQB 1ZA6B 3OSKA 1F3RB 1FLRL 4JG0L 3UTPD 2GY5A 4JPVH 1HIML 3SKNB 3SE3A 4O58L 3OJDA 4Y4HB 2O5XL 1FIGL 4JGUA 4Y0GA 5HJ3A 4Y4KB 1T83C 5I8OL 2PXYA 1Z2KA 5IVXE 4F7PB 5AD0A 4JRYE 3TVMD 5DS8B 1PAMA 1F3JB 1A02N 2WZPD 5C0AD 1IM3A 3RGVD 3S7GA 1EO8L 3SDAB 5HYEA 2EDHA 4I4WA 3RRQA 1M4KA 1M7IA 5KBNC 5F7FA 1QACA 5AZEL 4ZYKB 3FO1B 3QHFL 1BD2E 1TQBC 4X99A 1E27B 1P7KA 4K8RL 3SPVB 3V7MA 2NZIA 5I8CA 2EEAA 5ADPH 5SV4A 4LLWA 3DO7A 2R56H 2V9TA 2XZQH 4BSVA 4ZTPL 1RIHL 1U92B 1T2QL 4YHMH 4YZFF 2VTFA 5EU6A 1EUTA 4PTTB 2A6DA 2EYTB 2ICWJ 2YPLB 4Z0XB 3HR6A 2YWZA 5J11C 1RJCA 1CDGA 2NXYB 3MLSL 3QXAA 4O51B 4OV6F 5IBTH 3LQAL 4WW2C 2VAAB 3QUZA 4N0UB 3V79C 2X9YA 5INDB 3OXSB 3GB7A 1P7HL 2C5DC 4U6HB 4Z7UE 4ZUVA 3HC0A 5CAYB 2W0PA 3CXHJ 4R90L 1TZGH 3ZTJG 1OSZB 5ABDE 3RVUD 4LVEA 2QKIB 2Q7YA 5F7YC 2OZ4L 4OLUH 1NEZG 2BVOA 2ZUVA 1MFCL 1FZJB 4RZCA 3HLAB 3QO1A 4OGZA 3MRCB 5DWUH 4Y2OA 4UDTB 1U8JA 2FJGB 3QUXD 5JPNB 1EXUA 2VAJA 3SDDB 2GJZB 3ULUC 1MWAA 3B6SA 3D0LA 3O8XA 3BGFC 3ARXA 3WSQH 4NJAH 1JN6B 4XRCA 3MXVL 3CLEH 1HNFA 4V2CB 5GRJL 4G8EB 1EGJA 5I1EH 5ICXB 3D1MC 4AENA 2XA3A 4ZQKA 3U9UB 2G5RA 2FSEB 1T3FB 4UDUA 2IBZY 3FB5B 1NUNB 3PJSA 4YPGB 3TFKC 3CCHA 4QRRA 4LF3A 1EJOL 3O4LA 1UVQA 4APQB 2WV3A 4RMRA 2DWDA 3MLZH 3VFTA 1OVZA 1S7WA 2C1OB 3SKOA 5F7HA 5GGVH 5F71A 2O93L 1T5WB 3RWCA 1T4KA 5A40E 5IB2B 4JFEB 5E99H 4EJ1C 1SJEA 4F58H 1I9JH 2GJ6E 1SYSA 4JN1L 1Z9MA 5EOCJ 2AK4E 5DJ6A 3GHEL 4JO4L 3BZ4A 4OCNC 1IE5A 1BZ7A 1CD1A 4HMEA 5HHOE 5I71B 3CFJA 4DKFL 3FZUD 4WWKA 3WE6B 1WAAE 4X6BA 4Y2DA 3PDDA 4AIOA 4HKZB 1I8MA 5I0DA 2B2XL 3PWJA 5CHNB 3WJJC 5HI3C 4HS6B 4LNRA 3EIFA 1T20B 5AAWA 4ONGL 3NGBB 5BVPL 2YD3A 4TVPH 3P4NA 5FM4A 4DCQA 2AQ2A 3JTTB 1LO3L 1GIGL 3BE1L 4G80B 3GSUA 2H8PB 4WFGD 3RKDD 1KEGH 1DANT 1D9KD 2PR4H 1MRCL 1QBLL 4ZSOB 1KUMA 1H3UA 4LSTH 2H2SC 5HD8C 1Q0XH 4NQSB 2HFFA 4ZNEA 5J6GA 5L6YH 1TZIB 4G6JL 1BJ8A 1NFDF 1D3CA 2R0WH 3RDTD 3WFBH 2Y9RT 2N1KA 1WWCA 4KVNH 1A9EB 1X5GA 3OKNB 3FQWB 4JFFA 3BISA 1CT8B 2E9JA 4DZ8A 3VXTA 4OLYL 5ILTH 4XB8A 1CFSA 3W9DA 1J9CT 2JB5H 2IBZX 2AV1A 1OTSD 4QCIB 1M7DA 2J88L 1H3WM 4MA7L 5DZNA 2IAMC 1U6AH 3DURA 5FM5M 4Q9QH 1EDQA 5C6PB 2WLZA 4XP5L 3DYMA 5DD5H 4FQLL 4Y5VB 4Y4HC 1SMOA 4FFZH 5CEYA 2BRQA 1TTFA 2X4NA 1RZ8A 1RMFL 2A38A 3VXMA 4GKSB 4HWEL 4Y4KC 2WBJB 5EC1A 1X44A 1RFDL 2AJ3B 1OPGH 2H9GB 4NBYB 4ZUTA 3M1BB 1U42A 3BKYL 4NJ9H 3SDAC 4LP5A 1S7UB 4TVSa 4HJGB 2B0SL 3KWWA 3NA9L 4OIIH 3T65B 4R4FH 4Q9CA 1BQHA 1R5WA 4GKNB 2HH0L 2X89D 5BZDB 1PX3A 3Q48A 3FB7B 1DBBH 3FRUA 5DHVA 1XZ0B 3KS0J 4LP4A 4RWHA 4TSCH 4V1DB 4PJ9A 1JGUL 4JVUA 5FIEA 1CICB 2JF1A 2J3SA 3DYOA 5C2BH 3ZSSA 4PJEA 3I6GA 4QOKB 4M48H 4KI5D 4P2RB 1HQRA 4WGVB 1NDGA 5CILL 4LCWB 1ZLVK 1I9IH 2OR9H 3ZL4L 2X1XR 1NUFA 3KPMB 2BNRB 5CEZD 4RRPA 4P46D 1DSFL 1QRNB 4GG8A 3MNWA 4LCYB 4XNXH 2NXYC 4Y16B 5BW7C 2V5RA 3Q5YA 5DK0A 5CBEA 2P8LB 4S2SA 1U93A 2DBLH 2NX5A 3MGTA 4NKDA 1MI5E 4KROB 1PZUB 2I9LB 1YMHA 4KVCH 2O61A 4LSRL 5FB8A 1MSPA 1G0DA 3RAJL 2Z8WC 3H9SA 12E8H 1MH5A 1VPOL 2CRMA 2EKJA 4IRSD 4U49A 1HEZA 3D5OF 5E2VL 3KNBA 2CDGB 4HIXH 4X6CA 5GJTH 5E03A 3CFBA 2Z8SA 1XFPA 2YXMA 2NY4B 3MJ7A 3EFDL 1F6AB 3MJ9A 2QQLL 3P0VH 1N64H 1P5VA 3SDDC 4OCLC 4JB9L 3NZHL 5EU7C 3Q5TA 4IM8A 1ONQB 5KS9F 3OQ3B 5D2NA 5H94B 5I30L 3N1QC 4R2GD 2Y23A 4G8IB 1DBAL 4UINL 5AG9A 4A6YA 5HGHA 3ULUE 1UACH 1UM5L 3U0WL 2GI7A 2XWJA 3H0TB 4UIMA 4QTHA 2VLJB 3BEVB 1AI1H 5HGGS 1DLFH 4PLNC 5C0BD 4APQC 4U1LA 2Z35B 3VGFA 3QR2A 5HHVH 3OKDB 3AU1B 3MRFB 4ZXBB 1V8HA 4Y5XA 4PJAF 3SKMB 3RWHA 3EO0A 4KGJA 5HHNA 5TF0A 2FBJH 5AYUH 3K4ZA 4OBRA 1KIRB 5HI4C 1P1ZA 2R1YB 3NACH 3DVGA 3L3DB 4NQEA 4AEFA 4P2QA 2EDRA 2RBLA 2WINA 3MO1A 4PJBE 5EC2A 4NT6A 1GGBL 1MCDA 4YNYA 5FYLE 5I71C 5GRVK 3K0WA 1JGLH 4PBWD 4S1RH 3V6ZA 4U1JB 3P4LA 1E4KA 4WENB 4XPTH 4ELMF 1XT5A 2HVJB 3V5HA 5B39B 1QSEA 4Y5YB 3RL2A 4ZO9A 3H6JA 4I18C 2QJDA 4MWFA 3NGBC 2IH3A 3VG9B 1QLFA 4OM1H 2JJSA 3DUSB 1RJLB 1U36A 3MRHB 3LKSB 2X4PA 4LKCB 1FNSH 4O02H 2UWEF 1YYLH 1MFBH 2XN9D 1G6RB 1ORQB 1N6VA 2LTQB 1VADB 5FUZL 1G9ML 4HIHB 2VQTA 3SY0A 1N3NA 3TZVD 2HG5A 2CGRH 5DF0A 3TWCL 4XP1L 3GJFA 5JOPE 4NWUL 4K3GA 4LPXA 4M43H 1KYOK 4ZDHB 1KENH 4J4PD 3V8CA 4M7KL 1FL6A 3WXVH 1HYSD 2YD5A 2XG5A 5FO9B 4OGYL 1TCRA 5FUOH 2BCKB 3MLTA 1FORL 5F7EL 1RUMH 4WEUD 4L4VD 5C0IA 1QZ1A 4PLKC 3MRQA 3AY4A 5IGXH 5F1SA 4MAYD 4OJFH 3U0TA 3NH7H 5I17B 5D7LB 4PREB 2M26A 3QUKA 4RDQF 1F4YL 4UUJB 4Y5VC 1IGYB 4DUXA 2Z9TA 1P84K 2YZ1A 3WS3A 1C12A 1FL5A 4FQ2L 2WBJC 4KMLB 3F7QA 5IEHB 4LLDB 5C0ND 1NGXB 3LN5B 1YNKH 4HAGA 1ETZA 5JO5A 2DQEL 1Q0YL 3IU3A 4LLUA 4XCNA 2E7MA 5EORH 3ILQD 3DV4B 4HBCH 1T22B 3QUMH 4PJIF 4CAGA 3KYAA 2PCPA 3WL9A 2VIRA 4QRQA 2W9DL 2VDOL 1CICC 3SO5A 1I7UB 5MEQB 1NAMB 1OOAA 4EQ3A 1RUQH 2N4IA 3GMNB 2YD2A 3PHOA 3ZE2E 1N7MH 5HYQA 1Y0LA 1QFOA 4LMQE 3OX8A 1S3KH 3C6LD 5C86A 2JKXA 4YEFA 2BNQD 4OSUL 2RFXA 3MGOA 1JI1A 4Y16C 2ZNXA 2ZKHL 2YA2A 2ZOLB 2OBGA 2LE9A 4E0RB 5EN2A 4HH8A 1J1OL 1V3LA 2YPLE 2W65A 2Q8BH 1RUAH 2A6IB 1UYWH 2YSSA 3UTOA 2NZ9C 1EHXA 3G6DH 4NO3B 3PWNB 1KTRL 2R4SH 2P7TA 4MS8C 5MERA 4N0UE 1WIPA 3AMKA 4LSUL 5E7FA 3HI5L 3BKJL 3DRQA 5EU5A 1FFPA 1SYVA 3R4DA 4TULH 3X14A 4KZDL 2NY4C 3HE7B 4UNUA 5GISH 5GRVL 4DFIA 4JFXB 1WCBB 3W5MA 5ISZD 4HGKC 4ZUWB 2ATKA 5E94A 1VACB 1Z3GH 4FP8L 1Z9LA 4MX7A 4P3WA 3NFSH 3O3EA 1ADQA 3F7VA 3GMRB 5T3XE 2VKXA 4O2CA 5C8JB 1G7PA 1JWMB 2BNQE 1CLYH 2VB5A 4FQXD 4KK6C 3O2VH 3HZKA 1IEAB 4CJ1A 2X6MA 5EU7E 2EXWC 4W81A 2H41A 5DURB 1ZHKB 3QULB 5DQ9B 2D7OA 4AYFA 2EXYC 2GCYB 3WIHL 4Z76A 1NL0L 3GJEB 3MNVB 1N26A 1VHPA 4CU8A 5KSBA 1AO7D 4I2XE 4XI5D 4BQ9A 3BWUC 4ZXBC 1CDYA 5JLZB 4I77H 5BRZA 1WSST 4JM2F 1KLGB 4AEEA 5B39G 5EO9B 2ARJQ 4MJ2A 1QR4A 4H8WL 1R3LB 2NW3A 1K8IA 1JYWA 5BZWA 5CZXC 1BJMA 2HJLB 3H7BB 4X7EC 2MHAA 5CD5C 1I9RH 1INEL 3TA3D 1BHGA 2Z91A 3VW3L 3MCLL 5ISZE 1L7TL 5J06A 4F57H 1I7ZB 4UT9L 1GGIL 3UTSD 5I15L 5JPMA 4JFEE 1PZ5A 3BH8B 5HXMA 4H1LA 4Q6IA 4X9FA 3BN9C 5D6CB 4WHYG 2EE6A 3C87A 1H8SA 4M02A 1ROWA 2QR0B 4I5BA 1RHHB 4Y5YC 4PJ8D 1XMWA 4GH7B 2DI9A 1JIBA 3JUZA 4LKXB 5TDNB 3VG9C 5DD1H 4UIKL 5B8CA 3WFHA 1OW0A 1ACYH 4JRYA 2PW1B 2VZ1A 4JCMA 4XX1E 4Z78B 3RVWD 1M7XA 2LTQC 3GHBH 2OTWB 1CE1L 5HDBF 1H0DB 3EHBC 5FKPA 4M1GH 3QXDA 4JAMA 4ETQB 1J1XH 3ILPA 5DMYA 4TNVK 4ZSOE 4MXWL 4P3DB 3FO9B 1DQDL 2FECI 3QP3A 5F7KC 3RUGF 1VCAA 3H9YA 5C7XH 1FN4B 4E42B 2I25N 2OXHA 1KT2A 1O0VA 1U3YA 4NZUH 4HWBA 2CLVA 4R9HA 4XPHH 4K8RD 1AQKL 5BQ7A 2Z4QA 2F5BH 2XRAL 1P5UA 2FEDD 3X3FL 2VDPL 2WBWB 1I7TB 4PGJA 2EDQA 4QXUL 2WSKA 2R1XA 4ZFZA 3V8OA 3KS0H 4PY8I 4Z7UA 1MWAH 4LDLB 2ESVD 3Q2CA 3TVMA 1MREL 2CLRB 4PJDF 1A7RH 1KNOA 5C0AA 3RGVA 1WITA 2KZWA 3L5JA 3UJIH 4PRPD 1LVEA 1NGYB 1FZOB 5HI5C 3LKPB 1WF5A 4RGOL 3T0DA 4ODWA 4GAYB 3G08A 4XAWH 1EGJH 4JZNA 5MP6H 3KJ6L 1MJJB 4B5EA 4G6AC 5T3ZE 1OL0A 3HC4H 3IJSB 5DO2C 4AG4L 1G7JA 3HG1D 4P59H 2YK1L 1JYVA 3VGGA 1VFOA 3TBTA 3ARPA 1K2DB 5K9KB 2VDMH 4RQQA 3EZJB 3HB3D 2P5WD 4G6MH 2NY0B 3TBWA 2P45B 1S7SB 2FEEI 32C2A 1JF1A 5IQ7L 4UT7H 1PG7W 3S3SA 1UH4A 4QOKE 2HJKA 4P2RE 2L0DA 1ZANH 3FONB 4LCWE 3TPUA 1OAUL 4QRTB 4PJXA 4M00A 2EDOA 4Y7MA 2BNRE 3MBED 3W5NA 1RI8A 4OCXL 1QRNE 3IJYB 1J5OL 1W8NA 4UILL 3O6FD 2UZIL 4WW1A 1TVBB 2CKBL 3KR3H 3ZDZF 1ZMYA 5J0BA 4N5UA 4NFDA 1U8PA 2VDKL 3TN0D 2BVTA 4UBDD 4HKXA 3Q3GB 3CMOL 5FYKL 3X12B 3WNKA 3HE7C 3QUXA 2K7QA 1FBIH 3CFCL 5IR1A 4Y4FB 1L7IH 4ODXB 3FKUS 3OL2A 4Q7DA 4PJCB 4E41D 4F7EB 3CLFL 3IDMB 5HHQA 4MDIB 4KUCD 3DJ9A 1NGWA 3MRRA 4GAGL 5E5MA 4R8WL 5IHUL 2GIYA 2FWOB 4XWOD 5KZCB 2OL3L 3MCKB 4NQDD 1S5IL 2MCPL 3S96B 2WANA 5HY9B 1J0JA 1BAFL 1P2CA 1SEBA 5CBAB 1A1NB 3QWRD 1DN0B 2B1AH 1JWSA 1BQLH 5IWLC 3RVVC 3ZKQD 3F65A 1FGNL 2UWEB 4FFWD 1T66D 2E27H 3HI1A 5I66A 4P4RB 2DLIA 4CMMA 2I07B 3PQYD 3O3BB 2VLJE 3L95A 2EH8H 3D3VB 2AJUH 4L5FL 1JZ3A 3RIFF 1F2QA 3MRJB 4G3YH 4PRAB 1IM9D 1J1PL 3EDFA 3PWPB 1M05A 4PJFB 2YUVA 1T80A 1DQJB 3BRDA 5HHMB 1BGXH 3D9AL 3OAUH 1HWGB 3MV7D 5IHZB 5E2WH 4IOSD 2VL5A 3SGDH 2R4RL 2XZZA 4PRIB 5LCVL 4JJ5B 1JHKH 3LKOA 1RK1B 4HKJA 4X6DA 3QYCA 4X9IA 5DHVH 3IXTA 4N9GB 4HS8H 1UM4L 1AGCB 3W39B 5T1MB 1A2YA 1NMBH 2BHUA 2EICA 2DJ4A 4HLZG 3L3KB 4P5MA 2HFTA 3E6HA 1PEZA 4MNQB 1D9KA 4XXCA 4YE4H 2E9WA 1AR1C 4ALAH 2DN7A 4Z9KB 4CVUA 4K2UL 4EI5B 3FTGB 4ISVB 3RDTA 2FHBA 5DXWA 4WU5B 1ZSDA 3S36X 4Y1AD 1AE6H 2WUCL 1NMAL 4NCC1 1XGRB 4PLJD 2C9AA 3U2SB 4RMWA 5D4QA 4QRPD 2VZ3A 1TPXB 1UM6H 3O41B 1YJDH 4FXKB 2RGSA 4GSDH 1R3IH 2W60B 3WFDH 2Q3ZA 4UU9B 4D9QE 1KBGL 3UDWC 4HZLB 1NFIA 1NH6A 1UZ8B 3MOAH 3VXUD 3V6FB 2A6JA 3STLB 3N0PB 2FCBA 3DROA 3UROR 4X4YB 4RFEB 1RZFL 3MLRL 5F89B 1K85A 2BSSB 8FABA 1TNNA 4ZTOL 5J1AA 3W9EA 5DK2A 3WDJA 1OCWH 3FFCB 5JORB 2WIIA 3KG5A 3MJ9H 3RHWF 4FQJH 4LSPH 3UEZA 3MOQA 1TVHA 1SM3H 4TQEH 3FQRA 4LAQH 3C8KA 5D7LE 3GSNB 2EE2A 2ZSWA 1J8HD 4G8GB 4AIZB 2QQKL 1BLNB 2EDEA 5JMOC 1F90L 5KVEL 2Y07H 4OAWB 2DB8A 3OKOA 4JHAH 2X89A 1RK0A 4A6YH 3HNTH 1BWWA 5DRZA 4LCUA 1XGPA 2OR8A 3CFIC 5ALCH 4LLQA 4MCYB 1T7ZA 4K7PL 4Z7VF 5CMAA 4FXGA 1GL4B 4RAUB 1TJHH 2ADGA 2X70B 3CDFA 3HRZB 1TCMA 5EZLB 1FQ9C 3GI8L 4D9LH 2Z93A 4OLXH 4QRSB 5EOQL 2NTFB 4U1GB 2NY0C 3MBXH 3U6RB 4P46A 5L9DH 3MRBB 1RJYB 2Y72A 4PRHD 5C6TL 3UTTB 4JZOB 2V5SA 5KVFH 3QQ9C 1KYOJ 2E8YA 2P42B 1LD9A 5T3XL 4QF1A 1S9WA 2G9HA 4HKBB 1T1YA 3BHBA 3H3BC 1MFEL 1CL7H 5FO7B 1J8HE 3X13B 1VENA 5ICZB 4KRMB 3OKYA 3B2UD 4XVUD 5E56A 3U46A 1NC2D 3EYSH 1K4CA 3GRWL 3REVA 4XTRC 4EDXB 4TOYH 4ZD3L 4LOUC 4K71B 5IB3B 1A7PH 1UB6B 4AEIH 4ODTL 1G84A 3MV9B 5F6IB 1P84J 3NABL 2VRAA 3HNVL 1Y6MR 5H35B 4Y4FC 1CLCA 3ARUA 1A6VH 3P9LB 1KCRL 3WLWD 4R4BB 1MY5A 4OQTL 4LPVA 5F7UA 4LHUD 3UTQB 3L7EA 3VE0A 1EEUA 4KRLB 3QZWA 2G5BA 2Q87A 5C3LD 5B38B 3S36L 2DLEA 3K1DA 1HSAA 3QSKB 1FH5L 5KSAD 1EUUA 3VWKD 4OUOA 4GRMA 2Z0BA 2YUZA 1E4XI 1HDMA 4NQCB 3BYTA 3QUYD 1CE6B 1Q8MA 4JO2L 1G7HA 3UYRL 1A5FH 1JPFB 3GJFH 3QG7H 1MLCA 5C0BA 3PNWB 1UJ3C 4NYLA 4OFIA 2E6JA 4JPWH 4OLEA 3GMPB 2UUDH 3RL1B 4OCYL 1OAXH 3HR5B 2A73A 1KN4L 2R0KL 5EO0B 2FYYA 5LAXA 3JV6B 1G0XA 2VC2L 3QAZB 1DQMH 4Q9RH 4HH9B 1IRAY 3ARWA 1ND0B 5EUKB 2NY5C 2FX9H 4HPOH 5K93A 5LGKA 4H88H 4OF5A 3T77A 15C8L 2HMIC 3HHRB 2P1YA 2CLZA 3C2AL 3SJVD 1LEKB 1YPZA 1UXSA 2ZG3A 1Q9LA 4AH2B 5LG1A 4JE4B 5TF1H 3SBWC 4K3HA 2CD0A 2VQ1B 5JOEA 2V7HA 5FGCB 1HHJA 4QHLA 5FO8A 2DYPD 1C5BH 1X4XA 1DQLH 3R1GL 2XN9A 4HT1H 4PJ5B 3MRNA 3VRIA 5DD6A 2EDWA 6CGTA 1HXMA 5DSCA 5E8NA 5CP7A 4XBGA 4EI5C 3GSRB 3JBG7 3TZVA 3AXLB 3SKJH 2FX8L 5L88H 4YHOL 4PRNA 4OLZL 3RWEB 4BZ2H 3IDNA 1TPXC 2F53B 4ZMAT 5J89A 4J4PA 4PV8A 3WJLC 4FFVD 4OF6A 2ORBL 1TETL 3HE6D 3B9VA 5GS0H 1YUHA 5DJ8B 2CO7B 2Q7NA 2BVQA 4L4VA 1YMMD 5J3HD 4PY7B 4MAYA 1N59B 4N0YH 2QSTA 4QGTA 4OZGA 5CD3A 1B2WL 1EO5A 2VABB 4OB5H 1JNNH 5I0ZA 4D0BB 2OK0H 5DI8A 1I8KA 2P8MA 1DQQA 5JUEL 3N1FC 4Z6AT 2OMBA 2ZOKB 4NKIH 4POZC 1YEGL 5HBBA 3MLUL 2MQ0A 3DTXA 4G43A 5C9JB 4UOW0 3OBAA 5AYQA 1RZGB 1AIFA 2VE6A 1OAYH 4GOSA 4N8CH 2VR4A 3ZT7A 1ADQH 1W72A 3B3IA 3F7YA 3PGFH 4M8VA 1EEQA 4H5SB 4XMKH 3FO0H 1NCCL 2VSCA 3MJGX 2ICEA 4HC1L 3WHXB 1JNJA 5DJDA 4Z0BH 5F8RC 3FHQA 1KTLB 5EIIA 3BUYA 1KTDB 2HWZH 5GS2D 4AZ8A 3ZYJA 3C5ZD 4Z8FL 1S9YA 4G5ZH 3PUCA 4F9LC 3O3DB 1CCZA 3DHMA 3N9GL 4RGND 3BIKA 3DRTA 3EO9L 5FGBA 5F1IA 3C6LA 3IT8D 5C1MB 2FJGA 2FZ3B 4U1GC 1UT9A 1R5IA 2BNQA 2O5YL 1GAFH 5D72L 4OF3A 4BK5A 4PP1D 5D71L 5HDOA 3ZKXB 2WAHA 1FFQA 4L3ED 5GGRB 5T5FH 1UKTA 4ODSH 4YHNA 4KDWA 5HYIA 4LQFH 2IPKB 1ZVSA 2HKHH 4LARH 3VFPA 3EUUA 4I2XA 3EYVA 4M1DL 1JRHL 2BY3A 4H1LH 4ZUUB 9CGTA 1AJ7L 3QDMB 3E6FB 5B38G 4WFHD 2BSRA 2ITCB 4ODVH 4YDVA 4GW5A 3TJEH 4K71C 5D9SA 1OT2A 3O11A 2KBGA 1NANH 5F6IC 5FA3B 3P11H 1FCCA 2CMRH 4M62L 3TT3L 2HLAA 1T6VN 2V2XB 3FT3A 3MJ8B 3OPZH 4WUKH 2ADIA 1T5WA 1QRKA 1TFHA 1VKXA 5ISZA 5CIPA 1U8OA 4FQIH 1EVTC 5GGSA 2FJFA 5JXEC 2E7LC 3X11B 1T5XA 2GAZA 1YEHL 5SV3A 4OGXH 5FYJE 1A7OH 4KHXH 1MRFH 5JHDB 4I3GA 3HCVA 1BX2A 4QTIL 1C8PA 1ZA3A 3NAAH 4JRXE 4FQXA 4W68A 3SDYL 3CK0L 4PJCE 2OQJA 3MNZB 5D7IB 5HSFA 1NGZB 4NO0B 2XZCH 3BEWB 5EPMB 1DFBL 4RAVA 1CXHA 3TO2B 4YDLB 1MCQA 5DT1H 1BFVH 4L1DA 1AFVL 1KJ3L 1AO7A 5FDYA 1PKQA 4I18A 1RJZA 3IVKB 1OAQH 1WTGT 1IGIH 4HWBH 1KJ2L 4M5ZL 1CVRA 4JHWL 1R24A 3QAZC 1WICA 3SQOH 2UWEE 1IT9H 3TA3A 4MGXA 5IFJB 2Y36L 3TO4D 1JP5A 2VXUL 5TDOA 1MHCA 4MQ7B 2V2WB 3D3VE 3UTSA 4YBHA 1FL3A 4RFOL 1QVOB 3O0RL 3I02B 4MJ6A 1QFWI 3EYUH 4LFHG 1EZVY 4P3CL 3TC9A 3RVTC 3KHQA 3PWPE 4NRXB 4PJFE 3NPZB 5BJTB 4PJ8A 2BNUB 4HV8B 2AKRB 1S9KC 1JGVL 4NZTL 1ZHNA 1AHWA 5I1LA 3QJFA 3MFGB 1M6OA 3N1PC 1NDMB 5EUOF 3QIUB 1G7MA 2UYLA 3S37X 3QI9B 5KW9H 4Z95L 5F21B 5IMKA 4PRIE 1CDCA 2BMKA 4LPYA 4DVBA 3DUUB 1WV7T 2X4SA 5ETUB 3BD4A 2DM2A 1A3QA 5IB5A 2DS4A 1YNLH 1NJ9B 3IXAB 1ZTXL 2GUOA 4RMQA 4GKSA 2AJSH 4GMTH 4D8PA 1KB5A 1QNZH 4MNQE 1FZMB 4BFEA 5DMKA 1MUJA 2IALA 4ZFFB 1NCBH 1DL7H 5F96L 4QGYA 3ESVF 4JRWA 5C0CB 5F1NB 1KB9K 1KCSL 2J8UA 3VXRB 1V7MH 4C56E 5C6WH 2XIDA 5ESQA 2AJVL 4KTDH 2YBRA 3WFEH 4U1NA 5ID1B 1MJ8L 1KCUH 3GKZA 4NHUB 2VXVH 2DIBA 5I1CL 5DMJB 1WWBX 1XF2B 5TE7L 5TQ2L 5ESVB 3U79A 3AREB 4ENED 1DBKL 2D31A 1XGUA 3E3QC 1F02I 4F8QA 1OLZA 2ESVA 3QFDA 2VUOA 3HTLX 1UCTA 5F3BB 4G9DA 2EYRB 5DHYB 2PW2B 3FFCE 3C5JB 4PRPA 3FMGL 4RWYH 1I3GL 1JFQL 3LRGA 3OKKA 4NUGL 3QIBC 1MCJA 3HI6L 4Y19D 3RA7H 5SWQB 5ACZB 1L6XA 1EHAA 1EZVX 2VLKD 3U1SH 4KJPC 4G8GE 3V0WL 5EBMB 1JGDB 3VFVB 1LO0L 1IL1A 2V5TA 3HG1A 5GS1B 4JM2D 4YDIH 1JWUB 1KELL 2OZ4A 1SMAA 3LKQB 2ADFL 2P5WA 5DK3A 2OJZL 5FYKD 1UKSA 1ZT4B 4HS3A 1X5XA 3L3JB 3BPNB 4GXUM 1A3RH 3T3MF 3INUH 3ZKXC 3G5VB 4EKXA 5LWYH 2GSIB 2ZWLT 5DRWA 4JVWA 4I3SL 5DD3H 3C60B 1QO3B 1OM3L 2BVPA 5LGJA 3MBEA 4G8IA 4BSWA 2DMKA 1P69B 2VERN 5IESL 3OKMA 4GXVL 4M6OL 3D18A 3UTTE 1FNEB 4GBXB 3O6FA 3O2DA 4BKLB 4LLYA 4PGCB 1IQWH 2BRRL 3NCFB 4WU7B 4KUZH 4JLRB 1MCPL 2Q86B 1AD0B 1YEFL 4Q74A 5DRXB 2YD8A 3DSFH 2LV4A 1XF5A 4L3CA 5EU3B 1A3LL 1UWXK 1V7NH 4OF8A 3TNNA 3S37L 1T21A 1JE6A 1TZHA 3IFNH 1E28A 3SN6N 1N5AA 3I6KA 2P5EB 4E41A 1CIDA 4JO1L 4J7RA 1D5ZB 5JW3H 1YY9D 4KQ4L 1ZHLA 3B2VL 3LHPL 4BFBD 2DICA 1D5BA 5FHAL 3MV9E 4OTXH 4NQDA 3KPRE 4O2EA 2D7MA 4GG6A 4OZFH 4JR9L 1A14L 1MY7A 3WYRA 2DQHH 4K3EH 2EIBA 3IFPA 3OGOE 3QWRA 4KHTH 1OAKH 4L8BB 3FB6B 1YEKL 2GSGB 4YDLC 5DMGD 2H6PA 3UXFA 2NLJB 2X4OB 1MAJA 5KSUA 5HVWA 4NQCE 4DGYL 3GSWB 1NSNH 3PQYA 6FABH 5HD8D 3BZEB 3FOLA 4NO2B 4GAFB 3ROLB 1SVCP 1Y18B 2CKNA 3JTSA 1IM9A 3D2UB 3LMJL 1PKOA 4YFLI 3QCUH 4O4YH 1IFHH 2AJZA 1INQB 3QG6B 1YN7B 1KPUB 1MNUH 1D5MA 1TMCB 2UZXB 3LPWA 3MV7A 3RNQA 4WHTA 2X7LB 5DD0H 2DQGH 3W2DH 4DUVA 2BOBA 3C08L 1S78D 1DBJL 3RUGE 5D7KD 2P24B 1PYWB 5BVJB 2DQDL 3RWGA 5ALBL 4NDMA 5EZIH 4YHLL 2X4UA 4PR5B 3OJ2C 3RPIB 5C0JA 3QI9C 1MHEA 3PP3H 3EJYD 1VFUA 4CW1A 1QBML 3SDAD 4BQ6A 3VRJB 1QG3A 2CJUL 1DN2A 2H3NB 2YPKB 5T1KD 1AP2A 5D1XB 1L9MA 4RA0C 3QDJB 2IQAB 1T1ZB 4JO3H 5FGCE 4WV1A 4Y1AA 2BC4B 1B0GA 1J0YA 4JFHE 4YXKH 4PJ5E 4QRPA 4XPGL 4KZEH 3PWLA 3QCVH 3QRGH 4YIQB 1YQVL 1JNHB 3KYMB 3VXUA 1NCUA 1VEPA 1T0NA 3IKCB 4JY4B 3MJ6A 4OZIF 2VZSA 1ZEAH 5I18H 1R0AL 2ZCLL 3UCRA 1RSFA 4BH7A 2BY1A 5B21A 2BZDA 3N06B 1QYGL 3PG2A 4N5EC 2F53E 3H9HB 3I3EA 1JZ2A 3A6BL 5AZ2H 5C9KA 3W11D 4XP4H 5KSVB 5TGBA 3IDUA 3AREC 3I9GL 1ZGLP 1NBYA 1HKLL 4JDZB 1WIUA 1ZAGA 1QEWB 2VISA 3EYFB 5FYLH 2OLDA 3NVQA 4OM0H 4RFNB 1J8HA 4X0KB 4R7DA 4XCFL 3BX7C 5EOTB 3E3QE 4XZUB 4OZHB 3KXFD 3QUMB 4OCSH 4NCDA 1F97A 1UGNA 1AY1H 4BZ1L 4L8SB 3T0BA 1WEJL 4PRDB 4KAQL 3ZDZE 1J11A 5GS1C 4PGEA 4MLIA 3U4BL 3QQ4B 1S7RB 2JELH 1E6JH 2VITB 4JDTL 5ELIA 3U7WH 3PV6A 5SWSB 2ZCHH 4Z7WB 3EKCA 2XT1B 2E9IA 3GNML 4PRHA 5TE4H 3IFOB 1ZLUH 3BPNC 1H3VA 3CUPB 1A1OB 2VUYA 1GRWA 3T0EB 3CZFB 1A9BB 3AGVA 3C60C 4R26L 5T1DL 4U7KA 2R2BB 3RTQC 5FCUL 2NY7H 4XXDB 5DVLA 4GW4A 4UV7L 1S7XB 4GBXC 2VO5A 4IS6A 5DUPH 2EDKA 1NC2A 1S7VA 1YEJL 5CINH 1V05A 4P5TD 5HI4D 5ENWA 1MQ8A 3V4PL 1CF8L 3UJTH 1H5BA 4HPYH 4OCRH 3RVXD 2SEBB 2UVFA 3C09B 3QDME 4JQVA 4RIRA 3TT1H 2AAVA 1FVCB 3CSYA 3MFFA 3MZGB 3PGDB 4WFFD 4CVZB 3GKWL 5CJXC 1U91A 1R3HB 1HZHH 2D7QA 1BVKB 4HXBH 3ARYA 4XH2B 3LIZH 1NFDA 2AXFB 4YHIA 2DTSA 4PRBB 1MCIA 3E8UH 5IUSA 3KPPA 5F9JA 3IS1X 5C92A 2CDEB 3VMNA 1YNTB 3VWKA 5KSAA 4NKOA 2VDQH 4E5XA 1FV1A 1CS6A 2H26B 2C3WA 3QO0B 4IRZH 4OIBA 3MA7A 3QUYA 3X3GH 4LASL 4XC3L 4DGVL 3DMMD 1L9NA 4KC3B 5JHDE 4ZFGL 5KJRH 2VDRH 1AGDB 3DGGB 2NY5L 2R2CA 4CADA 4HEME 3C9NA 1LGVA 3OR7A 3DBXB 5ACLA 5F9DC 1N6QH 4QNPF 4LVHB 2C1PB 1W0VB 3CU1A 4YBQD 4Z7NF 4HJ0C 1QR1A 1FYTD 3DX7B 3A6OA 5D7JA 5GIRA 5E9DB 1H3PL 1UB5B 5FM5O 1MCFA 2F9BT 4IRJD 4HWZA 4LEOA 2RB8A 1ES0A 4NHCL 3WXWH 1MF2L 1EERB 3OJDB 3P3YA 5HJ3B 3U9PL 4GLRH 2PXYB 1W72H 1SJXA 2DM7A 2B20A 3SJVA 3S5LA 2BFVH 5AD0B 4OCMC 4IOFD 1IM3B 2FNBA 1M7IB 4M6NL 4X99B 1P7KB 3HS0A 2DYPA 1QFUH 4PY8J 5I8CB 5DJ2A 1F4HA 4LLWB 3DO7B 2NR6D 3ZDXE 4BSVB 4DAGH 2FD6H 1V3KA 1HQ4A 1BBDH 4TUKL 3VMPA 2E7CA 1IGTA 5EU6B 1QSFD 2H32A 2A6DB 4TVPE 3ROOA 3WKNA 2QHRL 2X4QA 3L5IA 4PS4L 3QXAB 4OBSA 1TLKA 1FCGA 4TTDC 1MEXL 2H45A 3HE6A 3QUZB 1K6QL 1FGVH 5IROA 3KPSD 1CZ8L 3G5ZA 3GB7B 3GBMH 4RBPK 1YMMA 1PG7L 2AS5M 2HLFD 4OI8A 4OGAC 4ZUVB 2OYPA 2JJUA 4TSBH 1N8ZA 3MRGA 1ZT1A 3CXDH 3VXRE 2MQCA 5SWZD 3B83A 1GGCL 2Q7YB 5KS9A 2BVOB 4RZCB 2Y7QA 3LB6D 4KROD 3QO1B 2NZ9D 3M8OH 5F7WC 3VXNA 1U8JB 1MPAH 4RFNC 1LK2B 1EXUB 3GEWB 2YZ8A 3BGAA 5B3JE 1LDPL 3A6CL 3B6SB 4FTVD 1OHQA 2XTJD 1EHLL 2FR4A 5E6ID 4DVRL 3O8XB 2ZPKH 4FFYH 3JV5A 4JQXC 3QJHA 4JQIH 4XRCB 2MKLC 1CGYA 4L8SC 3WO4B 4U1KA 5DQDL 3QDGB 4GRWH 4PJAA 3UYOD 3LY6A 5F9AC 1KJMA 4AENB 4ZQKB 5DHXB 3C5ZA 5F44A 2XQYG 2YMXH 4UDUB 4JCLA 3PJSB 4QRRB 4LF3B 3O4LB 1UVQB 4HAFA 2DWDB 3D48R 3VFTB 1CFNA 3F62A 1VFAA 4EBQL 1S7WB 4JRXA 3PIQA 4B50A 1N4XH 4Q97A 4XGZA 4XNYL 4NWTH 3RWCB 1A1MA 1CBVH 2CRYA 3CFEA 1T4KB 3C8DA 2XA8L 4L4TD 5CS7A 3T0EC 1KB9J 2APTA 1SJEB 1IQDB 3QIWD 5DQJA 3GO1H 4KKAD 3LDBB 3U36A 1SYSB 3V9FA 4ELMA 2OP4L 4UV4L 5JA9A 5DJ6B 1OAZL 3CGTA 1KV3A 5HY9A 3BZ4B 3ETBF 1MFAL 3PXHA 1BZ7B 1JMXA 1A7QL 1CD1B 4JGJA 3ZKMD 3FT4A 3Q6GL 3T3PF 3CFJB 4M93B 4YHZL 1I7RA 1UJ3A 4WWKB 4X6BB 4Y2DB 1J0ZA 1CGSL 1FO0L 1U95A 5C07D 1I8MB 2D9CA 4D0CA 3PWJB 4GMSL 3FN0L 3C09C 1QFPA 2YPVH 4LNRB 4YHPA 4XWGL 1MAMH 5FM8A 3H42H 2NY2B 3RWDA 1AXTH 3VXSD 3NFNA 3VFUA 3P4NB 1CYGA 2PN5A 4QHMA 3QPQC 4DCQB 1FLRH 1UJTA 4JG0H 1HIMH 4I0PD 5E2UL 3GSUB 1GPOL 3QFJD 4OT1H 4Z7OF 2P5EE 1DQJA 3GIZL 2HT3C 3QBTB 2O5XH 1OGAD 1IARB 1KB5H 5HVGB 3MQIA 1F3DJ 2FL5A 5T3ZH 2HFFB 5I8OH 5J6GB 5I2IA 4PJHF 1SY6L 3KLSA 1ZWIA 2VZVA 2E3VA 1PY9A 2IQ9L 4JFFB 3X17A 5JW4M 1R3JA 5AZEH 3QHFH 4M7LL 4DZ8B 4KKBD 3VXTB 3FN3A 3KAAA 4LVHC 3Q1SH 3U7YL 5BV7H 3O9WD 1CFSB 4PGBA 3W9DB 3QWOA 2QSCL 2AV1B 1P4IL 5FXCH 3P0YH 1M7DB 1NAKL 5DJCA 1FVEA 4IMKA 3C5SA 4YDJA 3DURB 4P2OD 1JZ8A 4ZTPH 2BVYA 3TO4A 1CLZL 4K9EL 4PJIA 4QRUA 1V5JA 1WBXA 4TSAL 4HQQH 5CEYB 4C56A 2X4NB 4U6XA 1RZ8B 1J88A 3VXMB 4ZO8A 1Z0NA 3B9KD 1XCTA 3MLSH 5EC1B 2PXYC 2Y6SC 5IW3A 4ZUTB 1WFTA 3KWWB 3REWA 1BQHB 1R5WB 5HHXL 3IDXL 3TCXA 3FRUB 5DHVB 2FGWH 5CUSH 2PF6A 1BZQK 3ZTNH 3LPGA 4PJ9B 1KC5L 3N85L 1QKZL 1JGEA 5HI5D 4PJEB 1MFCH 3I6GB 2VSDA 1EFXD 1B88A 1KG0A 1T7XA 25C8L 1HQRB 5DFWH 1NDGB 2CR3A 4RMVA 5E2TL 4NN5B 1LP9F 1JTOA 1RIVL 1EJ6A 5DO2D 3PE9A 2BOCA 2BK8A 2J5LB 4GG8B 3MNWB 1CI5A 3QDJE 1I3RA 1G9NH 4S2SB 5DK0B 4Q0XH 3QHTC 1U93B 4JPVL 5CBEB 2CIIA 2NX5B 3MGTB 3HPJA 3QUZC 3MXVH 3UTZA 3O2DH 4NKDB 1I3UA 2BSED 3BP4A 2YD9A 4NC1C 1FSKB 4MZ2A 3A67H 5IP4A 1UEMA 1YMHB 2O61B 4L4JA 2X4TA 2BSTA 1EJOH 1S7QB 5FB8B 1X5ZA 1TXKA 1MH5B 3H9SB 5K59E 1JHLL 1HEZB 3KNBB 4X6CB 2VR5A 4KPHH 3CFBB 4MJID 2MKWA 1RJYA 3K4AA 3MJ7B 4H20L 1WZKA 1TIUA 3QH3A 5ADPL 3ZDYE 2XZQL 2IPUG 4X5XA 2EDNA 4JN1H 3FOMA 4M3KB 3UX9B 4Y19A 2D2OA 2VOTA 3O8XC 3MRIA 4XT1C 5D2NB 5E1AA 4KK9D 2VLKA 3WO4C 4A6YB 5HGHB 2CKBA 2XWJB 4JM2A 2YWYA 3H7LA 4UIMB 3DHJA 4OZHE 5IBTL 3MRKA 4QY8A 4U1LB 4EOWL 3ULVF 3KPRA 5I1HH 2WLYA 4ONGH 5BVPH 1JJUA 4LGRB 3EGSA 4F37F 2HRPH 3AAZA 4Y5XB 3RWHB 3EO0B 5HHNB 1ACZA 1LO3H 3BE1H 4MXVE 4Q6YA 1UWEH 4YFDB 5SWSE 1P1ZB 3QEQD 1U58A 3LDBC 3DVGB 4Z7WE 4NQEB 4MJIE 1QBLH 1RZKL 3HAEA 2OL3A 4P2QB 3G5YA 1II4E 2WINB 5DWUL 3MO1B 4GRLD 3ARSA 1UCBL 5EC2B 3DOSA 1F00I 3FRPA 4G6JH 4NT6B 3TYGH 3T0EE 4LRNL 4LPWA 1KF9B 4M93C 2GYSA 4WWKC 5C0DA 3GMPA 4Y2DC 2VXTL 3CVIL 4L8CA 3CNKA 4OLYH 3V5HB 1TJIL 1QSEB 4NJAL 3RL2B 3CLEL 1MCNA 4MWFB 4L8DA 2IH3B 1QQDA 2J88H 1QLFB 1AGBB 2NY2C 4MA7H 1LO2L 3BKMH 2X4PB 3TGXA 4M3JA 4XP5H 3BDYL 3MLZL 2ARWA 3RUGA 2QBWA 1IZKA 5HHPA 5L2KD 5GGVL 4LSQL 3SGDI 4ZODA 3SY0B 1N3NB 1RFDH 3MLWL 2HG5B 3QEQE 3IDIA 3AVEA 3TV3L 2B0SH 2R0LL 3GJFB 4UQ3A 2HH0H 1NGPH 3B5GA 5GGTL 1FL6B 5JXAL 4OLVL 2BXYA 1TCRB 1JGUH 3MLTB 1EAPA 5C0IB 4XP6L 4HHAA 3MRQB 4PJDA 3U0TB 2B7DT 1BQHG 3QUKB 2X4RA 4X6DF 1P6AB 1IGML 5D1QD 3ZL4H 5F7MC 4DW2H 1VESA 5E9DE 3CU7A 3WS3B 1C12B 1FL5B 1K8DA 5DC9B 5JO5B 1ETZB 5ADOH 2Q8AH 4LLUB 2DMCA 3IU3B 2JK5A 3NFPA 3ARFD 4XCNB 1D5IL 2PR4L 1ZV5A 3OAZH 3ARBD 5HYJD 2JCCF 4HUNB 4JHZA 4RRPG 1ZLWH 2PCPB 2DI8A 4LSTL 1Q0XL 3WL9B 2VIRB 1P53A 4QRQB 1A6WH 3BI9X 2R0WL 3WFBL 4W6YB 2OMNA 2VABA 4PJ9C 5CGYD 5E2VH 4KVNL 3AB0B 3QPXH 3LAFA 5ILTL 3EFDH 2ED8A 3PHOB 2X1WL 2JB5L 4NN5C 5HYQB 4JN2A 1Y0LB 1IC5H 3OX8B 5GZOC 3OKLA 2J5LC 3NN8A 1U6AL