3OKMB

Crystal structure of unliganded s25-39
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
215
Chain Sequence
b'EVKLVESGGGLVQPGGSLRLACATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQSSLYLQMNTLRAEDSATYYCARDHDGYYERFAYWGQGTLVTVSAAATTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSTGVHTFPAVLSSDLYTLTSSVTVPSKTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-39 Fab (IgG1k) light chain
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
molecule tags Immune system
total genus 43
structure length 215
sequence length 222
ec nomenclature
pdb deposition date 2010-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okmB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okmB01
1JPGA 3F7YA 1U58A 3HC3H 3NZ8B 4CAGA 4XPHH 2DKSA 1YN7A 5TDOA 4IRJD 1TQCC 2WNGA 3R1GH 3LKOA 4OM1L 3Q6FA 4X80H 3TN0A 2CRYA 5AUMA 1H15A 2CIKB 2IQAB 4JHWH 2BZDA 1ZLSL 1QFUH 2AJSH 4LHUD 4BSVB 2D9QB 4LBEB 2P43B 2QBWA 2DAVA 1G84A 4LNVA 2ZJSH 3OGCA 4K3EH 4XVTL 1PAMA 3IETA 4NNPL 1T1XB 1MCBA 3S4SG 4LP4A 1UWGL 5IGXL 5T5NG 1T80A 3QYCA 3IT8D 4QYOB 5EN2A 3MRIB 4PYGA 1KF9B 4NYLA 5T3XL 3DSFL 2XFXB 1C7SA 4C58B 4E41B 2R56H 3QNXA 2OR8A 3PGFH 5GXBB 2JJSC 1FNSH 5EZIL 5JHLL 5JW4Q 1XF4B 3SDXF 2BVPB 1C5CL 3LHPL 1IRAY 1R5WB 5L6YH 2XKSA 1S7VA 3VFVA 4O2EB 5JW4R 4CN6A 1Y18B 3NFSH 1EA9C 1BD2B 4R0LC 1F4WH 3FQTB 3IXAB 4NP4L 3G9VA 3IDYB 2VE6A 3HR6A 2HH0L 4NQUA 4P23D 3MLYL 5HYSA 5D7KE 1Z3GH 4NQCB 2AQ1A 5CD3B 4LNRB 3S3SA 2ERJC 1UT9A 4HCRA 5BQ7A 4H1LA 3QZWB 4OLZL 5DZOA 1CFQB 2EXYD 3BD3A 1IGIL 3QXVA 3TBYA 1HQRA 5ICYB 4G9DA 5CJQL 3VFNA 3QULB 3D9AL 4FQLL 3RKDD 1DLFL 1H8SA 4OCXH 3VRLF 2PETA 3L5JA 4QEGA 5B39A 2VMFA 3CFCH 3ILQC 3QUMH 5SV3A 4I3SH 1A1NA 2APXA 1A22B 3CX2A 1OY3B 4NM4L 2DTMH 5B21A 2YMXH 3MOBL 4WW2F 1MHHA 3ARXA 3OKMA 2XTLA 5KJRH 3MBED 4HXAL 4WWID 1XGTA 3T04D 3MRDA 3F65A 4NQCE 4BQ8A 5I15L 3R8BB 1ZEAL 5GIRB 3K4AA 1IAII 3EKCA 3UZEA 3JBG7 4OFYD 2NY1D 4F7EA 1A9EA 4HH8A 1SEBB 4BZ1L 4ZS6D 5DJDB 1A4JA 4JPWH 5MI0C 3ZKMD 3BKML 1Z0NA 3KYMA 5D93C 3D0LA 2PCPA 4OCSH 2M26A 2PO6C 4B50A 4KKBD 2BVYA 2VZVA 4BQBA 3BHBB 2QSCL 1CR9H 1EEUA 3VRLE 3TM6A 2V5TA 4O02H 2KKQA 2CKBL 5DS8A 4UAOB 5IK3A 4NQTA 3EW3B 3I3EA 1A3QA 1ORSB 5ADPH 3T0ED 5HYJA 1JI1A 4ETQB 1M6OA 5DQDL 3K8KA 4MB4A 2B8OT 4WHYG 2QV2A 1INQA 4OZ4A 1AKJB 1ADQA 1KGCD 2OMBA 1RULL 3QIWC 4X98B 5E00B 4JDZB 4KK6C 3TJEL 2OYPA 2ZUWA 4O2FA 1LK3L 1S7SB 1W0VB 3KNBA 3EOAB 3IFLH 5KSVB 3IS1X 1NSNH 4LKXB 2E9WA 4OV5A 1DQJB 4ONFH 4UQ3B 1ZLWH 5H2BA 5C70A 4DQOL 3MV7E 3GJFH 2ADIA 1KT2B 5F89A 4O58L 2P5ED 1HQ4B 3I6GA 2N1KA 2EH8L 2F58L 1G9MC 5F7LB 4IEFB 4HLJA 5EC2B 1S8DA 3BIKA 4MXWL 3IU4L 4TUJB 3P4OB 4K9EC 1Q9LA 1O7VA 1N0LA 5HHQA 3D18A 1IC4H 2P46B 3RPKA 1RZJC 3CFEB 1ZHKA 4V2CB 2MPAH 3U4EB 2AEIT 3LKQB 4OAWB 3PIQB 5HDQH 1WVZA 4HV8A 2VDQH 1QSFA 2D9CA 4X4MA 4ZUTA 4FABH 1FSKC 3P4MA 2QR0B 3NFNA 4Y4KC 3HUJB 3WFDH 3BRGC 1CZ8L 3D0VB 2VYRE 1MCFA 5DJYA 3C60A 2NXZB 4U1IA 5BS0A 1KCVH 1G9ML 5I73C 4YDVB 3SCMB 3HR5A 2G9HA 4LU5L 3W9EA 4Z77B 1H9VA 4K9EL 4JY4B 4Y19D 3BISA 5C08B 2B0SL 4OLUL 4EIGB 4CVXA 1AFVH 2X89D 1A6UH 1WC7B 1Y6NR 2KZWA 3H9SA 4GUPB 4X6CF 2V5YA 2Z31D 1OLZA 2NXYD 4PJDF 3PWVA 3V0AC 5J8OA 3VD4A 2E7LC 5E6IA 3QNYB 1YJDH 1W8OA 4GW4A 2MJWA 4MVBD 2X9WA 4AL8L 3U1SH 4L3CA 2XRAH 5DUBB 2EKSB 4KRPC 4DKFH 1RJYB 5IB1B 1I9RL 4CW1B 3C09B 2J6EA 5DA0B 4TNVK 3W82A 3OG6B 4AT6A 2QSVA 4RIRA 4W6XB 5CHNB 4F7CB 3DJ9A 1K6QL 4CJ0A 5DJAA 4IDJL 1DQDH 5SWQA 5C6WH 1NCCH 4NC2B 2I5YL 4DVBB 4KC3B 4ERSH 1TNNA 5KZCB 1KJ2L 2NW2A 3N1MC 4H20H 3MLRL 5C6PB 3QUMB 5FGBA 3V2AR 2GTZA 1EZVX 4XNQB 4PRAB 1BOGB 3CPLA 4KDVA 5IT2L 3H7LA 1QEWA 3QQ4A 4RMQA 4N0UB 5I18H 4XP4H 5ERWB 3TO2A 5C0FA 3L7EB 4MA1C 3VXSE 5JHDD 2D0GA 4BZYA 5JORB 4RGOL 1MFNA 3DV4B 1NGXB 5D72L 3B2VH 3VH8G 1FL5A 2NY5C 3GRWL 3VFPB 3ZYOA 1CDJA 2O5YH 4J6RH 5F96H 4ODSH 4P2OA 1A7NH 4LRIC 4KDWA 1NCWH 4JHAH 3DROA 1UWEL 1F42A 4PRDB 1XF1A 4Q58C 2H6PA 1NUNB 3MLTB 1U93B 4FFZH 4JKKA 1QRNB 2WANA 3L3OB 4OZHE 2PW1B 2OK0L 4WTWA 4XBEL 1IGYB 1MNUH 1T89A 4KAQL 4P46C 4YC2C 1CD1A 4MAYD 2GK0B 4Z76A 5ISZD 4RSVA 4UOW1 2NY5L 3X3GH 4NFBA 1A14L 1BZ9B 3NPZB 2FB4L 1ZT7A 4JRYB 4N0UE 2AAVA 3UBXA 2D31B 1WEJH 3HMXL 3VG0H 1TCRB 4LEXL 3P73A 3MPCA 3LEYH 2F54D 5D70L 3WXVL 4J8RA 4JZNB 5E8NB 1MJ8L 3ZL4L 2APBA 3KPMA 3B9KC 2OZ4L 1P1ZA 4XTRD 3RNQA 4M61B 3RFZC 4OUUB 3Q48A 1WIOA 2FJGB 4MB5A 3MRGB 4PB0H 1HHIA 3VWKD 2XN9A 2W0FB 5B8CC 3MNVA 2VXTH 1F11B 5CEXB 4DGIL 3BPNB 2ZUSA 5DTFA 1FFNB 4D0CB 4AEHL 4NIKB 1QR1A 2MQCA 1IEBB 2R2CA 3GJFB 4L4TE 5C7XL 4ZFFA 3ALWA 2DQIL 3QQ3A 3EJZC 4JRXE 3W9DA 3UDWC 1Q8MA 3CFBA 3F58H 4OLEA 4LARL 3FOLA 4FRWA 2HVJB 5IKCA 2ATKB 4NKMB 5J6HB 4Y4HC 4R2GD 5IVXF 1HIML 2ADJA 2QQNL 4F3FA 1M71B 3H6JA 5DUPH 3I2CL 4ACPA 4M93C 4IMKA 5ICXB 3NCCB 2R1YB 3K81A 5DC9B 5HHMD 5INDA 4PJ5A 2P7TB 2YBRB 5L9DH 4YX2H 4P5MA 1T7YA 5CWSB 1GHFH 2ADGA 2OL3L 2ZPKL 1CFTA 4OBRA 5DHVH 3K8MA 4Q9QL 4QT5B 1E6OL 4DUWA 3GSNH 1R24A 4MQ7A 4WHDA 3VG9C 1MRCH 1KIQB 4F7PA 1A21A 4XNXL 3V0VA 4U6HA 3IDGB 3QH3A 2UY6A 4LLVB 2I27N 4BQCA 1KOAA 5A16B 3PABB 3UAJC 4L4VD 4NQDA 1V7MH 4M02A 1RQ5A 2ITCA 4OUOA 2K7QA 1U3HA 3HNVH 4P2QD 3KPRA 1Z5LB 2C3WA 1U95B 1M7DB 3FQNA 5H37H 4BELD 2EDDA 3RUGE 3C6SB 3KLAA 3VE0B 1CWVA 1EGJL 5T5NF 1QHOA 2H26B 1D5XA 2EDTA 5TQ2H 2A77H 4OI9A 4WFGE 4NRXB 4MQSB 1K4CB 1YMME 4ODVL 4C83B 4F37F 2X7LB 3QR2A 5IVXE 2ENYA 4WJ5B 3G6DH 5IM7A 1FO0A 5JLZB 3VGHA 1EEZB 1UJ3B 2VSCA 5LG1A 5CINL 2CO7B 4QRPD 5F21B 1RJLA 2AABH 1AI1H 4HUMB 4HDIB 4KPHH 3CFJB 4PTUB 4HKZB 2NY2B 3RTQB 3ULUC 1W72H 1OM3L 5E5MB 1RZIB 2OTUA 1MFBL 3D2UA 4RCAA 3S36L 4UI2A 5GGVH 3UYPA 3DMMB 3O45B 1WUNT 5HI5C 2AEQL 4J2XA 2F5BH 1HINH 3IJSB 1DVFA 3PP3H 3WJLA 3RWCB 2UY7A 4DOHB 5FYJU 3FTGB 3ILQD 5JDSA 4PJHF 3J7HA 4P23B 5F93C 4ZYKB 1SEQL 2VLRE 1JTTA 3ECBA 3VFRB 4X6BB 1N3NB 1X3DA 5HHXL 4TSBH 1OAZH 2I9LA 3HNSH 3ULUL 2B2XL 4EVNB 4PJ7E 3SKJH 2PYFA 3MZTA 1X5XA 1OTUD 2CIKA 2IQAA 3LIZL 3STBA 4TUKL 4BSVA 2IWGA 4WCYL 2YWZA 3HC4H 3OXRA 3P0YH 4X0KB 1PDKA 7FABH 4JM4H 5F8QC 3GIZH 2F15A 5C2BH 4OCLC 2XTJB 2XXCB 4K7PX 4WENB 1JWSB 1X4YA 3MRIA 1PZ5B 4HUXB 1HHKA 1IARB 2XFXA 5L0QC 2YRZA 3TIDB 2W0LA 3SOBH 1P5UA 1G1YA 1KB9K 4RRPA 2HRPH 1WBZA 3CNKA 2AJ3B 4GO6B 4ONOA 1RU9H 3VXUE 1QFWH 3O2DL 1G7JB 2CUIA 5F9OH 2BVPA 2PO6D 4ELME 1LO2H 4XH2B 1R5WA 4HUUA 3MBEB 4XZUB 5DMKB 4CN4A 4O2EA 3ZHKA 2P49B 1U8HB 5KN5B 1NC4D 1IM9A 4J23A 3SDDB 3FQTA 5GSVB 3U7YL 4MNGB 4NJAH 4E9LA 5TDPB 2CDFB 2KH2B 5IROA 1WLHA 1CLZH 4NQCA 1C5BL 2NY1B 1IE5A 4NO2A 1IMHC 3DUSB 3PE9A 4EIZC 2A2QT 3T2PA 1JRHH 4Z7WB 4J12A 4ZDHB 3QIWD 2X4SB 4YHKL 1OF2B 4HG4J 1G7QB 3GMNA 2JJVA 5E03A 3Q3GB 3VJ6B 4MNHA 5KVDH 2IFFL 4JB9L 5ACMA 3ZDZE 2IEPA 1MIEL 3QUYA 4LLYA 3THMH 5E1AB 2W60B 1YNLH 2MOVA 3P30H 4XNYH 4MJ6B 1VEOA 3W81A 1UXSB 4EZMA 1I1RA 4F9LA 4PV9B 3E6HB 4F7TA 3VFGL 4GMSH 3T08A 1NCBL 1P4IH 3KYOB 4PJGB 4UT7H 5IBLD 3U0PB 4P59H 5JW5A 1VCAA 5DHVB 2DQEL 1FFOB 3GSNB 4OQ1A 5GIRA 2V5MA 1QQDB 1CFNB 1SEBA 5FHAL 4BM7A 4OM1H 5D1QB 2UZYB 5J13B 3QA3B 1VSCA 4JFPB 4K7PL 4Y4KD 1ZLSH 1EK3A 4NFCA 1YY8B 1A3RL 1E6JL 4CU7A 4UT9L 5C07E 3NMEA 3BP4B 3QZWG 4XVTH 1KXQE 3MV7A 1VGKB 2A6JB 4NNPH 5EU4B 1UWGH 3BESR 3QI9B 3SPVB 2JCCF 4IRZL 1J0HA 2VZOA 5IGXH 1SY6A 4HF5L 3N1PC 1YMHA 2DD8L 2EDHA 3O6LL 5T3XH 1T66C 5JQ6L 5EUOF 3T1WA 4PJFF 2ZCLL 1ORSA 1EZVY 3D6GA 4J7RA 4YZFF 4XNMB 5EZIH 5JHLH 1OLLA 1FYTD 2FATL 2A6KA 1C5CH 1MPAL 4Z8FL 3LHPH 4LVNC 4QXTB 2QTEA 3VWJB 4JPVL 1XEDA 1AGCA 4KFZC 1AKJA 5E08L 5E00A 5GJSH 5C09B 3GHBL 4NP4H 4JDZA 2W91A 2HJLB 3V52L 3VGBA 5C0DA 1FNFA 1S7SA 1W72B 4PD4J 2HH0H 1BVZA 1W0VA 3PHOB 4RAVB 4KRMB 5F6HI 3AVEA 3MLYH 3SE9L 1YEEL 2NY4C 2XG5A 4LCCC 2AP2A 2DLFL 4XNUL 1FGNL 4UQ3A 1T83A 3ZZ1A 1EJ6A 5CSBA 4U1HB 5IMMA 1NAML 1GGCL 4HJGB 5CSZA 4G6KL 4OLZH 1IGIH 4IIQC 2ZCHL 4HC1A 4C59B 1NMAL 3IFOB 2A9MH 3L3HB 4JQXA 4ZFOL 3GIVA 2QHLA 3OJ2C 1S7RB 5CJQH 4YFLF 1LO3L 1N6VA 3D9AH 5EC2A 1QLEL 4FQLH 3P4OA 1DLFH 1KC5L 2YK1L 3ARRA 1WGOA 4PRID 3HE7D 1E27B 3CFEA 3OJMB 3S5LA 5EUOE 4WO4C 3LKQA 4OAWA 1ZS8A 3PIQA 5GGTL 2DJSA 3S34L 1KBGL 4NM4H 4YZFE 1IGTA 5TGBB 5C09E 3OL2A 3MOBH 4M6AA 1UC6A 4Z18A 1HHJB 2QR0A 3EYQC 1OP3K 3HUJA 3PWNB 1LO4L 4HXAH 3TVMB 2GJZA 4KY1L 3FO9B 3HE6A 3QDGD 4L9LA 4CKVX 2H2PC 2X1QA 4WI8A 4XWGL 5I15H 5IESL 1J1XL 4S1RL 1A02N 1ODAA 1ZEAH 3WFBL 4L8DB 1BVLA 4WDIB 5E4EB 4Z77A 4XAKD 3I84A 4GKNB 3O41B 4JY4A 1IJ9A 2OLDA 2PXYB 1FAKT 3UBXI 4BZ1H 5C08A 5EU3B 1N0XL 2P5WB 1WC7A 3BKMH 4ZS7L 3PQYE 3GI8L 4LLMB 4P46D 3BGAA 1MAJA 1X6LA 2ITDA 5I71B 1YPZE 1BLNB 2P44B 2FYYB 1MF2L 5KSBB 5F97E 2XZZA 3DXAE 1CFBA 3HZMB 43C9A 1MFEL 2Y6SC 2QSCH 1JN6B 3SO3B 1RJYA 5KAQG 5IB1A 2FHCA 3AU1B 3ARTA 2V9RA 1NJ9B 1MI5D 3V5KA 2CKBH 4POZC 2QQLL 5DC0A 3QPQD 5ALCL 3B9KD 5CHNA 4HWBL 2HN7B 2DIAA 3MFGB 3QXUA 1Q9WB 3ULSB 4OKVB 2ZSVB 5DQDH 3MOAL 1I9EA 4G6AC 1RULH 5ISZB 4OZHA 4OV6F 4OFDA 3HNTL 3VXMD 3VFOB 4KV5F 3TJEH 1LQSR 4G9FD 1CQYA 1OW0A 1LK3H 3V5DA 1JWMA 2W0PA 3ARGC 4RMSA 1T0NB 4XNQA 5E9DE 5D1ZA 2DDQL 3PDGA 5TH2B 4Y5XB 4JM2F 4N0UA 2YPLB 4WEUD 4KRLB 4Y4HD 4DQOH 1BJ8A 3RZCC 5JORA 2BSSB 4O58H 3H0TB 1QBAA 2EH8H 2F58H 1LE5B 1KPRB 3K2UH 3VFPA 2C3HA 4MMXC 1YUHA 3ARDC 3EYOA 4MXWH 3IU4H 5MEND 1UWXH 3WLBA 2PNDA 5IFAL 4LDLB 1DQTA 5KSAC 5IBUB 5DHYB 3HZYB 3VCLB 1F00I 5CBAB 1OD9A 2IADA 4JG0L 5HDOA 3SDCC 2VZ3A 1YEDB 1U93A 1QRNA 3L3OA 3AY4C 2PW1A 1MCIA 4L1HA 2IH3B 1OTTD 3UAJD 3NIDE 1CZ8H 1K5NB 4R2GB 4NQSA 2GK0A 2FEDC 2YR3A 3BW9A 3FO1A 3GHEL 1G9MH 1X5IA 43CAA 5CEZD 2YPLE 1TQCB 5HHMB 1BF8A 3BQUD 4FQXA 4LU5H 4WI5A 4K9EH 4Y8AA 4WTXA 4L29A 4HFWB 1QPXA 4JVUA 3DYMA 3W0WE 1IKFL 2B0SH 4MZ2A 4OLUH 3U36B 2ZUUA 5KBNC 2MKLC 5I1AB 4G42A 5LAXB 2APFA 3D5OF 4M61A 4Q9BA 4HWZB 1JP5A 4OUUA 2Z9TA 3FT3B 3MRGA 2AEWA 2W0FA 1CDIA 4LPTA 4AL8H 4EKXA 3FB8B 4OI8A 2ATPB 1F11A 2RQ8A 5CEXA 5E6ZA 3ULUD 2AK1L 1I9RH 4P2QB 4U3CA 1QG3A 4M3JA 1AC6A 4D0CA 1F3JB 4YLQT 1KEML 1IEBA 3RX8A 5TDNA 2G5BB 3PG2A 5C1MB 1JNHB 1FVDA 2YHGA 2NY6B 1K6QH 3LMJL 4IDJH 3SDAC 1EXUB 5FYLL 1ND0A 5T3XE 2ATKA 4EI5B 5EO1B 5EU5A 5J6GA 3RUGA 5C0CE 4ZUUA 3SKMB 2I5YH 4GRMA 4NO3B 3ARFC 1E4WL 1MLBB 2QADC 1KJ2H 1NBZB 5JUEL 3ZE1E 4Y5YB 1TVHB 1IEAA 1YMMA 2NYYC 4QRPB 5HHOE 3DNKA 1SMOA 2ERJB 1MFDL 5GS0D 5CWSA 2NLJB 1XH3A 5IT2H 4HT1L 3TH2T 4CRPA 5DJ2B 1XGQB 5IVZB 3H3BC 3LN5B 5FM5M 1KIQA 4JO1L 1FE8L 1SYSA 1U8KA 1DBML 3IDGA 3BZDA 5IHZB 1QD0A 4CL7A 4RGOH 1TFHA 3WHE1 5D72H 1Z2KA 3GRWH 3DTXA 4X4YA 4JFDB 1P4LA 5EU6D 3D39E 3FRUB 4LDEB 4APQA 1JPSL 1OSZB 1U95A 2AXJA 1EV2E 2AVGA 3JWDC 1UWEH 4G6ML 2E6QA 4RAUA 1RAMA 1GZQB 1I8KB 2VLRA 4MD5B 2H26A 4O51A 5DD6B 3QIUC 2OK0H 4NRXA 4XBEH 1K4CA 4PJ7A 4U33A 4WFFD 4XWOD 4C83A 5I8KL 4KAQH 4DZBB 5ANMB 3IKCB 4WI3A 1EEZA 1NCAL 2CKBB 5FYJE 2NY5H 5ID0B 2XQYG 1G7MA 3UTQA 4D2NA 3DRQA 1A14H 4OFIA 2FB4H 4QRTA 1IAIL 3CFJA 4PTUA 4HKZA 3RTQA 5C0NC 3C5ZC 3KPOB 1N64L 3HMXH 5MI0B 4LEXH 3O4LD 2DI7A 5DI8A 4BSJA 5D93B 2A74B 5D70H 3WXVH 1UM4L 1MJ8H 1P5VA 1NGQL 1T3FA 3ZL4H 2DOCA 3BYTA 3DMMA 3BZEB 3O45A 2KZ1B 2PO6B 2R9HC 1V7NL 3IJSA 3VXUA 4NT6A 4J3WA 3UTTD 2C5DC 4U6YB 4ELMA 1I3VA 2VLMD 3QEQB 4FOMA 2VN4A 3FTGA 4DGIH 5HYFA 2FR4B 5A43C 4ZYKA 4PPTA 3FKUS 4D8PB 4U1GC 3BGFC 3GFUA 4AEHH 1T5XA 3CLEL 3ZO0A 3MXWL 5C7XH 2DQIH 3MR9A 4PJBB 4HMEA 3WUWA 2BNQD 3C2SA 1G7HA 2CUMA 4LARH 3QDMD 5C3TA 3QEHB 1JHTA 3P40A 3QIWB 4TUOB 2XG4A 3I2CH 4UZGA 2CK2A 5DR5L 4RMWA 4LHUG 1LE9A 3WXWL 5TE4L 5JO5B 4Y2OA 1PZ5A 5L8KB 2BFVL 3FB6B 1WSST 3VXRE 1EBAA 2LE9A 2OL3H 1MCHA 3UYRL 3TIDA 4PV8B 4QF1A 1E6OH 4QXUL 3V6FB 1ZVSA 1M05B 2H45A 2AJ3A 4XNXH 3ZHLA 1G7JA 1NCTA 1K2DB 1INEL 3QEQE 4XZUA 2HLAB 1I9IL 5DMKA 4BFIB 3CFKA 5KN5A 1DLHA 3RY6A 3SDDA 2UYLB 4U05A 5EOCL 3MRLB 4F57L 2B20A 3VXOB 1JNNL 5TDPA 2DF3A 1T66D 5FO7B 1EAPB 4PLJC 1XGUB 5EFIB 3KVQA 5T3ZE 5FO8B 1DUZA 1MCQA 2XXMB 5EO0B 1FSKB 3VDAA 4Y4KB 1EGJH 3QFJD 3DUSA 5GGUB 3PWUA 4MQXD 4ZDHA 5HGBA 2EYSA 2VQ1A 1G7QA 4ODVH 4U3XA 2VIRA 3Q3GA 5DDHA 5I73B 1FFRA 2P8LB 4LKCA 3GSUB 3PNWB 2XZCL 4KI5F 5CINH 2NY4D 5C07A 3T2NL 5HVGB 1GGTA 5E1AA 1UG9A 2R2HB 5DO2D 5BZDA 5GSRA 4DZ8A 4KTEL 1RSFA 2WBKA 1OM3H 4QHNA 1QFHA 1MFBH 3S36H 1IAKB 3D85D 32C2B 2EYTA 2FWOB 1KJ2B 4LPUA 3CDYA 3LSOB 5CP3H 5IR1B 2X6MA 5CGMA 4OD2B 3U0PA 5DK0B 4IJ3C 1FLRL 4KRPB 1F4AA 5JPNB 1JF6A 4NWTL 5DHVA 3E1F1 4HKBB 5DFVD 1FFOA 3GSNA 4S0TD 3LZFH 4WO4D 3LQZB 1R3KA 1NCDL 1SEQH 3RVUC 1MJUL 1I1AB 3SQBA 5HHXH 1OD7A 4NN6C 4C55A 1CICC 4FQIL 3PWJA 4F37K 5D1QA 3ULUH 2B2XH 3QA3A 4Y2DC 1ZT4B 3WJJC 3EYQD 4JFPA 3LIZH 1IZKA 3OKOB 4TUKH 5GJTL 4OCYL 3BEWB 2V7HA 1YEFL 3UTSB 1AO7E 5CGYC 3WNKA 4OSUL 5BVPL 2H2PD 5E70A 1T7ZA 5EU4A 3LKSA 3FT4B 3QI9A 3UMTA 3ZE0F 3QDHA 1X5KA 1RIVL 2B4CC 5J12C 3L5IA 3CMGA 1GOGA 3DGGA 3UZQA 1F2QA 2JELL 5DJ6B 4XNMA 2KQMA 4PJ8C 2RCSL 4XPBL 3O2DH 3INUL 3DHJA 5EUOA 2ZOLA 3V7AG 3D3VD 5DT1L 1PKQB 1XMWA 3MJ7B 2YUZA 1CVRA 3VMNA 4CU6A 2FDBP 5C09A 1CGWA 3QDGB 3U7YH 2APVA 1G6RL 1AY1L 4V1DB 3PHOA 4FP8L 4M7JL 2Z4QA 2AQ3A 3U30C 1C5BH 2B4CL 2H1PL 4HJGA 4BA8A 5KAQF 1V8HA 3G08A 3IFOA 4YC2B 4YHKH 2L0DA 4EQ3A 1FYHB 3F5WB 5IB4B 2IFFH 3C08L 3T3PE 4JCMA 1YPZA 1KTDB 2BXYA 3GBNL 1TQBC 1MH5B 2FEEL 1FVCB 2IBZX 3K46A 3TN0C 3B9KB 5H37G 2OJEB 3RZCD 4RWYH 2CLZB 1WTLA 3BJ91 3MYZA 2EDNA 3GJEA 1HHJA 4ZOAA 5IMOB 3VFGH 2RHEA 4YE4L 2FECL 1NCBH 5I2IB 4V1DE 3GSVA 3TVMA 5B8CB 5F71A 2M1KA 2MFNA 4NZTL 2VDKL 2EIBA 2OL3B 5KSAD 1LMKA 2IBGA 4G9FB 4JAMB 4OJFH 2DLTA 2DQEH 1YEJL 4MNQE 4WDIA 3FO0H 4OIAA 1NCUA 4YEFA 3W39A 1F8TL 2V2TA 4LPCA 2PXYA 3F12A 3P4NA 3SDCD 1URLA 3MRFA 2HYMA 3HC0B 5FHAH 5EU3A 1MAML 1MCLA 4KUCF 4F58L 5E9DA 2P5WA 1BEYH 4K7PH 1F6AB 3T8XA 5CJ8A 3U9PL 4LLMA 5JZ7C 5JIHA 1A3RH 1E6JH 4DKEL 4UT9H 5I0DA 4BQ9A 2FEDD 4X7TA 4M93B 1F02I 4ORZC 1D5MB 2HA1A 4HIHA 4IRZH 3CH8A 5MENB 1JN6A 1JZ3A 4HF5H 3RBSA 1HKLL 2DD8H 5JOPD 5KOMC 1NJ9A 3O6LH 3RPIB 5JQ6H 3K7UA 5FYLD 4G7VL 2ZCLH 4ORGA 1MJ7L 3DETD 3CSGA 2FATH 3QFDB 4CBPA 4D0DA 1D7FA 1Q9WA 3ULSA 4Z8FH 2V2WB 2FZ3B 2JF1A 2ZSVA 3OV6A 4HBQA 4JPVH 4NC1E 2FBJL 3DRTB 2LTQC 3IDXL 3MRPA 5E08H 4H26B 5DD5L 5FKAB 3GHBH 1IC5L 4YBQC 3V52H 4TVPE 2BMKB 1RURL 1T0NA 5I76B 3SE9H 4XPFL 1S9XA 1YEEH 2Y7QB 5I1DB 1CFSB 1Q38A 2DLFH 3PDOB 5EOCJ 1H5BA 4XNUH 5AAMA 1FGNH 2NTSP 4Y5XA 1QP1A 5J11B 4Q2ZB 1ZLVH 2YPLA 3SDAD 1NAMH 1GGCH 1PYWA 4JEGB 5HGGS 4G6KH 4JHZA 4HCRL 1G7IA 3BKCL 4G8GD 2ZCHH 4TNWK 3HA0A 1NMAH 3W0WA 3GMRB 5SX5H 4JM2A 3ARFD 2QADD 3FHQA 4BSWB 4GRWH 1XGPA 1LO3H 2E7BA 4AG4L 5SWSD 5HDBE 2Z35B 1QLEH 1KC5H 2YK1H 5HJ3B 4HIEB 5CIPA 4FQQB 5DHYA 3HZYA 4EUPH 2V9QA 4GG6F 3GDBA 1YEIL 4M7LT 5GGTH 1YEDA 4MHHG 4N1CA 3S34H 1KBGH 3BUTA 1TDQA 1X5LA 2D7TL 5DVMA 1ERNA 5DSCB 2J1KA 3QQNA 4PY8I 2EO9A 2IH3A 4LFHD 1LO4H 1Q94B 5CD5D 4HZLB 2DM2A 4KY1H 4E5XB 1FNLA 3RDTA 3BD5A 1IQDB 4XWGH 4X9BA 3MLPA 1J1XH 4XP6L 4S1RH 5F1NB 2Z91B 4ZPTB 3WFBH 5C0CA 1ORQA 5LGKA 5IUSA 4HFWA 1CFVL 4FZEL 3JUZA 1XGYH 5I1AA 4ZS7H 1GOFA 4QY8B 5DZNA 3GI8H 5F9WC 2ICEB 5E8OB 4PRHB 4HWZA 3VGEA 4J3SA 3P9MB 1EMTL 1MF2H 1ED3B 4K8RC 1MFEH 4X8XA 2ATPA 5EU6B 3QHFL 3F7VB 4YNYA 5L0QB 5FB8A 1A4KA 5C0ND 4FNLL 2IF7A 1F3JA 4NO5B 4F8QA 3O3AA 4CU8A 3UXFA 4GG6E 2QQLH 2JJSA 5ALCH 5MHSE 3D39A 5J89A 2G5BA 4O2CB 1JNHA 5EH1A 1CD8A 1J9CT 2VLJB 1FH5L 4HWBH 3QUXA 5IBUG 3UZVB 2WMPA 2R9HD 1SYVA 1LO5A 3QDJE 4EI5A 1HYSC 1ZA6B 4FXKB 3QHTC 3MOAH 4JPKL 4CNIB 3W2DL 4OI7A 1UCBH 4NO3A 4PG2A 1JPTL 1MLBA 1NBZA 4PGDB 3HNTH 4K8RL 3DVFA 4Y5YA 5BXFB 4KK8C 3TEUA 4XPAL 2DTSA 5JIPA 1SJEB 3N9GH 4ZXBA 4PRHE 3O4LB 2YEZB 4KVNL 4P2RD 2XACC 3VXQA 5CSGA 3CVIL 3KXFE 4XB7A 1K8IA 1UKQA 3KS0J 3C60C 5I0ZA 4E42A 3LPFA 3CUPA 3BVNB 4PRPB 3ZYZA 3FRUA 5IFAH 4R6UA 1P2CB 3O2WH 1CCZA 3TBVB 4XXCA 1KJMB 4HHAA 4MD4B 4Q9RL 3CC5B 4JG0H 4CMMB 4RA0C 4NZJA 3QXDB 1GZQA 1I8KA 1BFTA 4MD5A 2Y72A 5MP6L 2Q7YB 1DN0B 4JJ5A 3QDMB 5DRNB 4PLOB 3V79C 3L3JB 1WAAF 3MOQA 3ROOB 3Q5OA 1FORL 3DVGB 1X5ZA 4WHCA 2YD3A 4DZBA 3OXSB 1ZGLM 5EB9A 5E6IC 2P47B 1AH1A 2CKBA 3OPZL 5K59F 5ID0A 4U6XA 3GHEH 4PLJD 3IF1B 4IHOB 4JO3L 1TITA 4YFEA 1R6VA 2XZAL 4P4RA 2DQUL 5D5MB 4MJ5B 4P49A 3KPOA 3MROA 4I0KA 5JA9A 1DBBH 3DX9A 4WU7A 4M3KB 2R1XA 4LSUL 1IKFH 1NBVL 2A74A 2HFEA 3VXRA 1IGJB 4PRPE 5IEKB 1JGLL 3VRJB 2BRQA 3UEZA 1GAFL 4U6YA 4XX1E 4MCYB 4ZOEA 3QEQA 5FGBC 1V5JA 2AK1H 1NAMB 4GAYB 1KEMH 3GM0A 1QA9B 2J6EL 2P4AB 1FZJB 1Q9KA 4ZFOB 1CLCA 3AROA 3LMJH 4LVNB 3QFJB 4RFNB 4GRWB 5FYLH 4AENB 1FAIH 4NGHL 4XCNB 3VI4E 5LGHL 4F80A 4NQVA 4TUOA 1L4IA 1ZV5A 4PJCB 4Y1AD 2R1WA 4HIJB 3A6BL 3I6KB 2VITA 3RGVA 1T21A 5JUEH 1E4WH 3LKNB 1WWAX 4EUPB 3MYJB 5K59E 2W1NA 2YD1A 1CTOA 5JO5A 2NY4B 3HZVA 3CU1A 2Q3ZA 4I48B 1CICD 4LLDA 4P2OC 1MFDH 3M1BB 4Y2DD 4PV8A 3REVB 1IGCL 4HT1H 3Q1SL 3OKDB 1M05A 1PX4A 1NEZG 1PD6A 2QSTA 4IIQB 4JO1H 1FE8H 4TTDC 1DBMH 4TQEL 3C5JB 3D85B 1S7TB 2XIDA 3AGVA 1K2DA 2HLAA 5FYKD 4I77L 4ODXB 1T89C 3ILPB 3IFPA 4XC1L 2HJFA 2UYLA 4X7CC 1JUFB 5FAAA 1OAYL 5FO7A 1A7QL 2AK4B 3B9DA 1II4E 2BCKB 2CDEB 1G7PB 3OF6D 1XGUA 4DUVA 5B3JF 4WV1A 1JPSH 1UB6B 5F1SA 5FO8A 4G6MH 5EO0A 3LH2L 4MCZB 1MLCA 3DHMA 5DEGB 4I2XE 1HI6B 1CI5A 5KTEL 4GRLD 4PP2A 4LLAA 2AXFB 5SWZE 5I8KH 4ONHB 2B7DT 4ZAKB 2P8LA 1GXEA 4JANA 1NCAH 4L4JA 2VL4A 1UACL 3PNWA 4YIQA 3TH3T 2HLFD 5L2KD 1AO7A 4FQ1L 2WBJA 4TVSa 1IAIH 1K8DB 2R2HA 4H8WL 1CE6A 3KLHD 3TBTB 1U8MA 1KXVC 5EUKB 2VWEC 1Z6JT 1N64H 3QXTA 2G5RA 4HZAA 1HHHB 3CVHB 3WO4B 1UM4H 3ZSSA 1IAKA 1NGQH 4RX4A 5F7MC 1KJ2A 3D3VB 1BX2B 2EIZB 1V7NH 3BDYL 5DK0A 4IMKC 5JPNA 4MA3B 4HKBA 1LP9E 5J1TC 5HBBA 3LEXB 1Q0YH 3LQZA 3S8WA 3U7AA 1I1AA 1KENL 3TN0D 2A6DB 5J9PB 5D7LE 1QYGL 4N5EC 1JMZA 3CLEH 3MXWH 5IG7A 3I6LD 5GS3A 4RGMB 1SJHA 4Y4FB 3STZB 3E2HC 3BRFA 3BEWA 4QRRB 3MREB 5F6IC 3UTSA 1VB9A 1ZSDB 4PIRF 1HWGB 4TPRL 3FT4A 3MRJB 4LOUD 5DR5H 3ARGB 4HFUL 3PL6C 5TF1L 1E4XI 3WXWH 5TE4H 3DBXB 1EFXA 3RVWC 3OBAA 5F7DB 2BFVH 1MHCB 3OB0H 4UT6L 4MHHI 4C4KO 3UYRH 3T0EE 4HJ0C 3WSQL 1BWMA 1QZ1A 4K3DL 5JZ7D 4LF3A 1JRHI 3PF2A 2WM0A 4LIQL 1AIFA 4GW1B 2V2XA 1LO0L 3SY0B 1INEH 5CJXC 1I9IH 1T04B 4RBPH 3ARDB 3DURB 2CRMA 4TSAL 3TNMA 5DURB 1KCUL 3L5XL 3KPQB 4F57H 1XCQB 1RZ8A 5KSAB 1JNNH 3AUVA 4V1DA 5E7FA 1M7IA 4YHOL 2UV3A 2HRLA 4QRQA 3SDCB 2OZ4A 2R8SL 1A7OL 2EDRA 2GI7A 4FHBD 4W81A 4MNQA 5MEQA 3WD5L 3T1FB 2P5EE 1OTSD 2VRAA 2UVFA 3ZMRA 2PUQT 5I16B 2X4OB 4POUB 3STLB 1H3VA 1DVFC 3WJLC 3P0GB 1OAQL 5IB4A 3HKFA 2XZCH 5KOVC 1FO0L 3NIFF 1KTDA 3T2NH 3K74B 1MH5A 1BPVA 2R0WL 4G43B 1R5IB 1FVCA 3IAGC 1ACZA 3DOSA 1FCCA 4KTEH 3H9YA 2CLZA 1N6QL 3CIQA 3RVXC 5GGSA 4WFHE 5IMOA 3BUYB 3RVTC 3LQAC 1VEPA 3JZ7A 2NNAB 2AI0L 3UPCA 2DBLH 1FLRH 2OL3A 1P4BL 4JAMA 2ESVD 2MKWA 3O2VH 4Y19E 1NCDH 3CDGB 1MJUH 4JG1L 3QHZL 4PR5A 4EN3A 1OGTB 4FQIH 1IFHL 1WFUA 1ACYL 3SDAB 3L95B 4DN3L 1Q1JL 4DUXA 1F6AA 2DQFA 3NIGE 2D7NA 3G6JF 3N85L 4FQ2L 4G8GB 5GJTH 4OCYH 4AQOA 3EDEA 1B6UA 1YEFH 4AM0B 4KKAC 1PZUB 1AXIB 1QBML 3MV8D 3ARFB 2QADB 4OSUH 5BVPH 5E8PB 5BJTA 3LQAL 1BQHG 1CDHA 1D5MA 5BOZG 2IAMB 2Q7NA 3EDJA 2B1AL 5FA3A 3NIFE 5IROC 4HKJB 1N4XH 1XZ0A 1RIVH 2BVUA 1EGJA 5KVGL 1BHGA 5HYJD 5ENWA 1OT2A 3OAUL 5FF6B 1L0XA 1CIDA 4UNVA 2JELH 1DUYA 1MHPL 1HZHL 2RCSH 4XPBH 4LLWB 1KEGL 1ZK9A 1HNFA 2EZ0C 2FZ3A 2V2WA 5DT1H 5F7EL 1D9KB 4WI2A 4Y16B 1KJVA 1T1YB 4H26A 3U0WL 5FKAA 3HI5L 3KPSE 1QLRB 1G6RH 5HHVL 3ISWA 3TNNB 1AY1H 2BMKA 4XHQA 3QUYC 4UTBL 4M7JH 4M6ML 4XP1H 4Y7MA 2Y7QA 1CFSA 1T03L 3PDOA 4AZ8A 5BOPA 2B4CH 4LCUA 1TJIL 5L8JB 1T6VN 4OGAC 4HG4K 4Q2ZA 1BWWA 3ARWA 3GMQA 3DX6B 3QIUB 3ARBC 4RFEB 5JHDE 4NQXB 4L3ED 4F9LC 4WGWB 3MCLL 3G6JE 1KNOA 4CVZB 5DRZA 4C57C 2X4NB 3GMPA 3J8F7 5DJCB 4LLUA 4K23L 3CZFB 1NMBL 5C9JB 3C08H 5MEPB 3C5ZB 3GBNH 3O6ML 4B7LA 4R7DB 2XWTB 4B0MM 1QSFD 2VZUA 3EYUH 1PGRB 4ETYA 3TA3C 4Z0XB 1SJXA 3C8KB 4EBQH 4I0PA 3BP7B 3H8NA 1CT8B 4GG6A 5I1IL 1EVTC 2WQRA 3C60D 2VLLB 4PFEA 4YE4H 5BS0D 3V7MA 3F7RA 1IBGL 4E5XA 4UV4L 1RHHB 1EEQA 1RPQA 4XCFL 3IAQA 3MV9E 2AJUL 3QDJA 3ULVD 4QHLB 4NZTH 1IQDA 2VDKH 1JK8B 4DW2L 3BWUC 5F1NA 1QHPA 4U1GB 4ZPTA 4IM8A 1YEJH 4P99A 5KSUB 1I8MB 4KKLC 3MV11 5HPMA 1F8TH 4HUNB 4C4KT 2XPGA 2F54E 4KH2A 4HGMA 3H9SD 1MAMH 1QACA 4F58H 1Y0LB 3BSZL 4QY8A 4LEOA 1HXYA 1KB9J 5E8OA 4PRHA 2VJXA 1XGRB 1EO5A 4WFEE 4DKEH 5E6ID 2VR4A 3QUZA 3F62A 3HRZB 3OAZH 5K9KA 3RJDA 1ED3A 4QLRA 1REIA 4XXDB 2AXGB 4X8JA 1AGBB 2ICCA 1HKLH 4XP5L 1SY6L 1R3HA 4JN2A 5D2LF 1SM3L 4R3SB 4JFYB 4UDTA 3VI3F 1T20A 1KG0B 4G7VH 1T83C 3MO1B 4AH2A 3SJVE 3A6CL 1MJ7H 1Z9MA 1VFBA 3RKPA 5CZVH 3VXNB 1FN4B 4PJIF 3T3MF 3BX7C 3OMZA 1UH2A 2DN7A 4JQXC 3TBSA 3ARED 3IVKA 2UWEB 4M00A 5JW4N 2FBJH 3LRSB 3VA6A 1X5GA 4PG9B 5DD5H 3X14A 1IC5H 2WIMA 1BFSA 1TLKA 2A83B 5DRXB 5CILL 1RURH 1CGSL 1BECA 4TOYL 5ESVB 1JZ4A 3IGAA 3NCMA 4PJ9A 4XPFH 5IQ7L 2PR4L 25C8L 1EHAA 3RVVC 3JV6B 4XC3L 3BGMB 3QIBB 4QHKJ 3V8OA 5FKPA 1KCLA 4HCRH 3BKCH 4H1LH 1OT1A 3MODL 1WZLA 2EDYA 3O11A 4L4VE 2Y9RT 1CXEA 4YXLL 1XF2B 4PRPA 5D1XA 3HE6C 4L9LC 4AG4H 4MLSA 4P2OD 3L1OL 3WDJA 5FEBA 1NKRA 5D2LE 3BT2L 5FHBL 3QCUL 4MD4A 5ETUA 3VI3E 4TTDD 1HCFX 2JB6B 3SQOL 1YEIH 1MFCL 4TSCL 1QBLL 1DN0A 1I7RB 2D7TH 4PJIE 5GRXG 4N0RA 3DVGA 4Y1AB 3TH4T 4XBGB 4GG8A 5E8EB 1ZVYA 3HG1B 1WCBB 3L9RA 4ALAL 3IF1A 4XP6H 5A1AA 4PRBB 2G2RB 2X70A 2GCYB 3GB7B 4NN6B 4P4KD 4N90D 3KPLB 5IFJA 4MJ5A 4Y2DB 3MUHL 1IQWL 3QUKB 1CFVH 4FZEH 1N5AB 5BZWB 1IGJA 2WLYA 2X05A 3SBWA 2E7HA 3O9WA 2DI9A 1E0OB 1G6RB 3VRJA 2XN9D 3T4AA 4QTIL 1EMTH 5AEAA 2ZWLT 1UB5B 4MCYA 4X6DE 3QHFH 5J12B 2EDJA 1OW0C 5HHPB 1F58H 4FNLH 1JVKA 1NAMA 3NOIA 5C0BB 5D1ZC 1TZIA 3HTLX 4PJBF 1GVIA 4PLNC 4PJ8B 1UYWL 4Z7QE 2PYED 3G5YA 4PJXB 4JN1L 3W11C 4ZFOA 1FH5H 1NFIB 4TULH 4AENA 5T1MA 1D5BB 4LSVL 1D3CA 4HIJA 3W2DH 1IL1A 1JPTH 3LKNA 3IDJB 5KS9B 4I2XA 4PJ5D 3GSQB 4K8RH 3H7BB 3U30B 4AY0A 1DQQB 5SWZA 5DEZA 4I48A 5GGTA 2W65B 4XPAH 5AWNL 3M1BA 2BXZA 3REVA 4LVEA 3IB4A 1DEEA 3OKDA 5GGRB 1J11A 4IIQA 2J12B 4KVNH 3SGDH 3OR7B 3CVIH 4ZO9A 1TENA 3ZTNL 4NQDD 4ODXA 1UEYA 3F7PC 3ILPA 2BSRA 4NN7B 1U3HD 3JTSA 5C0BE 3RVWD 1JPGB 3F7YB 3KPRD 1JPFB 2XQYK 4NCC2 2AK4A 5TDOB 2J8OA 4FQXC 3S88L 4Q6IA 1P53A 3TN0B 4RFOL 5AUMB 4Q9RH 1LP9A 2GSIB 4DKDC 3SKOB 1R5VB 3ME0A 1AGEA 3OKYA 4P5TB 5MP6H 5KS9E 5D7LA 4ZODA 2AXFA 3WNNA 1FORH 4ONHA 5D8JL 5IFHL 4ZAKA 1ZMYA 4JO4L 5EN2B 4MX7B 3OPZH 4WUUB 4NYLB 4JO3H 2ARWA 2PN5A 2XZAH 4HWBA 2EICA 2DQUH 4RGND 3B8YA 4EUPG 3CLFL 3D2UD 1FC2D 4WU5A 2XQBL 4U1LA 1NBVH 4LSDA 3CVHA 3B5TA 5FGRA 2DIBA 1S7VB 3BAEL 4QWWC 4OF8A 4HUKB 1BX2A 1JGLH 2GY5A 5EU7E 2I60L 4KK5C 2EIZA 4NOFA 5D71L 4R26L 2BSED 2VE6B 5HYSB 1HWHB 4XT1C 3ZDXF 3LEXA 4M9PA 3T65B 3BE1L 1H3XA 2OP4L 3IJYA 2A6DA 4UUJA 4NUGL 5BQ7B 4H1LB 3CDFA 2J6EH 3RVXD 1ROWA 4Y4FA 3RVTD 4WEBL 3STZA 3TBYB 4NGHH 4QRRA 1R3LA 4WUUE 4LSRL 2LTQB 5LGHH 3VFNB 1ZSDA 5DJXB 3A6BH 3NZHL 3MRJA 4YAQA 4MAUL 3ARGA 3ZLQC 5KVFL 3WLWC 2L7UA 5T1DL 5B39B 5F7DA 4IDLA 4APQC 5BRZB 3EO0B 3UO1H 3L3DA 1IGCH 5FECA 3Q1SH 3LPWA 1JGEB 3WYRA 1FYTE 4XNZC 5GS2D 1MHHB 4KKAD 1XGTB 5FK9B 3DI3B 4GW1A 3SY0A 5IV2B 1MHEB 1YEGL 2IANE 4HULB 1FC1A 4I77H 3DURA 1JNJA 1A2YA 3VMPA 4N9OB 2NY0C 3RAJL 4NQCD 3BYYA 4F7EB 1OAYH 1A9EB 3QSKB 3RWFA 4Q0XL 3D25B 3E8UL 5JA8B 3KYMB 1W8NA 1AD0A 3D0LB 1EO7A 2PCPB 4MDIB 1OGAE 3QXAB 4I3GA 2YC1A 1VFUA 3LH2H 2I25N 4AYFA 1HYRC 3TCLA 5DD0L 5KTEH 6FABL 5I16A 1TETL 4KJPD 1UM5L 4H5SB 2X4OA 1JBJA 3STLA 2Z31A 2VUYA 5BRZE 1VEMA 5B4MD 1C1EL 4MGXA 3MUZ1 3IFNL 5DS8B 4FQ1H 2BVEA 2E27L 5FOBB 1R5IA 4OGAD 5FUZL 1Q0XL 4PYHA 1NDMA 5L8LB 4O4YL 1BMGA 4YGVA 4WI6A 2VTFA 5F9WB 1M6OB 4L1DA 1YQ2A 1INQB 2E7MA 4OZ4B 1I3RB 3H42L 4YDKL 3JSSA 4POYA 2J7LA 3BDYH 5AAWA 2FIRT 2NNAA 1D5IL 3FO2B 5D6DA 4I4WA 1R3IL 1XF5A 1KPUA 4M48L 1KENH 2KL6A 2I26N 3A0OA 3KPSA 1OGTA 5CJBA 1QYGH 4DKAA 3QT2A 2G60L 2ADIB 2ZG3A 4WWKC 4LHQB 1TJHL 3MCKB 4AM0A 1S8DB 4Z7VB 4TPRH 3SDDC 3WL9B 2IAMA 1S7XA 3QWOB 15C8H 1AD9B 5HHQB 1ZHNB 3FFCB 1MI5E 4LQ1A 2Q86B 4HKJA 1ZHKB 4FFWD 4UT6H 4FG6C 3UJJL 4URTB 5FF6A 4HV8B 3WSQH 1QSFB 2R2EA 3MX0A 4K3DH 3NFNB 2DQDL 2J5LB 1MY5A 4LLWA 4LIQH 5DJYB 1LO0H 1AKJD 4U1IB 1U8PA 1D9KA 4Y16A 2BRRL 4TSAH 3VXME 1LGVA 1T1YA 2D7QA 5FM5O 1KCUH 3HR5B 3L5XH 1QLRA 2G9HB 3W9EB 2H3NA 4YHOH 2D0HA 4FXGA 3WNOA 2OXGA 3MV9A 3P4LA 4M1DL 4CVXB 2R8SH 1A7OH 2W9DL 3H9SB 5I8EA 3DX6A 4NQXA 4YXHL 2CR3A 4Z7VE 4OCWH 3WD5H 1IAMA 2C3GA 4JFHE 1OAKL 5GHWH 1U3YA 3FFCE 1I7TA 2YD9A 3KR3L 4S1DC 5DJCA 4GW4B 3BN9C 5D7SL 5KANI 4L3CB 4Z7UE 2R4RL 3CZFA 1OAQH 3ULUF 3B2UC 2G75B 5C9JA 1FO0H 1TTFA 1GRWA 3VXPB 3C5ZA 2C26A 5F1IB 2F74A 5CGTA 2R0WH 4AT6B 3RVVD 2XWTA 4RIRB 1RJZB 3EBAA 3TZVC 4ZUVB 4YHNB 2DL9A 5D1QC 5J13C 4DAGL 3S3JA 3DYPA 3C8KA 4Z0XA 3O0RL 3H3PL 1CT8A 1N6QH 1V3LA 5SWQB 2NXZD 2VLLA 4BZ2L 2W92A 1FNGA 1EHLL 3SJVA 3HE6D 2OCFD 1AXSA 1RHHA 4KJQC 2AI0H 3SCMD 3MZGB 4QHLA 3QI9C 2J8UB 5CEZE 2GTZB 4YDLC 5FA4B 1QFPA 1P4BH 4W4NA 4LFHG 1OB1A 3CPLB 2D7MA 3G5XB 3CZJA 2WW8A 1I8MA 2VAAA 1Q9OA 3B5GA 5C08D 4JG1H 3QHZH 3BIAX 1S7QA 1UEMA 1QRKA 5C0FB 1IFHH 1ACYH 4DN3H 5I1CL 1Q1JH 1KULA 1EUUA 1Y0LA 3N85H 1JZ5A 4FQ2H 5T33L 3WMSA 1FL5B 2LU3A 3DO7A 1QBMH 5GRZA 1HEZA 4X9FA 3LQAH 4XXDA 3EO1B 2AXGA 2B1AH 3NABL 3QWQB 2EDFA 1DDHB 1YDPA 4P2OB 4L4VA 4PY7B 4R3SA 4JFYA 3ZSTA 5KVGH 4Z78B 1KG0A 3OAUH 2H6PB 1S9WA 3MO1A 1MRFL 1MHPH 1HZHH 5D2LA 3OKNA 4RZCA 3VXNA 5HGHB 1WIPA 1RZGB 1GZPB 3HRPA 4NNXB 1MFAL 1CD1B 3O8XB 4OKDA 1WK0A 5F7EH 5KZCD 1GPOL 3LRSA 3VFMA 3AS2A 5DRWB 4HWUA 2DQCL 4QXWA 2R0KL 4PG9A 1H3TA 3HI5H 4PJIA 1ZT7B 5HHVH 2A83A 2ENSA 5DRXA 4M6MH 5C0AE 3TCXA 3P73B 1T03H 3DX7A 4R7NB 2QHRL 4P3DA 3W11D 1TJIH 4CGTA 5MEOB 3JV6A 3BGMA 3QIBA 3ARVA 3KPMB 1P1ZB 1MCWM 1OP3H 1KJ3L 3MCLH 1AGFA 5EO9A 1T2XA 4J4PA 3R06A 1HHIB 4F8TA 3TVMC 4JKPL 1XF2A 5F1KC 4K23H 3WIIL 4QHMA 5DTFB 4TRPL 1KPVB 1NMBH 2DKUA 3LAFA 4IOIB 1IEHA 1QR1B 2VDOL 2F53E 5E4EC 5K33A 3O6MH 3H2WA 4PREA 4ZFFB 3QQ3B 2PXYC 4X6DA 3MRHA 3W9DB 5DC4B 1ZKAA 2JB6A 4JDTL 2XZQL 3P3YA 3CFBB 1QRND 3FOLB 5IKCB 3I75A 5JW3L 1I7RA 4WFFE 5I1IH 5IBTL 2ADJB 5I71C 4JFZH 5ACZA 5IWLA 1WIUA 1FRGL 2RR3A 4XBGA 4PJEB 4XCFH 5E8EA 2AJUH 4JRYD 4RA3A 5INDB 4MWFB 4DW2H 3HG1A 1KCSL 1WCBA 4FQXD 4PJ5B 4M8QB 4P5MB 5L7XL 1FDLL 1VACA 3BXNB 3C9NA 1CFTB 4M1CC 1HH6A 4M7ZC 1R24B 4MQ7B 3GUTA 3K80A 3V0VB 3QUKA 4BH8A 3V5HB 4PB9L 1N5AA 2LQRA 4KZEL 3E2HB 3EYSL 3QH3B 5BZWA 4OZIF 3KYNA 3BSZH 5F6IB 4BK4A 1PKOA 3IS0X 2UZIH 1R0AL 1G6RA 2N56A 3UTTE 1NAKL 3PL6B 4UNUA 2RAMA 2ITCB 5FM4A 1YYLL 4FTVB 1H0DA 1BVKA 5J7CC 1E4XL 1NFDF 2ZNWA 4XP5H 1SY6H 3FQNB 1T7VA 1SM3H 5C0BA 1INDL 3FCTA 1H5BC 3CSPA 3KLAB 3QNZA 4Y5XC 1D5XB 2Q8BL 4GRWF 4NCDA 4QWWD 3U7WL 3A6CH 4WNQA 5A3IC 1NFIA 4OIIL 4PJEE 4KK5D 2XWBA 4PJCF 1X5HA 4L8BB 1L9MA 5IM7B 4JM2C 1FO0B 4WFGD 1YMMD 5DWUL 5KS9A 5ITBL 3H7BA 3MLVL 4JZOA 4X9GA 2MSPA 5CILH 5EORL 1CGSH 4TOYH 3N1GC 5IQ7H 2PR4H 2OTUB 2D4FA 2Z8SA 25C8H 3D2UB 4XC3H 2DRUA 5GGRA 4OZIE 3QQ9C 1QUNA 4LASL 4XHJC 3MODH 1DVFB 4YBLC 3LKRB 3ZKND 4ZUSB 3RDTC 4Z6AT 1JPFA 4APQD 1NFDE 3ECBB 3RX7A 3L1OH 4ZO7A 3DIFA 2I9LB 3BT2H 4OLYL 5FHBH 5I19L 3JTTA 3QCUH 2PYFB 2VLRD 2GSIA 3SQOH 3SKOA 4QTHA 1MFCH 4U6TA 1R5VA 3QDAA 1FPTL 1WV7T 4TSCH 5MERA 4P5TA 5T1KB 1A6TB 2EDBA 1QBLH 3OXRB 1CQKA 2GKIA 5FYKU 1P84K 4EDXB 5GRYA 4LGRB 4N0CC 3MQIA 1MRDL 4MX7A 4WUUA 1HHKB 4ALAH 2NY2D 2COQA 3GBML 3RTQD 3QPXH 4KQ4L 2CLRA 1ZGLB 1WBZB 1IQWH 4UBDC 2YD8A 3DMMD 1ES0B 2WK2A 3RIAF 2NY6C 3QUXC 5AZEL 3VGDA 3RHWF 4HUUB 1NH6A 4K2UL 1FNEA 5CBEA 4EI5C 1H8OA 4J3TA 3VXUD 1IM9B 1FYTA 3DVNB 3SDXB 2BHUA 4QTIH 2Q8AL 3ZYIA 5IVNA 1ONQB 4PG2C 1O7SA 1NQBA 2IANA 2DWEB 4Y5YC 3N50A 1KN4L 3MRNA 3T65A 3UPAA 3SHSA 4JKMA 4WGVB 1X4ZA 1CE1L 1S9VB 4NO2B 1WF5A 1FV1A 4ZXBC 1UYWH 5C9KA 4M7LL 4JN1H 1HILB 4JFEE 4NM8L 3TC9A 2B39A 3VFWA 3GMNB 3BOVA 3FZUC 2XTJD 1H8NA 4MNHB 3I02A 4LSVH 3S37L 5IHUL 5DJXA 1OGAA 3V0WL 1CDYA 4NRZB 3LB6C 3JVGA 3QUYB 2GITB 4LLYB 5IQ9A 1F6FB 4OZGF 5KG9B 1DQLL 1L0QA 4KKNA 5BRZA 1V3MA 3EO0A 4XXCC 5AWNH 3ARBB 2YWYA 4MZ3A 5C6TL 5FYJL 2VR9A 1JGEA 4F7TB 3SDXE 4KROC 5F3BA 5FK9A 1CGXA 1G9NC 1MHEA 3ZTNH 2EXWC 5IV2A 4L8CA 4JQVA 3SDDD 3S96B 4WW2B 5JW5B 4KZDL 3GSWB 3OWEA 4FQCL 1OAXL 3BP5B 2IH1A 2IMNA 4MJ2A 1TTUA 12E8L 2LABA 1BFOB 5GGVY 1X7QA 3S88H 3AAZA 2DYPB 5LCVL 4RFOH 2AERT 4FMFA 3D25A 3TA3B 5E2WL 5EA0L 1MCDA 4RQQA 5HYSG 4AJ0A 5DJZB 1DBJL 2N4IA 3B83A 4MDIA 3QXAA 4HPOL 3MJ9L 3I85A 4KGJA 2CXGA 2WINB 4H1LG 1GGYA 2O26U 3MV7B 5D7IF 1G9NL 4H5SA 5D96C 4AMKL 4F15C 3EIFA 1FBIL 5C07D 5D8JH 5IFHH 4JO4H 1YMHB 3FOMA 3LOWA 4O9HL 3QO0B 2HT4C 4LMQE 4OZGE 3RWHB 4YR6A 2Z8WC 3DX8A 3PGCB 5FOBA 2R0LL 3IRPX 1HOCA 3TESA 1KB5A 1ZLUK 3CLFH 3B6SA 3RI5F 2XQBH 5B39G 3WO3B 2A6KB 4U1SB 4MSWA 1A6PA 4S1DD 3MLSL 3BAEH 4HS8L 4HUVB 3BN9D 1AGCB 1DL7H 1I3RA 1JCKA 2XOTA 2I60H 5D71H 4R26H 3FO2A 3RGVC 3WDIA 5C0DB 4A6YA 5I1JL 4PLKC 4G3YL 1PG7L 4R90L 3PXHA 1M1SA 5D1QD 3BE1H 2OP4H 4NUGH 2WZPD 5IMMB 5CSZB 2AV7A 2YPVL 5K93A 2FRGP 2AV1A 4WEBH 3GIVB 5EBLB 1UA6L 2VSDA 3MCKA 4LSRH 5D7IE 5T3ZL 3QI9D 1D6EA 1DE4B 4Z7VA 5DGRA 3WL9A 3NZHH 3Q6GL 3QEUA 4MAUH 3QWOA 5KVFH 2GFBB 1AD9A 4QCIA 1ZHNA 1S5HB 3FFCA 4X9HA 2FX7L 5T1DH 2Q86A 1UQSA 3S5LB 2JTDA 2CSPA 4Z7UA 1ZS8B 4WV1C 5I1HL 4Y89A 1IGTB 4M6NL 4XRCB 1FVEB 5I17A 2VXSL 3VWJD 4ZQKB 3QWRA 3L3KB 2NY7L 4ZSOE 5K9JL 4P0DA 5F6HJ 3X17A 1IM3A 2APWA 2GJZB 1YEGH 3RL2A 5GZOC 4M9OA 5C09D 2X4PB 3DVIA 3HE6B 2Y5TA 4L9LB 2P8PB 1BVLB 4H0GA 4WI4A 3RAJH 3OZ9H 4CN1A 5D6CB 4U7SA 1PY9A 4IRSB 1QSEE 2WBJC 5J1SC 4NNYB 4Q0XH 3EUUA 2V6HA 1MCSA 4DN4L 3E8UH 3P77B 1CXHA 3GEWB 4NQEB 2ARJB 1RUPL 2ITDB 5ITFB 4PGCA 5HDLA 5DD0H 3VXSB 6FABH 1TETH 4ODUB 43C9B 1BAFL 5SWSE 4XVSL 4YGAB 3WIHA 2G75A 2BOBA 4OTXL 1C1EH 4JREC 3V5KB 4YHIB 3EJYC 3IFNH 3VXPA 3KJ6L 4AEFA 4Q9CA 5F1IA 2E27H 1I1AC 5FUZH 1JGUL 1Q0XH 1RJZA 4ZUVA 4YHNA 5EOTB 4O4YH 1JIBA 3TWCL 5T5FL 4LQFL 5HI3C 3TVMD 5DMIL 3H42H 2HTLC 3IU3B 4YDKH 3S6CA 4OZHB 2YD6A 2X9YA 4XMKL 3MACL 1D5IH 3WHXB 3V5DB 1VADB 2J8UA 4D9RD 1JWMB 5FA4A 3UC0L 1NUFA 4NQEE 2I9TB 2PXYD 1G1CA 1R3IH 2FBOJ 3G5XA 5D1ZB 5C0JA 2HVKB 2WP3O 4M48H 2OSLB 5TQ0L 4AIOA 2P5WD 2QLVB 4HJJL 3I3BA 4X6CE 4JFQA 2G60H 3B3IB 5C0AA 2A9NL 2FIKB 2XY1A 5IHBA 4PJDE 5E4IA 5ID1B 5C0RL 1FJ1A 1TIUA 1TJHH 1YUHB 3EYOB 1LNUB 3JV4A 4I18A 3WLBB 1VPOL 3EO1A 4M1CD 4EOWH 1DDHA 4PY7A 3U9UA 1CF8L 2ZOKA 2IADB 4GS7C 2OBGA 1J12A 3ALXA 4W68A 2LVEA 1YZZA 3UJJH 4Z78A 5SV4A 3V6BR 4F2MA 1DQMH 2F53A 3R0MA 4L4TB 2DQDH 2ZCKH 2X1PA 4WHTB 5HGHA 1RZGA 1GZPA 2UWEF 4HS6B 4JRXB 4NNXA 4NQSB 1AR1C 3O8XA 2GSGA 2FSEA 3BW9B 1MELA 2BRRH 1FP5A 3FO1B 5DRWA 3NACL 3G9AB 3NBNA 43CAB 1NGWB 5IW1A 1NFKA 3KLDA 4FQXB 2FEEI 3EFDL 4L29B 5JXEA 4LAJH 3RZWA 1U91A 4R7NA 2YPLD 4M1DH 1KN2H 4JR9L 5MEOA 3UPRA 1NGYB 4G8FB 3TV3H 5I1LA 2W9DH 4G42B 2PTVA 4YXHH 3B9AA 3OJDB 3W0WD 2FECI 1ZXQA 5DXWA 3WE6A 1OAKH 2ED8A 4M4PA 1W0WB 3VW3L 3KR3H 3FFDA 3S36X 3WS3A 2Q76A 3V6OE 3QAZC 1A5FL 3VXTA 5D7SH 5C0GA 4DJMA 3HB3C 1MQKL 3NFPA 2DQJL 3A67H 2ZP0T 2HMIC 3B5HA 1KPVA 4MXQD 4IOIA 4NC1C 3P9LA 3UTTA 4NHUB 3TO4A 5TDNB 1PFCA 2W38A 4EN3C 1FVDB 5C71A 3ORJA 4DAGH 3QQ9D 3O0RH 3H3PH 5IJVB 1CGUA 1ND0B 4XHJD 4G6FD 1GIGL 4JHWL 5EU5B 5J6GB 3RUGB 4ZUUB 4GRMB 4BZ2H 3RDTD 4P48A 1EHLH 5T3XD 2X4QB 1HN1A 4PJEA 3OR6A 4YHML 1IEAB 1YMMB 5C0CD 4MWFA 5IVXB 1OAUL 4M8QA 1C08B 1EEYA 4RISL 1DFBH 4JZJA 3BXNA 1F6LL 2H32B 1XH3B 5JMRA 4RMVA 4OCMC 1JGDA 5DF0A 4CDHA 1FL6B 1UZ6F 1NL0L 2HFFB 1F3DJ 1SYSB 1U8KB 3V5HA 4X5XB 3UBXG 2F19L 4DEPB 4NO0B 4TVPL 5I1CH 2BOCA 2A6IA 2FO1A 2VAJA 1AQDA 5T33H 3KDMB 2CIIA 2YD2A 5FUCE 3DTXB 4X4YB 2WIIB 1P4LB 2XNAB 3PL6A 4G5ZL 4OZIA 1AHWC 1PEWA 4FTVA 1DR9A 3NABH 2NZIA 4APQB 1HXMA 1J0YA 3IRZA 5LQBL 1RUQL 3D39D 2DM4A 4K71C 4RAUB 1WTGT 4PJXF 2NY6D 1MCNA 4XNZB 2VLRB 4O51B 1NFDA 5J11C 4Q7DA 1KCRL 1MRFH 4EI5D 1ITCA 2NX5B 4N8PA 5CJXA 4PJ7B 3U2SB 4UDUB 1J0IA 5FIEA 4L8BA 1TPXC 1MFAH 1MUJB 1GPOH 5IVOA 3NCYP 5C8JA 1FFPB 1G7MB 2NY0B 2DQCH 3UTQB 2R0KH 3DRQB 4Z0BL 2A0LC 4QRTB 1H3UA 4PJAF 3TJHC 3EGSA 1LEGA 3TBWA 4ZXBD 3C2AL 2Z92A 5DI8B 4YXKL 1U42A 3GM8A 1SQ2N 3AB0C 1T3FB 2X9XA 4I0PC 3FZUD 2PTTA 5BVJA 3MCG1 5FYKE 1KJ3H 1I7ZA 3VXUB 1P7KB 4NT6B 3LB6D 4NHCL 4JFDD 3LKRA 4ELMB 4ZUSA 4NZUL 2EDWA 3WIIH 3SGKA 1I8IA 1L6XA 2R69L 4TRPH 1ZVHA 1KFAL 2VDOH 1T5XB 3HFML 5A2IH 4HAGA 4EDWL 3TYFA 2NX5E 2WP3T 4U1NB 3TIEB 5HPOA 1VKXA 3MR9B 4PJHB 3SGJA 3WUWB 2FHFA 4JDTH 2XZQH 2CPCA 1G7HB 3NCBB 4PBVC 4JPWL 5T1KA 1A6TA 1JHTB 3MRCB 5JW3H 5IBTH 4KKCC 1P7QA 4HEPG 3MJGX 2M2DA 1HSAA 3QUZC 4EDXA 4JFEA 1FRGH 4ONGL 3NPSB 1LE9B 3MUJA 4K94C 4J1UA 5L2KE 5DZLA 1JGVL 1KCSH 2P24B 5L7XH 1FDLH 5HYIA 4U1KA 1RUKL 4QF1B 1S9KC 1ZVSB 3SE4A 1ZGLA 2AXHA 2J8HA 3ARYA 1NGZB 3GBLA 4PB9H 1ES0A 4WWKB 4QOKE 4XI5C 4KZEH 3EYSH 3CJJA 1RVFL 1I7UB 4UQ2A 3MRQA 3CFKB 3QP3A 2VXUL 1DLHB 2B1HL 3DVNA 3SDXA 3UJIL 3UJTL 1NAKH 3CFDA 1ONQA 3QEQD 4PJHE 4K94L 1E4XH 2DWEA 1XR9B 3UTPD 4PJ9C 1IKNC 1S9VA 4HWEL 3L3IB 1DUZB 5HYQB 3BFOA 1GC1C 3BKYL 4TTGA 1F5WA 3ES6B 3SGDI 4M7KL 3G5VA 1LK2A 3MLWH 5HGDB 2D7PA 1RJCA 3PWUB 3U7WH 1HILA 4OIIH 4YHYC 1I3GL 5HGBB 2EYSB 2VQ1B 4K7FB 2VIRB 4KK6D 5DDHB 4C56E 4G80B 3RWEB 4LKCB 5E2TL 4NRZA 5C07B 4PLKD 5D1XC 4G6JL 2GITA 5J3HC 5DWUH 3FONA 4MLIA 4UIMA 1OP5K 5KG9A 5ITBH 3MLVH 2CKNA 4X6EA 5BZDB 3AM8A 5EORH 5ESAB 5GSRB 4DZ8B 3H3KA 4GBXB 3UCRA 3V4PL 3ARBA 2CO6B 4QHNB 1U8JB 1EAJA 2OI9B 1GC1L 5E5RB 5HDQL 1UADC 2EYTB 1U2HA 3KGRA 5EWIH 4RRPG 2FLRT 3FQWA 4LASH 1EDQA 5FGSA 2GJ6B 1BZ7A 3S96A 4WW2A 2X41A 1A7PL 3GSWA 1QFWM 3BP5A 5FDWA 1R3KB 1BFOA 2X2YA 5DQJB 1JZ2A 3TZVB 1J1OL 3U4BL 1VFAB 3PWJB 2DYPA 1X5JA 4OLYH 5CIPH 3TA3A 5I19H 5LJYH 4PP1C 4WVRA 3ZDYF 5ECJE 2ICWJ 1BBDL 1V05A 1U8LB 1GGBL 5DJZA 1FPTH 2V7HB 1NDGB 4D9QE 1EHXA 1A6UL 2F5AL 3SBWC 3HS0B 4GSDL 2WINA 3O9WC 1WFOA 3CSYB 1JTPA 1WZKA 3LKSB 4YDLB 5FV2A 4X6FA 3O3DA 1MRDH 1NGPL 2WBJD 3QO0A 1I1YA 3RWHA 1G9EA 3DSFH 2ZSWB 3GBMH 3PGCA 4KQ4H 3DGGB 2AJYL 2ZNXA 1EH9A 2GJ6E 4JFFE 5EUOB 4U1SA 5AZEH 4ODWA 2ZOLB 4RFNC 4JLRB 3ABZA 4K2UH 4HUVA 4I3RL 1DQDL 4KRPD 2RB8A 4OM0L 2Q8AH 3PDDA 5EZJA 2ESVE 4ZSOA 3EJYD 5CUSL 1Q72L 2Z4QB 4P2YA 1WT5A 1I1AD 1TNMA 1KN4H 2FJHB 2GT9A 4L5FL 3VD3A 3B4NA 1JV5B 1CE1H 1DZBA 1TXKA 3BP6B 4H0IA 4I13B 3L5WA 3ZDYE 2HG5B 3MGTB 4LHJB 1QSEA 4M7LH 5HGAB 3G08B 4NM8H 3Q5YA 4JY5L 5EBLA 3UTSD 3VFTB 3Q2CA 3MV8E 4KXZI 4AEIL 3ROLA 3PQYB 3S37H 2YRPA 1DE4A 2JCCE 5IHUH 1RZKC 3V0WH 1YPZB 4R97C 3C5SA 3FT2A 5CEYB 2GFBA 1S5HA 3RIAK 2F8VA 2VDPL 3DXAB 3RHWK 4D9LL 5FM8A 1DQLH 3LS4L 1NC2B 4Q6IC 4PJFE 1QSZA 5I8CA 2XI9A 1NCWL 1B0RB 5C6TH 5FYJH 4GQ9L 2YUVA 2YN3A 3GJEB 1E4KA 4NFDA 4XRCA 3W5NA 1FVEA 1F97A 4ZS6C 4CVUA 2Z93A 4ZQKA 3GSVB 3L3KA 1ETZA 2MHAB 3ZKMC 2X4PA 1U2CA 3ULVF 3E6FA 1IZJA 3MLZL 4V1DD 4ZAKC 2P8PA 4KZDH 4FQCH 1OAXH 1RZKL 5DHXB 12E8H 3W39B 4KKBC 3IDIB 2V2TB 5D6CA 1I4FB 4IRSA 3P4NB 3F12B 1K9TA 3MRFB 4NNYA 3M8OL 1TZGL 4MJ4A 5LCVH 3P77A 5E2WH 4R4NC 5E9DB 5EA0H 4L3EE 1JMXA 4NQEA 3T8XB 2ARJA 4GKOA 4JJHA 3WO4C 1DBJH 2XY2A 2OM5A 4HPOH 3MJ9H 4X7TB 3T0EC 5ITFA 3VXSA 4X6CA 1KACB 3N1FC 4ODUA 1G9NH 4HIHB 4AMKH 2GQHA 1FBIH 4NWUL 4PJDA 5FUOL 2FGZA 4RAHA 4O9HH 4M7ZB 4YHIA 2WLZA 2MMXA 3PHSA 4GOSA 1RIUL 2BY2A 1OWRM 2R0LH 1MCRA 4NPYB 1XFPA 4ORGB 3QCVL 5EOTA 3S5LG 4D0DB 4RGMC 4Y4FC 2I07B 2BK8A 3CVHL 1CN4A 5BS0E 3V95A 3MLSH 5GRVK 4HS8H 4EQ2A 3QEGL 2NY3C 3IU3A 1UM6L 3MRPB 3HB3D 3HPLB 3KJ4B 3ULVE 1UCTA 2V5RA 3RQ3A 3WHXA 4G8IB 1VADA 1I1CA 3EYFB 1S9XB 4S1QL 5I1JH 2I9TA 4G3YH 3EJZD 4R90H 4EN3D 1H5BB 5EZLB 5L9DL 2HVKA 3FHAA 4QRSB 4TVPD 2NW3A 4YX2L 2OSLA 1GYAA 3HZKB 4YWGL 1PYWB 2DL2A 4MA8L 1G7IB 4DGYL 2JIXA 3B3IA 2FIKA 2YPVH 3E0GA 3HAEA 3W0WB 4JM2B 5LGJA 1CGYA 1K3IA 1UA6H 5ID1A 1XGPB 5T3ZH 4LAQL 1LNUA 3I9GL 1TVBA 4I9WE 3Q6GH 3FAXA 4QHKI 3RI5K 2DQHL 3HPJA 5CIPB 5CAYB 3AMKA 3L7FB 2FX7H 4YHPB 3V6OA 1I85A 3EOBA 2KQNA 4KMTL 5I1HH 4F33B 2Q3AA 4L4TA 4G6FB 2OX5A 3CGTA 4WHTA 4JRXA 4MJIB 4HS6A 2NY7H 2ID5A 5EC1B 4YBLB 3SE3A 5K9JH 4S2SB 3JWNC 2EE6A 4MXVF 3RDTB 4OGXL 1QLFB 2WBWB 2Z31C 3C6LB 4KV5E 4LCWE 4P57B 1NGWA 1PEZA 2EKJA 2NXYC 5C0CB 1ORQB 1WBXA 3QJFA 2Q1EA 4UOJA 3FRPA 2H9GA 5E56A 1S7WA 5F9DC 4MVBC 2AJVL 1PQZA 4R9HA 4KPHL 4XVUC 5GS1A 5HHOB 1JJUA 1S7UB 1NGYA 4G8FA 3ET9F 5E99L 1RUPH 4HK3J 3OJDA 1JYWA 1W0WA 3NA4A 2FGWL 1B2WL 5E95B 3GK8L 2Y07L 1AE6L 3O4OC 2A0LD 1BAFH 4BJLA 3QCTL 4XVSH 1U8OA 4YNYB 3DYOA 3X13A 5D6DC 3TJHD 5FB8B 1A4KB 4OTXH 3O3AB 4K7PY 3ZYJA 4R8WL 3KJ6H 4NHUA 4PY8J 4OLWL 1QO3A 3D39B 5D2NE 1JGUH 4MJIE 4TSBL 3BPCA 4I0PD 3QUXB 5HI5D 1SYVB 3T0AA 3TYGL 2DLEA 5IJVA 1LO5B 3TWCH 1TCMA 5K9QG 4LQFH 1ZHBA 5DMIH 3ZE2F 3PJSB 1KXTB 2EE9A 3QDJD 2X4QA 4HK3N 4I8DA 3MLRH 4XMKH 3MACH 1YEKL 2IAMC 3ZTJH 5DVOA 1BM3L 5IVXA 1MIML 3UC0H 3WDHA 1JTOA 4FFYL 1C08A 3OHXA 2H32A 4RNRA 1KTLA 1XIWA 4ZXBB 1FL6A 3GO1L 1J87A 5C0EA 2HFFA 4N8CL 5TQ0H 4M5YL 3AS1A 4HJJH 3VXQB 4X5XA 5TJWK 4NO0A 3FRPG 2HRPL 2CXKA 1K8IB 4KKCD 4PRHD 2A9NH 4KU1A 1R3JA 2XN9E 2BY0A 3KDMA 4E42B 5C0RH 2OR9L 3CUPB 2WIIA 1D9KC 2XNAA 4Y16C 3S7GA 1A1MB 4KVCL 2JJWA 5E5UB 5HHNA 3K0WA 1F4HA 3RY5A 4HHAB 3A6OA 4HH9A 5J0BA 1CF8H 4HXBL 1HNGA 3BH8A 5I1KL 2YD4A 2VLJD 3S35X 2DS4A 2PYEE 4KROB 4LSQL 2C3VA 4JJ5B 3E3QE 1Z9LA 1HSBB 2NX5A 3S4SA 3U2SA 4UDUA 1B9ZA 2XWJA 3ZE2E 1MUJA 3LRGA 4U6XB 1FFPA 3NACH 4KTDL 4Q97A 4PJ9D 4P4RB 1A7RL 3EFDH 3MROB 5I30L 2OS7A 3DX9B 4WU7B 2R1XB 1YNTB 5L2KA 2HFEB 3S3PA 2WSKA 4JR9H 2FJFB 1S9YB 3VXRB 4NKOB 4WY7L 1UENA 2OZ4H 3O6FB 1DBAL 4WI9A 4NQDE 1M7XA 4GKZB 3U46A 1X5FA 5GQBA 5D96B 2EIEA 4F15B 1P7KA 3VW3H 4PRPD 4LK4A 3OAYK 4QOKA 2JLLA 5D1XD 5J3HD 3AXLB 2IFGA 3O3BB 4HD9A 4ZTOL 1A5FH 3KPRE 5INCB 3BH9B 3QRGL 1PLGL 1MQKH 2DQJH 2HP4A 5CP7B 4UILL 3SEPA 5BW7A 3MNWA 3MRBA 2VLKB 3TIEA 4U1NA 5HSFA 1Q9KB 4PJHA 1CDCA 4L8SC 4YJZL 5I75C 4X7EC 2IPKA 4PGEB 1I1FA 3H9HA 3KAAA 1YN6A 3MRCA 1GIGH 4HIXL 4NQVB 4K07A 3F6LA 3WV0A 2O93L 2R1WB 1HIMH 2QQNH 4W6YB 2VITB 3RGVB 1IAOA 4A2MA 1T21B 3RWIB 4YHMH 5D9SB 3HZVB 4BYHA 4C56A 1OAUH 2P24A 4LLDB 4RISH 2ZPKH 4RGNE 4QHUB 4PP1D 4Q9QH 1F4YL 1BIIB 4KDTA 3CK0L 1NL0H 4N0FB 1NGZA 1Y6KR 3K1DA 2F19H 1B0WA 4WWKA 4FXLA 4M4RA 4TVPH 3WBDA 4LCYB 3O9WD 3BN3B 1I7UA 1TVDA 2VZTA 3IFPB 4L3AA 1FL3B 2HJFB 2H8PA 3PWPE 5C86A 2E8ZA 4G5ZH 2YUXA 3S35L 3VU2A 2VLKE 5GJSL 1YEHL 4AIZB 1XR9A 3EYVA 4WV1B 1A47A 4J3XA 5LQBH 1RUQH 2JK5B 1OWWA 4OQTA 1FZKB 5HYQA 3L3IA 2FD6L 2H2SC 2X5PA 2AKRB 5F3HB 2CLVA 2CGRL 3ES6A 2DQGL 3QIBC 5HGDA 1KCRH 1DBKL 3U48A 1ZT1B 1MLCB 4AK1A 4PP2B 4RMRA 4K7FA 4WIQA 4E0RA 4OT1L 3WUWG 2A9ML 4G80A 1BQUA 4J4PC 4YPGA 3RWEA 4JANB 4YIQB 3UYOD 5JPMA 2IBBA 1AO7B 4Z0BH 5SWZD 4M62L 4RWHA 2WBJB 4E41E 1CE6B 3G5ZB 2JE8A 1MCPL 1U8MB 5ESAA 3C2AH 4GBXA 4YXKH 4X7FC 2R15A 1U8JA 4I5BB 1SVCP 3RWDB 1C5DA 4CMHC 3KPPA 2VC2L 1BD2E 2AEQH 4R96A 1OTUC 2GJ6A 4NHCH 4JFFA 4XPGL 4PGBB 5IWLC 4JREB 4NZUH 2AK4D 2R69H 5C2UB 1T4KA 3ALPA 4NN5C 5DQJA 5I6XC 2HJKA 1WBYA 1KFAH 5ILTL 3TZVA 1YNKL 3HFMH 1VFAA 4EDWH 2CQVA 2ESVA 1LWRA 1RHFA 5IG7B 2E5EA 4XCYB 1U8LA 1SJHB 5E2JA 4YO0B 1QKZL 4WCYH 5D7LD 5B38B 1NDGA 5IIEB 3HS0A 5J4MA 1B4JL 3CSYA 4ZAKD 1OP9A 2E6PA 4ONGH 4S10A 2QEJA 2BVOA 4KI5E 1FG2B 2GTWA 1JE6A 1EFXB 3MV8A 1JGVH 1MWAB 2ZSWA 2OMNA 3D69B 1ZAGA 2JCCA 4R4ND 3X12B 1RUKH 2X4RB 1KCKA 5ELIA 1EO8L 4LF3B 2W9EL 2DICA 3SGEI 1GL4B 4G8EA 1AIFB 4N8VB 2V2XB 4PJFA 4Z95L 4JLRA 1RVFH 1T0PB 2Y6SD 3TNMB 3CH1A 3VA2C 2VXUH 1A0QL 2B1HH 2IPTL 1QTYT 3REWA 3UJTH 3UJIH 2VR5A 4MDJA 3O3EB 1RZ8B 4POZD 1M7IB 3OAZK 4K94H 1IC7L 4GS7B 3VFUB 2EC9U 2DWDA 3OGOE 2FJHA 4LSTL 3SO5A 4QRQB 1LD9A 4IS6B 2LAGB 1WWWX 1JV5A 4HWEH 4MNQB 3BP6A 5MEQB 3BKYH 2HG5A 4Y4FD 4M7KH 3MGTA 5HGAA 3RU8L 4G6AD 4QRRD 2NY3D 4JFOA 5C0IA 1VDGA 2DJ4A 3VFTA 2MWCA 1I3GH 3EZ8A 2BNRB 4JRWA 4L3EA 3LPGA 3PQYA 2ICWB 3ARGD 4JB9H 2LFGA 5E2TH 4NN7C 3K2UL 2ORBL 3ZE0E 3I50L 1MIEH 4G6JH 1KIPA 5CEYA 2O61A 5IBLC 5EU7C 3DXAA 3TT3L 1NC2A 4ZFGL 2DI8A 4JFXB 3V4PH 1B4RA 5LXGL 5K9QI 1B0RA 3HUJF 1GC1H 2CDGA 5GGSB 2MCG1 5D7JB 3MJ8A 2Z0BA 3LVEA 4NDMA 4P5TC 1C8PA 1U0QA 2RBLA 3ARDD 3QAZB 2MHAA 4H25A 5DURD 5F8RC 2YS4A 4WFHD 4YH6A 1NKOA 1A7PH 2DLIA 4X5WA 3EOYG 1NLDL 3IDIA 4Y5VC 1I4FA 4EEEA 3SKNB 4PR5B 4EN3B 1J1OH 3U4BH 4XCCL 1D6VL 2BNRE 1BBDH 2DQFB 4OB5L 1RZJL 1ZWIA 1GGBH 3B9EA 3OG4B 3VH8A 1ZANL 3RNKB 2F5AH 3PV7A 2PW2A 5DFWH 3GSXA 4GSDH 1KTRL 5F9JA 5BJTB 4JVWA 1CYGA 3P0VL 4N1EA 3V6ZA 4LGSB 5FA3B 4U2ZA 1NGPH 1NLBL 1SVZA 1XZ0B 4XVUD 3HMWL 2W07A 5ENWB 1FZMA 4EI6A 4NPYA 2AJYH 1J8HB 1DUYB 2VQTA 4U49A 3O3UN 1L9NA 3HUJE 4M03A 4FQHA 4LPXA 1MPAH 1QVOB 1GH7A 2I07A 3T0XA 8CGTA 3VD7A 4OZHF 1PY4A 4I3RH 1AHWB 4OFVA 1KJVB 2Q20A 2YA0A 3MRKB 3HPLA 1HCVA 4OM0H 4WW1B 4G8IA 3AREA 3JVGC 3EYFA 4KMLB 5CUSH 3X11A 4LGPB 1Q72H 4U1JA 4K71B 1ZGLP 3MNZB 5C08E 5J56B 3KPSD 4LCUB 5EZLA 4QRSA 4L5FH 5KVMC 1T22A 4LCWA 2Y36L 3LKPA 3DV6B 3GMQB 3HZKA 5JW4M 3HE7C 3IJHB 1KNOB 1TPXB 5DRZB 4JY5H 3K1KC 4HMDA 3GMPB 2X4UB 4AEIH 4LLUB 5GRWA 3PV6B 4NCC1 2CRIA 4JQVC 2IAMD 2NYYD 2FX9L 1MAKA 3ARSA 1L0YA 4HIIA 3RY4A 1J8HE 3L7FA 2VDPH 4N68A 4D9LH 4YHPA 5IB5B 3LS4H 1JYNA 2UUDK 1L7IL 3AB0B 5E2UL 5F9AC 4I0PB 2Z8VC 4F33A 4GQ9H 4GG6B 4KRNA 2BSTB 3HN3A 5D2NA 4ZUWA 4F7MA 4CVWA 2GY7B 4MJIA 5EC1A 1D9KD 4Y16D 5T1LA 5F88B 4S2SA 4N5UA 3DI2B 1QLFA 3QDJB 3C6LA 1NANH 3MLZH 5IESH 4P57A 1RZKH 1P84J 1CS6A 2YD7A 2MCPL 2VL5B 2Q6WA 4DK6A 3MV9D 5HPMB 3GGWB 4UIKL 2XPGB 1T1WB 3M8OH 1TZGH 3QIUD 5HHOA 1S7UA 1N0XH 2EECA 4P4KA 1A6WL 4GW5B 3HI1B 4PUBL 4LEOB 1HXYB 1OVZA 3QPQC 1PG7W 2IALA 1MCWW 3QUZB 5K9KB 1CGVA 5ICZA 3KXFB 4X8JB 4U6VL 1CDGA 4WFED 2R29L 4NWUH 5FUOH 4DFHA 3C5ZD 5H94A 1R3HB 4JN2B 2D7OA 1I9JL 1RIUH 2ED9A 4UDTB 1T20B 5F7WC 5DGQA 4AH2B 3QCVH 1QRNE 4NJ9L 1VFBB 1KB5L 4G7YL 2HKHL 1FG9C 3RUGF 5IP4A 3TBSB 3VGGA 3CVHH 3SJVD 3IVKB 3WFHB 2PYEA 4JKLA 3QEGH 4NUJA 3PJSA 3WN5B 1UM6H 3DECA 3X14B 4BH7A 2EE2A 4AQ1B 4JRYE 4M1GL 2FCBA 2GAZA 2FLBT 2V5SA 3IGAB 4PJ9B 4S1QH