3OKMB

Crystal structure of unliganded s25-39
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
215
Chain Sequence
EVKLVESGGGLVQPGGSLRLACATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQSSLYLQMNTLRAEDSATYYCARDHDGYYERFAYWGQGTLVTVSAAATTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSTGVHTFPAVLSSDLYTLTSSVTVPSKTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-39 Fab (IgG1k) light chain
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
molecule tags Immune system
total genus 43
structure length 215
sequence length 222
ec nomenclature
pdb deposition date 2010-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okmB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okmB01
1AKJD 5DRNB 4XPAH 4ZQKA 2AQ1A 3QG7H 3IAGC 1P84J 1BEYH 2NY0B 3G08A 2GSIB 4UNVA 4WHYH 1RZKH 2V2TB 3TBSA 5TPWH 1FN4B 1E28A 1QP1A 3MLWH 1MIML 1CGSH 2UUDK 5A2FA 3FQNA 4JG1L 2Q7YB 4S1QL 2XWTA 2EDLA 4OBSA 5T1KB 2OK0L 4NNPH 3HR5A 5TDPB 4KTDH 4RGOH 1LD9A 1YYLH 4HV8A 4ZTPH 3RWCB 1KGCD 2YUVA 4XRCB 5BMFH 2YWZA 5D71H 4AIXA 5AG8A 3MV8E 3VXRE 2DQGH 1A4KA 5I8EA 2JJWA 4Y16A 3NIFE 3LHPL 2OXGA 3WN5C 3NIGE 3E2HB 4RGMC 1E6OL 3QULA 2R0ZL 4YC2B 5SWZD 4G6KH 4U3CA 1M05A 1YEIH 1L0QA 3U4BH 5D6CA 3CVIL 2VE6A 5IFJA 3EFFB 1P7KB 3PWUB 2CR6A 3B4NA 1CF8L 3AS2A 3SDCD 1F58H 1SM3H 1TVHB 4O2FA 2AJVL 4XNUL 1XF4B 3IFNL 3B9KB 5IQ9B 4U1JB 4NKDB 3SDCC 1KELH 4Y5VB 4L4JA 2UVEA 3DX7B 2AW2A 5JXEA 1AGDB 4KXZH 1VENA 1CGWA 4B7IA 4OIIH 3KPRE 1KT2A 4LPUA 4U6XB 5KSAB 5LWYL 3MRQA 1TFHA 4OD2B 3FTGB 4J3VA 4ZO8A 4FQPA 2L7UA 4FTVE 3BAEL 5TDOB 3DBXA 4GBXD 4NZTH 4XCFL 5B22A 1K5NB 4GBXC 3BW9A 5JQ6H 2PCPA 2Q86B 4G6ML 4OUUB 1EJ6A 3SY0A 4WHDA 5EBGA 5DEFB 5M95B 3AAZA 4PRAA 4KI5F 1HH6B 1ZHBA 5T1LA 4M8QB 5FOBB 1C5CL 4GXUN 3RIFF 4BQCA 1SEBB 4LASL 2BHYA 1JPSL 4J4PA 3UTSD 4MZ2A 2ZCKL 1GC1H 2C1PA 4MXVF 2G5RA 1AGFA 1BX2A 1NBZA 2BNUA 3O8XB 5IHUH 1XZ0B 2V9TA 4YDJB 3MV8B 1NFKA 5HPMB 5DJ0B 2VWEC 2DQFB 3ZT5A 4O00A 4UINL 1R3LB 3UJTL 1XR8B 3VE0A 4RWYH 3V0WL 3WFCL 2H32B 3HE7B 5DTFA 1QBBA 4LLWB 2BVUA 1G0XA 3MPCA 1AO7A 1AXIB 4HK3N 2JIXD 5GGQH 5FK9A 4YDVA 1VADB 4P4KD 2XRAL 1LNUA 1CR9H 1RPQA 1OCWL 4P4KC 5DD1H 5I15L 5K9KB 4HC1A 5BS0B 3QG6B 5B39G 3NTCH 2WW8A 1XH3A 4F80A 1NFDF 4LCCB 2VLJD 2NY5H 1CDHA 3B83A 3UAJD 4PJEA 3IFPA 3BESR 3SDXE 1TJGL 5EORL 3TWCH 4TNVF 1U8PA 4HBCH 4IMKC 3UAJC 2BY3A 2CK2A 2MOVA 2VLKB 3V5KA 4RFEA 4PYGA 5JA8B 5H94B 2C4FT 3C6LD 2AJ3B 3GM0A 3MRCB 3CFEB 4M7KL 5IMMA 1T2XA 5GHWH 5C08A 3C6LC 5KVFL 3A6OA 1ETZB 4HCRA 5J6GB 3GJEB 3GMMB 2ADFH 5CP7B 1F4YH 4LBEB 3V6BR 5CKGA 3RX8A 2FHFA 3SPVA 1NBYB 1AI1L 1FYTA 3IFLH 5BO1H 4OQTA 1EJOH 3B5TA 1TLKA 3R06A 2F58H 2XXMB 1Z0NA 5DR5H 4OLZH 3GMRB 2FGWH 3MFFB 3H9SD 1CLYH 3HPJB 1BM3H 2EYRB 1KJ2A 3RQ3A 5L8JB 1NCAH 4XCNA 1EHNA 3MO1A 2IFFL 1BVLB 1C16A 5E99H 1M4KA 2C3XA 4NRZB 1G9NH 2AGJL 4IRSA 4NO0B 1DJSA 3V6FA 3RZCA 1MFBL 3BUYB 1ULVA 5D8JL 2VDRL 5BVPL 1IARB 4HUUB 2K7PA 2LU7A 4WENB 4TTDC 3WIFA 5T5FL 1FZMA 3BSZL 1Q9WA 3OF6D 3FQWA 4OZ4B 4IS6A 4Q2ZB 1IAIH 1VDGA 4JLRA 4TYUA 1AQKH 2HKHL 2HAZA 4NWTH 1S7UB 1P6AB 4UDTB 4UDUB 1CFSB 4KI1A 3MJGX 2O5YH 4JDZB 2D3VA 1OPGH 3WFBH 4FQIH 1S3KL 2D0GA 3MNWB 1KB5B 4M6ML 3MLTA 4G7YL 2AK4D 2J12B 2H41A 5EPMB 4G9FA 5J8OA 4FABL 4V1DE 2J5LB 1VGEL 1T3FB 4L3AA 4KK6C 5I76B 4BJLA 3TZVD 5GJSL 4UUJB 1TZGL 1BLNB 4FZEL 5FO9B 2FATH 4JG0H 3TZVC 2EH8H 4PRIE 4KJQC 1JHKL 1U41A 1A1OA 5AD0A 3LKRB 4WDIB 2XT1B 5FECB 4XP4H 3Q1SL 5H2BA 4JR9L 4EQ3A 5EOCH 3RHWF 5I1DA 3QQ3A 4LCUA 4J1UB 5EUOE 4FQ1L 2L0DA 4LNRB 4DW2L 1G7LB 4KKBD 5SWSA 2VLRE 5DHVA 5CIPB 1YC7A 5D1QA 5FUOL 1G6RB 5HD8C 3PQYE 4KKBC 4R0LA 1MWAA 3U7YL 5C2BH 1XR9B 1MRFL 3G5ZA 4JHAH 1V7MH 3SKOA 1IQDA 2IPUK 3MLSH 3V4PH 1BF8A 1RULL 2AQ2A 4NGHH 3CLEL 4KU1A 2AJZA 2VDQL 3ARBD 1MRCH 4NQSA 2VDLH 4MGXA 1JV5A 4JZNA 5I1AA 4XCEB 5HVHB 5D93C 4WCYH 3QB7C 4L8CA 2YHGA 3KPOB 4WUUB 4Y89A 3VA2C 1A7PH 4LSUL 2IEPA 1X6LA 5F7WC 1P4BH 4EVNB 4L8SA 3GB7B 3MJ9H 1HHKA 2VDKH 4V1DB 1KF9B 2AK1L 5ID1B 2B39A 5DLMH 5FGRA 5SWQB 4K8RD 3TBVA 3D2UB 1W0VB 1KN4L 1WFOA 3ARUA 3LSOB 2ITDA 1PYWA 1YECH 2LVCA 1FNGB 4PRIB 3QIBB 3D85A 1KCUH 4MJ5B 2YEZA 1Y18B 4YLQT 2EDYA 1H3XA 3L9RB 4NC2B 2J6EL 1CICD 2CLZB 3VCLA 4JRXE 1YA5A 2OTUB 1MCJA 3X13A 4FQJH 4Y8DC 5HHNB 3FQXA 1CICC 4U3HA 2CKBA 5I30L 2VDNL 5KZCB 4NQXB 3QHFL 2VLRB 3QWOB 1CGTA 1MCRA 2VH5L 5KVGH 4HIXH 4BQ9A 3BVNB 3CXHJ 3FONA 2GYSA 4BZ1L 2FWOA 4U1MB 4K94C 4OZIB 4HDIB 1QKZH 4YR6A 5JQHC 1GGYA 3QIWD 4G42A 1S7VB 4LKXB 4XGZA 5F3BA 4K7PX 1N0XH 5SX4I 4EN3D 2VZOA 3WFHA 2MHAB 2OR9H 4OZFH 2ZCHL 3STZA 2IAND 3ZDZF 4DZ8B 4EN3C 1UXSB 5IW1B 2ZG2A 1X5IA 2WNGA 5D7IA 5DUPH 2ZUTA 3FT3A 5E9DD 3ZTJH 2BP3A 1KGCE 3U1SL 1JFQH 3RNQA 3VD4A 4K3DH 2A1WL 2FHCA 4YXHL 4BA8A 3WHXA 3HR6A 3SDAA 4HKBA 3H9YA 5IVZA 1RJYA 2V2XA 3HZVB 5CP3A 4JO2H 5SWZE 5IGXH 4HSQA 3O9WD 4IOFD 4FMKA 1CE1L 1UM5L 3SO5A 1E6JL 4F2MA 1MCOL 1AR1D 2GJJA 4IOFC 3P73A 4QXGH 4PJHF 4LEXL 4YIQB 1AR1C 3ZKSD 3AFLA 5GXBB 3T2QA 1KUMA 3VRLF 1MCDA 3OAZH 1RZJH 1DP0A 1KTDB 2GJ6D 3K2UL 1JN6A 2ATPB 1NJ9A 4NQEA 2X1OA 2B8OT 4TOYH 5JNYA 3IU4H 1LQSR 4IRZH 4MYWB 4P2RA 1AKJB 5GS2D 3G9AB 5T3XD 3F5WA 5ENWA 2F8XC 4F15C 1NGQL 4HWBH 2YR3A 1C8PA 2WQ8A 3HPLA 4N9GA 4HMDA 3T2PA 3QEUB 4PP2A 3NCCB 3G5YB 3AGVA 4PR5A 3CDGB 3GSVA 5CD5D 1I85C 1QFUL 1Q0XL 3T65B 3U30C 4WGWB 3OJDA 4HS8L 4G9DB 4GG6E 3OR7A 5F9JB 3BPCB 3QUMA 3S37H 4F9LA 5CD5C 5JR1H 3S4SB 1Q9OB 1LP9F 2NY7H 3HE6C 1JIBA 1IKFH 1QYGH 5JOPD 2P7TA 3QIUD 1MHPH 3HRZA 2ERJC 3UTSE 4HJGB 3DROA 5IOPA 5DJZA 2VWEE 5BOPA 3QIUC 4UV7L 1ACZA 1JHTA 3ABZA 3ULUF 3TNMB 1MHEB 3DVGA 1FDLH 5FYLD 3WN5B 4RGMB 2A6JB 2YPLE 4MCYB 3RRQA 1MCQA 1F3JB 2G60H 4M7LL 5JTWA 4QRSB 3HNVH 5SWZB 4ERSH 4Y16D 1X5AA 1EPFA 3O0RL 1L4IA 1CD0A 3WYRA 4Y16C 1N64H 3SDCB 1AE6H 1J0JA 1KEML 4M93C 3OXRB 3VXNA 8FABA 1BGXH 1RVFL 5JIHA 3T8XA 1BD2A 3IDNA 5HY9A 4LDLB 5HBBA 2VLJE 2YSSB 5DS8B 1B0RA 2HJKA 4NO2B 3ZDXF 1F8TH 2VDMH 1K6QL 5JXED 3DNKA 3QUYA 1T5XB 1KLGB 4JGUA 5KJRH 1Q9KA 1CFVL 2EKJA 3HI1B 4GKNB 1U8MB 5JXEC 5C8JA 2X42A 3DI2B 5M7QA 5BVJA 1F02I 4J8RA 4X7CC 4LHUA 5KVEL 3BN9D 7CGTA 2FX7L 4NKMA 5A43C 5CEZH 4JVUA 5SX5K 4UU9A 3U83A 4TVPL 5EN2A 3O45B 1MCWW 2VL4A 3BN9C 1J86A 1IJ9A 3JZ7A 4HZLB 2KH2B 1P7QA 4QHKI 4GG6B 2B0SL 4RISH 6CGTA 4M7LT 1SJHA 4RQQA 3FT2B 1EGJH 4P3WA 1A02N 1WBYA 2B1AL 4ONOA 1I7TB 5ACZA 1DQDH 4QHLA 5T1LD 3Q3GA 4KWUA 4GAGL 3UTSB 1WAAE 3VDBA 5F1IB 5DUBA 2V9QA 1YEFH 1B2WH 4FFYH 4J4PD 2W9EH 2MKLC 3E8UH 3SKNA 3T0BA 2APVA 5C71A 4WUKH 1WSST 1BOGB 3QUZA 4KGJA 1QFWH 1WUNT 4J4PC 3UTPE 4PJAA 5EC2B 4Z7QF 2Z9TA 4QWWD 1ZSDA 1WFUA 4YHPB 2AJXH 5A2KH 4OLYH 2P44B 4MA7L 5FB8B 5EBLB 3VFPB 4QWWC 2JIXB 3UTQA 4P4KB 4LVEA 3RIAK 2X4SB 4JFFA 3D69A 1AO7D 5E6YA 1A9EA 2YUWA 4LNVA 4XVUD 4MAYA 5IBLD 3LKQA 4JFEE 3R8QA 4ZOEA 4XVUC 2ATKA 3RJQB 5I17B 2MMXA 5DI8A 1KULA 1CBVL 3SBWA 3GHBL 1YY8A 2HVKA 1QHPA 3PF2A 2DQDH 2AK4E 2IALB 3C6LB 4ZYKB 2AJSH 4U1IA 5INDA 3P2TA 3MCKB 1ZT1B 3BIBX 1LP9A 3BP6A 5FA3B 1MCWM 3GSNB 5E1AB 4JPKH 3L3IB 4O4YL 5DD5L 1N5AA 3FN3A 1A64A 4WNQA 2V7NB 5C08D 3CZJA 1KLUA 4P9ML 3GMNA 3GRWA 4L3CB 4FS0A 5IJVB 2FIKB 2EZ0D 4ONFL 4X6DA 1DQQA 1FC1A 2ZSWB 1W72B 3MC0A 1FYTD 2EZ0C 3D0LB 4HFUH 1IC1A 3KPNA 3NFNB 3MUGA 3TCLA 4JG1H 5AYUH 5I8OH 4XVSL 3C9NA 5IMOA 4S1QH 3H9SB 3U6RB 5ACLA 3KYOB 5LJYH 4H1LA 1Y0LB 3EFDH 4GLRI 4FQQB 3MUY1 3JTTA 4YDIH 1A6TB 1VFOA 2IBGA 4U6TA 5IBTL 1EEZA 2JLLA 1MHCB 2BSTA 5AWNL 3E0GA 3LHPH 5I1EL 4ZSOA 2O61B 4IRSD 5BRZA 2R0ZH 3RZCD 4QHUB 1CLOL 2D7TH 4IRSC 3CVIH 1R6VA 3RZCC 1IZKA 4F7EB 1D6EB 1ZHNA 2BVYA 2KKQA 4X83A 1CF8H 3RUGF 2PN5A 1AGEA 2AJVH 2O93L 1KN2L 1C5DA 1R3KB 3DECA 1EH9A 5E8NB 4FFVD 3IDMB 3U36B 2YMXH 1KIUA 4B5EA 1U8JB 3GBML 4C55A 5LBSH 4FFVC 2YD1A 4ZNEA 4D9RD 4P5TB 4Z7OF 4L1DA 3QEQE 3SQOL 1K8IA 3MLZL 2XY1A 3DXAA 5DJ6B 4QXUL 5FEBA 4JFQA 3SKJH 1RUKL 2DL9A 3PHOB 2VR9A 3SGKA 2PW2A 5I2IA 2GTZA 5D2LA 2Y5EA 3MRLB 2EE2A 2GITB 1FO0L 3RL2B 4KRNA 3FOMB 3U2SB 1EDQA 5CUSH 3NCFB 3VFWA 5CD3A 4NC1C 3IJHA 1MAMH 1Z9MA 4OCYL 4S11A 1C5CH 1L0XA 5ETUA 4LASH 4U6HA 1DBML 2X4QA 1HSBB 1JGDA 4HUVB 1JPSH 3ZYOA 3KPQB 4XWGL 5SWSD 3JSSA 5D1QD 2FR4B 2ORBH 1H8NA 5IV2B 5D1QC 3UJTH 3GSOB 5DJ8A 4X4XB 4R0LC 3V0WH 5E8EA 5E94B 1XF2A 3ARBB 3HC3H 4QTHB 1ZHLB 2HFFA 5D93B 1EO7A 1T1XA 4NNXA 3P9LB 3CX2A 5E9DE 5I15H 3HAEB 5CINH 1WZMA 3MGAA 3S35X 2HVJA 3BWAA 3T1FB 3ZYIA 1K3ZA 2R2HB 1Y6KR 2FECI 4PIRF 3L95B 1GCFA 2ZG1A 4QF1A 5EORH 1AXTH 4P0DA 1G7PA 1I1CA 1PKOA 5EO9B 5DSCB 1CN4A 4JPVH 3HUJF 3QCVL 5JZ7D 2XZZA 3DGGA 2P5ED 2ZG3A 4XPTL 1P5VA 5JZ7C 3Q48A 3HTLX 4QEGA 5KVFH 1MFEH 3FKUS 2DMBA 4L8SC 2AI0L 2SEBA 4D3CH 1DBBH 1RZ7L 3O3AB 4P23D 3D0VB 5C0AD 4P3CL 3BT2H 4P23C 1AI1H 4NKOA 1CICB 1EFXD 4P49A 1J0YA 4UZGA 1OSZB 3KPLA 4H26A 4D0BA 5T3XE 2XKNA 3QYCA 4OFPA 4IMLA 3RGVA 4HQQL 3CCHB 1F2QA 3KDMB 1Q9LA 3MLYH 1MY5A 4WO4A 3G5VB 4BH8A 4WJ5B 5EFIB 5GGTA 1FIGL 3NACL 5DZLA 3MLUL 4LLYA 1IT9L 3WSQL 3PWJA 3PIQB 5LCVL 3QIWB 3LCYA 4I2XA 5EB9A 4EN3B 2YK1L 1MFBH 4GRMB 2XYCA 2IANB 2BRRL 4X99A 4QHNA 2RAMA 2V9RA 2Y36L 4Z0XA 3P77B 5JOPE 8CGTA 5E9DB 3I02B 4H25A 4HT1H 4YHLH 3ZDYE 4BZ2L 1I9JL 2HKHH 5E2UH 2HTLD 4JFPA 1WFTA 3EO1A 4U2YA 4P9HH 1T2JA 4OI8A 5FKAB 1EO8L 2HTLC 4J3SA 4WW2F 4DJMA 2H1PL 4WTZG 3O9WB 4RA0C 3S36L 1NUNB 4ONHA 3TT1L 3SDAD 4X9GA 4D8PB 2XZQH 3MRMA 4RSVA 3SDAC 1RZ8A 1VGEH 5CEXA 4ZODA 3T4YA 2VZVA 1MCKA 3O3BB 4FA8A 4UTAL 5GJSH 4LLMB 4DUXA 1I7RB 2FGZA 5IEKB 1T04A 2GJ6B 4E0RA 3QISA 4O2CB 4LPWA 2AJUL 4FQLL 3LQMA 3AMLA 4YHKL 4F15B 1R3JA 1BIIB 3VXUE 2R8SL 1E4KA 3FOLB 4NQED 5JO5A 1EEYA 4Z7NF 2FL5A 5I0ZA 2DF3A 4JR9H 2YD3A 4P2RD 5KN5A 3OR6A 4FQ1H 4ZQKB 5CJXC 1EK3A 3F65A 4U7KA 5J89A 1CLCA 1FLTX 3U30B 2NY2D 1RI8A 3G08B 1J11A 1K4CA 1QLEH 5DD0L 3MRIA 3CK0L 5E8OA 5KS9F 2NY2C 3TBSB 1IAKA 4K7PY 2X6MA 1E28B 3ARDD 3H7LA 1RULH 2ERJB 3FQNB 3ARDC 2W38A 2VDQH 1VESA 4OCXH 2XWTB 3QIUB 3AROA 1J8HA 4TN9A 1ZLVH 3HR5B 4MNGE 1LD9B 3VFNA 4HV8B 4OF8A 2B5IB 4DVBA 5GISL 1UA6L 4G7VL 4LSUH 1I8MB 2MJWA 4LPYA 1U95A 1A4KB 1DR9A 2I27N 4Y16B 2CRMA 3QULB 2DTSA 1DQLH 2OYPA 1M05B 4KKNA 4S0SD 4NHCL 2X4UA 3CSBA 2R56L 1KN4H 1JNLL 4O2FB 3OKMA 4I4WB 1OM3H 1U3JA 3KWWA 3BGFB 4L3EA 1BD2D 2XG5A 4XH2A 1VFAA 3L7EA 3V79C 2CJUL 2VN7A 3UC0H 3IT8D 1TTGA 1EMTL 4HS6A 3H9HA 2FYYA 1KT2B 3QUYD 2D31A 3MRQB 1NCBH 1ZS8A 3FMGL 5DMIH 4PP1C 3QHFH 3QUYC 1NKOA 3ME0A 5C08E 3DBXB 2VH5H 4OLXL 4LHUD 4BZ1H 2A6KB 4EI6A 2CDEA 4NHUA 2YA2A 1HE7A 1MJ8L 4HIIA 3BW9B 2D7OA 5EO1A 2D7MA 2PCPB 3KAAA 3FRPA 4W6WB 1UACL 1P7QD 3SY0B 3HRPA 1XF3A 4M7ZC 1X4XA 3N9GH 3AAZB 4PRAB 5INCA 1ZHBB 1OP9A 3HI6H 5DRXA 2LAGB 5D9SB 5T1LB 5IESL 1FAIL 2QV2A 4WTXA 3NCBB 5T1DH 2C1PB 2I24N 1C12A 1AGFB 1BX2B 4MJ2A 3ZYJA 1NBZB 2BNUB 4JJ5A 1XMWA 1PEWA 1DCLA 3LV3A 2BXYA 1HZHL 3RY6A 1TNMA 3QUZD 4OV5B 4TQEL 4HZAA 4AJ0A 1QTYT 3VE0B 4MB5A 3DYOA 5DTFB 5A40E 5JPMA 1ZLSL 1CE1H 1UM5H 4KRLB 4XMLL 1AO7B 1TPXC 3QZWA 15C8L 5FK9B 4YDVB 3W2DL 1LNUB 1RIHL 3P4OA 3AMKA 3BDYH 4MAYD 4MQSB 4YFLF 2HJFA 4ZD3L 4DGYL 1XH3B 4JRYA 3CH1A 5E5UB 5FV2A 4MAYC 1L7TL 3K2UH 1OF2A 3IFPB 4PJEB 5IROA 4J23A 1Z5LA 2Z8RA 1U8KA 2WWKO 3MV01 4UV4H 1U8PB 4D9RE 1B6DA 1JBJA 3V5KB 3MA7A 3QUKA 4RFEB 1N8ZA 4QYOA 2Q8AH 4D94A 1TTFA 3IDUA 3SBWC 1ZT4A 1J5OL 2ZUSA 3AC0A 3C08H 1MCIA 5IMMB 5C08B 4PRBA 1MAKA 2X9XA 4Q7DA 5F7MC 3QDGA 3EO9H 3TN0A 5LG1A 1FSKC 3SPVB 4CW1A 2Q76A 3VH8A 1QFUH 4NC1E 3VA6A 1FYTB 4LCIH 5DVKA 1KB5L 5KG9B 4GG8A 3SGEH 4YUEH 3R06B 5DK2A 1YEKL 5AZEL 5JOFA 1F97A 2QLVB 2CRZA 2NR6D 2C4XA 4MMZC 3IYLW 2QKIA 4M1DH 1KJ2B 1HN1A 4UV7H 2CH8A 4XCNB 3MO1B 4XPHL 4NKIH 1C16B 3NA9L 4FQ2L 4IRSB 1DUZA 3BPNB 3V6FB 3RZCB 5AEAA 2XZCH 3VWKA 5BRZD 1WEJL 3MZGB 3WIFB 4Y5XA 1FZMB 4PD4J 1Q9WB 3FQWB 1M1SA 3SE8L 1RFDH 1CDCA 3OPZL 5GIRA 4IS6B 4HF5H 3H3BC 1KCSL 4JLRB 3AU1A 4PJ7E 3P0GB 2IPTL 1UFUA 2W9LA 4EIZC 2N1KA 4XBGA 1K6QH 3MLTB 4ZPTA 3P4LA 2P5EE 4CUCA 4G9FB 5JMOC 3IDYC 3DUSA 3JUYA 4MNHA 1BJ1J 2ZUYA 2XN9A 5KVEH 1MCFA 1NAKL 3MZTA 2FX7H 4QXWA 4XNMA 4YK4C 4HK0B 3LQAL 4TVPH 4YHOL 1OAQL 1C7TA 2ED8A 3C5SA 3GK8L 5FGCE 5C0AE 5CHNA 4L8DA 3SGKC 1A1OB 3Q5YA 1YQVL 5AD0B 2DJUA 4MLIA 3QXAA 1ZMYA 2FO4A 3OZ9L 1NLBL 4JKPH 3KYKL 5JW4N 4JKMA 3MGTA 2F15A 1AQDB 4PJXE 5H2BB 5I1DB 2OL3B 3KR3H 3QQ3B 4LCUB 4G8FA 4GAGH 4RAVA 3LKNA 2A73A 5IVNA 5SWSB 2NLJB 5DHVB 5AG9A 3F7PC 5D1QB 2J3SA 1JZ8A 2IBZY 5CGTA 4L29A 4R0LB 1MWAB 1JWUA 1QO3A 4TSAL 3G5ZB 3OKYA 3SKOB 2UZIL 1IQDB 4MA7H 3MV11 5BJTA 3U0PA 4PJIF 1N6VA 5ILTL 2ICWA 4CKVX 1VGKA 1FIEA 1PJ9A 2B4CL 5CJOL 4GRWH 3SOBL 3LPGA 2AJZB 1AFVL 4NDMA 2QQNL 1MFAH 2X05A 1IM9A 2DM4A 5HGDA 1JV5B 4M4RA 1TCRA 4JZNB 5I1AB 3A6BL 2Q6WA 3IAPA 5GGVH 4L8CB 5JUEL 2H9GA 4EBQL 1CBVH 1Q94B 1KCVL 4TSBL 4OCRL 4I0CC 4JQIL 1X4ZA 1Q72L 2P5EB 3DVIA 2NX5A 4K23L 4L8SB 4KRMB 3CUPA 1HHKB 2H45A 4KJPD 1CTOA 3NCJL 5EU4A 4O4YH 1J1OH 3TBVB 4KJPC 1EAJA 3KNBA 1A7RL 5C0AB 4X6CE 5FGCB 1U3YA 2J6EA 4P9MH 5EA0H 4NQDE 2ITDB 1PYWB 2XQBH 4X80L 2VXQL 4Q6YA 3LKSA 2YEZB 1NCCL 4U31A 4X8JA 5CBEA 3VCLB 2O5ZL 3GBNH 3MJ8A 4QXTA 4FQXD 2AV7A 3DRQA 5BW7A 3IJYA 3X13B 3FQXB 2D2OA 3O3DA 4PV8A 3RGVD 2CKBB 4FQXC 1FL5A 1QNZL 4U7MA 4LHJB 3RGVC 4ZUTA 3WDIA 4XC1H 3FONB 1N0LA 2FWOB 5IBTH 1NBVL 4Z8FL 4G42B 4XGZB 5F3BB 5I1EH 3TVMA 3WFHB 4ESKA 1OAUL 2J88H 3L5JA 5GGRA 5I73C 3STZB 4XVTL 2NQCA 4TNWF 1RQ5A 5ABDE 4PLJD 2WWMD 5D7IB 3PP4H 3FT3B 4PLJC 1ZAGA 4NM4L 4W70A 4PJCA 4XNXH 5T5NF 1DLFL 1T6WA 4JKKA 3RNQB 2EYSA 4L4TA 5IT2H 3WHXB 3IXAA 2ZWLT 4LL9A 1IM3A 1X5HA 3SDAB 3SE3A 4HKBB 5IVZB 1RJYB 2V2XB 3CFCL 1IGMH 5DVLA 4W4NA 4G43A 1XGTA 3MRBA 3FFDA 4QXUH 1J88A 1DUYA 4F2MB 2V17H 4I13B 4PY8J 3P73B 5FYJH 1PQZA 4JCMA 3B2VL 3RU8L 3IKCA 4X9IA 1FO0H 2IG2H 1RIUH 4GRWF 1IBGL 3QSKB 1JN6B 3JWOH 1NJ9B 3OG6B 4NQEB 2Y6SD 4CU7A 5JNYB 1U8IA 4OSUL 35C8L 2E9IA 4JDVA 4P2RB 4W81A 3TO4A 3F5WB 5ENWB 2Y6SC 1JRHI 2E27H 4D0CA 1E4KC 4ZXBA 5EOQH 4WWKA 5H37G 5EZIL 2PKDA 3W9EA 2NY2B 1M7XA 3HPLB 1CQYA 4N9GB 5F97E 4F33A 4PP2B 4HW6A 5FF6A 2VQUA 4PR5B 3GSVB 1SVZA 3BPOC 3FL7A 4XPFH 1WBXA 5AAMA 5C0CA 4RWHA 3OJDB 5IQ7L 3OR7B 3QUMB 4PJ8D 4WI2A 4DKDC 4ISVA 2Z8VC 4KHTH 1UG9A 1J1XH 3WS3B 4PJ8C 3LMJH 5ISZE 3O41A 4CN6A 2P7TB 3HRZB 1BQLL 4DN4L 3DROB 5IOPB 5DJZB 1J8HD 5MI0B 2CMRL 1JHTB 1OWWA 3DVGB 4Z0BL 4IRJA 5I71C 3RDTA 3MV7E 4G6JH 1BZ7A 3O4LE 2LU3A 3KYMA 1OAYL 5KANI 3VJ6A 2G9HA 4PRHA 3BP5A 1EA9C 5E5MA 2KQMA 1RZ7H 3VXNB 2DD8L 5C70A 1P7HL 2I26N 4CDHA 4XPBL 4IDLA 3ZE1F 3T8XB 5LXGL 1BD2B 3IDNB 5HY9B 3C6SA 3G6DL 4P3CH 4PRPA 1B0RB 2HJKB 1IFHL 1U3HD 5KSBF 5EZJA 3A67L 4OFYA 5LVEA 4L3ED 4Q9RH 3VDAA 2VXSL 5I66A 4G5ZL 3QUYB 1KLFA 1U3HC 4FFWC 5HI3D 2PTTA 1UM4L 1Q9KB 1CDYA 1I8IA 3BIKA 4HQQH 3EJJX 5C8JB 1NGYA 5HI3C 5BVJB 3ARFD 1S9YA 4J8RB 1A7OH 4LHUB 1EERB 4Y1AE 1FIGH 4NKMB 4LSVL 3NACH 4UU9B 3ARFC 3DARA 5EN2B 3CDYA 3IJSA 5J12C 2CQVA 3QFJD 1P7QB 3PNWA 1IGJA 4IJ3C 3EOAB 2GW5A 1TDQA 4X6DE 2R4RL 2QADD 5E2VL 5C0BE 3KPMA 4HXAL 3MLRH 2BRRH 1ODAA 1OT2A 1I7UA 1SJHB 4RQQB 4X4YA 1WWCA 1TZIA 3SKUD 1OSPL 4Y2OA 1VPOL 2QADC 3GSNL 5ACZB 1FRGH 4QHLB 3Q3GB 4I9WE 1KJVA 3TH2T 1NANI 1NCDL 5K59E 4ZFGL 5DUBB 4BZ2H 2BFVL 1MAJA 5I6XC 1I9JH 3SKNB 4BYHA 3QUZB 1MOEA 1U8OA 4X5WA 4JY5H 4PJAB 1W72L 2PYEE 4ETYA 4K3JL 3BGAA 1HILA 4OD1L 3TT1H 5ICZA 4FMFA 3UBXI 1P9MA 3RY6C 1GZQA 1T7XA 3L3KA 3UTQB 1M71A 5HVWA 2ADIA 1MCHA 1P5UA 1MJJA 4H8WC 3D69B 1A9EB 2VXVL 1H3GA 4MAYB 2W91A 3OJMB 4UTAH 1RURH 2W9DL 3WD5L 4NWUH 3F8UB 2ATKB 4Y8AA 2AXJA 4CGTA 3DGCR 5DI8B 4JRYD 3U48A 3MCLH 5E8PA 4HLZG 4YHKH 1TQCC 5A3ID 1YY8B 2HVKB 2R8SH 3GBLA 2MCPL 4QTIL 1TQBC 3QCUH 1XGRA 1MJ7L 5A3IC 4U1IB 5INDB 5IROC 1LP9B 3BP6B 2EO9A 2AEPL 3UTOA 4KVNH 1FSKB 4QGYA 2PXYA 4EXKA 2QQQA 1N5AB 4KY1H 1LDPL 4HKXA 4WNQB 4M61A 3QDGD 1KLUB 1Q1JL 5D2LE 5DD0H 3TN0D 3GMNB 3CK0H 1TCMA 5KAQF 4X6DB 1DQQB 4I0KA 3A6CL 2CD0A 4XTRD 4AY0A 4NUJA 1AGCA 4NCC2 3KPNB 3MUGB 2ILLA 4Z7WE 3D9AL 4HXBL 1FE8L 3TCLB 4GAJH 3KPPA 3C9NB 5L7XL 3HS0A 4H1LB 4PUBL 1YN7A 2JELL 1FGNL 1DSFL 3RA7H 3DO7A 3PWNA 3JTTB 4ODWA 5EBMB 1F6LL 1GH7A 5HHMD 1QBAA 3M8OL 3PDOA 4WFHE 5GRZA 3T3ME 1EEZB 1UA6H 1GGIL 4Q9QH 1U0QA 2BY0A 5CGMA 1N5YH 2BSTB 4MJIA 2VO5A 4JB9H 3P0YH 4ZSOB 5BRZB 2X1XR 3HI5L 2ZKHH 3N85L 2WBWB 4NHCH 3VWKD 4DVRH 1BWMA 4NZUH 3AREA 3L3OB 3OJVC 4Y4FA 3W0WD 2R56H 3VFSA 1JNLH 1KG0A 1ZHNB 4OFVA 5CZVL 1KYOK 2GJZA 1AGEB 3VWKC 1I4FA 1C5DB 3HAEG 1FG9C 4XNYL 3FQRA 5E4IA 3IDYB 3Q5OA 2H32H 2J2ZA 3I3DA 2OJEB 4AENA 4MVBD 1K8IB 1H0DB 4YK4B 4R4BA 1U91A 4QRRA 1HHIA 1A6VL 1CDIA 4MVBC 4OGYL 1KC5L 4JFQB 5F7DA 4OLXH 2XN9D 2PW2B 4LSQL 5I2IB 2GTZB 5D2LB 4OAWA 1JPTL 3K2MC 2EDOA 5C07A 1TTUA 2DDQH 1HHJB 3KXFE 1UXWA 3O6LL 1GAFL 1FVDA 1JL8A 4K9EC 1VSCA 3CAFA 1ZXQA 4ODSL 2CUHA 3MCG1 3VFWB 5CD3B 3IJHB 2CDGA 3LPFA 4ZUUA 4K8RL 5ETUB 3VFRA 5IESH 5JW3H 1FAIH 2FEEI 4ODVL 4U6HB 4HWUA 2X4QB 3PGDA 1JGDB 3OJ2C 2XY2A 1YEHL 3EYSL 3MNZA 2AV1A 3QHZL 2X9YA 3MODL 3WO3B 2X7LA 4NJ9L 4TQEH 4QT5A 4I2XE 4XAKD 5DJ8B 3FRUA 4X9HA 2VB5A 5E8EB 1AGBA 2BNQA 2Q1EA 3W11C 1XF2B 3CZFA 4YFEA 4AT6A 1ZLSH 2FECL 3SCMA 2HFFB 3OGCA 1BJMA 1T1XB 1EHXA 2WLZA 4NNXB 3LN9A 3I9GL 2VSDA 1IM9D 3M1BA 2OI9C 2DKUA 1NGPL 2HVJB 3BWAB 2N56A 4U0RB 3CFIC 1A1MB 5GRVK 4XAWH 4HWZA 4QF1B 1G7PB 3ZTNH 5CMAA 3DGGB 4N8PA 1J5OH 2V5TA 4KAQL 2AAVA 4WW1A 2SEBB 5C0EA 2GY5A 2V5SA 2AXFA 1OP5H 2J8UA 4KROD 1T21A 4ZFFA 2YPVL 4OZFA 5T33L 2E7LA 4KROC 4ORGA 1KPRA 5CSZA 3U4EA 4NKOB 2DTML 4YHYB 1VHPA 3CLFL 5EC1A 3KPLB 4D0BB 4H26B 2XKNB 3RGVB 4IMLB 2WBKA 1YEKH 1ES0A 3EKCA 2L4OA 9CGTA 3GIVA 1Q9LB 3AB0C 4JM4L 4WO4B 4BH8B 3DMMC 2EDDA 5EU6A 5FO7A 5BW7C 4MD4B 4M00A 4LLYB 5CILL 4XPHH 2DQIL 4NNYA 4Y4KA 3BP4A 3PWJB 2DM7A 4I2XB 1KV3A 5T3XL 2XZAL 2XIDA 2NW3A 4X99B 1JPGA 3TVMD 4QHNB 4Z0XB 1LK2A 1Z3GL 1WEJH 5KVDL 3TVMC 5GZOD 1VEOA 3SE8H 3RWGA 1G6RH 3OPZH 4H25B 1JZ4A 4K71C 4OGZA 5GZOC 4ZUVA 3OAYH 4JFPB 2PR4H 4K55A 3EO1B 1T0PB 2IPTH 3GHEL 5F9AC 4DKFH 1MUJA 3MRPA 4X9BA 3MMEA 1CGVA 1UWEL 1YZZA 4ONHB 4RIRA 3TBYB 5LGJA 3RWCA 3V2AR 3MRMB 5J4MA 1RZ8B 1HXYA 2CLRA 4KKCD 5CEXB 1MVFA 2R23A 3T4YB 5DHXB 3LQAH 1NMAH 2WV3A 4KKCC 1RZKC 5FYLL 1RZIA 2BVPA 1GHFH 1T04B 2ID5A 4E0RB 3BEWA 1U2CA 1DFBH 3ESVF 4ODTH 4L3EE 3FT4A 5C9KA 1R3JB 1YQVH 1C1EL 5JO5B 2F19L 1NLBH 1EEYB 1UC6A 2D0FA 2IPUG 2VXUL 1VFMA 2O26U 4YXLH 4R90L 3TO4D 5KN5B 3V9FA 1GGCH 5GPRA 4P2QA 4N8VA 4ZXBD 3BPOB 5DFVD 5GZND 4WWKD 4Z7VE 4M03A 1A6UL 2XQYK 4YGVA 1K4CB 2E7HA 2QHLA 3QFJE 4Z7UA 1LILA 5DFVC 4WWKC 3MRIB 4ZXBC 5GZNC 1V3LA 2JCCE 3PUCA 5E8OB 5AZ2L 1ZA6A 3FTGA 4X7DC 5IB1A 1IAKB 2UZIH 4WU7A 5JHLL 5C0CD 5IR1A 4HH9A 1MH5A 4J3TA 5JPNA 2FJHA 5F6HI 3GSXA 5ILTH 2Z35A 4KRPD 5CJOH 3AUVA 3QI9A 3BIAX 2KBGA 3VFVA 4KRPC 1J8HB 5I71B 2M2DA 2HMID 2HWZH 3V4VH 5HVFB 3A6BH 3VFNB 4QRPE 4YHML 3S88L 4MA8H 3NAAL 3SDYL 2HMIC 4LQFH 1HKFA 1FVCA 4DVBB 4CL7A 4PS4H 3RZWA 1U95B 4F7MA 4X7TA 5DHYA 4OCWH 4JQIH 1AC6A 1Q72H 1IQWL 1QBLL 1VACA 1P84K 3T3PF 3UPRA 2X4UB 3VXRA 3OKOA 2DQFA 3RY4A 4PRHD 1A7RH 4Z5RA 2IQAA 3OKMB 5F7KC 4E42A 4NZJA 3C09B 1U3HB 3P0VL 4R3SA 1W0WA 3KWWB 3BISA 4L3EB 5CJ5A 2DOCA 4PRPD 4XH2B 1VFAB 3L7EB 1VADA 4E41A 2BCKA 3N06B 3UJJH 1MNUL 4OFYD 1CI5A 2O5ZH 4HS6B 3H9HB 2FYYB 1LO2L 2D31B 3ARFB 1ZS8B 1DANT 2Q7NA 4U6YA 5J12B 25C8H 1GC1C 4Y88A 1RZFL 5SX4H 1I75A 4HC1L 3HNSH 4MB4A 1YNLL 4KKAD 4EI6B 3KPRA 1BVZA 2XICA 2CDEB 2OJZL 4NHUB 5IP4A 1WF5A 4X5LA 1XIWC 4HIIB 3MRDB 2Z93A 5EO1B 4KKAC 3BKJL 3IKKA 3MRCA 4FTVA 1FG2A 3K1KC 1I9IL 1XF3B 1OAUH 3PL6A 1TXKA 3L3HA 4R97C 1CK0H 5INCB 2VMFA 5DRXB 2XA8L 2OCFD 5I6XB 5MHSD 5T3ZD 1R0AL 5JHDE 1YJDH 4HCRL 3U9PL 1A7NL 3F7QA 4HAGA 1A7QL 1C12B 2OM5A 5HHME 5TDNA 2OTPA 4M62L 5HDBF 1KCKA 4OD3L 3LV3B 2E9WA 1P4LA 4XNQB 2X4PB 4OQTL 3RVUD 3ULVH 3SEPA 1R3IH 3CFCH 4I3GA 3VW3L 4M02A 3RVUC 5JPMB 3IRZA 2BOCA 2H2PD 4K3EH 1V5JA 3QZWB 3W0WE 2F5AH 3P4OB 2H2PC 1P9MC 1KJ2L 3B2VH 2IGFL 3TIDA 5D7LD 1PDKA 3OAUH 3RU8H 3ZL4L 3M45A 2HJFB 3SO3C 1CXKA 2IJ0C 2FJGA 2QSCL 1HIMH 4EDXA 4JRYB 1TQBB 3CH1B 2EIEA 1IBGH 1REIA 4XPGL 3F7VA 1OF2B 3EJZD 3T0AA 1IMHC 1Z5LB 12E8L 1D5IH 35C8H 3EJZC 3MA7B 3QUKB 4GMSL 1N8ZB 4QYOB 3BXNB 4KC3B 3IB4A 4P3DA 1ZT4B 4JZOB 1K2DB 4G8GE 3OAZK 4LIQE 4PRBB 3SDXA 3QDGB 3K46A 3EJYD 5FM5M 3THML 2DI7A 2PXYD 3VFTA 2RR3A 3QHTC 4I3RH 2ARWA 3TN0B 3EJYC 1IGIH 4XVJL 3MBEA 1G9NC 4CW1B 2Q76B 1AHWA 3AY4A 3VH8B 3TNNA 1MQKL 3TJEH 1MJUL 5FFLA 3TPUA 2X4OA 1UZ6E 5ITBL 3P30H 5GGSA 5H37H 1SBSL 4GG8B 1EV2E 5I8KL 5DK2B 4B50A 1F13A 2FX9L 2I5YL 4JO4L 5JOFB 1T7YA 2DIBA 3MJ6A 2QKIB 5HHMB 4LF3A 4NIKB 4WIQA 2N7AA 3WS6A 4Z0BH 1PGRB 1FAKT 1VA9A 2APFA 4XAKE 1RUAL 4ZFZA 1DUZB 5E5RB 2W65A 4POYA 4MJID 4HWNA 2H3NA 1YEDA 1MCSA 1FZJA 5TQ2H 3VWKB 2OL3L 1FHGA 3W0WB 1ZT7A 1YEGL 2DAVA 4PRNA 2FB4L 3ARED 3WUWA 5GIRB 4J2XA 1WICA 2WM0A 2WUCL 5JLZA 1MWAL 3AREC 3AU1B 2H26A 4PREA 4RMRA 3DWTA 2OQJA 5F71A 4ENED 4YDKL 1H15A 5IF0A 3D87B 3V7AG 1KPVA 5FM8A 1OP3H 4ZPTB 3CC5A 4ENEC 4YFLI 2K1MA 1A5FH 4OFDA 5C0JA 3DUSB 4MNHB 4QRRD 2GFBA 4LCYA 4RFOH 2XN9B 2BJMH 1TENA 2VQTA 3HCVA 4XNMB 2BOBA 3S34L 5HVGB 1PLGL 2FBOJ 1UWGH 2ICWI 4PG9A 5CHNB 4L8DB 2RFXA 2X70A 2IH1B 3MTRA 4YEEA 2D7QA 5ID1A 1LEGB 2MQCA 2R4RH 3ZHDA 1W0VA 4S1RL 5E2VH 4HXAH 3QXAB 1BVKA 4YBLC 3ALWA 3MGTB 1VPOH 2HRLA 5BZWA 4UTBL 1MRDL 4G8FB 4RAVB 1N3NA 3LKNB 4TPRL 2A73B 4MJ5A 5MEOA 2JK5A 2BFVH 3O6FA 3H42H 4MX7A 3B2UD 3VRJB 4L29B 1XAUA 3BGMA 1JWUB 3B2UC 1QO3B 5EUOA 5B39A 3CXDH 2YOCA 2GEEA 5TF1L 4BK4A 5BJTB 4JDTH 4OD1H 3UTTD 1NFIA 1PY9A 2ICWB 3PQYA 1ZWIA 1VGKB 1E4WL 2BNQD 2CK0H 3WKMH 2ZUQC 4EOWH 5ITFB 2CKBL 4H20L 2OI9B 3EHBD 3QAZC 4NDMB 5IB4A 1N4XL 3SCMD 2VTFA 3OG4B 1IM9B 1A2YB 5HGDB 3RNKA 4C56E 3EHBC 2Z8WC 4MXVE 1TCRB 4HKZA 3SCMC 3IDXH 4JM2A 5DGQA 2Q6WB 5FUZL 1FBIL 3M07A 4PJCE 2H9GB 3IAQA 4DTGL 1F90H 1CE6A 5E8DL 4DZ8A 3B43A 3WFEL 1AP2A 1ZOXA 2NX5B 1MJ7H 4FG6D 4LVNC 4LEOB 3BMWA 4L4VE 3CUPB 4KTYA 5ESAA 4ZOBA 3D6GA 1J10A 4FG6C 2BC4A 2X5PA 5HJ3A 5EU4B 3VXPA 5FDWA 4GG6F 3TV3L 1RK0A 1Z6JT 4KROB 3Q0HA 2DBLL 3KNBB 4HLZH 3MRJA 5DQJB 1G6VK 3HZVA 3QWRA 1A3LL 3V4UH 1RUMH 1NFDE 4GLRH 3LKSB 2C3GA 1D5MB 3AB0B 3N50A 4X8JB 5CBEB 2E7LC 1RAMA 1N6QL 5HHXL 4QXTB 1FE8H 3MJ8B 4FFZL 2AV7B 4D9LL 4KJWD 3IJYB 5DFTA 3O3DB 4PV8B 5J13C 4AYFA 5L7XH 3EDKA 4KJWC 5HGBA 1FL5B 2LU4A 4DKAA 4ZUTB 3C8HA 1NL0L 4JRXA 5EU6D 3E1F1 3T0VA 2DLFL 5I1CH 3R1GH 4APQA 1CDGA 1EZVX 4WRLA 5C0CE 1FPTH 4P99A 1WZLA 3WV0A 2X2YA 3TVMB 2NTSP 3WXWL 1B4RA 4DFIA 4JQVA 4F8QA 1BQHG 5GGRY 4K71B 4GW1A 2W0KA 5MEQA 5KOMC 3I85A 1ZGLM 1NEUA 4LSTL 1I3UA 3O11A 4PJCB 4Q58C 3T0DA 1BBDL 4U7SA 2EYSB 4XNYH 3ZKXC 2APWA 2EECA 3PWPE 1JTTA 3Q6GL 4OCNC 3IXAB 3LN5A 3LAFA 1IM3B 3QUML 1OW0A 5DEGA 4NN7B 4MMXC 3MOBL 4G43B 1XGTB 1A6VH 3MRBB 4I48A 1DUYB 3NBNA 1GRWA 4CVXA 4I77L 4YXKL 3WN5A 1KC5H 3GI8L 4GAYA 2VN4A 1ZEAH 5GGUA 2WWKT 1MY7A 3MSPA 1JPTH 3IKCB 1UT9A 3O6LH 3FCTA 4PRPE 2BVQA 4OIAA 5ADPL 1WAAF 4KUZH 4ODSH 3K81A 4XX1E 2QJDA 1YC8A 1U8IB 4HHAA 1HNFA 2D4DA 3QUXD 4JDVB 1NUFA 3TO4B 3ZE2E 4K8RH 3QUXC 4D0CB 1AR2A 3MRGA 4ODVH 4ZXBB 1WWBX 1KIRB 4WWKB 5HHVH 3W9EB 4P46A 4PJBE 5B21A 2VXTH 4P2QD 2R15A 4F33B 1YEHH 3HMXH 3EYSH 4LGPB 5FF6B 3QHZH 4JGJA 3VG9C 3HI1A 4BFGA 3MODH 1LE5A 1A47A 1CYGA 1WBXB 4NJ9H 5C0CB 3VI3E 3VXTA 1DBKL 3H3PL 4GBXA 4M48H 4U1GC 5F1SA 5KANG 4KRPB 4ISVB 2BZDA 2XTJE 4U49A 5IVXA 5MHSE 5J9PA 4Y4HA 3EYOA 5TF0A 3O41B 1WLHA 3GMLA 4P5MA 2DMKA 4DEPC 4JFXA 4HLJA 1G7JA 4IRJB 2QQKL 3RDTB 3OSKA 2ARJQ 1BFOA 4S1SL 2FJFA 5IB2A 1BZ7B 1UH3A 5CEZD 1H8OA 4K2UH 1AIFA 2BSSA 3KYMB 2YPLA 2CXGA 1BOGA 3VJ6B 2G9HB 3OKKA 4XBPA 4PRHB 1S7WA 3BP5B 1LEKA 5E5MB 3QCTL 4YFDB 5D7LE 3VXRD 3JV4A 5MERA 5I1GL 2YPVH 4HIJB 3T09A 3FB8A 4DUVA 4Y19D 3D5OF 2X09A 3C6SB 3HNTL 4JFYA 4PRPB 4GS7C 1LO5A 1VEPA 4MXWH 5KSUB 5EZJB 2LVEA 2DTMH 1CDBA 5I66B 4E41D 2PTTB 3BIKB 1I8IB 3LS5H 5DQDH 2A77L 2VLJA 3O2VL 1NGYB 1S9YB 4W4OA 3CDFA 4PTUB 2EXYD 3GFUA 2OZ4H 1FNEA 4DWHA 3U9UA 5KTEH 5CILH 3NFSH 3IJSB 2DQCH 2EXYC 3KPRD 4I3SH 6FABL 1BECA 4KZEL 3PNWB 4R97B 2OP4L 3N1MC 1IGJB 1WQVT 2DQHH 1AY1L 4QO1A 3UBXG 3LZFH 1A1NB 3IF1A 4OZHA 5GS2H 3DSFL 2X89A 2XZAH 4FTVD 3KPMB 2ZUXA 3CVHH 1I7UB 1CGUA 3PL6D 1TZIB 5EO0A 2HTKD 1ORSA 4ODUA 3PL6C 5F7NC 3WUZA 3P4NB 1JMXA 2X1QA 3C60A 4P2YA 3GRWL 3TGXA 3ULUL 3GHEH 1U8OB 4X5WB 3ROOA 1KFAL 4K7PH 2KZWA 3UZQA 1WAAA 2R2BA 1TVBA 2IBBA 3I2CH 4DGVH 1I1AA 2HT3D 4CVUA 4MJIE 2F53D 1HILB 4FQQA 1UWEH 4IIQA 5ICZB 1V8HA 4RZCA 4AM0A 5E2TL 1GZQB 1KIPA 3L3KB 2HT3C 1M71B 3ZDZE 2ADIB 1KBGL 1MJJB 1WITA 3SO3B 1H3PL 4JHWL 3EYFA 1GIGH 4BSVA 4CRPA 3L3JA 4N9OB 1CVSC 5DQ9A 3KLDA 2I07A 5EIIA 1A8JH 2GK0A 5FYLH 1WCBA 3BKMH 2NNAA 2EICA 2ZUWA 2VC2L 2ZJSL 1CIDA 1RU9L 3RAJL 1EHLL 1SEQL 2DJSA 4Q97A 5E8PB 1FH5H 3LKPA 4M43L 5D96C 4JFEA 5I1HL 4V2CB 2F19H 1XGRB 1WBZA 5C09D 4J6RL 1ERNA 2X4TA 4KPHH 4R90H 4QRRE 5IKCA 2PXYB 1DQML 4PJHE 4HKXB 4U05A 4M61B 4WY7H 2AK4A 3LS4L 5GSRA 2EIDA 4P59H 2EE9A 3VRLE 3DI3B 4RMVA 3MUJA 1XF5A 1BHGA 5J7CC 2E6QA 4YHIA 5DFWH 3MBED 1NLDL 2NY6D 1ZGLA 3GKWH 2VDPL 5EBWA 5IFAH 1AGCB 1YMMA 3TZVA 3MRRA 3MBEC 2NY6C 3EYUL 1AHWC 3AY4C 3HZMA 5DUMH 3GMQA 3SN6N 3H7BA 3HS0B 1JGUH 1QEWB 2JB5L 5DD3L 1YN7B 3NMEA 4C83A 3DO7B 1XFPA 3PWNB 4IBLT 4ODWB 5F1KC 1L7IH 4YHMH 3S88H 3NAAH 3SDYH 5A2IH 2WSKA 3NVQA 4TSCH 3ARGA 4LLUA 1U8NA 4UILL 3WNKA 1U6AL 4UNUA 4MJIB 2HLFD 3UTTE 1ZLVK 3WS6C 5FAAA 2V5YA 3IXTA 4K3GA 1IQWH 2BNQE 3VD3A 2HLFC 4O58L 1T0MA 3CSPA 3LIZH 3AREB 1AJ7L 3VFSB 1KG0B 5IV2A 4FZ8L 3UO1L 4HIHA 2GJZB 1I4FB 3GUTB 4FRWA 3RWDA 3ESUF 1T1YA 3U82B 3P0VH 1Z9SA 2FRGP 5GRUL 3FQRB 5CZXD 1EFQA 1JWSB 2NYYD 5HGGS 1F3DJ 4HK3J 1Q8MA 1WISA 5CZXC 5DZNA 4R4BB 1U91B 4QRRB 1HHIB 4XP9L 2R2HA 1KJ3L 2GTWA 1RZFH 4XCCL 3K8LA 5F7DB 4HC1H 3P9MA 5EO9A 3B9AA 4OAWB 2J8UE 3QEQA 2OJZH 5C07B 2YRZA 1O7SA 1UXWB 4KMTH 1FVDB 3BKJH 4YPJA 1I9IH 4TUOA 2HN7A 3ILPA 3S9DB 3ARRA 3MOAL 3UYOD 3KLHD 4ZUUB 2CDGB 3VFRB 5GS1A 5D7SL 2AERT 4JPWL 5DXWA 2IPKB 5DA0B 4HCRH 1A7NH 4WFGD 5DT1L 3FFCE 5FYJU 3JWDL 3MNZB 2AV1B 4OD3H 2X7LB 1JJUA 3M17A 1MFCL 3D39E 2KQNA 4HUNB 2ZUQB 4QT5B 1LK3H 4OQTH 3UTTB 5EDXA 3FRUB 3QAZB 5EFIA 1AGBB 2BNQB 2VZ3A 1K85A 5JXAH 3VW3H 3CZFB 2WLYA 4AT6B 1MLCA 1TETL 1OLZA 4OKVA 3SCMB 3PQYD 4ODXA 3OGCB 4JFZL 2D9QB 1HCVA 1YMHA 5C9JA 3M1BB 1DDHA 3ZL4H 4HEPG 4C57C 4LQ1A 5E2WH 2QSCH 1NC2A 1ZANL 4JM2D 4LVNB 4DGIL 4HWZB 4Z7QE 12E8H 1MPAH 4JM2C 3HG1A 2IWGA 4HPOH 1H8SA 2CGRL 5CMAB 4GMSH 3D18A 4NFDA 4PJ5D 3DO3A 3WFZA 2VL5A 1S8DA 1D5XB 5TE4L 4N1EA 4NZRL 1DQTA 4HJJL 1MFDL 1V7NL 2W92A 4YPGA 2BSED 2M26A 5C0EB 2J8UB 4NCDA 4ZFFB 4Z76A 3WMSA 3AS3A 4OZFB 1OQXA 2OR7A 4UB0L 3QEGL 1JGVH 4XBEH 4D8PA 5BXFA 4LDEB 4ORGB 1JE6A 1FV1A 1KPRB 5CSZB 3U4EB 1MJUH 5JDSA 1P2CB 2MFNA 5ANME 3NH7L 2L7JA 4LAQL 2LFGA 5EC1B 1ORQA 1HXMA 1SBSH 5I8KH 3IS1X 1I8KA 1AD9B 1ES0B 3L3DA 4LLMA 5GS0D 4JO4H 4GW4A 1YUHA 3GIVB 4I5BA 3ARSA 2R0LH 2X10A 5GS0C 5EU6B 4P2QE 2JJTA 4P9HC 4XWOD 4JRXD 4NNYB 2RJMA 4Y4KB 3BP4B 3NPZB 1SVCP 4RNRA 4XWOC 3KJ6H 1RUAH 4HFWA 1SMOA 1JYNA 1RJCA 2P5WA 3EGSA 4APQD 3V6OA 3L5IA 1I85A 2NW3B 4Z77A 1M6OA 1I3GL 4FXKA 1JPGB 3LEVH 4APQC 3X11A 1LK2B 1CU4H 3OKNA 5DWUH 3LH2L 1YEGH 4M6OL 4PJEF 2FB4H 5DHVH 3RWGB 4JQVC 3ZKXB 4KTEL 2O5XL 3HE6A 4R8WH 5JIIA 5I75B 2WUCH 3S5LA 1DL7L 4ZUVB 3RWIA 3MLXH 3T4AA 4LRNL 1SY6A 4YDKH 1MUJB 1FNHA 4RGNE 3MRPB 1JTOA 3QIUA 4PY7B 3BE1L 3OXSA 5B38G 3MMEB 5FHBL 2EEBA 4MD5A 5CEZE 3PWLA 2B1HH 1CD1A 4RIRB 1I3RA 3FAXA 1NEZG 5CGYD 2LABA 5LGJB 2VDOH 3V0VA 5LKNA 1OW0C 1HXYB 2CLRB 2UV3A 1BQSA 2XA3A 5CGYC 1A14L 2A9ML 5L6YL 2R23B 1U2HA 1I8MA 1GXEA 3RUGE 2EDQA 4DOHE 3W81A 1RZIB 2BVPB 1PLGH 3GZKA 5I1LB 4XP6H 4Y19E 2ARJA 3GSRA 2DLHA 3BEWB 3BZEB 4XMPL 3FT4B 4GT7A 3LRHA 3VI4E 3C8DA 1QRNA 4E41E 4S1RH 1URLA 4LVHC 4O9HL 5TQ0L 1PW3A 4JO3H 4LSSH 4I4WA 3U0WL 4UTBH 5ADOL 5E08L 4M1GL 3VXMA 4P57A 1M7IA 1H5BC 1G7IA 1ZA3A 4P2QB 3VG9B 3DHJA 1NSNL 4N8VB 2HRPH 3RPIA 2IQ9L 3VXUA 5CLTA 1TMCB 4P46D 3B6SB 5D5MA 1YYMH 1BWWA 4YGVB 4U1GB 2WUBL 4Z7UB 1FLRL 4P46C 1GOHA 1EZVY 1ZA6B 3OHXA 4C59B 4EJ1C 5IB1B 3R0MA 1MSPA 3R8BB 2ZP0T 4WU7B 5IR1B 4P2CG 4HH9B 1MH5B 2R1XA 3FRPG 2FJHB 5JPNB 1CZ8L 3N1FC 3NFPB 3GSXB 1NMCC 1FFPA 1KSRA 4Q0XL 2A6KA 2Z35B 4DEPB 5F44A 4LSPL 4HGMA 4PGCA 3QI9B 3INUH 1SYVA 3VFVB 4Y4HD 1INQA 3GNML 3U7WH 1UYWL 2W07A 4X4ME 2YD5A 4Y4HC 3VD7A 4DTGH 1FVCB 5E8DH 1KPUA 5D9SA 1QBMH 2IAMA 4F7MB 4X7TB 5DHYB 2F53E 4MNGA 2A6IA 3TH3T 3KJ4B 1VACB 2AEQL 2EO1A 3UPRB 3BDXA 4JJHA 5DK0A 3TV3H 3S35H 3VXRB 3OKOB 4GS7B 2YPLD 2ICEA 4OZGA 5MP6H 4DOHB 4OV5A 2DBLH 3QZWG 4Z5RB 4POUB 5DC9B 2IQAB 4Y19B 1OHQA 4E42B 2MPAH 1MVUA 4R3SB 1W0WB 5JA9A 4PY8I 4N0RA 4OCSL 1TZHA 4H8WL 4E41B 2BCKB 5CP3H 3HUJE 3GO1H 1P53A 1X44A 2DI8A 1N6QH 4D9LH 3VFGL 5C09E 4JFDE 4G3YL 3WNOA 2R0WH 3UYPA 4U6YB 1BZ9B 2FNBA 3AVEA 4MAUL 4XC3H 5FO8A 3K80A 3RY5A 2WMPA 4PB0L 1OD9A 3KPRB 3NZHH 3V0AC 2DLFH 3P11H 4W4OC 2Z93B 4FP8L 2NY1C 2HFGL 1PKQE 1G9MH 3CPLA 4FTVB 5F96L 3IRPX 5I0DA 1FG2B 1HYSC 2ZZUT 3G5XA 1LO3L 1L9NA 3VH8G 2YKLH 3PL6B 4UIKL 3L3HB 2X89D 3T2NL 5GRWA 4PJ7F 2BNRD 2BERA 4FXGA 3CMOH 3K8KA 1QSFA 4BH7A 1JNNH 3WIIH 3DV6A 3F58L 3L1OL 4GXUM 4DK6A 4LSTH 5KG9A 1ROWA 4YGAB 2R1WA 5TDNB 3C60D 3MOQA 5E95B 3Q6GH 1P4LB 2VQ1B 3C60C 3QNXA 4LPTA 1RMFL 2MSPA 1G1YA 1I1AD 5D72H 3NPSC 5CJQL 1V3MA 2BOCB 3WLBA 1IGCL 1I1AC 4I77H 4YXKH 4OLVL 4IIQC 3E6FA 1DBAH 3UTPD 3TIDB 3PDDA 5FM5O 1JRHH 2RHEA 5D96B 2FJGB 4EDXB 3PABA 3RIAF 4TTDD 1PX4A 2BDNL 1P4IH 3F7VB 3J7HA 4OM0L 4JKWA 1F4WH 4NO5A 4JFED 2FH8A 5MEND 4P3DB 1SYSA 1UWXH 1CLZH 4RFNC 5K9JL 3NA4A 1G7HA 3SDXB 1PG7W 5HXMA 3VFTB 1PSKH 4B0MM 1WZ1H 3PWVA 4DQOL 3BKCL 3MBEB 2NY6B 1B6UA 4NRYA 5LQBL 3K4DA 1QA9A 1AHWB 4PJGE 2OS7A 3TNNB 4NN6B 3UPCA 1XGQA 3H3PH 1INEL 4MSWA 5D7IF 4KK6D 5L8LB 4ACPA 3ZE0E 5E70A 2QHRH 4POZC 3TPUB 2X4OB 3ZSSA 2VJXA 5GGSB 5ESVB 4Z7NE 4HK0A 5GGSY 1M7DA 1YMMD 1CXLA 1ZVYA 2ENSA 2I9LA 3GI9L 1PZUB 4KJQD 5I1KL 1S7SA 2E9BA 4HH8A 2DQEH 4LMQI 3O2WL 4K9EL 1IRAY 4PB9H 2ITCA 4WFGE 4DN3L 4F58L 4BFIA 1QR1A 4LF3B 1DBJL 5D6DA 1AQDA 4R26H 5KS9E 2QQKH 2ZCLH 2OL3A 4F8TA 3DX6A 3ARGD 5HD8D 4ZFZB 3CFJA 4OF6A 2W65B 4X6CF 2NLJA 4YNYA 3ARGC 2H3NB 1YEDB 1FZJB 1UB6A 2YD2A 3VGDA 3MV9E 4WI8A 1ZT7B 4RRPA 4HPYL 3CD4A 4PRNB 1JUFA 3WUWB 4ELMA 4Y5YA 4M6NH 2YUXA 3GGWA 5JLZB 1CS6A 4LARH 2ED7A 2H26B 4PREB 4HG4J 4UQ3A 2OQJB 5FYKH 2JJUA 2HH0L 4TUJA 1H15B 3HC4L 5IF0B 1KPVB 3CC5B 1NBQA 4PJ5E 1A0QH 4ALAH 3CFDA 3V52H 4PJ7A 2VAJA 1QSEA 5C0JB 1D3CA 2GFBB 1Q94A 4LCYB 3WIHH 1A3RH 3HCVB 1P1ZA 2BOBB 3RFZC 1T83A 2FD6L 2P5EA 2AABL 3TYGL 1UKSA 4PG9B 3QEQD 3R0NA 4D2NA 4AIZA 6FABH 1MCPL 2RFXB 2X70B 1AY1H 1NANH 4N8CL 2X44D 3MA9H 3I50L 4P23A 3H8NA 1U42A 4QHMA 2Z91A 1BVKB 5LGHL 5C0AA 2VITA 1OWRM 5BZWB 4OF5A 3GSUA 1EFXA 4LHQB 1N3NB 5MEOB 1NMBH 3DTXA 2JK5B 3O6FB 5GS1C 4MX7B 4Q6IC 1ONQA 3GRWH 3ULUH 4PJXA 3BGMB 1MREL 5EUOB 5B39B 5I19L 5L9DL 3GEWB 3QPXH 4UOW0 3SGJC 4LLVA 5C6TL 1NFIB 5CSGA 2WANA 5E2TH 3PQYB 1ZWIB 5ALBH 4GQ9L 1KBGH 3UXFA 1EAPA 4N90D 5F6HJ 3RTQA 5IB4B 5CEYA 1HOCA 2H8PA 4JCLA 3RNKB 4NOBA 4HKZB 4JANA 5I8CA 4JM2B 4KQ3H 2DLGA 3GJFH 4NJAH 3BI9X 4HUMB 2WK2A 1CE6B 1NC2D 2NCMA 3TA3C 1QZ1A 2EDJA 1AP2B 3NCYS 4M43H 4JY4A 2N4IA 5EULV 1YEJL 1P6FA 1HH9A 1X7QA 2Y23A 4PJ5B 3HG1D 1NCWL 4R2GD 5E4EB 3QT2A 5ESAB 3JBG7 4J6RH 4OF0A 2J4WH 4FNLH 2BC4B 1XF1A 4R2GC 5FDWB 5HJ3B 3VXPB 4R4FH 1L6XA 5EZOL 3I3BA 1RK0B 3VWJA 3LS4H 4WEBH 3MRJB 2ESVA 4M5YH 1E4XL 4G6FD 4OLWL 2KZ1B 4XPAL 2P8MA 5TE6H 5B3NA 3QG7L 4LGSB 1BEYL 1A21A 4WI6A 3ETBF 3RX7A 4X6CA 4KHXH 4CMMA 4J12A 4NQDA 5DEZA 4WI3A 3C5ZA 5TPWL 5GJTH 4PJAF 3KPSA 5HGBB 5C0FA 1CGSL 3MLVL 4JRXB 5CJXA 5F7FA 3GMPA 1HINH 1QFOA 1J8KA 4S1DD 4APQB 2JJTC 2Y06H 4Q74A 4KTDL 4RGOL 4S1DC 5FYJD 2P5WD 4M8VA 4GO6B 4N68A 3DVNA 3QWQB 5BMFL 1J1PH 2G75A 4GW1B 4R96A 4QGTA 5IVXE 5MEQB 3V6OC 4JZJC 2DQGL 3ARDA 3UO1H 1MHHA 1UCBH 2EDWA 3DETD 4GH7B 4FN0A 4L9DA 3O11B 1EBAA 3HE6D 5IWLA 3JWOC 1QUNA 1FNSH 1YEIL 3DETC 3U4BL 3WS3A 4LSDA 5GRUH 2JF1A 3LN5B 1U58A 1ZVSA 1F58L 1SM3L 5DEGB 4KZDL 4JN1L 2CR3A 1KELL 4F37K 4I48B 1MEXL 4RBPH 4XP9H 4A2MA 4NUGH 4MNQE 4PTTA 5D2NA 3FO1A 4CVXB 1KJ3H 4GAYB 4X6DF 4M9PA 4LU5L 4OIIL 5GGUB 3ECBA 4IOIA 4UMGA 3OB0H 4LLDA 2D7NA 3FCTB 3LD8C 2BVQB 5K59F 3F7YA 3EDEA 2J1KA 1D6VL 1YNKH 4HHAB 4NZTL 5E6ZA 5IB5A 3MOAH 1QRND 3K0WA 5JQ6L 4EI5A 5D7SH 3HKFA 3MRGB 1OAKH 4U6VL 2R29L 4P46B 2XNAA 3VXMD 5DT1H 2EH7H 4HBQA 2FZ3A 3VXUD 5KW9H 4M3JA 3JWDH 4NBYB 2BMKA 1BMGA 3WCYA 1NMCB 1LE5B 3I6KA 3VXTB 4AEFA 1S78D 4GBXB 4CAGA 5T5NG 4B53A 3QDJE 1GC1L 2XXCB 4OZHE 4UT9H 3O81A 4Z95H 5DMJB 2EYTA 5ICXA 1S78C 5BV7H 5IHUL 1TETH 2BNRE 3DX8A 3TIEA 5IVXB 5L2KE 5J9PB 4Y4HB 3EYOB 5GGTH 3GMLB 3EOAA 4RWYL 3IDIA 4P5MB 5C7XH 4JFXB 4KK5D 3BH8A 4ZTOH 3JXAA 4CNIA 4ZUWA 1G7JB 5ISZA 4DGIH 3GKZA 5ID0A 4OT1H 2YD6A 4RDQF 4KK5C 2VZTA 2E3VA 1BFOB 2IAMD 2FJFB 3TPKA 5IB2B 5DD1L 2VAAA 1QQDA 4PJIE 5D2LF 3NTCL 4HIEA 2IAMC 5T3ZL 1AIFB 2BSSB 3H6JA 5HYJA 3RVTD 4NZRH 2YPLB 5EU7E 3MV7A 3OKKB 1S7RA 4XBPB 4DZBA 1NDMA 1S7WB 1LEKB 1ADQA 1FFOA 1EVTC 2H6PA 3RVTC 2EKSA 3JV4B 5MERB 4Z7WF 3O4LA 4F57L 3G6JA 1BFVL 3FB8B 4UB0H 4PJDA 1C7SA 2F74B 4JFYB 1LO5B 2OBGA 1T4KA 4LP5A 5GHWL 4PBVC 1YY9D 4X9FA 1CVRA 3CFBA 2W0PA 4LAQH 2C7UA 1F4YL 3VMPA 3TO2A 1OP5K 2CUMA 5MENE 1YY9C 4Z18A 3TFKD 2VLJB 5E7BA 1MIEH 3T77A 2R69H 5AUMB 4CBPA 3TFKC 5M94B 5J1AB 1VCAA 1FNEB 3U9UB 4OB5H 2F58L 4XB7A 3QBTB 4HAFA 4PPTA 5DR5L 1S7XA 4OLZL 2G2RA 2ICWJ 1CLYL 4OF3A 2E9JA 3IF1B 3AXLA 4OZHB 4Y1AA 1BM3L 1CIUA 4MQTB 1OTUD 3OGOE 1NCAL 1I3GH 2XKSA 1YMME 2BVEA 1BQUA 5EO0B 1OTUC 3LH2H 1ORSB 4ODUB 1G9NL 2B20A 2EXWD 1QSFD 4KTEH 1KTLA 5C0BA 1MIMH 2EXWC 3C60B 1GOFA 1FNFA 3ROOB 1X5LA 2YRPA 3NPSB 2YN5A 4YC2C 2OK0H 2R2BB 1TVBB 1I1AB 2LTQC 4YDLC 4IIQB 4JQXA 1AQKL 4RZCB 4TVPE 4NWTL 4AM0B 4F7TB 4X6FA 1CG9A 1KIPB 3B9KD 5EBMA 2IBZX 4BELD 3EYFB 3QNYA 2OX5A 4NQCA 4BSVB 3L3JB 3WNPA 5L6YH 1OPGL 3B9KC 5DQ9B 4FQIL 4JFOA 2PYEA 2YXFA 2I07B 5J0BA 5EIIB 4J3XA 2GK0B 1WCBB 2NNAB 1R5IA 2GHWB 3NCEB 1E6OH 5B4MD 1FCGA 5L8KB 4XMPH 1RUQL 4NN5C 3LKPB 3L3OA 4RFNB 5DDHA 1UEYA 5B4MC 2VIRA 4JFEB 5MENB 3S98A 1WBZB 5CKAA 4XNUH 3IFNH 1S5HA 2XWJA 2X4TB 3VXOA 4JG0L 3PE9A 3EOBB 5IKCB 1K9TA 3VXSA 1J18A 2AK4B 5DK3A 1UKTA 5GSRB 4XP4L 3VGAC 4JN2A 2OJEA 4LFHG 3LN4A 2DQJL 1H0DA 1XF5B 3CU7A 4ZOCA 5LWYH 2VUOA 4GRWE 4YHIB 5IW6A 3BJLA 2V2WA 1ZGLB 2F54A 5EBWB 3BAEH 1YMMB 3TZVB 3IFOA 3MRRB 4NT6A 4Q0XH 3HZMB 1G9EA 4U2ZA 4XCFH 5C2BL 3GMQB 4LSPH 5IMLA 3H7BB 1HHJA 1BFTA 4OFKA 3BRGC 4G6MH 3O8XC 3GNMH 2YD9A 3V4PL 5JW5A 4C83B 4Z7WA 1Q0YL 4NGHL 2F5BL 2C26A 3ARGB 3PP3H 4LLUB 1U8NB 2VDLL 5F21B 1CL7I 3HN3A 5F88A 5IUSA 5D6DC 2ZCKH 3ARPA 3IXTB 4M4PA 4WCYL 4JY6A 1XCQA 2AEQH 2WIIA 4DKEL 4M5ZL 4N90E 1UCTA 4QOKE 1A7PL 1T0MB 5DYOA 1ACYL 2W0FB 4A6YA 2NZ9C 4UINH 2YA1A 4GUPA 4HIHB 3MJ9L 5IM7A 3WFCH 3RWDB 1KCRL 2VLKD 1T1YB 4HUXA 4ONGL 1S5IL 2W1NA 5DLML 43CAA 2DM2A 4LCWA 3F62A 4Y5YC 2XRAH 1OCWH 3HG1E 4S2SA 5IB3B 5KAQG 1KYOJ 5C0ND 4G3YH 1J12A 4K3HA 3B5HA 2GTWB 1QSED 1A1MA 3SE9L 3P9WB 5C0NC 1A6AA 1TJGH 1JWMA 4PB0H 4Y2DA 3P9MB 2AQ3A 2R4SL 1LO4L 3D1MC 4YX2L 3QEQB 3DRTA 5EG6C 4EUPA 3V5DA 4XCYA 3BPLC 3FB7A 4M7KH 1T83C 4TUOB 3QRGL 2HN7B 5FM4A 3ILPB 1N6UA 2C1OB 4U1HA 3KXFA 5GGVY 3UDWA 5GS1B 3JTSA 1NDGA 5F1OB 5I1JL 3F58H 1EX0A 1N0XL 5FCUL 2OR9L 4NO0D 1IVLA 4FQXA 2VERN 32C2A 2AKRA 3IS0X 2W0LA 3M17B 5DUPL 4MJ6A 1KTKE 5C0DA 1RMFH 3CU1A 5FYJE 2P5WE 1F4AA 3V6OE 4MD4A 1JZ3A 4EXPX 2UWEA 1MLCB 1GGTA 4OKVB 2RB8A 2IFFH 4ODXB 3IDGA 3SKMA 1JI1A 3RTQD 3WNMA 1YMHB 4NFCA 2AGJH 1DEEA 2EDXA 3ARQA 1DDHB 5C9JB 4JO2L 5IGXL 3TYFA 5BOZG 1JNHA 3RTQC 5D8JH 1NC2B 2VDRH 3D3VE 5BVPH 4YHNA 4QXGL 5T5FH 3HG1B 3L5XL 3BSZH 4R2GB 1E27A 3GSQA 2WP3T 3D18B 5J1TC 2G5BA 2JCCF 2VL5B 5C0IA 1S8DB 1T0NA 3RL1A 3WXVL 4YPGB 3N0PB 5DMKA 5I18L 3RP1A 4IRZL 1S3KH 4G6FB 4M6MH 4Z76B 4G7YH 5L0QC 3VWJD 2ESVD 4GAFB 5BXFB 3TBYA 1FV1B 3VWJC 1DVFA 4FABH 1INEH 1QLRA 1YEEL 3EZ8A 5JDSB 1JF6A 1G7MA 1ORQB 1QRNE 1HXMB 1JF1A 5GRJL 1I8KB 3L3DB 4GW4B 1YUHB 4I5BB 4PFEA 1TZGH 4FZEH 4NQDD 1A6PA 1CFQA 3C5ZD 3MFGB 3VXME 1JHKH 4GKZA 3S37L 4DN3H 3KPSD 5JR1L 2P47B 3C5ZC 4DFHA 3D25B 5D5ME 3C5JA 3ZKND 4ZNCD 3Q1SH 4ZS6D 1T20A 4YZFF 4RNRB 4KK9D 3ZKNC 1MHPL 4HFWB 5HYQA 4X6EA 1TITA 1MELA 4ZS6C 2P5WB 4DW2H 1MI5A 3EGSB 5E2JA 3VD9A 4KK9C 4JZJB 4Z77B 1F42A 1M6OB 1IEAA 4FXKB 5ERWA 5FUOH 3X11B 1FDLL 2GT9A 4PJFE 2IH3A 3U7YH 3OKNB 4HPYH 2M8XA 1MRFH 4MD0A 1N59A 4PJ8A 3NGBC 3HE6B 3ALXA 3S5LB 2BXZA 3WJJA 3BOVA 3RWIB 3T4AB 1T89A 5D7KE 1N64L 2DL2A 3CLEH 1NAMA 1PEZA 4S0TD 2HH0H 3HC4H 3OXSB 4MD5B 5IWLC 1BGXL 3PWLB 2BHZA 4JFHD 1CD1B 3HMXA 1I3RB 3RKDD 1O5DT 1GSMA 5FHAL 3V0VB 5I16A 1I8LC 2JB6B 3RKDC 3LD8B 4TVSa 4OZGE 5KJRL 1OP3K 2QEJA 5D2NC 3MXWL 1ND0A 2ARJB 3GSRB 4M93B 1NGWA 3MBXL 1PX3A 4UT6L 2AK1H 2GIYA 3SE4A 2EIZA 5CEZL 1L6ZA 4LRIA 1QRNB 4QRTA 4U0QB 5LGHH 1OTTD 1YNTA 1U3HA 1BOYA 3RVVD 4EI5D 3VXMB 4P57B 1M7IB 1ZA3B 1G7IB 2UYLA 4N5UA 1OTTC 3RPIB 3B5GA 3VXUB 1KOAA 3RVVC 4EI5C 4LLQA 5D5MB 2J6EH 3ILQD 1EGJL 1NH6A 4PP1D 1OD7A 1DQDL 2HFTA 3ARFA 4IDJL 3ILQC 3OHXB 3TH4T 5I30H 2VDNH 5IMKA 3RI5K 1YEFL 2R1XB 2Z92A 4Z7VA 2X41A 2W9EL 3LB6D 3E8UL 2HP4A 1FFPB 3NZ8A 5AAWA 1X5KA 3QFJA 4GQ9H 3FO2A 4WUKL 5F7LB 1IL1A 4PGCB 2JCCA 3MRDA 4O2EA 3LB6C 1A9BA 1SYVB 2C3HA 1QSFE 4OLYL 1INQB 4GW5A 5EOCJ 5I9QC 1IEHA 1JYVA 2M1KA 4CMHC 2ED9A 3DLQR 2FEDD 4MCZA 4X6BA 2ZCHH 1QVOA 1KPUB 4YJZL 2IAMB 5EWIL 5ISZD 1S7TA 2FEDC 3GDBA 4JHZA 1YEJH 2OZ4A 4MNGB 2A6IB 1NCWH 4B7LA 2VRAA 3UX9B 4QRPA 1MCCA 2A0LC 3U1SH 2DKMA 5HYJD 5DK0B 1K4DA 2A1WH 4YXHH 2DQDL 2ICEB 3QPQD 4OZGB 3MV7D 4XNQA 2X4PA 2AJSL 5GRYA 3CVHA 2K9UA 3QPQC 4G8IA 5HSFA 1MVUB 3O4LD 4OLWH 1ZLUH 4JPKL 2ZOLA 4AQ1B 3DURA 5JIKA 1TZHB 1E6JH 1MCOH 4OM1L 4LEXH 1T7VA 2CIKA 2YPKA 3DHMA 4S10A 1YJDC 5JW4R 1W8NA 5FO8B 4MA3A 1KTRL 4HFUL 3MLVH 3NABL 1U8LA 2JJSC 3ULVD 5AYUL 5I8OL 2FO1A 3BXNA 2PO6A 4JZOA 1NGQH 3ULVC 5JDJA 1K2DA 3CPLB 3KPTA 3EFDL 3I6GA 4GSDL 4RMUA 3G5XB 3EUUA 1NCNA 4YDIL 2DYPA 4Y1AD 3WO4C 3S8WA 1F11A 4FXGB 1QSFB 4LGRB 4BH7B 5HYEA 3DV6B 1Q0XH 1YPZA 4HS8H 4D9QD 1JVKA 2A38A 1YN6A 2D7PA 2FCBA 2CPCA 2LTQB 5C0BD 4YDLB 2D7TL 2R1WB 2WINA 2PYFA 1W8OA 4AL8L 4XP5L 5JHDA 4I9WD 3QNXB 4KZDH 4FQCL 5JW4Q 4JN1H 2YD8A 5BS0E 3DOSA 1MEXH 3WLBB 5K9QI 2YMXL 3W82A 3Q5TA 3E6FB 4JQXC 4M1CD 1RY7B 5LBSL 5J57B 3E3QE 4LU5H 4NQCD 4M7LH 3OKDA 4NN5B 1JYXA 3GM8A 2PYED 4ELME 2VLKE 4M3KB 1OOAA 4M1CC 5J06A 2EDNA 3PABB 3WUWG 3O0RH 1OAZL 3W0WA 3SKJL 3UCRA 1B0WA 4TTGA 1D6VH 4NO5B 1RK1A 4KQ4L 1KEMH 1LEIB 5E0QA 2ZUUA 1RVFH 2W60A 1SYSB 3K4ZA 1ED3A 2IMNA 3VGAB 4U6VH 4OI9A 1NCTA 1QSEE 2R29H 1G7HB 5CUSL 3VXSD 4AEEA 1ZV5A 4C4KO 3X3GL 3FB6A 1MAML 3PWVB 1Y6NR 1CFVH 1LO0L 4NRYB 4G8GA 4JKLA 1QA9B 5C6WH 1XGQB 4MSWB 3ARYA 1B4JL 2F54D 1YDPA 1M7DB 1QLFA 3QO0A 4PJCF 2I9LB 2ORBL 2FLRT 4WFFE 2VZ1A 4HS3B 1S7SB 2IH1A 1MLBA 2ICES 2ITCB 1LEGA 4OIBA 2HT2D 2B0SH 3QJHA 3F6IA 4BFIB 1QR1B 3HC3L 4ZUSB 2HT2C 2B1AH 1AC0A 4L9LA 3DX6B 3T0XA 1RSFA 3CFJB 5CINL 2D9CA 4YNYB 5T3ZH 3VRJA 1UB6B 1I9EA 2DJ4A 5ALCL 1AXTL 4WFHD 5EOTB 4JAMA 3HLAA 1JUFB 4JPVL 1FQ9C 5TH2A 4ELMB 4Y5YB 4RA3A 4F57H 1BFVH 3GGWB 4JRWA 3QQ4A 1N2RA 5ITFA 2KUTA 1MFEL 4QRUB 4UQ3B 5F89A 5IBUB 4TUJB 5HI5D 5HHOA 1QR4A 4LCWD 4D3CL 1DBBL 1A2YA 1JPST 1KACB 1HYRC 1J0KA 5HI5C 3CFDB 4WFEE 3BX7C 3FQUA 1WGOA 3BT2L 4PJ7B 3EDDA 1QSEB 3T3PE 4U1LA 5FDYA 3O2DA 3GHBH 3BPLB 1P1ZB 4PJ9A 3B9DA 2V7HA 3RX5A 3BJ91 4Y2DD 2ESVE 4LEOA 1CT8A 3MLYL 4AIZB 5DD6A 4KDVA 4BSJA 1G84A 1YQ2A 2X4NA 4Y2DC 1KB9K 4U33A 1DLHA 4GXVL 4WV1A 5DD5H 1JZ7A 4P23B 4YWGL 4QHMB 1T22A 2Z91B 2GKIA 2E7MA 2VITB 5DQJA 4UQ2A 3SDDA 5JW4M 3KXFD 2VYRE 3GSUB 3REWA 4ONFH 1JNJA 1EFXB 1V3KA 3KPSE 3NN8A 4LPCA 1D5MA 3UDWC 1FCCA 3DTXB 1JF5A 2FSEA 1ONQB 5ESQA 3DMMA 3CH8A 4PJXB 4XVSH 3IU3A 4DCQB 4LMQE 1B90A 3KLSA 2HG5A 4HT1L 4YHLL 2FX8L 4W68A 4LLVB 5GS0L 4P2OA 2EDEA 5E2UL 5K93A 4LSRL 3F7RA 4P9HL 4WUUE 1EAPB 3RTQB 3QQ9D 4WI9A 5CEYB 1HOCB 2H8PB 1CXEA 3AM8C 2OSLA 1B3JA 4YQXL 5AWNH 4JANB 5I8CB 1Z0MA 3QQ9C 3ZE2F 4P5TD 5FGBC 5BCAA 3U0TA 1CQKA 2XZQL 1F00I 1CLOH 3MUHL 5HDBE 5C2UB 3R4DA 2BK8A 1RUQH 4P5TC 4PJBF 4JY4B 1UB5A 3HHRB 3S4SG 4C56A 1HH9B 1X7QB 1XGUA 2XFXA 4JFHE 3WE6A 1IAIM 4NSKA 1KN2H 3L5WA 5E03A 4RAUA 3VI3F 5L0QB 5ACMA 5D2NE 4WI4A 4WHCA 3GBMH 5HHPB 3VWJB 4F3FB 2ESVB 3NIDF 4LVOC 4L4VA 3SQOH 2DQJH 2EC9U 3MLZH 4NQVA 2P8MB 4OF7A 3N1PC 2AJYL 1EEUA 1AD0A 5IJKC 1RUKH 1DVFD 3BP7A 3PGFL 4ZFOA 4O51A 1DEDA 1FZOA 1JI2A 1QLEL 1QRKA 4X6CB 5DJ2A 1ZTXL 4CMMB 1DVFC 4NQDB 1NFDA 5CFHA 3C5ZB 4OZIE 1MCLA 3KPSB 5C0FB 2FLBT 1Q0YH 1INDL 1C5BL 4O02L 3GMPB 3PV6A 1A3QA 2F5BH 4OCYH 4OCXL 3OX8A 2VSCA 1DBMH 3ARBC 1UH2A 1KIRA 4KJYA 3QH3A 3DX9B 4L1HA 4XWGH 1MI5D 1QHOA 3NGBB 3DVNB 4DKEH 4M5ZH 2G75B 1F2XK 4R96B 4XNZC 1ACYH 1UZ8A 1ITBB 3ARDB 4LK4A 1MHHB 5A1AA 4YAQA 1KCRH 3G04A 1ZKAA 5CJ8A 1DQLL 4ONGH 1S5IH 3U79A 3DJ9A 2PETA 4UOW1 1U58B 1UVQA 1ZVSB 1VFBA 3WJJC 1ZHKA 3VXQB 4K8RC 2ZPKL 1T89C 5DC0A 4G6AD 1U8HA 1OM3L 3T08A 2GCYA 5FXCH 3FB5A 3O3EA 5HYJE 4PTTB 1WTGT 5D2NB 3FO1B 4G6AC 2D4FA 3PWPA 3SE9H 4Q9BA 3UC0L 4KGLA 1B0GA 1EEQA 3TBTA 3HFML 3ECBB 4IOIB 2R4SH 1LO4H 4HMCA 5GQBA 4YX2H 3QCVH 4LLDB 4Z9KB 1NCBL 3G6JE 5DMIL 4PJDE 1GGUA 4OKDA 4XPTH 1J05A 4PGDA 3F7YB 4KK8D 1F3RB 3QRGH 3WNNA 1UEMA 2AI0H 5IB5B 4JHBA 1U92A 4KK8C 4TRPL 4HIJA 3SE4C 4EI5B 3ROLA 4LRIC 4V2BA 4JPIA 5I1JH 4MS8D 5F6IC 2CSPA 3C87A 4PV9A 3EZJB 1ZVHA 4FFWD 2XNAB 5FCUH 5KSUA 5B3JE 3N9GL 1HHGA 3QIWC 2BY2A 3ULVE 4MS8C 2FZ3B 3HI6L 1BJ8A 2BMKB 3I6KB 2HKFL 4L8BA 1XIWA 5T1DL 4PJBA 4MQ7A 4PTUA 1RZGA 4UT7L 1JTPA 2EYTB 5I9QB 5ICXB 3MLUH 3DX8B 1IT9H 3TIEB 4BSWA 4M7ZB 4BFEA 3WSQH 4OLUL 4CMHB 4Z6AT 1WIOA 5LCVH 1T2QL 1RD6A 1S9KC 1KXTB 4D9QE 1A1NA 3IDIB 2YK1H 4LOUD 3BH8B 5TE7L 1WIUA 2XPGA 5CZKA