3OKMB

Crystal structure of unliganded s25-39
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
222
structure length
215
Chain Sequence
EVKLVESGGGLVQPGGSLRLACATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQSSLYLQMNTLRAEDSATYYCARDHDGYYERFAYWGQGTLVTVSAAATTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSTGVHTFPAVLSSDLYTLTSSVTVPSKTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-39 Fab (IgG1k) light chain
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
molecule tags Immune system
total genus 43
structure length 215
sequence length 222
ec nomenclature
pdb deposition date 2010-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okmB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okmB01
2WBJB 2P8LB 5CBEA 3GBLA 4QNPE 3EYOA 1AC0A 2YPLD 3BN9C 1WLHA 3QG7H 5LG1A 3O0RL 1GOHA 5ISZD 4XP6L 5JPMB 5F1NB 3A0OA 3QJFA 3CFJA 3FONA 1UYWL 4NKIH 3U7WH 3SGDI 4MA1C 2FH8A 3DRQB 4PG2C 1F8TL 2EH8L 4HJJH 2J5LC 1UQSA 2VRAA 1MHCB 3AC0A 4G6KH 4NRZA 4WV1B 1YC8A 5GS0C 4X8XA 3UP1A 4GAGL 2HH0L 3QRFM 2QQNL 4LLMA 1UWGL 2MCPL 5FA4A 2VZVA 5IFJA 3KYOB 4ZS7L 3W9DB 1KN2L 2XKNB 3BGAA 3QH3A 1NDMB 3NVQA 4FQCH 4X6EA 4PB9L 5HHMB 2IEPA 4R8WL 3W39A 1I7TA 2VIRA 4OI9A 3HLAA 1OCWL 5D2NC 1XFPA 1UB5A 4DWHA 2N7BA 2RFXA 2VDRH 4NZUL 1F97A 4CUCA 4WO4B 4FQQB 5EU7C 3O2DL 2JCCE 4OM1L 2Z92A 2X42A 4Y4FA 2W38A 3JUYA 1GOFA 5E8DH 3CFBA 5HGDA 4KTDH 3OXSB 3TVMC 1AGFA 3D3VD 5HHOE 4XCYB 5EZLB 4S0TD 1FYTD 5CP7B 4FFVD 4ERSL 1N4XH 3WIFB 3FFCD 1U2HA 1NL0L 5E9DD 4KZEH 1GZPB 2BRQA 1G9NH 1PD6A 2PF6A 4TNVK 3FOMB 1DN2A 3T0DA 3VG0H 3KPSD 2KBGA 4ODXB 3PWNA 4Z18A 5MEQA 4YK4B 4H1LB 4KHXL 2W65B 3OV6A 4HLZG 1VFUA 1QRNA 5ADOL 4JFDA 3Q6GH 4NN6C 2Q8AL 1V5JA 5MI0B 1CE1H 3SOBL 1DJSA 2XNAB 4LSSL 4DOHB 1HZHL 3UBXG 2XQYK 2UVFA 3A6BL 1IGJA 1FC2D 5DRNB 3U79A 4Y5XB 1YECL 4Y1AA 2E9BA 4P3DB 3CFKB 4ODVL 4P4RB 3N1FC 4MJ6B 2PYEB 2MJWA 3RVVD 2J6EA 2DBJA 4UMGA 4M6ML 5GGUA 2DL2A 2Y7QB 4P23A 4KTEL 4IOSD 4JY4B 5JW4M 2Q76A 4KKBD 4JM2F 1CIDA 4MXVF 3RWHB 4P2RB 3IDMA 5DWUH 1G7MA 3KYNA 4RDQG 5TFSL 1FZKA 1OGAB 1JRHL 4N0CD 2HKHL 3MNVA 3EFDL 3TZVD 4OLEA 5C9JB 3MRCA 3EIFA 5IESL 5C70A 4OLYL 4DCQA 3QWRD 1EUUA 4W6XB 3DI2B 2Z31A 5HYJD 2KZ1B 3NFPB 1E0OB 4UBDC 1A1NB 3AREC 3TA3C 1FVCA 4MJ2A 1JUFA 1EXUB 3BPNB 2W0PA 4FP8H 5HHNA 4OLWL 4KXZH 1KYOJ 1CD9B 4PP2A 2YMXH 1CLOH 1RHHB 3RI5F 2AJ3B 4NQCA 4UNUA 4CMMB 2FECI 2Q6WA 1MPAL 3OKNB 5FGCE 2HT3C 4I3RH 4JRYA 3GMRB 3JV5A 2HT2D 1YEKL 3S3PA 2XPGB 3V4VL 1Q0XH 1BQUA 1AIFB 5KOVC 4HS6A 2X1QA 3GSQB 4FQXC 5C07B 5DJDA 2Q7YB 1D9KB 3TFKC 4L9DA 5HDLA 1TVBB 3JV6A 1EEZA 2FO4A 2OLDA 4KY1L 4BQ6A 4M93B 4X0KB 4YDKL 5C71A 1P7HL 5HYSA 5B38G 4U6VL 3CXDH 5D72L 5D1ZD 4NO3B 2DDQL 3PG2A 3L6FB 1VGKB 4ZFZA 5DJZA 1JGUH 5EOQH 5IT2L 1X5XA 5ANMA 3QJFB 3CFJB 3DV4B 3EDKA 3ARDA 3I3DA 3IT8D 3BKJL 5DSCB 1RIHL 3PP3H 5BS0E 3MRDA 1PGRB 2J8UE 1HKLL 1UQSB 3H9SD 2Y06H 5MERA 4C4KO 5L2JA 1WFOA 4WVRA 1UXSB 5T3XD 1IAOA 2CO6B 1FO0A 4L4VB 4KPHH 5IOPB 2GITA 2V7HB 4LLMB 5FA4B 2X6MA 3NAAH 2FGZA 4LHUA 5C0ND 4FQ1L 3D0VA 4TSBL 1OP3K 2A6KB 4RQQA 3GMOA 2Q3AA 2XI9A 3IFOA 3AB0B 1MIML 2IWGA 2H1PH 5FGBA 1NKOA 2H2PD 1GVIA 1I7TB 2VIRB 4LARH 4QHUB 3HLAB 3LKNA 1DVFD 3HAEG 1BF8A 1DL7L 1S5HA 4HS8L 3LS4L 2RFXB 4XVUD 2QHLA 1I85A 5KSAC 2MCG1 4NC0B 2E7MA 2DTSA 2ICEB 3V95A 3ZKXB 4E41D 4PR5A 5D7IF 1CBVL 4FTVA 1NCTA 4WWID 2KUTA 3CFBB 2CDEA 3TO2A 1BEYL 1R0AH 1N8ZA 1G6RB 3DV6A 1G9EA 3HI6L 3R06A 5T5FL 1DQQA 1AGFB 1A4KB 2J88L 4OF0A 3IAGC 4QXTA 1JNNL 4DUWA 4PJGE 3BP5A 2QQKH 3QDMD 2DQCL 1HHGA 4DQOH 2HN7A 2R2HB 1RUML 2YPLA 3SY0B 2BNRE 3LH2H 3GKWL 1AXIB 1LO0H 2DLGA 2DQIL 5ISZA 2RHEA 5DD6A 3MROA 3CDFA 5H2BA 4FRWA 3K3QA 1U58A 4JDZA 3O4LE 4S1QH 1TJGH 1H5BA 2YPKB 2G75A 1CGSH 4O2EB 4IMKA 2VDLL 2EDYA 1CD1A 1QFOA 3OKYA 1G6RL 1JNLH 3IDYB 4M6OH 4ENED 4ZOBA 1QRNB 2KQMA 1VFOA 3AS3A 4IRZH 4PRDA 1NCDL 5HHVL 3MXVL 1MCRA 1T5WA 4PB0H 1DEEA 5FO7A 4JFPA 3VI3E 3VA6A 3ZE2E 4P49A 1MCEA 35C8L 1SYVA 4M7KH 3VD9A 1HSBB 3DURB 4ZTOL 1IGCH 4YUEL 1NBQA 5IB5A 1MAKA 3QI9B 2R0KL 1DQMH 3TBTA 3MV8B 3V5HA 2OK0L 3GSWB 5FIEA 1NCCL 1TCMA 4JG0H 5GHWH 1G1YA 3CK0L 4XC3H 4OUUB 1KFAH 4GQPH 1XEDA 4LCCC 5L9DL 4MQSB 1MFCL 3MUGB 1T6VN 3MUHL 5M94B 5JOFA 2DJ4A 1EEYB 1GHFL 2Q76B 3D3VA 1XCTA 2NY1D 2VLRE 4QY8B 4U31A 1FYTA 3VGFA 5JPNB 4GRLC 1YN6B 5FUCC 1MRFH 4KUCF 1ZLUH 1VPOH 3FFCA 4HUKB 3DOSA 1FZKB 2MSPA 4JFOB 5E9DA 4F33B 3RWDA 4HF5L 4MAYB 4POZD 1VEPA 2ESVE 8CGTA 1K5NA 3JTTB 3VD5A 3GJFA 3KPSA 2VKXA 1ND0A 3C8KA 4F57L 2HFFB 4TVPE 2Z31B 3H6JA 3PHSA 5DO2C 2FHBA 4LPYA 1C5CH 4NQEB 2XTJB 4ELKA 4HIXL 5I1EL 5H37G 3D18B 1XH3A 2JCCF 1E4KC 4KUCD 3TF7C 1D6EB 4AEHL 4JDTL 1BPVA 1VADA 4MA7L 3QO0B 4KXZI 1CFVL 4JJ5A 3TNMA 4BFEA 2X4QA 3G9VA 3NGBC 3F7YB 4KMTH 4UT7H 2IAMB 3ARDC 3WIHA 4JRYB 3L3KA 5I0DA 2V2TA 4ODTL 4LCYA 1FAIL 2FJGB 1JPFA 5F8RC 5HPMB 4XBGA 2PO6C 4JGJA 4NPYB 5JIIA 5JTWA 5DJDB 2DWDB 2CRZA 1KTKE 5HHOD 1RZIB 2V5RA 3TESA 1EEZB 4I3GA 4YLQT 4FABH 2H26A 4GQ9H 4EQ2A 4PJXB 3DUUB 1TQCB 1QSZA 2E8ZA 4MAUL 5B3JE 4RAVB 2O93L 1OAQH 3VWJB 3VFSB 4HIEA 1ADQA 4Y16A 5L88H 4JKMA 4K3GA 4H20L 5GJSL 3EW3B 4HKXA 5GGQL 3CCHA 4UAOC 3TZVA 3BSZL 2XG5A 3PWPD 3MRDB 1QA9A 4JM2A 3DI3B 3HZYA 2IJ0C 5HYJA 3IYLW 3MJ9A 5ENWA 4LLAA 4WU5B 5MERB 2XA8H 4ZUSB 3C6LD 5ECJE 2APVA 5CZXC 6FABH 3DVNB 1C5BL 1B2WH 3MRBA 4MA8L 4MNGE 3NCMA 1FN4A 3DO7B 4CVXA 3PGFH 3NCJH 1BZ7B 2J4WL 4LHUB 3GMOB 3V7AG 4WI6A 3ZTJG 4JHAH 1CLYH 4HJ0C 2NY0D 1S5HB 2CLZA 4OZIE 3GB7B 3QR2A 4QRUB 5CSGA 5J1AB 4PJ5E 4OCNC 4MDIA 2OL3H 4DKDC 3U4BL 1DQQB 4QXTB 3BP5B 4XMPL 1HHGB 2WANA 2XZQH 2F74A 2HN7B 4LSQH 1H15B 4S1SL 2IFFL 4PRBA 1PQZB 1CLZL 3QHZH 2JKXA 1U8QA 4G80A 5CP3H 1JGDA 3EYSL 4H5SB 4UB0H 4TUJA 3RWFA 2FX9L 3ZHLA 1H5BB 1KLUA 4J3SA 2W60A 5CJ8A 1VHPA 5FKPA 3OKMA 4HK0B 1RJYA 3H9SA 1NAKH 5IKCA 3OJ2C 4Y5VC 1A7OL 1TETH 4ONFH 4RFEB 4YGVA 4JFPB 4HZLA 4PGDA 3UBXI 3PDGA 2JIXB 2QBWA 1SYVB 3S8WA 1KB9K 3ZO0A 3TH2T 4P5MA 3GHEL 2FX8H 4FFVC 4YHPA 4E0RB 3P9LB 1F58L 2ARWA 2OTUB 5IB5B 2EO9A 2V5MA 1MCKA 1UA6L 4IOIB 3GM8A 5JORB 1QO3A 4KRLB 1DVFA 3V5HB 4D9QE 2XFXA 3SKNB 1I1AB 4XP4L 2PW1A 2BZDA 2NX5B 3LEXB 1KTDB 3ET9F 3S98A 1QSFD 3C2SA 2C5DC 1NEZB 3PWLA 5DS8A 3MCLH 1KB5H 1HIML 1C12B 1WBXB 3SE4A 3UTSE 5C08B 3WDIA 1FL6A 5JOFB 2V17L 1CK0H 2J8UF 4YHYB 1A6VH 2YEZA 4K9EH 1XGTA 1I1FA 2B1HL 4NCDA 3QDMA 4XBPA 5F89B 3BE1H 3QCVH 3LZFH 3MJ8A 5E9DB 4KKLD 3CSYA 1BZ9B 5D7IA 5J13B 1K5NB 2F5AL 5BO1L 5FAAA 5BS0D 4XH2A 1CXHA 4J6RH 3RZWA 1ND0B 3RVVC 5DEZA 3C8KB 2Y07L 4JRXE 1EGJL 1YNKH 5HY9A 2ATKB 4OTXL 4XVJL 5EORL 3RY6C 2I5YH 2Q8BL 4Z8FH 1M6OA 4IDJH 4KKBC 4OSUL 4AENB 4G8IB 4XC1H 5J9PB 1AKJB 1WBZA 4ETQB 5C2BL 4LQFL 4JJ5B 3ESVF 1LE9A 5D93B 4MJ4A 4K8RC 3TNMB 3OAZK 3TBVB 4YX2L 2AQ1A 1S7TA 3G6DL 4HXBL 4BFIA 5I17A 2XYCA 2IPTL 4OCMC 4D9LL 4GXUN 2YUWA 4LCYB 1ZLSH 4Z7QE 4EIGB 1HK6A 3T0BA 1FDLL 4QHNB 3V6FA 2BMKA 5TF1L 1R3HA 3FRPA 4FQJH 4B0MM 4JPWH 1U36A 4G6MH 3UYOD 3NPZB 5EULV 1WAAE 3ILPA 2H26B 3VI3F 2F8XC 4M4RA 4CJ0A 4FQHA 4PJDB 3ZE2F 3QUKB 1JZ3A 5A2FA 3PUCA 4NWUL 4Y16B 1B88A 4GW4B 5JXED 4UDTA 4ESKA 4QHMA 3HPLA 3O4LD 2HT2C 2LFGA 3HPJA 3ARGA 3PE9A 3VD3A 3JVGA 4OLZL 4ZODA 5INDB 5E2VL 4C56B 1QA9B 4JM2B 3T0XA 5ACZB 3HZYB 1JBJA 5HYJB 5ENWB 2C26A 1KACB 3JWOH 1DBAL 2BFVH 3WUWA 5J6HA 5E5MA 3UJIH 5B8CA 1VA9A 1FNGA 1FN4B 2D7OA 2WBWB 1VKXA 4NHUA 4CVXB 4Q2ZB 3FQRA 3K7UA 5SV4A 3R1GL 4UQ3B 1DBMH 3OKDA 5D1ZC 4Z78A 3BPCB 3NZ8A 2E7LA 5BW7C 2E6PA 4H0IA 4YFLF 3FT2A 3WSQH 1WUNT 2AJXH 1QEWA 1KN4L 3FN3A 3ZE1E 2PKDA 2E9JA 4RMVA 2JCCA 5DFTA 3W0WE 2OMNA 4GW5B 3KPQB 2H8PA 5IFHH 2C9AA 1UVQA 4G6AD 3BDYH 1GC1C 3ZL4L 2B7DT 5HHOA 5LBSH 1C16B 4G8EA 4LEXH 5DD5L 3ARVA 4PD4J 1NLBL 4CVZA 2AS5M 1W2KT 2H6PB 1ORQA 1KUMA 3MGAA 2GYSA 3HI5L 4JZNA 5C09E 3L3OA 3VH8B 4PRBB 5IB1A 1XF4B 5D6DA 15C8H 1U8QB 4HJGA 4L8SB 4AG4H 1X4XA 5SWZD 1YEIH 1CTOA 1FCGA 3KJ4C 2VE6B 4EXPX 4F9LA 3BKCH 3U1SH 3OKMB 5CD5D 1W72H 3SE4C 2GTZA 1AI1H 4L8CA 4APQA 5JHDD 4YGVB 1MOEA 5D71H 3AROA 1NUDA 1S78D 2ZUVA 1HYSD 4L3CB 4BH8B 2P5EE 1YC7A 4YHPB 1QZ1A 4XNQB 3F5WB 5C0CE 4TULL 2NTSP 1S7WA 5KVMC 4HIHB 2VLJE 4YIQB 5B3JF 4XPBH 5DRZB 2XFXB 3VI4E 1KIRB 1HWHB 1IEBA 5SWSB 1DDHA 4RIRB 1NMAL 3WXVH 4N8CH 1P6FA 3C8DA 3PWLB 3MODL 1QD0A 4JLRA 3VW3H 2XICA 1FL6B 3G6JF 1ACYH 1JGVL 4OFPA 4XB7A 4YE4H 2YEZB 1XGTB 1IQWL 2HLFD 1T4KA 1I1FB 5DMIL 5DMJB 4R7NB 3PHQA 3WO4C 4QO1A 4TRPL 1H3VA 3ZKSD 4N8VB 3WFZA 1RFDH 3HR5A 5D8JH 4A2LA 1QSEB 4OD3H 1PKQB 3MACL 5D7IB 4M3JA 5DZLA 4XH2B 2ZSVA 4RRPA 3SDDA 4Z0XB 1JF6A 1A47A 4BZYA 3I6GB 5MEPA 4OZIF 2NY7H 1H0DA 3ZYJA 1VDGA 3MLSH 5KVFL 3V0WL 1FH5H 2GJJA 4R3SA 1IAMA 4XP5H 1DBJH 3O3UN 3MBED 4OJFL 3GSXA 1JHLH 1IC7H 1WBZB 2HJKB 2NY1C 3MBXH 1AXTH 1KLGA 1S9YB 2J8HA 2EZ0C 2X1XR 1Q72H 1T0NA 1FVEA 1S7TB 4POZC 4DW2L 5I17B 5DD1L 1K2DA 5F3BA 4R4NC 4YR6B 4PJ5D 4J3TA 3RWIA 1NMBL 2HFGH 1QSFA 4O9HH 3GZKA 7CGTA 3ZKND 2E3VA 4PY7A 4JEGB 3MMEA 1I8IA 1J05B 3MXWH 2O61B 3D2UB 3EOYG 1NBZA 3STZA 5L6YL 1SEQL 4XP6H 1A2YB 3LSOA 5ICYA 3LB6C 1WISA 4HAGA 3O6FD 1XAUA 2AJUL 4OCLC 5IHUL 2DLFH 2I07B 4HG4K 5EIQA 4G9FE 3U4EA 2EH8H 1KG0B 2YKLL 5FGRA 1R3JA 5BS0A 3HPJB 3S34L 3ARGB 3WS6C 5LCVH 4TQEL 1XR8A 2J8UA 3GM0A 3RL1A 1DQDL 2BVQA 2EEAA 3D39B 2QQNH 1XIWB 3V6OE 2MCPH 5DUML 1JYWA 3TNNB 3NPSB 2NY6D 4WTZA 1KN2H 5FV1L 2VXSH 5E5MB 3HRPA 5E0QA 4NHUB 3FQRB 4U1LB 4U1NA 4Z78B 4GSDH 3VCLB 3MC0A 3NZ8B 1GRWA 3KNBA 4YO0B 3DTXB 1UJ3A 3FT2B 4GS7C 5TQ2H 3BP7B 5DVLA 3QULA 4OM1H 1KCVL 5HDQH 2BDNL 2R8SH 3QEQB 4YHNA 2JCCB 3ULUD 3DSNA 4XAWH 4F9LC 5FK9B 4U6YA 4RFNB 3IU3A 3SCMC 3UTSD 1BJ1H 2H8PB 1ZXQA 4HQQH 2XQBL 5F44A 1QBBA 3C6LC 4PGCB 5ID1A 5LXGH 2DQGL 5BV7L 1A6WH 3EYFB 1IT9L 4PJGA 3PHOB 1NL0H 3F6IA 1FLRH 5TGBB 2DQUL 2BNRA 5D2LE 3RWCA 4JZNB 3RUGE 3HC4H 1OW0C 1KELH 3L3OB 5F9OH 5IB1B 1DANU 2A73B 2NTFB 1RIVL 5JXEA 2HA1A 2HMID 2NY0C 3O4LA 4KHXH 4HGMA 2X4NA 3CDCA 3DRTB 5I1JH 2CUHA 4JRXD 1K6QH 1OGTA 5FGSA 1J5OH 5AEAA 1KULA 2Q8AH 3EGSA 5DK3A 1I3VA 1A3RL 2P5WE 2FJFB 3LHPL 2CDGB 2GTZB 4OZFA 5DR5L 2NQCA 1ZVSA 4APQB 4CU8A 4LSSH 3JSSA 2EE2A 1A7RH 5D96B 5EOCL 1R3KB 1UCBL 3QFDA 4Y2DC 4ZG1A 4DN4L 5D7JD 4H1LH 4OKVA 2EDFA 2H3NA 3K4DA 1WAAF 1RZKL 4HIIB 5EUKB 4RMWA 1OLLA 1V05A 3VRIB 2EDDA 5EUOE 5LKNA 3I2CH 5C0GA 4CW1B 2PETA 4M6MH 1KCUL 4J23A 4U49A 3RZCB 5T1KA 3E2HB 4KTEH 4EUPB 3RNKA 1ZLWH 4I0PD 4JLRB 4X4ME 1LO4L 5I9QB 3GSUA 1MJJA 3UTTE 3S5LG 5GGRB 1A6UH 4K7PX 5TFSH 1ZGLA 1OOAA 1BWWA 5FYKL 3GIZH 3S4SA 3PHQB 2HKHH 4K2UH 4Z7VA 4HUUB 3EFDH 2BY0A 3SKUD 4PJ8B 4OLYH 2ESVA 3HR5B 2NY4D 5F8QC 4JY5L 2ICWI 2IQ9L 1Z0NA 3WNMA 4XNYL 4O58L 1QYGL 3SDDB 1TJIH 1ZANL 3V7MA 4NGHH 3EOAB 1H3WM 2GSIA 1FGNL 5EPMA 3KHOA 3ZE1F 5IIEA 5MEPB 5FO9A 4YAQA 5JHDA 3QHFH 4R3SB 4UILL 5HVFB 1IKNA 2ZNXA 1AHWB 1QFWM 4KUZL 3ZKQD 3HNTH 4XCNB 2ZNWA 3GSXB 2VL4A 1IGIL 1NCUA 5GZOC 1DP0A 3CUPA 5EBWA 3QEGL 1ORSA 2LTQB 3B2VL 3G5YA 5FGCB 4ZPVA 1YEKH 2M8XA 1FVEB 1RULH 1YY8A 3OKOA 4WFED 5T3ZD 1CICB 4LSUH 4DZBB 2P8MB 2QTEA 5FOBB 5F3BB 3W0WD 1A6AB 1SY6A 1NMCC 3RWIB 4KKAD 3HN3A 3SKOA 3TYFA 1E28A 1DBKL 4NFBA 5ICXA 4DVRH 5D1XC 4PYHA 2AJVL 4KY1H 1S7XA 1BFOB 1K3IA 2WWMC 2WUBH 4BQ8A 3MMEB 4WW2B 1P2CA 1HHIA 5KG9A 1WCQA 3CU7A 1RUPH 3MTRA 3MA9L 1N5YL 2IGFH 3VJ6B 3LSOB 3BHBB 5GRJH 1EZVY 5C09D 1HOCA 4LGRB 1U6AL 4MJ5A 3OF6D 4LSRL 5DI8A 1II4E 1UJ3C 3BKJH 2AAVA 4G6FB 3NIFE 5TDNA 5TE4L 2HKFL 1XGQB 4S2SB 1DCLA 3L95B 3IGAB 2R0ZH 1ZTXH 2J8UB 2UY6A 4C83A 5T1DH 3KS0J 4P59H 3VI4F 2VNCA 4IMLB 3PGDB 4MNGA 3NFNA 5C92A 4LKXB 2NYYD 3MBEA 1UG9A 3FO1B 1OP5H 2P5ED 4HUWA 4JANA 4JGUA 4JZJA 4NQSB 4D0CB 3UC0L 5FHBH 5CJQL 1CDGA 5B39G 5C0CD 4Q6IC 5CBAA 3Q2CA 3LQZA 1CFTA 2DQJL 1CDJA 4FQPA 3HE6C 3S88L 3BGMA 4HUXA 2V2WA 1T5XB 1RUQH 3B6SB 3Q5OA 4OZIA 3KPOA 5BVJA 1ZSDB 4OAWA 4PJ5A 3CMOL 3NZHH 2HRLA 1BEYH 3MOBL 4R4BA 4U6YB 5T5FH 3IU3B 1DQJB 1JF1B 2V2XA 3QG6A 4HFWA 4UDUB 2AEPH 3DBXA 4MS8D 4I1NB 1PYWA 4EBQL 3GKWH 1IC1A 2J5LB 4JO4L 4LLYB 2BNRB 4HBQA 1AGEA 3UO1H 1U92B 3O6FA 2A6DB 4KK9D 1CGXA 2IH1A 3BWAA 4IIQA 2VDLH 4M1CC 3AXLA 2AJZA 1G6RH 4ZUWA 5F7DA 4TNVF 1NCDH 1OGTB 3O8XB 1JN6A 3VMNA 3EGSB 4YDLB 4LRIA 2OR9L 1CE6B 3QFJE 4V1DE 3IDNB 4J3XA 4G6AC 4YNYA 4FS0A 1D5IH 3VFOB 4F37K 3O6LL 2A2QT 2DD8H 4HWNA 4ZTOH 4YUEH 5GS0L 3LKSA 3EOBB 4HMEA 3QFDB 4BFBD 3IDUA 1IM3B 1SMOA 3MJGX 3Q48A 2ADIA 1NCCH 2F53D 2RCSL 5FHAL 1J0IA 3MZTA 4PLJC 1IM9B 3WN5A 1KPUB 5CJXA 5L9DH 3ULVH 3WFEH 5C0GB 3Q3GB 3LOWA 3QQNA 1A7PL 5T1KB 1DEDA 4NDMB 2IF7A 2Z91B 4HFUL 1IKFL 1PEWA 4EOWH 3UTSA 4XPGH 3RNKB 1NLDL 1N59A 1SJHB 2G2RA 5K9OA 3P40A 4YHLL 1MNUH 3GSUB 5BXFA 4J3UA 1AFVL 4JHWH 2VLRB 1S78C 3RWJA 2C4FT 1HYSC 4FMFA 3JV4B 1JRHI 3T2OA 3EBAA 1G7LA 5C0BE 3T09A 2RAMA 2J6EH 1BBDL 3UTZB 1U8NA 4G9FD 3QDGD 4X5WB 2ESVB 2W0KA 4U1IA 4JRXA 1Q38A 1AY1H 4HIXH 2EXWC 5K9JL 5I74C 4DZ8A 4LF3A 4OZHB 3K8LA 5EPMB 4JDTH 4RAHA 2E27L 5IIEB 3LEVH 1U8KA 4GG8A 4YAQB 4F9PA 1KC5H 1AD0B 3WFHB 2HLFC 1JL8A 3QAZC 4CRPA 4QTIH 1D5BA 4JFFE 5D7JA 5E6YA 3W9EB 2ICCA 5EWIL 3G5YB 4UV7H 3GSNB 5D2LF 5DRXA 2P4AB 2X4TB 2ENSA 3RUGF 3MV11 5LGHH 3TYFB 3MGOB 3S37L 5HHQA 5HD8D 4I0PA 4P48A 2GUOB 4OIIL 3O45B 2F5BL 1TJHL 1HHIB 1ROWA 4R0LA 1WAAA 1U8MB 3AU1A 4Y4KD 3GSNL 3KHQA 4X7FC 4KJWD 5DGQA 3BGFC 3L3JA 4H20H 3EO1B 4MJ5B 2BC4A 3TA3B 5D7SL 1T3FA 3FQXA 1M7IA 5I6XB 2XZAH 4AEIL 1CGVA 3RX5A 3T1WA 4POUB 3G6JB 4XMLL 5E2UH 2P5WD 4O02L 5EUOF 3SE8H 5C0JA 3QQ3A 4MA8H 4EZMA 2VZ3A 2VZUA 4PJIA 3RGVC 5HJ3B 2FEDC 4MNGB 1UZ8A 1X44A 4JM4H 3P11L 4J3OC 2UYLB 5A2IH 5EO1B 2APTA 4BELD 5E6ID 4JZJB 2I24N 2ZUXA 4FQXB 3IDJB 2KZWA 5CBAB 5C6TH 5B21A 1CFTB 1WFUA 3KLHC 4R9HA 3OKLB 2WP3O 3EO0A 4HUXB 3BD3A 3VXOA 3P30L 4OZIB 4RMUA 4NO5B 4M00A 5BVJB 3W0WA 3MUY1 3VDBA 1U8IA 2QADD 2DTML 4KU1A 3SDCD 5CMAB 4JG1H 4LRIC 1X7QA 4GW1A 2IALA 2X2YA 1T89A 3QQ4B 4LBEA 1LO5A 3MA7A 4HFWB 4GAFB 2X9WA 4ZPTB 3DBXB 4MD0B 1PYWB 3GHBH 3A6CL 4S1SH 3VG9B 4DKFL 4N0UE 5EU5A 1CU4L 1EK3A 3CXHK 1E6OL 2BJMH 5E00A 3FL7A 1BLNA 5C09A 5FDWA 1VFBA 3OF6A 1MFEL 5ICZB 4L8BA 1BGXL 4PBWD 3BWAB 4PRAB 4Z76A 2YK1L 2ATPA 4OQTA 4ZUWB 2XWJB 4OUOA 1L0QA 2HTLD 3OAUH 3ULUC 3V4UL 5J11C 3F62A 4UV4H 4P99A 1FE8L 4FXGB 3GKZA 1LEIB 5C0FA 1ZGLM 3GHEH 3G5ZA 4H25B 1F2QA 2D4DA 5I73C 3V5KA 5KSAB 3BRFA 3LKSB 4LIQL 1UA6H 3RNQB 3SHSA 2P5EA 1I4FB 4QYOA 3B5HA 2O26U 4YHZH 2ADIB 5C0CA 3FJTA 4KGLA 4AMKH 4U7SA 1KJMA 2VAJA 5AYQA 4O2CB 3WN5B 2HMIC 3BPOC 1KT2B 2QSCH 1NGXB 3NIFF 2V17H 2VDNL 5TDPA 2X4RA 3N1GC 4OCSH 4FFZL 1A9EA 3O2VH 3S36H 3TYGH 3IVKB 1N26A 5HHXL 3KJ6L 1NFIA 2B1HH 2G2RB 3F7VB 4JN2B 5K9OB 3BIAX 3H0TA 5BXFB 3BO8B 1KJ2B 2DAVA 2BVPA 3C60D 3V52L 3RWJB 3WLWD 4KC3B 2EICA 4U3XA 2DQEL 4L4TE 4LHJB 2HRPL 5D7JC 1WC7B 5DJXA 4AQOA 3MRQA 2F5AH 4LPCA 3FT3A 5JO5A 3FN0L 2GK0A 3T0WA 1FFPB 4U1IB 1EGJH 3BIKA 4IRSA 2C4FU 5JOPE 4NJ9L 3O9WB 4PJCE 4XVJH 1KEMH 1E4XL 2WQRA 3IJHA 1JWMB 5F97E 4LP4A 4X6FA 2XY1A 4LF3B 5K9QG 1KJ2L 4QRSB 1O7SA 4G5ZH 2VQUA 3TIEB 1WIUA 1EHLL 1G9MC 2PTTA 1PKOA 2CIIB 3HNVL 2R4RL 3HRZB 3LQAH 4NO0D 3B9KD 4LCCB 4AEFA 3RJQB 1QBLL 5T5NG 1JWUB 3N1QC 4OCRL 4LLQA 4H88L 5FUOH 3O4OC 3U6RB 4D9LH 2APWA 2P7TA 5DHVA 5C3TA 4ALAL 4PS4H 1FDLH 3MRPA 2OJEB 4OGAC 4GRLB 1GIGL 4NHCL 5CEXB 3EYVB 2Q3ZA 4D0DA 1FFNB 3DUHA 3K8MA 1GPOH 1G7QA 5JHLL 4LPWA 1OLZA 4BA8A 5HDOA 5GZNC 5DF0A 4R0LB 1QR1B 3WIHH 1EHAA 2NXYD 2DN7A 4O5LL 1WZMA 3IDXL 4GLRH 1T22A 1AJ7L 2R0WH 5KVGH 4P57B 1I75A 4G9FA 4OLZH 1UWEL 3X11B 1LNUA 5CWSA 2XN9B 2XWTB 2EIZB 2OP4L 2BSTA 4X8JB 5T1MB 1RIUL 4KKAC 1RVFL 1JI2A 3QFJD 5DJCA 3V6OA 3QIBD 4V1DD 1NGWA 3QQ3B 2DBLH 3CX2A 3MRFB 3QEUB 2ITCA 4N90D 2JJSA 4N1EA 1ADQH 1UZ8B 5K59E 1UM6L 4TSCL 3MUZ1 4NNXB 3TIDA 4JB9L 2CMRL 3ARFC 5JMRA 5I8OL 3FO9B 2NNAA 4ZAKD 2Z8VC 3MJ9H 3CFEB 3I9GL 1T21B 3EO0B 4XXCC 1RUKL 2LV4A 2IBZX 4PRNB 2X70B 1ZS8A 3DHMA 4G8FA 5ETUA 4XP9L 4KQ4H 1BQHA 1O7VA 4GW1B 4OLUH 2Z4QA 2X89D 1CN4A 1KCSH 1LO5B 2CXKA 3B43A 3BT2L 1GSMA 4LCIL 4L4JA 1UM5L 4UAOB 1EBPA 2NYYC 5ILTL 1FO0L 1QBML 5EU5B 5D2LA 4Y4KA 2MMXA 1RZJC 2ADGB 4LSTH 1MELA 2WM0A 3RUGA 1VFBB 32C2A 5ALBL 2EYRB 2PXYD 5C0AE 4MX7B 2AK4B 3SJVB 1I1YA 1JPSL 1U91A 1A7QL 3LKPB 4P4KC 2E6JA 5F6IC 4U1MA 3TV3L 2P5WA 1UADC 4MDJA 4JN1L 2NW3A 4KK5C 5C0FB 3RVTD 2F9BT 3DMMC 5J56B 2QV2A 3SN6N 4JFFD 2BX5A 3EDJA 5E6IA 2Y5TA 4J1UB 1ZHLA 4KRPD 5FECA 4ZYKA 2VWEC 2VLJB 3HMWL 5EUOA 1QR4A 3F8UB 5LGJB 3MODH 5IB2A 3MRNB 2HT4C 3RX8A 1OF2B 1I9RH 4HGKC 4IRJD 4PRPE 4X4MA 5IBLC 2X7LA 3SDAB 3UTTA 1LK3H 1BD2E 1B6DA 3FO0L 3VXQA 5FKAA 2VOTA 5I0ZA 4TRPH 1I1RA 3EYUL 1XCQA 3FRUB 2ZKHL 4B5EA 5CGYD 1WSST 1XZ0A 4Y5VB 3MACH 5IF0B 3TJHC 3FT3B 5JO5B 2GK0B 4U33A 3CJJA 1XF5A 3BIKB 4IRSB 1TENA 3RL2A 4HIJA 3O11B 5IMLA 5KVFH 5I8KL 1CFSB 4X6FB 3QXUA 4NT6B 5DC0A 1T1YA 1I9JL 1OAZH 2DYPD 3BP6A 1LMKA 1TVHB 5JUEL 1MVUB 1IC4H 4UU9B 1P7KA 3RTQD 1M71A 2YR3A 5DD1H 1G0XA 2BRRL 1K9TA 1JF5A 3MNZB 4P9HH 1NMBH 4HHAA 4J8RB 5IEHB 2YD7A 1FNEA 2OBGA 1Q94B 1L0XA 4JFHE 5DJYA 1IAKB 5EC2B 5I8EA 2AXFA 2BVYA 1G7QB 3HZKA 4QRQA 4UOW1 4WIQA 1FIGH 4PLOB 1SEQH 4ONHA 8FABA 3C5ZC 5L6YH 3HI1A 4BSWB 5D1QC 1K8DB 2C1PB 2ZUQB 3C60A 3RVUC 3MFFA 4JO2H 5CEZH 2HJLA 4WWKD 1T22B 1FGVH 3DX8A 1JGLL 4JPKL 3KG5A 2DIBA 3S34H 1A02N 4G9FB 5FF6B 5EFIA 2I9LA 3IDGB 1BECA 1V7NL 3ZYIA 5JNYB 1EJOL 1EO5A 1WZ1L 3L7EA 2R15A 1RURL 5DJCB 4PJ7A 2VZOA 3U0WL 1AR1C 1A1OA 4I18C 3IKCA 4UUJA 5HD8C 5E8EA 5DK0A 2IPUG 3ZT5A 4WJ5A 4NYLB 1NGQH 3GFUA 4W81A 3B9KA 3QXAA 1ZHBA 4KJWC 1EPFA 4BSVA 2R39A 4DGYL 2A6IB 2BDNH 2RQ8A 5BOZG 5I66B 1HDMA 3IFNL 5AUMA 2WLZA 5I76B 4K8RL 3JTSA 3MRRB 3C09C 12E8H 4Q0XH 4JQXC 4NM8L 3VXMB 1ZS8B 2HFEB 2FBJL 3LPGA 2DM7A 4CJ1A 3MLYH 1BQHB 3PNWA 4XB8A 1IT9H 2Z4QB 3DARA 4PJCF 4U1SA 4JAMB 3BJ91 3KVQA 1UACH 5E4IA 2IC2A 1U8PA 4XWOD 4KROD 1KTLB 3MLVL 3DIFA 1T66C 4WHYG 5E6IC 4RMRA 3LRGA 4X99A 5I1CL 1RIVH 2F54D 2FIKB 5MEND 3S3SA 4WY7H 1BBJA 3RUGB 3PWUB 1F42A 2DQDL 5E95B 1JIBA 1ZWIB 5ITFB 5J1TC 3K0WA 2V9QA 2YWYA 3VFNA 1A3RH 5JOPD 1I1YB 1U91B 1MCFA 1YN7A 2JELL 2QADC 1S9WB 2N4IA 2EC9U 4JQIL 3SDCC 3RDTC 3QFJA 1IGML 1FL3B 3QIBA 2J8OA 4PJFF 4V1DA 3KXFE 5TQ0L 3WIIL 3I85A 3MJ6A 1I8MB 1UCBH 4RFOH 3SGKA 1BVZA 2WNGA 1GAFH 2YC1B 1OTSD 3QNXA 3D5OF 2A0LC 3T1FA 3QUYD 3UZQA 3T77A 5I2IA 4U1JB 3MRMA 5HI4D 3QUZD 4OF8A 1EV2E 2ZP0T 4CVUA 1CDHA 1ZHLB 1L6XA 3C5JA 1IILE 4ZAKA 4MB4A 4I2XA 3UTPD 3MV7E 2JK5B 5EUOB 4JO1H 4Y19E 2BSSA 3D85D 2HTLC 1QQDB 4YHML 1FPTL 3BQUC 1DQLL 4BKLB 4H1LG 2VDKL 4I5BA 4MA3A 3UTTB 1IL1A 2YXFA 4QGTA 1G7IB 3VMPA 3VXQB 3KJ4B 1LK2A 1GC1L 5CILL 5ERWA 3Q5TA 1CDYA 4HH9B 2H32B 3H3PH 1NAML 2Z9TA 5C0BA 4A6YB 2ICWJ 4TUOB 4J4PD 3QXWA 1XZ0B 5K59F 5F9AC 4PTTA 4EUPH 3P4NA 2FZ3A 2GCYA 1ZANH 2PXYA 1BREA 4E42A 2W59A 1WWWX 5IJVA 4G8GD 4XNUH 5I1GL 5K9QI 4HIJB 4OZGE 1GYAA 1T03H 3EOTH 4UILH 4HXAL 4KUZH 1C1EH 4XP1H 2L7JA 2AKRB 5KANI 1IGIH 4QHLB 1T1YB 3R8QA 4A6YL 2OTWB 5DFWH 3QEGH 4I77H 3B2VH 1IJ9A 4JFFA 3WLWC 1JZ8A 4GG6E 1M71B 5C7XH 4P46D 1HH6B 3FB8B 1BJ8A 5BZWA 1ZV5A 5I16A 3V9FA 2MHAA 2X09A 3MRJA 2EDRA 4HEME 5EU4A 1DBKH 2OM5A 3OB0H 3T0VA 2AJVH 3MYJB 1A22B 4XCEA 4M9OA 2OQJA 3MLUH 2BY2A 5FM5M 4DVBA 3IB4A 4IRJA 5DJYB 2NR6D 2QL1A 2D0GA 1Y18A 3J8F7 2C3XA 4FQ2L 4HC1L 1N5YH 3ARBD 3M8OH 4ONHB 8FABB 1G9NC 2BVOA 3HI1B 1F4XL 4LSRH 5E2JA 2GJZB 3V6BR 1YNTB 3I02A 5IMOA 1U8HA 3RY5A 1A14L 3DX8B 5D9SA 3D6GA 2HP4A 4X80L 3VGHA 1DE4B 2CRYA 5C0AD 5BRZB 1NC2B 3W82A 3VWKD 4ZO9A 1SYSA 4ZD3L 1B0GB 3L7EB 3ARTA 4U7MA 4KJQD 4M4PA 4IJ3B 3NABL 4RISL 2WZPD 2BY1A 2X1WL 4UUJB 3WKMH 2VXUH 3FQTA 5E8EB 2VISB 3UC0H 1X5IA 4K71B 5CJQH 2DYPA 5DLMH 4WJ5B 3S88H 4TOYL 1JPST 3RTQA 3UTOA 3KYKH 3DX6B 1BAFL 2NY2D 4BSVB 4F8QA 3IJYA 1MHPL 4W4OC 1QFWL 4MSWA 4XNZB 1FCCA 4QGYA 2VAAA 2WWKO 3MOBH 3ZDXE 1X5FA 1CXIA 4L5FH 3AAZA 1U8OB 2E7CA 1HI6B 2OXGA 3QIBC 3H9YA 4EBQH 4U6HA 5EU6B 1T83A 5KW9H 3U30B 4ZTPL 2OCFD 4U1SB 4U6TA 4N0UA 4KMLB 4MWFA 1OQXA 4XBEL 5DUPL 4NN5C 4WUUE 4WNQA 5IVNA 5SX4H 4ELMA 4P3CH 3ARQA 4JZOB 3E8UH 1FSKC 5IBTH 4WWKA 5INCA 5F3HB 5BOPA 3WV0A 4L9LB 4M7LL 4LOUD 5HI3D 5C6WH 3MRGA 1YUHB 3LRSA 4KK8D 2OR9H 4QRRD 1X4YA 1W0WA 4N0YH 4LSVL 1MI5D 2FYYA 1MHEB 1T1XB 4GS7B 2E9WA 2R2CA 5HYFA 2PYEE 4NKOB 1MCWM 2ITDB 3HA0A 2A77L 3DSFL 2X4SA 3T1FB 5HXMA 3T77B 4K7FB 3SCMB 2V9TA 4LLWB 4YXLL 1P4IL 3PDOA 2YD2A 4GRMB 1OSPL 3U36B 5F7LB 1NEUA 3INUH 2DF3A 2PXYC 4TUKL 3CZFB 4HK3J 1B0RA 3LN4A 2OJZH 1WT5C 4JFHD 1LILA 3BKYH 4JHZA 4YHLH 1MFDL 2XRAH 3ROLA 2EKSA 1J18A 1WWBX 1NC4D 2B4CH 2NXZD 3T0EC 1FRGL 4I5BB 1IL1B 4DJMA 3LPWA 1A6ZB 5EU3A 3GEWB 1Q0YL 5E8NA 3KLAB 4G6JH 5C0BB 4KRPC 2F54A 2JB6A 1X5JA 4NSKB 1RJLA 2VLKB 4G42B 2GKIA 1M7DA 2YRZA 3P4NB 2FZ3B 1ZT1A 4LLDA 2XXCB 4X98A 3MSPA 4Y2DB 4KZDL 4PJCA 5IJVB 1ZHKA 2W0FA 3TCLB 3D69B 4YFEA 3M17A 3WJLA 1FHGA 3FB6B 4K3EL 4NKMA 1FZOA 3E6FA 1GGYA 1F02I 1T1ZA 1OARH 5C07E 4WUKL 4CNIB 3F58L 1INEL 4I4WA 3QUZA 2VUOA 5GS2H 2BXYA 3E6HA 4NQVB 4TVPH 4LKCB 5CGYC 1S7QB 4Y5YA 3CDGA 1OT2A 1RJZA 5I16B 3QUXD 2XV6B 3BRDA 4ORGB 1DUZB 3MRJB 3QNYA 1LD9A 1U93A 3WHXB 3S37H 3D85A 5TE7L 5FO8B 4LPXA 1KCLA 4OIIH 4P0DA 4HGWA 1R5WB 3NCYP 1TJHH 3VGEA 2WINB 3OAYK 2R1YB 3U0PA 3QWOB 3NTCL 3KAAA 3GSNH 2FD6H 1YMHB 3U4AA 3T2NH 3CXHJ 5A40E 1FFQA 2NLJB 5D7SH 1LDSA 2EIBA 4L4VE 3MLRH 5BMFL 5IMOB 1IEHA 2D3VA 4ZDHA 3TO4C 4J4PA 1YYML 5TPWH 4CAGA 1NGZB 3KPNB 1BMGA 4KTYA 2VDOH 3HG1D 4O02H 3V4PH 3WNOA 4X7SL 1JJUA 4M43L 1KJVB 1SYSB 4GMTL 1EX0A 4MQXD 3OG6B 5KOMC 3GMLA 4JQVA 3P11H 5AG9A 3ARSA 3CAFA 4X4YA 3G6AB 3KR3L 4URTB 1BIIB 1T7XA 1T2QH 1NMCB 3SBWC 5CP3A 3GO1H 2VR5A 3WLBB 5D1XB 4I3SL 1J10A 3P30H 1OB1A 3IJYB 5KVEL 2BK8A 3MR9A 1KIPA 4QXUL 1W0VB 4Y19D 4MSWB 3N1MC 3MLWH 4G7YH 5E8OA 5AZEH 4MD4A 2GHWB 3UBXB 5FDYA 5F7EL 5LJYH 3SQOH 3SKJH 1ZK9A 4HUNB 4BQ9A 1N5AA 4N8PA 4U6HB 1QLEL 4X5LA 3WJJA 1AQDA 3DGGB 1JGEB 2R9HC 4OZGF 1CU4H 5KAQG 1IGYA 1NJ9B 3N50A 1U3ZA 4KHTL 3ARBA 3NA9L 2EDXA 2D03L 2HVKA 4J3WA 4N0UB 5I30L 3L9RA 3QIUC 3TN0D 1MFEH 2W9EH 3OG4B 5EZIH 2YD1A 3DHJA 3FAXA 4LCUB 5INCB 4LHUG 1U8LB 4B53A 3R8BB 2BSED 4D94A 1KB5A 2XZCL 3NCFB 4Z9KB 1J0YA 3EO9L 5C0AA 3MRGB 4GG6F 4R26L 3S3JA 3LV3A 3VWKA 1Z9LA 1QLRA 1N6VA 2IPUK 4ONOA 4PP1C 1YMMD 3JUZA 3MV8E 1W0WB 5HVHC 4Q6IB 4Q9QL 4XCCL 4ZFGH 4CVWA 2OTPA 1N2RA 2F15A 3K8KA 5E5UB 2VH5H 3HE6B 1H3PL 4EDXA 3NACL 3RWEA 1HHHA 2O5ZH 3BH8A 3PV6A 4EDWH 4XWOC 4XPTL 4F37F 1Q1JH 5T1LD 4XNMA 5CEYB 2YD8A 4FFYL 2WBJD 3PDOB 1QNZH 2CD0A 3NFSL 2A74A 3D0LA 5C0RH 3WD5H 2E7BA 2AV7A 3IF1A 1IFHL 1OAYH 2IH3B 5IEKA 4DTGL 5JQ6H 1NH6A 4GKSA 4PRPA 4JREC 3ROLB 2EKSB 3HZMB 1DLHA 1BD2A 4ODWB 2DQEH 1FZMA 4KGJA 4DGVL 1A1MA 2CLRA 1Q9LB 2A6JA 3QUYC 4NQEE 5CD3A 3V0VA 1A0QH 4L4TB 3QUZC 4NUJB 3FN0H 3O41B 1B4JL 3RP1A 3BEVB 1MFAL 2JB6B 4NN7C 1INDH 5LQBH 1M7DB 1PDKA 1S8DA 1ZT1B 5HHMD 4GUPA 1KGCE 3BMVA 3QA3A 1CDBA 4OCXL 2Z8SA 5B38B 1KJ2H 4PJCB 3I50L 4Z7OE 4CU7A 3THML 4QHKI 4UZGA 4XCFL 4WO4D 3ZDXF 3HNVH 3WFDL 4O00A 1RZ8B 1LEGB 1K4DA 1KJ3H 4LRNL 1FZOB 4NKMB 3E6FB 4OCRH 5GIRB 1RK1A 2GSGB 1BVKB 1N6QL 3EHBD 2FATH 1VGEL 4ALAH 3CVHB 1GIGH 1FNSL 4X9HA 3DETD 4HKBB 4PJFB 5FB8A 4PV9B 4N0FA 3OR7A 1LEKA 2ZCLH 4NNYB 3UPRA 2SEBB 1BX2B 3L5HA 1HQ4A 1T6WA 4OD1H 3HAEB 1NC4A 3ES6A 1AXSB 3WL9B 3IDXH 1AJ7H 1MCNA 2JJUA 2LVEA 4F58L 5E08H 3CVHL 5A1AA 4RCAA 4YDJA 4LEOB 2AXJA 4FZ8H 2UZXB 1YEEL 3TJEL 3BZFB 2AXHA 1UWEH 1V8HA 2CDFA 4P46C 3GI8L 4EI5C 3NH7H 2JB5H 2F8VA 1OWRM 4M5YL 4PGEA 3UYRH 4X7CC 5C0DA 3SDYL 1RIUH 4GXVL 5GRUL 1RVFH 1X4ZA 3QAZB 4O51A 5IK3A 2R23A 5J1SC 3GIVA 5F7KC 3GMLB 3U7YL 2NR6C 2PYED 3WJJC 3BP4A 4KI5E 2GIYA 5HYQA 4K3JL 3VFUA 4Q58C 3G5XB 4M7LT 3LS5H 4PGBB 3M1BA 5I8OH 1PSKL 4OCYL 4FOMA 3I9GH 4P2RD 1TZGH 3NCBB 5C9KA 4RMTA 3HE7C 3KYMB 3QUXA 1TZIA 2R1XA 3VWKC 2MWCA 1OGAD 4M8QB 3T4AB 5M95B 4EN3C 1YEHH 5CCKH 5E8OB 4MD4B 3OMZA 1RK0B 3PJSA 4K9EC 5DQDL 2F8OA 3BGFB 1MJUL 4XPFL 3WMSA 1N5AB 3T4YA 5ILTH 3CLFH 1QBMH 4OLXH 4IS6A 4LNVA 3KYAA 4N1CA 3F12B 5K9KA 3TBYA 4AM0A 5ALBH 1IC5L 1ZA6A 5GJTL 3N06B 4AH2B 2DMKA 3RGVB 3IXTA 1JPSH 4M9PA 5KSBA 4C54A 4U1GC 1SMAA 5EO9A 3V5DA 1QP1A 2NW2A 2H9GA 1S9XA 3KXFA 4F8TA 3MFGB 1NCBL 1SVZA 2W9LA 5FCUL 5F88A 5HGHA 3UYPA 3MRHA 3UJJL 1Q9WA 5IM7B 3BH8B 5C07D 3DVGA 4GO6B 5E7FA 1D9KD 1MRDH 4OQTH 1YEDB 1YA5A 2ICWA 4XGZA 3ABZA 5SWQB 4MCZB 3MV7A 4MVBD 4Y19A 3O3DA 4ZO8A 2WBKA 2A74B 2RR3A 3VGAB 3IF1B 4G43B 4HWEH 5IEKB 1T7VA 43CAA 2R1WB 4XPAH 4BUGA 2VITB 5GGSB 4PRPB 4X9IA 3FO0H 2VXVL 4UTBH 3GNML 1BD2B 3H7BB 1Z3GL 2CKBA 5CINH 1A7NH 2ZKHH 3MV9E 2DLEA 4L4VD 3MGTA 3TN0A 3WNPA 5J11B 1EMTH 3JWDH 5ESQB 2C1OA 3WNKA 3MLXH 4WU7A 5HGAA 5DUBB 3LMJH 2G9HB 2EE3A 1S8DB 1YDPB 2Y6SD 4M5ZH 1YYLL 1I7RB 1E4XI 3JWOC 4O4YH 3HS0A 1CZ8H 3MPCA 1TMCB 3BD5A 1IMHC 4WI9A 1YPZB 1PJ9A 2FH6A 2P49B 3PABA 3ULUL 1ZLVH 2DQFB 2VABA 4U1KA 3BUYA 3BVNA 3EDEA 4JFZL 5IQ7L 4CKVX 1GH7A 1RK1B 1RD6A 2V5YA 5DA4A 5E99L 5T1LA 4GG6A 3OPZL 2YD9A 2P8LA 3GSRB 4PJDE 2Q86A 3EJYD 5JOEA 5JPMA 2CK0L 5F1NA 4LAQL 3ZE0E 3LN5A 1AE6L 3UPRB 2HWZH 5FV2A 3SGDH 5JW5B 1MJ8H 3DRQA 1HQ4B 3O6ML 4C56E 1MHCA 1QRND 4WV1A 5F1OB 4PJ9A 4RZCA 1OPGL 2WMPA 4MXVE 3O2DA 2VXQL 3ULVD 2X4UA 3SGJC 5IB4A 4ZOCA 3LAFA 1NDMA 4JPIB 3S6CA 5C0DB 3QI9D 3QCTH 1PZUB 2ZUYA 4UIKH 3WHE1 1MCPL 3FAWA 3MV8D 4JHBA 4BQBA 1SJEA 2ZUUA 4QWWD 4BZ1L 4WDIB 4WO4A 4WRLA 4OFVA 1AR2A 1UKSA 4ZO7A 1B9ZA 3L3HA 3FRPG 1OAUL 4DGYH 4NO2A 4ZXBC 3OXSA 1XF3A 1QRKA 3MOQA 4MZ3A 4XX1E 2D4FA 1G9ML 3ZTNH 1AGDA 1NSNL 5CP7A 4Y89A 1MQKH 1F3DJ 2ZJSL 3WIFA 3BAEL 5KBNC 5KSUB 2HYMA 1VESA 4MAYD 4MQXC 3PJSB 3U48A 3T08A 4UTAH 3S7GA 5KN5B 3MLVH 4Z7OF 2W65A 2Z31D 3LKRB 4NQED 5DQJB 4XVTL 2XTJD 3GMMB 5KJRL 4WUUA 5K9KB 3FB7B 2XXMB 3WUWG 3WDHA 3EFFB 4MHHI 3W11D 3IJSA 1QKZH 1ZA6B 2XNAA 1RMFL 1GGCH 3KPMB 2B5IB 3MLZH 3IXTB 4P9ML 2AXGA 3OXRB 1KGCD 4CADA 2I26N 2ENYA 5EO9B 1XGUA 4NKDB 4C59B 2IAMD 4WTXA 1QVOA 5T3ZL 4BZ2L 2H9GB 3LD8C 3ARFB 4JRYD 1S9XB 3KXFB 2VR9A 4BSJA 4P4RA 5SWSE 4MJ6A 2PYEA 5JXAH 5F88B 5SX5K 3RIAK 3MRHB 1FNLA 4PRIE 3FQNB 3MJ7B 1Z5LB 4GMSH 3CVIL 4NM4L 4JY4A 1NGPH 2ICWB 1M7XA 3U9PL 2NY5H 4XGZB 3CGTA 1J0JA 5GS1A 1AC6A 3GSOB 2D7MA 3MV7B 5F96L 3KLSA 3O3DB 3VWJD 3OR6A 1FPTH 4ZUTB 1MREH 2J2ZA 1DQLH 3PP4L 4UT6L 2Q7NA 3IDIB 3ZKMD 1UB6B 2QSQA 1WV7T 3FB5B 1QSEE 1U3HB 3GBNL 3RY4A 4YHOH 3X12B 5C9JA 3HNSL 5CILH 2LQRA 1N0LA 4M7JL 4ZNCD 3NFPA 1A1NA 3ARZA 1UXWA 4P4KB 4KI5F 4NZRL 3MGTB 1EXUA 1TQBC 2G5RA 3HZVA 2C1OB 5BJTB 4WU7B 2UV3A 2WBJC 5HGAB 3BKML 4LHUD 5DJAB 3BPLC 2VO5A 5I1GH 2AJ3A 3FZUC 1RZJL 2Z8WC 4CMMA 1U8JB 3DMMB 1KCKA 2FB4L 2YSSA 4ODHH 4OZGB 1OP3H 4U2ZA 5IBUB 2H32H 3GMRA 4RGNC 4A6YH 1HQRA 2P43B 4KI5D 2XPGA 3QXDA 2PR4H 3PABB 1SBSL 1QLFB 1AIFA 2VABB 4R96B 4U1KB 2JJTA 3BUYB 3MZGB 5J3HC 4FXLA 3DX7B 3GSQA 3ME0A 3O2WL 5C07A 4BH7B 2Q7YA 4HCRL 4F7EB 3X17A 1TVBA 1RAMA 4M7ZC 3ZSTA 4X0KA 3LEYH 3U82B 4NO3A 5AZ2H 2Q86B 3TT3L 1H8SA 3L6FA 4NKQB 1VGKA 3B3IB 5TH2A 1CQKA 2VL5A 3HB3D 2HLAB 5GS3A 3KPLB 3DV4A 3LN5B 4HC1H 2OZ4H 5M7QA 1PLGL 4RRPG 5DSCA 5FUZL 5BZDB 3D39E 4PJ9B 4RZCB 1A14H 1UXSA 2EE9A 4D9RE 3RKDD 4L4VA 4X80H 4ZS6D 1J1PL 5IOPA 2D31B 3S96B 2V7HA 2JIXD 3KS0H 2DMCA 2X4UB 4JFYB 5IB4B 5FYLH 2A6KA 4RGOH 3MRKB 1BZQK 2NY3B 3HC3H 4HWZA 4QHUA 3CFCL 1JNHA 1ZLVK 5A3IC 4YHKH 3C87A 1I1AD 2D2OA 2NX5D 1SJEB 4OT1H 2DLIA 1X5HA 3QEQE 4UQ2B 4OIBA 2NCMA 1JHTB 2VSCA 2ICEA 3FHQA 5CJBA 5IGXL 1A7BA 4TOYH 5CZVL 5IW1B 3L3HB 5C08D 5F7WC 1EAJA 1F5WA 4NO2B 5MI0C 1XF3B 3BZ4A 1G6RA 2UY7A 2VZTA 4IOFD 3QUMB 3OL2A 1A4KA 3RU8H 1RUAL 3I6KA 1OD9A 4B7LA 4ISVA 1AGDB 3GJFK 5LWYH 2R2HA 1ODAA 3C5ZB 2DI8A 4JCLA 3SY0A 4DGIL 5D1QB 4Y5XC 3B83A 3X13A 5HSFA 3IFLL 1EDQA 5GRXG 2LU4A 1ZKAA 2IFGA 3GGWB 3BH9A 3CPLB 3BYYA 2YPKA 4O2EA 3ULSB 3TBWB 2ZPKH 3PL6C 3QUML 3QZWB 4LSDA 1X5KA 4WUUB 4WTZG 5TE6L 1MEXH 3DO3A 3L3IA 4MNQE 4M7LH 2G60H 1AKJD 4UT9H 3SE9L 1MIEL 3IJSB 4D8PA 5J6GB 1OTTC 1HSBA 2F19L 5F1IB 3D87B 3K1KC 3QPXL 2AXGB 3DURA 5LAXB 3W2DL 4CADB 4CL7A 1JFQL 3QI9A 5EOCJ 1ITCA 4XPHL 1XGUB 3WS3B 1L7TH 4CBPA 5FYKE 3MV8A 3GSWA 1QVOB 4PJDF 4G3YL 1I9IL 3B8SA 4YBLB 3LKQA 2A77H 1HYRC 4I0CC 4OUUA 3ZE0F 3HKFA 3MUGA 3C09B 5D7KE 1P4IH 3EYQD 3GK8H 3QT2A 3E3QC 4LAJH 1AP2B 1OSPH 1EEYA 1L0YA 1S7SB 1WGOA 5GS1B 4QY8A 2ZCHL 5JPNA 3W5NA 2YA2A 2ZUTA 3K74B 2XA3A 1YN6A 3CFDB 4L1DA 3X14B 3OR6B 4QXGL 5I1DA 3I3BA 4JFOA 4HUVA 4F33A 4Y16D 1S9VA 1X6NA 4MAYA 4K7PH 3H42L 3JTTA 2EO1A 3DYOA 4AT6B 4Z7WE 4C56D 3RAJL 3VFGL 5D5ME 2HFFA 4JM2D 1KENH 4OZFG 4NQEA 4CDGC 1D9KC 1UXWB 3D18A 5FFLA 1IBGL 1PY4A 3RDTB 1D6EA 3HZVB 4XVSH 4XMKL 3UJTH 3QO0A 3KGRA 4Q74A 4KDVA 3L1OL 5E24E 4F2MB 1J7VR 4G9DB 1YEGH 2YSSB 2R56H 3OJVC 3SKMA 2IANE 1UM4H 3F7YA 4TPRL 5F9JA 5EZOL 4HPYH 4LASH 2IAMA 1VEMA 1CR9L 3RI5K 3A6OA 5ALCL 3P2TA 4H26B 3SGEI 1HQRB 2EYTB 1PG7H 2FJGA 3QXDB 3MOAL 4YWGL 5HPMA 3F58H 3AUVA 5I1AB 2LE9A 5E2WH 4NPYA 5JW4R 1S7VB 2DWDA 5KZCB 2YHGA 3S37X 1RZIA 3BQUB 5HPOA 4FNLL 1A6TB 3Q0HA 1CYGA 1JV5B 2O5YL 3S4SG 3CC5B 4PJXA 3DUUA 2UWEE 1YJDH 5JLZB 2Y6SC 3AB0C 4RAVA 5ID0A 3VWJA 4G7VL 4KDTA 3VFSA 2PCPA 5I1HH 4R2GC 5TH2B 2VL5B 4FQLH 4Y2OA 1F6AB 2FIRT 2VQ1B 3NTCH 3V0AC 4YFDB 1BFVH 1DBBH 4UOW0 4HPOH 1EA9C 4OGXL 3PWJB 4DKEL 1BIHA 3OTTA 1OM3H 2IADB 4Y4FC 4WU5A 1P1ZB 4ZUSA 2VQTA 3QG7L 4LNRA 4LK4A 1D3CA 3DVNA 4HWUA 3DO7A 2Y1VA 1BZ7A 3K2MC 5EG6C 1NBVH 4NKIL 4M43H 3U7WL 4QCIA 2FLBT 4YH6A 4HWZB 2BVTA 4LDLB 1JNHB 3H3BC 2XKSA 5SWSD 3TBSB 1HHKB 3GB7A 4MD5A 5IROA 3ISWA 4OM0H 4QRUA 5J1AA 2F58L 3GBML 1JPTH 4PRID 1NFDB 4ODSH 4JPVH 4FQCL 3HC0B 1Q8MA 4M1DH 3VE0B 5KVEH 3ULVC 1QFWI 3BZ4B 2R29H 2M26A 4U0RC 3I6KB 1YNLH 2ARJQ 5I1KH 2VDRL 4ISVB 3VXSB 3P0GB 1H15A 2BCKB 1DSFL 3X13B 5J0BA 2RIKA 1PQZA 1LO2L 3L5IA 5E8DL 1L7IL 2Z8RA 1QSED 4H5SA 3NA9H 4LU5L 3BH9B 2D03H 4QWWC 3QO1B 3FO2B 5DHXB 2ADFH 4R4FH 4HK0A 2IQAA 4NZTL 5D2NE 3WUZA 1N4XL 3JXAA 4RFEA 4P23C 4U6XB 3HMXL 2ZWLT 3L3IB 1G9NL 3EO9H 1TNMA 4LSPL 4M1GH 1JK8B 2JIXA 4R26H 4D8PB 1I8LA 4N5UA 2X4PB 4NBZB 3AMKA 5EU7E 2YPVH 3EDDA 1Z9MA 1BOGB 3S5LB 4E0RA 3P9LA 1MFBH 1XR9B 4P2QE 4ZFOL 2OTUA 3OGCB 4X4XB 4QRPB 4Q9QH 4IOIA 4QKXB 1CTNA 5JORA 1U95A 1H3PH 3Q5YA 2A9MH 3QEHB 1H8OA 3OAZH 2GTWA 3SKNA 3VXUB 3NACH 1I1AA 3LKQB 2NX5A 3LEXA 1KTDA 5CEZD 1CE1L 1K85A 1LQSR 1NEZA 3L5XH 1MF2H 3N9GL 3GMNB 2Z31C 3PWVB 3RQ3A 1WBXA 1C12A 4WEUD 4FFYH 2XTJC 2QQLH 1G7HA 1CT8B 5C08A 2OX5A 1P4BL 4DFHA 2D7TH 1EGJA 5DD3H 3NFSH 4NZDA 1FAKT 3MX0A 4TVSa 1BFSA 3UZEA 2ORBH 3D2UD 3P9MB 5JIKA 1D5MB 3CLEH 5F89A 1IFHH 4Z95H 1YEFH 3DECA 5GGTL 1FL5B 1CDCA 4RA0C 5I1DB 4CMHB 4HUVB 1S9VB 1R3IL 4X9BA 1VERA 1BZ9A 4KAQH 2AV1B 1NCAL 3ARGD 5I71B 4Z7UB 3BMWA 2KPNA 4HK3N 4Y88A 1V7MH 3D39D 1XIWD 3O3AA 3OZ9L 3P4MB 5DWUL 5GGVH 4OZHE 2ATKA 4D9RD 3SPVA 1A4JB 3ORJA 2WUCH 2DLTA 1X5YA 1FG2B 4AENA 2FWOA 1DQTA 4G8IA 5J9PA 1AKJA 4ETQA 4NQTA 4OCXH 1TQCC 3FCTA 4Y4HA 3H9HA 4QHKJ 1ACZA 3I50H 3VFRB 2UUDK 5JDSA 3VWJC 3SKMB 5JR1H 3TBVA 5F9JB 1U9KA 3WFDH 3BZEB 3QEQD 1WIPA 4LRNH 5HHPA 4FP8L 4H0GA 4R97C 1N6QH 4QHNA 2YMXL 1JPGA 3DX9B 5DD0H 2X10A 4UIMA 4KJYA 3BUTA 1ZT4B 1H3UA 3T0EB 4Z6AT 5HYEA 4PJDA 3R4DA 4PYGA 4XNXL 5ID0B 3QUKA 5FGBC 5IMKB 2A1WH 2PCPB 4GW4A 4RA3A 4AL8L 1MJ7L 5IWLA 1CGTA 5B39B 1UJTA 3VFVB 4LVHC 5IROC 1IQDA 1I85C 5INDA 4QLRA 5E94A 4C56A 3CVHH 3BRGC 3G6JE 5JW4Q 1B6UA 5ACZA 4YBQC 1RV6X 4HBCH 4APQD 3GI8H 4LNRB 4K7PY 1IE5A 3J7HA 1JGUL 4M5YH 4KV5E 5GRUH 4Q2ZA 3Q1SH 4U4BA 3N85H 3P73B 3IS0X 4QCIB 1WICA 4UQ3A 3HAEH 1NDGB 1WIOA 2FGWH 3BPCA 3WBDA 2VDMH 4TTDD 1KCRL 5FYKD 1FC1A 3U7YH 1H3XA 5D7LE 2Y06L 3VDCA 2X41A 4K3JH 5EA0L 3RZCD 1H5BC 4MD5B 3AVEA 4IMKC 2I60H 4GW5A 4QRTB 1PSKH 5D7KD 3KPQA 5C0EB 4Q9RH 4Z7WF 2DS4A 2H1PL 3RKDC 5D5MF 2FR4B 1J0ZA 4LARL 2P48B 1G0YR 1C16A 2YUVA 3OKKA 5IMMB 4X4ZA 2H6PA 2HJFB 5DK2A 3VH8A 4LIQE 2R69L 1XF4A 4PJ8D 3TO4B 4KWUA 4L8SA 1I1AC 3OKEB 1R0AL 2VC2H 3SDDD 1BFTA 4OLVH 1A5FH 2VE6A 5HYIA 3BW9A 2QQKL 1IC5H 2IQAB 4DQOL 3FHAA 3LH2L 1LO0L 1GL4B 4GXUM 1V3MA 5DT1H 4L3CA 4BH8A 4WW2F 1CGSL 4XNQA 1N0XH 3F5WA 1NCBH 1U95B 1CFBA 2UWEF 4HIHA 4IRZL 1CICD 4YIQA 1KIUA 3GI9L 5DRZA 4PB0L 5J13C 2GTWB 3LQAC 1KIRA 3DYPA 5SWSA 4O2FB 2FCBA 4GBXA 4WCYH 1P9MA 5I18H 4RIRA 43C9B 1ZT7A 4M7KL 4RBPK 4F3FA 4PRIA 4NCC2 4HT1H 2R2BB 2H41A 1G7HB 1IGCL 4BQCA 2XG4A 5GRVL 5IVZB 2ADJB 5IW6A 1DQML 3PXHA 1I8KB 4JFEE 3O3EB 4YC2B 1EFQA 2FHCA 3L7FA 2BSRB 3LKOB 4HSQA 5GHWL 4R7NA 5D93C 2LVCA 1JZ6A 4OCWH 1HILA 2M2DA 4XC3L 2H45A 2XTLA 4OFIA 3CSGA 5CIPB 3QIUB 1CFQA 4NC2B 2FL5B 3SE3A 3LIZH 1ONQA 4G6FD 4N8VA 2VXVH 5DQ9B 1G84A 4B7IA 3GNMH 1QSEA 1PKQA 3T0AA 2N56A 4Z0XA 5T33H 1Z9SA 5H37H 4HWBL 2AP2A 3I6GA 4KQ3L 3MV9B 3O3AB 4EVNB 2AGJH 3SPVB 5CSZA 1MRFL 1VPOL 3QIWA 1T7WA 4GKNB 2FWOB 5DHYB 4MNHB 2HJKA 1K8IA 5DMYA 2B0SH 1S9YA 3FCTB 4Y4HB 3H9HB 1HXYB 5JDSB 3U7AA 5H8DA 4M62H 2MPAL 4Y16C 4EEEA 4N0CC 5J12B 3C6SB 3D25B 4NBXB 1KEGH 4YR6A 3TZVC 4JFZH 5IQ7H 3BN9D 5HHPB 5IVXB 2IMNA 2ID5A 4JM2C 5FUCE 1JPGB 3OPZH 2FJHA 1H3TA 3VU2A 1NUNB 1F3RB 4UIMB 4KJYB 1J05A 4UT7L 3NMEA 5DFVD 5E2TL 2O61A 3D2UA 1A2YA 1MLBA 2AJSH 2BNRD 5ESAB 3T04D 2I07A 5DZOA 3GSVB 3AM8A 3IRZA 3O6MH 1KG0A 4IM8A 1HKFA 4QTHB 1IQDB 2XN9E 1OPGH 3O8XD 4HV8A 3VXNB 1SM3H 5E94B 3D39A 3W81A 4FABL 1XIWA 4GQ9L 4Z0BH 3TNNA 3GUTB 1N3NA 1PEZA 4KH2A 3X3FH 1E4WL 5L88L 3SEPA 4LQ1A 1XGRA 5F70A 1OQOA 3ZTJH 4OBSA 4U1LA 5J8OA 1MCPH 1RZFH 3GMPA 5GGVY 5KS9F 3VCLA 1MFNA 5GSRB 2DRUA 5ESVB 4YO0A 3DTXA 1IM9D 4D0BA 4NQDB 2XA8L 3BP7A 2A38A 3QEQA 6FABL 2OL3B 3BXNB 5T1KD 5EOTB 4M6NH 1YEJL 5FK9A 1S7RA 1L9NA 4HH8A 3V8OA 3CX5J 1BHGA 3ALXA 1G9MH 3B9AA 4PGCA 4JHAL 1IEAA 4WHTA 3WFCL 1TVDA 1CLYL 5IB3B 2XQYG 2ZJSH 2VLRD 3EYFA 3OKKB 4OZHF 3PHOA 4AJ0A 5TGBA 5C0NC 3C08H 5F93C 2EDJA 1CVRA 3DGCR 5DK2B 2H2PC 4NFCA 5AYUH 2OL3L 1DVFC 1YQVH 2ESVD 2A73A 2NTFA 3GMQB 4EI5B 4H8WH 4XVUC 2AK4E 3DRTA 3SJVE 1P9MC 4WFFE 5GS2D 4TVPD 4TN9A 3BW9B 2FJFA 4U1HB 5DRWA 2XZQL 4LSQL 2CDGA 5H94A 2CR3A 4MNQA 2C7UB 4LPUA 3I84A 2HVJA 3BYTA 1OAXH 2X4OA 1R3KA 1A3LH 2YRPA 3G08B 3L5WA 2W9DH 2DI9A 4BZ2H 5C0IA 1HSAA 3NOIA 4WEBH 4PG9A 1JI1A 3BDXA 4HIIA 5EUKA 4JKPH 1NAKL 3VRIA 4IDLA 4N68A 1TETL 4ONFL 4X9GA 4HKZA 1JYVA 4YDVB 4CW1A 4GBXB 5F71A 3RZCA 2K7QA 3HE7B 3ROOB 1ZT7B 4F3FB 4PRHB 1BQHG 4PRIB 2EYSB 3U9PH 4RGMB 4UINL 4ENEC 4EUPA 3H7LA 4EN3B 4P9HC 4P5TB 3DROB 5IW6B 3QJHB 5GGRA 3RRQA 2CRMA 2YXMA 3C9NA 3BISA 3L7FB 4KVCL 5IFAH 2Y4SA 3T65B 4UBDD 2Z35B 4KV5F 1HILB 3TA3D 4HUUA 5FYJL 1CFQB 1WQVT 4X6CE 2FX7H 1ONQB 4PJ8A 1FV1B 2L0DA 4KFZC 3HFML 1C08A 3D3VE 5DJ2A 1B0WA 4M7JH 5IQ9B 2VZSA 4ZOAA 2RGSA 2PNDA 4K9EL 4F7TB 3EOAA 4NZRH 5GSVB 2P24B 5DZNA 2YS4A 2HT3D 4FQIH 4RWYL 5CSZB 3TWCH 2OXHA 3BE1L 3QCVL 3QIWB 3LZFL 1AHWA 4WW1B 4XCNA 1CGUA 1R5VB 1K8IB 4K94H 5L0QB 4N0RA 3NCYS 4FQXD 2CR6A 2IANA 4NRXB 5DEGA 2CKBH 1YNKL 2VN7A 1CICA 4DZBA 2P8MA 3EDFA 2I5YL 5FOBA 1A6AA 1SEBB 2CQVA 3ARGC 4IDJL 3O2WH 3JVGC 3HHRB 4M48H 4OGZA 4XC1L 4MJIB 3UCRA 5B22A 2MQCA 3NPSC 1BFOA 2FJHB 4HMCA 3STLB 1MAML 4WW2A 4LVNB 1CDUA 2YOCA 5B8CC 3O0RH 1F11B 2UWEA 2DWEB 5EN2B 3VJ6A 1MLBB 3BHBA 2E7LC 1UYWH 4S1RL 3QPQD 1V3JA 3ESUF 4DEPB 5GRYA 2GJ6B 1F8TH 5DVOA 5FUZH 4FQJL 1DTUA 4JPWL 4S2SA 1XGQA 2VTFA 3L95A 3ZYZA 3IGAA 1F00I 1KBGL 4G6ML 1RU9L 1LE5B 1FJ1A 4HV8B 4GAGH 1VB9A 2HH0H 5FA3A 1UWGH 4IMLA 1CDIA 2VSDA 4ZS7H 3PGDA 2GY7B 2ARJB 1N3NB 1PY9A 5KSAD 4EXKA 4V2CB 4PB9H 1XGRB 4LKXA 1I7ZB 4R8WH 2EDQA 3FO1A 2R2EA 1OCWH 3CFCH 4NQSA 3U46A 4D0CA 5BV7B 5ACLA 2BY3A 3GMPB 3HUJE 2K1MA 1K3ZA 4NZUH 1AO7B 4D9QD 5D6DC 4D0BB 1A6PA 1T5XA 3O2DH 5I1IL 3B6SA 3JWOL 5GGSY 4TYUA 1ZSDA 2VKWA 3UJIL 5A16B 3CD4A 3ALWA 4ZUUB 4ZUVB 3VXME 1S7RB 1DQJA 2A83B 1JF1A 3CMGA 1MY7A 4LHQB 4UDUA 2Q87A 4APQC 1FP5A 4JFED 4PBVC 1IEAB 4WHTB 1U2CA 1G7JA 3O6KL 4ERSH 1JP5A 3WSQL 1BJMA 4PG2A 4DGIH 2AJXL 3ARRA 4JKWA 4LLYA 3JV0A 1U92A 2A6DA 3LPFA 5IV2B 4OBRA 1M4KA 5ELIA 1V3LA 5IFHL 1VEOA 4XWGL 3BDYL 3QUMH 1D6VL 5LBSL 3RZCC 4JFQB 5ADOH 3O9WD 3O8XA 3GJEB 5TE6H 1A9BB 1WVZA 4NRYA 1ITBB 4K23L 5EIVA 1CE6A 5D2NA 5DRWB 3DXAE 3SOBH 2OI9B 5H94B 1MIEH 3IDNA 4XHQA 4MNQB 2AI0L 4ZOEA 3VFOA 1HZHH 3QPXH 2HVJB 3A6BH 3W2DH 2D0HA 1JFQH 3EOBA 15C8L 1YECH 2X4OB 4YQXL 4XPHH 4AG4L 3L5WB 1IM3A 4CN4A 1YEIL 1UWXH 5C0IB 3H9SE 3ARPA 1HSAB 4PG9B 2BHUA 1I9IH 1XT5A 4ODVH 3TVMA 3BKCL 1UT9A 4PJ8C 3U1SL 1W72L 1IM9A 3NCEB 1KPUA 1AI1L 4OFYA 4GRLD 4HKZB 2PYFB 3Q3GA 3V8CA 3SDDC 2PW2A 3LQMA 4NDMA 2Z91A 5DEFA 2ZCKL 2C3WA 3VXRB 5HBBA 5GRZA 3RIAF 2Y72A 4PJAB 1SJHA 1AHWC 4OIAA 1NGYB 3E0GA 3PGCB 2VLRA 4LCWE 4GKZB 3C9NB 3KPRB 5B4MD 3JV4A 1JRHH 2BP3A 5DO2D 3LDBC 2YN3A 4E41E 1GCFA 2LTQC 3WXVL 4N8CL 3UTZA 2ED9A 4FG6D 3BFOA 1J9CT 2IBZY 4X5WA 5IESH 1CICC 1C08B 3VW3L 5DJ2B 1T2XA 2XN9D 5AD0B 3DYMA 4Z7WB 2ZG2A 1CFNA 5I75C 4PD4K 5D5MB 2DKSA 2WIIB 3GDBA 4OZHA 4XMKH 4OLWH 1OVZA 5BVPL 4HD9A 2CUMA 1AD0A 2W07A 3WFHA 1RFDL 4RNRB 1MPAH 2P44B 5D8JL 4JFXB 5EZOH 1PG7X 3HCVB 1CR9H 3W9EA 4XXDB 1MCCA 2IANB 5DEGB 5EC1B 3GSNA 4KKLC 3V4VH 2HFTA 3RBGA 1QFUL 2JTDA 1FH5L 2PUQT 2X4TA 4XP5L 1DBJL 4WI7A 1JHLL 1IC7L 3MBXL 1AXTL 3MGOA 2GK2A 4FNLH 3BZDA 5FYLE 1Q72L 5I19L 2GUOA 4YDKH 4U6VH 3O45A 3Q6FB 5D72H 1ES0A 2DDQH 4JDVB 3ARYA 1U8MA 2UWEB 4PJEE 1P5UA 5IT2H 3EO1A 2HFGL 3TA3A 4X7EC 1TQBB 5CZXD 4OGXH 1RIHH 4XZUA 2FBOJ 5BRZE 3SJVD 2AK4D 1EFXD 3C5SB 4WFFD 1HKLH 5F21B 3X3GL 3BPLB 4XRCB 3G6JA 3L3DA 1FJ1B 3MXWL 1QPPA 5FA3B 1A21A 4D2NA 4HJ0D 1JWSB 2Y36L 3ARUA 5HJ3A 4P2OB 4FQ1H 3R0NA 4TSBH 4RGNB 2DLFL 3QCUL 2QHRL 4HX1A 2UYLA 5EDXA 5EO1A 1MIMH 5DFVC 2R2EB 1TXKA 2G5BB 3WHE0 3U46B 1MRCL 5LCVL 4FQXA 3IDJA 1DL7H 4HS8H 3LS4H 5DURD 2VLJD 5D7LA 1IZJA 3OKLA 4FZEL 4M7ZB 2MKLC 4MB5A 5JXEC 2DM4A 2F58H 3GBMH 1PFCA 4NO5A 2Q20A 1CBVH 3G5VA 4X6CF 2VXSL 2XY2A 5F6HI 3O8XC 4P5KB 2BOCA 2A9NL 5CMAA 3T8XB 4YDLC 3VXPB 2FDBP 3HI6H 2J88H 5CHNB 3QQ4A 2CH8A 3SDAD 4GSDL 5D70L 1JNNH 5EU6E 2DQCH 4ZPTA 4MD0A 1G7JB 1RUMH 4MA1B 1DSFH 3K4AA 3BOVA 2Y23A 3H3KA 5TQ2L 5HDQL 2R8SL 2DQIH 3BEWA 4OFKA 5CKGA 3HR6A 3NBNA 1LO2H 2B4CC 3RKPA 1L7IH 2C3HA 4XAWL 2FSEB 4MMXC 1KIQB 4LU5H 5ICZA 4PRAA 1H9VA 4HQQL 4MCYB 2WV3A 4IRSD 2XWJA 5LXGL 3CFIC 5HHVH 4LDOB 5F9DC 4NZTH 3MXVH 1A6WL 3MQIA 5L2KE 3HMXH 4NRYB 1FLRL 3FT4B 4LSPH 5D2NB 1JMXA 35C8H 4LVOC 4Z5RA 2EIDA 3TPUA 4FXGA 1LEIA 4H25A 3HC4L 1KELL 5F9OL 5FM4A 5ACMA 5KSAA 4Z77B 2R0KH 4X5XB 3RNQA 3PWPE 1I4FA 2OK0H 4P2QB 5I1JL 1K6QL 1J5OL 2QKIA 1T20B 1AH1A 4GAYA 1MCSA 4BM7A 3ALPA 3TVMB 1MWAB 1IGTB 3CK0H 1U0QA 4O2CA 1BQLL 1CWVA 1EAPB 2X5PA 3N9GH 1MUJB 4X9FA 1KT2A 3FQWB 1A7RL 1MFCH 5I1LB 1NGXA 3NN8B 2DIAA 2PW2B 1P4BH 3K2UL 1GHFH 5DEFB 4FXKB 5CD5C 3RGHA 5EBGA 3IVKA 3F7VA 4JN2A 4JFEA 5KS9B 4U2YA 1IKNC 3U2SB 3BO8A 1DN0B 1KJ2A 1WBYB 5GGTH 1XGPB 3PL6B 2GY5A 2BHZA 3I2CL 1MWAL 3WEXB 3FTGB 1R3IH 4HF5H 1WC7A 3TEUA 3FFDB 4NN6B 1RI8A 1NCAH 2VLKE 2V5SA 2N7AA 4EQ3A 1KLFA 4L3EB 3HUJF 4HEPG 1FFPA 1WCBB 2OR7A 4F57H 3OZ9H 1A6UL 1CFNB 3O9WA 4K8RD 5I1EH 1E6JL 1JWMA 3GIZL 4AEHH 1FVDB 4MA7H 4K2UL 3UROR 1CFVH 4QRSA 3TIEA 4UNVA 1YQ2A 1UWXK 4XAKE 2CIIA 3HRZA 4LCCA 4NWTL 1JWUA 2BHYA 4LP5A 1TJIL 3L3GB 1IZKA 4NGHL 3U6RA 4ODTH 1FAIH 2R4SL 5I6XC 3P4OA 4FMKA 2V7NA 3QHFL 5IW3A 2OJEA 4PJHE 4GRLA 5CEXA 3VXMD 3EYVA 1TCRB 3IFPA 3ECBB 3HNTL 1FFNA 3U0TA 5KSVA 1E27B 1QG3A 3V2AR 3ZZ1A 1ULVA 3QDJB 4MAUH 1ES0B 1RHFA 1RULL 4XNXH 1QR1A 3MBEC 2EKJA 4LSUL 5F7MC 1QSFE 4JZJC 1VACB 4X7TB 5GJSH 4AL8H 1MJ7H 3AREB 4P57A 3REWA 2UZIL 1E4KA 5GGQH 3BSZH 4DVRL 4XZUB 2VR4A 3X11A 4L29A 2WUBL 2XN9A 5CBEB 3EYOB 2XWTA 2EIZA 1S3KL 3L3DB 1RUPL 4X8JA 5T1MA 3DVIA 4GJTB 3DXAD 1C5BH 3ZKNC 2IGFL 5GRJL 3MRFA 3QEUA 3GRWL 4MXQD 2J4WH 3FONB 5JW4N 2HAZA 1KB9J 3VG9C 2MQ3A 4HX1B 1KCRH 4PJBE 2PO6A 4NRZB 4NNXA 3O6FC 2R0ZL 1ZTXL 3FO9A 5T1DL 3QPQC 1TTUA 5EA0H 4P59L 5I15L 3CFEA 1CD8A 5D7LB 5CZKA 1T21A 3WXWL 4IIQC 4GFTB 4ONGL 5IFJB 4NCC1 4PRNA 5E1AA 25C8L 2X70A 3QH3B 3G5VB 2ERJC 2BOCB 4X6EB 3W39B 3U4BH 3QNZA 4WENB 4R2GB 4MXWL 1UB5B 5FHBL 2WQ8A 3UTTD 4DK3A 3MRIA 2NY6C 2I25N 4XMPH 1O5DT 3QQ9D 4LCWD 4NFDA 3IU4L 2IFFH 3OB8A 3D48R 1ZVHA 1RUQL 2Z92B 2R69H 4Y4FB 4GAJL 1CLZH 3BEWB 3M45A 2ADGA 3PIQA 3NZHL 5HGDB 3EYSH 1BF2A 2FX9H 2EYRA 3WN5C 2AQ3A 1QHPA 4MX7A 2AK4A 5CJXC 1EFXA 3KWWA 3SJVA 2AEPL 1UZ6E 1SJXA 3LKPA 4J12A 1A7OH 1FBIL 3VGBA 4DUXA 3U9UA 3UO1L 4Z5RB 3TPUB 4JKLA 5CAYB 5MEQB 1AQKL 3PWNB 1F58H 4MYWB 1TDQA 4M03A 4U3HA 4J1UA 3GI9H 4JFDB 2QKIB 3SQBA 4GAYB 4XP4H 2VLJA 4PJEF 5FYJU 4U0RB 2JF1A 1T1WA 2IG2L 1D5IL 5LGJA 1HIMH 4BK5A 3O9WC 1UENA 2DD8L 3MRNA 1IGJB 1HCFX 1JTPA 1OF2A 5FYLD 4Y1AB 4OV5A 4QNPF 3SDAA 2DKUA 2EEDA 4F9PC 4PTUA 4JFEB 4Q9CA 2APXA 3ZMRA 1FORL 3ULVL 3WFEL 1VENA 3FRUA 5GGUB 2N1KA 4F7MA 4Y5VA 4X6CA 5IF0A 1U3JA 5BO1H 4P23B 4YEEA 5BRZD 1NC2D 1MHHA 4N9OB 4EOWL 4XPGL 2Y07H 4HWBH 4KQ3H 4C4KT 1MNUL 2EZ0D 3IDMB 3VMOA 1G7MB 3KYNB 3O11A 4JHWL 4OTXH 5BCAA 5EORH 1CFSA 2Q8BH 4Z7VE 3ETBF 4NT6A 4OSUH 3OQ3B 4I0PC 5CIPH 5C2BH 3MNVB 2J6EL 4LQFH 4PV8A 1HXMA 4MLIA 4NIKB 4R4ND 4Y7MA 5ITBL 2BXZA 2ZOKA 3MRCB 1TVHA 4R0LC 5FCSH 5SWZE 3UMTA 5L8KB 4DCQB 3LY6A 1MVUA 2MPAH 4UU9A 5B4MC 4YX2H 3G6DH 1CD0A 4HXBH 1AY1L 1FVCB 4FA8A 2IPTH 1JUFB 5JHDE 2AEWA 3QDHA 3MNZA 4FG6C 5HHNB 3P4OB 3LEVL 2NY4C 4J8RA 2COQA 2V7NB 5IEHA 1Y6KR 4PJFE 4PP2B 1Q94A 1KC5L 2NMSA 5TF1H 3B8YA 4W6WB 3LB6D 3IFPB 4NQCB 2Q6WB 3U0TB 2C4XA 1IAKA 4QTIL 5EC2A 5EU6D 4WI8A 5KSVB 3QP3A 5E2TH 4UV7L 4BSWA 2P42B 1HHJA 1K8DA 2C1PA 4NWUH 1NQBA 1E4JA 4HS6B 3VDAA 5LGHL 2CJUL 4OF7A 3REWB 3RY6A 3JV6B 1T7YA 2FO4B 5E2VH 5FF6A 1EH9A 3IDGA 4L29B 3MO1A 5HYSB 5JNYA 3MRLA 2WIMA 1ZA3A 5L2KD 3K81A 1JTTA 1UH2A 3BI9X 4W6YB 1DBAH 3UTQA 4ZFZB 5DJZB 1E4WH 3MLTA 3NGBB 1T89C 3VFTA 5ANMB 3ARDB 3R1GH 4R97B 3QWRA 4NYLA 2XZAL 3LN9A 3HUJA 2PO6B 5DVNA 3SCMD 4ZFFA 4H0HB 5L2JB 1KN4H 2A6IA 5E2UL 5I66A 1IAOB 1FO0B 3SE8L 4XT1C 2CKNA 5I76A 2GITB 3MRRA 1YEJH 1U42A 5E1AB 1UFUA 3D0VB 4RQQB 4JM4L 2HFEA 3VXMA 3ZSSA 3IFOB 1TIUA 2J1KA