3OKOB

Crystal structure of s25-39 in complex with kdo(2.8)kdo(2.4)kdo
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
219
Chain Sequence
EVKLVESGGGLVQPGGSLRLACATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQSSLYLQMNTLRAEDSATYYCARDHDGYYERFAYWGQGTLVTVSAAATTPPSVYPLAPGATNSMVTLGCLVKGYFPEPVTVTWNSGSLSTGVHTFPAVLSSDLYTLTSSVTVPSKTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords S25-39 Fab (IgG1k) light chain
total genus 41
structure length 219
sequence length 222
ec nomenclature
pdb deposition date 2010-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okoB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okoB01
3MV11 4KK5D 5J56B 4L3ED 2B7DT 3KJ6L 3MLXL 3D0VB 4PJHA 4HKBA 3VWKC 2J8HA 2J8OA 1DBKL 4HUWB 1KT2B 5F88A 4OF0A 3D5OF 2ZCHL 2Y5EA 4X8JA 2ICEB 1KIPB 3V0VA 5EO0B 4Y5YC 5EZLB 3MXWH 4XNQA 3MNVB 5T3XE 3GMNB 4LHUB 3QNZB 3VFGH 4M7KL 1IGJB 1UJ3B 1OGAB 3F7YB 3ES6B 4I3RH 2IFGA 3DXAD 3MUGB 4ORGB 1S9VA 4FFZL 4ZFGH 5I30H 5DZLA 2X6MA 1RZ7L 4O51A 4EKXA 1OAUL 2YK1H 3NACH 1FORH 4LF3A 1C8PA 1CGTA 2YPKB 5BZWA 5DHVA 5IESL 1YN6A 3MOBH 3TH4T 2F53E 1YEGH 4ZUTB 1I1CA 3BFOA 4Y1AE 2BNRD 3LN9A 2BY2A 2DM2A 3GIZL 5MEQA 3KXFD 1FAIL 1D3CA 4AH2A 1S7RB 2PW2A 3EDFA 5F1KC 2PR4H 4NN6C 5E8NA 1XCTB 3O3BB 1UC6A 2MSPA 5FYKE 4R90H 5KS9F 1T0NA 43CAA 3BJLA 4F7CA 3GIVA 3CLEH 2AJVH 1LK2A 4NCC2 3L7EA 4YDVB 5AAMA 3GRWL 4RGMB 4LQFL 4L29A 3LQZA 1UH4A 3ROOA 2EKSB 1MAML 4LARL 4I0KA 1GSMA 4QGTA 3LH2H 4IOIB 1E4KC 2DQHL 1TJGH 5ANME 3EUUA 1CI5A 4KKNA 3WNLA 3MLWH 1HK6A 1LP9F 4X0KA 3VG0H 1N0XH 5I19L 3AY4A 1S78D 3C5JB 4KK9C 2EE9A 2GFBA 1MCWM 2MCPH 3NH7L 5I1AA 2VJXA 1MHHB 1LO0H 3VXMD 5D5MF 4MJ5A 5JOPD 4KTEL 1JWSB 4ZPVA 3D85B 2HRPH 5F3BB 3QG6B 4JVUA 3QUZC 4S1SH 1U8QB 5CEYA 2WLZA 3FQNB 5F96L 1U8QA 3PQYB 2VDLH 4D0CB 4ETQB 3QZWB 1L9NA 1ZV5A 1JNHB 1B6DA 4K7PX 3Q6FB 2P8LB 1SMOA 1A1MB 4PJEA 4GAJH 3HZKB 3QA3B 5LGJA 3PHQB 1P7QB 5BS0D 4JZNB 5MENE 1NMBH 1YMME 4ZG1A 3GM0A 4WWKB 4PRPB 4BM7A 2IPTL 2D9QB 1Y0LA 3MJ8B 3DURA 5CD3B 1JFQL 1OT1A 1PSKL 1OGAA 3CXHK 4QHUA 3WFCH 1B2WL 2YC1A 4U31A 2C3XA 4YBHA 1HEZB 4LVOC 3O6LL 1NUDA 2FO4A 1DQJB 4JHBA 5HXMA 2CIIA 5D5ME 4RMRA 4I0PD 1G9EA 4Z7WA 2LV4A 1HXYA 1RJLA 4NHCH 4Y5XB 5H94B 4OZFH 3CCHB 3IB4A 4NO0D 5IF0B 2B39A 3FO1B 3RU8H 4LSSH 4DGIL 1KJ2A 4JZOA 1OP5K 3BPLB 2Q86B 4ZUTA 1JPSL 3BH8B 2V6HA 3VXME 1T21B 2UWEE 3SBWA 1OAQL 5KZCB 1SJEB 4KY1L 1UB5B 1FL6B 3P73B 5F93C 3QP3A 1CXLA 3HC3L 4PRBA 2IF7A 3C5SA 4HS6B 5EU5A 2BY1A 3QUMA 5TH2B 4B0MM 5CIPB 4L9LA 1VADB 4QRSA 4RGNE 1ZHNA 4M93B 1NFDF 4KJYA 4TUOA 1BLNB 4P46C 1A4KB 3RWFA 3SGDH 5HI3D 4KGJA 1UZ8B 1JYVA 5CP3H 2YOCA 2IALB 3GGWA 4UT9L 1W0VA 3U2SA 3FQRB 3FO2A 4APQC 3ZYIA 4HW6A 4ZAKA 4FFZH 4ZFGL 1U95A 3AB0C 3JV6A 4J3UA 3MNZB 3VFMA 3OJDB 1CLOH 5JW3H 4D3CL 1DQQA 3Q5OA 3HCVA 3NGBB 1DUYA 5IGXH 5JXAH 3VDAA 4UBDC 3DSFL 1ZHKA 4FHBD 4HD9A 4PJBE 4CW1B 3WDJA 3MJ9H 4JFQB 2CIKB 4YGAB 1I7TB 4NIKB 1CDIA 3QULA 4C55A 1RZ8B 3F7VA 4PYHA 1CWVA 1FPTL 2O5YL 3BP6A 1OWRM 1U3ZA 1EEQA 4HLZH 5E03A 5CJ5A 4MZ3A 5ICZB 2F58L 3ZKMC 2EEAA 2F54E 3VD9A 4G9DB 1Q9LA 3JWOL 1OVZA 4KDVA 5HYEA 1P4LB 1U42A 3ISWA 1ZLWH 2WZPD 4I0PB 3ARED 2P1YA 4OCYL 5L2KE 5FF6A 4NO0B 1LO3L 1KTDB 5HPMA 4Y1AD 3X14A 4RAUB 3ARXA 2OI9B 4G8GA 4J3SA 2V2TB 2IGFH 5DS8A 1UADC 1E4WH 4UQ3A 2AJZA 3GJFB 1DBAH 3NACL 5BV7C 4CL7A 5J3HD 5GXBB 3QIBB 5KSVA 1KBGH 3G5YB 5DVLA 2DQFB 5J9PB 4RWYH 5C0CB 3DGGB 1JYNA 3QRFM 4Y8DC 3CUPA 3O8XC 5F44A 4JVPA 3BO8B 3UJTH 3R06B 1XGYL 5C0AB 3OKKB 4K55A 1MCFA 4CJ0A 3MLPA 4RGNC 2E5EA 1A22B 5B4MD 1TPXB 5F9JB 1MHEA 6FABH 2AQ2A 5KJRL 1J5OL 1QQDB 4K2UH 4FQ2H 3SGJC 1KGCE 1CFTB 5HGAA 3QR2A 4KQ4H 1LDPL 2E6QA 4I1NB 4MB3A 1M05B 1FGVL 4EN3A 1PX4A 2F5BH 2E7LC 4OFIA 4LIQH 2IAND 4I3GA 3KPLA 1PKOA 1A4JA 4Y4HC 1K5NA 2HJFB 1NBVH 4I5BA 4JM2C 2H1PL 4OLUH 5TFSL 4J12A 2A6JB 1NCWL 1E4WL 1SJXA 2YD2A 1B0GB 5EBMB 1UJTA 4ZO9A 1HOCA 3GSNB 2VSCA 4EOWH 4JPWL 4Z7VF 3T2NH 4ODHL 3V8CA 3A6CL 5I74B 1UWXK 3C5ZB 1CGYA 1N0XL 2A38A 2IH1B 1DQML 1A5FH 3KPNB 3BEWB 1I8LC 1MNUL 1RUQH 1E0OB 1MCPH 1ETZB 5ADPH 4FQPA 4MJ5B 3QXVA 5EUKB 1FFNA 2WP3T 1PZ5A 1IAMA 2K7QA 4KZEH 3ZTNL 5IB5B 3SO3B 5I1IH 5BVPH 2BOCB 3TVMB 3WIHH 2XTJC 4GBXB 3MRFA 4NRXB 4ZTPL 4I4WB 1LEKB 4PJ5E 1BOGB 2YXFA 3MRFB 2GHWB 3RTQD 4BSWB 3LCYA 2AK1L 5DURD 3GSVB 1G0DA 1GL4B 2CH8A 3SKJH 3LQAC 2X41A 5IMMB 1BVZA 1QFHA 3MUY1 4U4BA 2H9GB 4J6RL 3CFJA 3HZKA 2DTML 3HNVH 1RAMA 3MV9E 3MRHB 2R9HD 4JCMA 4PGEB 3DX8A 3QIWB 5D72H 3WUWB 1FZOA 2QR0A 3H2WA 4M7LT 4YAQB 5ICYB 3WFEH 4OAWB 2H2PD 3AREC 1TCRA 4RQQA 4YDJA 2XACC 2Z93B 4X9FA 1DVFC 2XA8L 4M62L 4M8QB 1X5HA 2P5EB 1BVLB 4HQQL 4Z7OF 5IFJB 3QCTL 1I85A 1KUMA 4WFGD 1TENA 2C4FU 4RISL 3IKKA 3MV7D 4LKCB 4OI7A 1XFPA 3UXFA 1KELL 5CBEA 1U8LA 3EO9H 3U0TA 4DW2H 4XCFH 5GS1A 3GSRB 2JF1A 3GHBH 3TA3B 3CLEL 4XPFH 2I24N 4GQ9H 3JV0A 3HI6L 4UOW0 1CFQA 3O6FB 1QVOA 2A74B 1G7HB 4MA3A 1EXUB 3RY6A 2AKRA 2CPCA 4M7ZC 4CVWA 3R8BB 4K94H 4LPCA 4XP6H 4LLMB 4Y4KD 1PY9A 4L5FL 3RWCB 3W0WA 2YBRA 4PJDF 5HGBA 5IHBA 4JFHD 3QUXA 4MHHI 5IROC 3T2QA 3MLSH 1H3WM 2JK5B 2FR4A 3U46A 1FDLL 3X12B 2FSEB 2QSTA 4GLRI 3BXNA 3RIAK 1FCGA 1AGBA 4HSQA 1HI6A 3F7PC 1CICD 2FSEA 3LSOA 3OKLB 4Y4FB 4CJ1A 1KIRA 4XPTL 2CDFB 3E8UL 1AY1L 4RWHA 2GEEA 1AIFA 4GKSA 1UVQA 3RY6C 4WUUA 4DVBA 4HFUH 1FGNL 1DBJL 3RJDA 2NTFA 3QUMB 3D2UB 3L6FA 2BERA 3ZTNH 1AGCB 3THML 1B0RA 5I73B 1L0YA 3EYVB 4LSPH 5MP6L 5BV7H 4PG9A 2EZ0C 4K3GA 1FN4B 4LP4A 4CVZA 4DTGL 5MEPB 2DKUA 3MGAA 2HVKA 4RAHA 4H0IA 2AK4D 3VXRE 4LDLB 4JO2H 1CCZA 1ORQA 1S7XB 5C07B 5JZ7C 3DO7B 3V5DB 4G6KH 1N4XL 4MQXD 3IETA 5KANI 5D72L 3VXSA 1R6VA 4G3YL 4X6FA 1AXTL 2VB5A 4EUPG 3KG5A 3FB8A 4OFVA 4GH7B 1QNZL 1PBYA 1N6QH 1KIUA 3J7HA 1BQUA 1H9VA 1P84J 5F7EL 1J1OH 3KHQA 1MCKA 1T66C 4X6DB 4UOJA 3B5GA 1Z3GL 5JDSB 2R8SH 4XX1G 3B9DA 4JRYB 4KRNA 3VWJC 4RQQB 4F37K 1YNKH 1UYWL 1KYOJ 2E9BA 5J7CC 5JOPE 1RUKL 4OD3H 2OYPA 5E5UB 4YO0B 5ACLA 1U3YA 4WFHD 5DRNA 1IM9D 5I8CB 5ELIA 3DUSA 2C1OA 5BS0B 2YZ8A 3WBDA 3GFUA 4WWKD 1EHLH 3CVIL 4ELMA 3RA7H 1G9ML 4JFED 1CTOA 5DGQA 1HSAB 12E8L 4LDEB 2HG5A 2EXYD 3EIFA 3WO4B 3VFWA 5ID1A 3QXAB 4DEPB 4QTIL 1EBAA 3BW9B 3MRCB 5KZCD 1P4IH 3FFDA 3S3PA 1WAAE 3P3YA 1MQKH 2FBJH 3NTCL 4QRPD 5FCUL 1OAKL 4CNIA 1KACB 3BUYA 3NFNA 5BRZA 3LPGA 3GMMB 4BQCA 5CJOL 4FQHB 4XHQA 3VXUE 3O45A 2F8OA 2RGSA 1AO7E 2W0KA 5DRWB 2G5BA 1IGFH 4RFNB 3QUXB 1B9ZA 5EOTA 5C0JA 4P2QE 3MMEB 5LXGH 4NDMB 1VFAA 1G6RA 3VXOB 3M1BB 3EYOA 4O2CA 3BHBA 3INUH 1TVHB 8CGTA 1JGVH 1KB9J 3GUTB 1LVEA 1EHLL 2P5EE 4M3KB 3L3JB 5IV2B 1TCMA 3BKYH 12E8H 4K23L 5J13B 4NN6B 5IIEA 1Y6NR 3DROB 1Q94B 2VZVA 5J1SC 1CVSC 2MKWA 5IB3B 3MJGX 1YNLL 1WWCA 4XXDB 5DEGA 1XF4B 2H2SD 2CLRB 2VISB 4IRSC 3BH9A 4HC1L 3TBYA 2DIJA 5IVXE 2A6IB 3IFLL 1MHPL 4WHYG 4XNUL 2D03L 1KOAA 3DYMA 4PGZA 4BFIA 1F02I 1A7RH 4C56A 3VD3A 1OP5H 1FLRH 1V05A 1W72B 4ZFFB 1AD0A 5EU6D 4WCYH 3PWLA 2ZSWA 2QEJA 3EAKA 3MACL 1LWRA 1TETH 2CLVB 1OHQA 3MRDB 5ACMA 4ZUSB 4X7TA 4KAQH 3PQYE 2FD6L 5TJWK 5JDSA 4LGRB 4H1LH 5ENWB 3MCKB 3GSVA 3QCVH 4Q97A 1U36A 2FX7H 3PWNB 4YHPB 5DVOA 5IM7B 2NY0B 2C3HA 5FUZL 2HJLB 1KNOA 4L4TE 5BMFL 5KS9E 1NUGA 5F8QC 4CDGC 1UZ6E 5CEZD 2ARJB 1DVFA 2YZ1A 4PGCB 4S1RH 4LVOB 4H20H 5IBLD 4OIIH 1EZVX 2AVGA 1SEBB 5GGVH 2VN7A 4KC3B 3FT4B 1UXWA 4UOW1 1TLKA 3QIBA 5FO8B 4ODWA 3OKNA 5CD5D 5FCUH 1M7XA 1JNLH 1FZKA 4DKFH 2CRZA 2HN7A 3OGCB 4L5FH 3D39E 4HHAB 5GHWL 5DD5L 2Y6SD 2P5WA 4JZJB 1MNUH 1RUQL 1U8KB 3ARZA 2RAMA 4WU7A 5FM5M 5HHOA 3D0LA 3EW3B 5DRWA 4YUEL 1U3JA 4HK3N 1JGEB 2I26N 3B8YA 4NZTL 3AFLA 2DLFH 3SEPA 5CP7A 4PYGA 3W9EA 1KIRB 4HWUA 4F2MB 4WJ5A 1I1AB 3KLAA 4NO5B 4OZGB 3O3BA 3RWEA 1IGTA 1KLGB 1MH5B 3MA7A 4FQQB 5DI8B 3UZQA 1IGTB 2PXYC 5F7KC 4JY4A 5E2WH 1IJ9A 4QRSB 5IEKB 2AXHA 1XGPA 3VFUA 3D6GA 4JQXC 4R7DB 1JNNH 3HN3A 5E6ZA 4YXKH 5JOFB 3IGAA 4RNRB 5GS3A 3LEVL 4MDJA 4HZLA 4CVUA 1FHGA 5I1GL 1I8KA 2AABL 4AEFA 1GGIL 5MHSE 4JLRB 3BKCH 4N8VA 5HYSB 4EXKA 4QRUB 3T4AB 4NNPL 3EJYC 2FB4H 3T08A 4N8PA 2BOCA 4BFIB 1YYLH 1GIGH 3LV3A 1ZMYA 4TULL 2W9DL 3B83A 3FMGL 3O0RL 3IDMB 3N85H 1H3TA 5I66A 1CU4H 1OB1A 3VWKB 2AERT 4KDTC 3C6LC 4YFLI 1RZ7H 2J2ZA 2PKDA 1XGQA 3HI6H 3AGVA 3CFJB 1JWUB 2ITDA 3LQAL 2DWDA 4K8RD 2QQLL 1TJIH 3PWNA 4YHPA 4ODSL 4WTZG 3O2DL 3Q2CA 4JQIH 3CVHA 1BFOA 3WFDH 3R8QA 3T0DA 3C5ZC 2GQHA 3MRPA 2Z93A 3MC0A 3TPKA 3W11C 4OZ4B 3GBML 4OLEA 1CGSL 1DSFH 2IAMA 1BIIB 5KN5B 3O8XB 4CVXA 4PGBA 2HT2C 3H9ZA 3LHPL 2CXGA 1WIOA 4FQLL 1YEJL 4LLYA 2AJZB 1UXWB 3GJFA 1D5IH 3LEYH 3UTPD 4MQTB 3A67L 4BZ1H 1WZMA 1IQDB 2OQJB 4WI8A 4X4YA 3FO1A 4M1CC 1GGBL 4UIMA 4R2GD 4C54A 4PREB 4GBXD 3GJEA 5DXWA 1BBDL 4EUPH 4XWGL 4I77H 3BKML 3VMOA 4LQFH 1KEML 3CMOH 3KLSA 4PREA 1A6TA 1AO7A 1YQVL 3PGDB 3THMH 4RCAA 5I17B 1UQSA 2DWEA 3LKPA 1NFIA 4JZJA 4V1DE 3MJ6A 3GMQA 5DMKB 3BAEH 4Q6IB 2GK2A 4WI2A 4BH8A 5L7XH 4BJLA 3HNSL 3ARBA 4LLUA 5I1LA 5L8KB 2PTTB 3OQ3B 5BXFA 3C5SB 4OGAC 1G9NC 5EBLA 1IAIM 1N3NB 4CADA 3CK0L 2DN7A 2VLRE 1DEEA 4XMLL 4EI5D 5EA0H 2XQBH 4JY4B 5HTSA 4F33A 5I1GH 3FL7A 3IDXH 3JWDC 2VR5A 2WBJC 1YEJH 3OXSB 2OP4H 4MJIE 4YPGB 5EBMA 5JMOC 1ZHLA 4JM2B 1DQQB 1J1OL 3GI9L 3S96B 1A14H 4FOMA 3VXOA 5DUPL 3QDJD 1MCWW 1CN4A 3BYYA 4W6YB 1QRNE 2WUBH 1D6EB 2V7HB 3MGOB 3LZFL 3FQXA 4P3DB 4JJ5A 3BEWA 2CO6B 1BZ9B 4MA7L 4R26H 3NZHH 2BMKB 1LP9B 2JCCE 3H42L 3WLBA 3F62A 3QUZB 1S9XA 4PP2A 4LSVH 3MLTB 5DC0A 2V5RA 2ZNXA 4PJ5B 3WFCL 2R1XA 4WFEE 3TEUA 4P0DA 1TJGL 3HLAA 4NQVB 3MJ7B 5B4MC 5C0BE 1NBYB 1F4HA 3SE4A 2HLFD 2VAJA 2DQUH 4L8SB 3NCYS 1B3JA 4RFEA 4S2SB 2ARJA 1DVFB 4NC0B 1IQWL 3C87A 4K3JL 4DGIH 4ZFFA 1G9NL 4ZXBC 2Z9TA 1F4WH 2A77L 2NW3A 2V2TA 3CVHB 1CLYH 1S3KH 4HG4J 3FZUD 4ZAKD 3KPOA 1HIML 5D1XA 3UBXI 3MA9L 2BCKB 4QYOA 3ULUF 4AT6A 3MQIA 4GXVL 1G7PA 4V1DD 3ZO0A 5C0CA 3QDHA 4HXBH 3BRFA 5T1KB 1MIML 1AE6H 4FMFA 4WI5A 3VXRB 4LHUA 1OF2A 3SDAB 5C07E 1AKJB 5GSRB 1BD2E 4BFBD 4U1HA 1KJ2B 4NNYA 3MO1B 3B4NA 2NNAB 5EDXA 5ADOH 5GZOC 3D0LB 4JY5H 5GGSB 5AG8A 4H0GA 3ARQA 4Y16A 4LGPB 1CGVA 3TPUA 3VXTB 4OZHB 3OZ9L 5KTEH 1MWAH 2NY2D 3RZCC 1ZT4B 1CFVL 5TH2A 7FABH 4LNRB 5H35A 5H35B 1S3KL 1MVFA 4PJ7F 4NO3A 5L9DH 3GMRB 2QADD 4FA8A 1XF2A 1N5YL 2ADIA 4P99A 1YEIH 3RWIB 3B6SB 4I3SH 2P45B 3EOTH 1ZT7A 3RWIA 3X12A 4XP4L 4CMMA 4O2CB 2NW2B 4UZGA 3X13B 2DKSA 2OR9H 5CKAA 3NGBC 5IMKA 5ITBH 3KGRA 1NKOA 3FTGB 1ZHKB 5F7DA 4FG6D 5IR1B 2ZUXA 3QFJE 1JK8A 3AMLA 4UMGA 5SWQA 4PB9L 2I07B 4G8EA 5AZEL 5T1DH 1IVLA 2F8XC 3EJZC 5BRZE 1VHPA 1T6WA 4RMQA 4O9HH 4ERSL 4MVBC 4ZAKB 4W81A 4HS3A 1WZKA 4BSWA 1Z2KA 1HKLH 3DOSA 1S7VA 4OIIL 2A6IA 7FABL 3RZCD 5EU3B 1RHHA 4NGHH 4F3FB 1ZSDB 2UWEA 3WNNA 1LO4H 2V7NA 2N56A 1R3IH 1D6VH 1ZA6B 3MNWA 1DANU 2DQEL 1UWGH 4PJDE 5HGGS 3W5NA 3RGHA 4QOKE 3FONB 2X1OA 4KTDH 4RFEB 3FQNA 4ZXBA 4KV5F 1QFWI 1DSFL 4WI7A 3QHTC 4X6DE 5D7KD 3V6ZA 1FFOB 1DL7L 4X5XB 3PDOB 1MIMH 2UZXB 1UG9A 5TDOA 4JRYA 4HWEL 3W39B 3EYFA 5IHUL 4GMSL 4G6AD 3DSNA 1SVCP 1WSST 1LHZA 2EH7H 4RA3A 3SGEI 3WO4C 4KHTH 1YQVH 3TYFB 2R4RL 2PO6C 3FB5B 1OSZB 4HV8A 1CZ8H 2YA2A 4NQEA 1MJUL 4BKLB 3BAEL 4BK5A 4HKXA 1CFQB 3O6FA 4LVEA 2M2DA 2BP3A 5L88H 1I8IA 3IT8D 5GRJL 4MQ7B 1FNGB 3SKNB 5I8OH 3IDGA 2A9MH 2AKRB 5KSAD 2OS7A 1NSNL 2A6DA 3CH8A 3DX7A 3VXSD 2DQDL 2ESVE 3FOMB 2A6DB 2NY6B 3FFDB 3PWJA 32C2A 4X7SL 4EDXA 5DD1L 1MCPL 3S4SG 3RAJH 3ZT5A 3CVHL 3HG1B 3SKOA 4X6DF 1EJOL 4LSRH 1KENL 5IW6B 1GCFA 2APBA 4HIIB 5ISZA 4JGMA 4JE4B 3BD4A 5FHBL 4NFBA 2A9NL 5DQJB 4FMKA 3REWA 3IJHB 4UT6L 4G8GE 2GTZA 1PZUB 2BFVL 5D2NE 3C08H 5TE6L 4JGJA 4XBEH 1FFPA 4ZMAT 5IQ9B 3FHAA 3U0PB 3M1BA 4CMHB 3MRBA 4GAGL 1E27B 4TVPH 4HGKC 3TNNB 2I9LA 2WIMA 1MHCA 2DI9A 3DETC 2APXA 4IMKA 4KKCC 4R8WH 5B38B 2A6JA 4KI1A 4OTXH 4OCWH 1D5BA 5H2BA 5TGBA 1HH9A 4MCYB 2XTJB 3I02A 1QSEA 4N0UE 4XHJD 4BQ9A 2EIZA 4N0CC 2DAVA 3JTTB 3I02B 3TZVB 2AP2A 1C5BL 4DOHE 4Q2ZA 2XRAL 1FVDA 5D7KE 1MRCL 5IVXB 5DK2A 2NX5E 3I6LD 4NJAL 4MJ6A 3TFKC 2A6KA 3WJLA 3PL6C 4LHQB 3LKOA 1WTLA 3SDXB 1HHIA 3SDAC 4B41A 4PLKC 5M95B 3DRQA 4OZFG 2CKBB 1SYVA 1DL7H 2HVJB 2VLJA 2EDDA 4Z7NF 1GHFH 2BVPA 1MJ7L 2D7NA 1BM3H 1G0XA 4OCRH 4NM8L 4ENEC 4A2MA 3ULVL 3HZMB 1TJHL 3N0PB 1KJ2L 1CDHA 5IHLB 4KQ3H 4ZOAA 2EH7L 4HJGB 2L4OA 5ANMB 1G7IB 1T2JA 3ARGA 1GRWA 1NUNB 3NN8A 4PRAB 3X14B 3T0EA 2EYTA 4QXTB 4MWFA 4U1HB 1B2WH 1J0JA 3S4SA 5DA4A 3H7LA 3VMNA 1VESA 4PRNB 5I19H 2GJZB 3IFOA 3HI5L 5JPMB 4PLKD 4QWWD 2WWKT 4OT1H 3MBXL 4D0DA 3CH1B 1TFHA 5LGHL 2ZUQC 1AQDB 5FUCE 4IIQA 4WW1A 5LCVH 5F1IB 3FQTA 1UWGL 4ELKA 3CXDL 3MRIB 4OM0H 4Y1AB 5F1IA 1KELH 2YBRB 4RWYL 4PRHA 2H2SC 2PETA 5F96H 1JGUL 2HKHL 2ADIB 3KPRA 1DR9A 2Z31B 1RU9L 2BX5A 1ADQH 1XEDA 3BQUD 2VOTA 5EU6E 1LE5B 4JZJC 4YBQC 4OQTH 4JG1L 1LE5A 4HXAL 5C0AD 1DBKH 4WJ5B 5BZWB 1NAKL 4NBXB 1E28B 4JPKL 3ZYJA 4EBQH 5IV2A 3RWEB 3ELAT 3IKCA 4WFHE 4UV4H 3C8KA 4LARH 4MAUL 4Y8AA 4JFPB 3FQWA 4OZIB 5HHME 2NR6C 1D7FA 5C9JB 1FLTX 5HI5C 3JTTA 4OLWH 5JR1L 2BVOB 3V4PH 1WCQA 2FECI 1J7VR 4A6YB 4Z78B 4U6YB 5FHAH 3DV6A 1MHHA 1KC5H 1BECA 2BNRB 4JPVL 4ZOBA 4MJ6B 1GZQB 2QKIB 4ODXB 3DX9A 1G9MH 1SY6L 2Y9RT 3UTSE 4F7MB 1QR1B 4IJ3C 3N06B 3CDGB 4OD2A 1OAYH 1I7UB 3IJYB 4PG2A 1QRKA 4M6OH 3HZMA 3QO0B 4WI9A 1MFCL 1RJYA 1QBML 4PJEB 4XPGL 3RVVD 4TSBH 3V79C 5F9OL 2OR7A 3TVMD 1RK1A 4WWKA 1EFXB 5FF6B 5TPWH 2R2EA 3BZFA 4J6RH 4QXTA 1DLFL 4P9HL 2R8SL 2VDLL 3I85A 1SJHB 5HGDB 1MRCH 2IBZY 1RJCA 3EDEA 4NHCL 5KS9A 5DF0A 2VLLB 1KB5L 5DGRA 5HHQB 3ZT7A 2VDOH 1PJ9A 4OLZH 3H0TA 2C3VA 1XGTA 3MRIA 4Y1AA 3MR9B 2Z8SA 5DJZA 4D8PB 1AGFB 2R0KH 3MODH 1QQDA 3NCFB 4QHUB 4OBSA 5D4QA 4LAQH 4G7VH 5D2LE 4NUJB 1I9JL 3CPLB 1UM6H 4U1IA 4YHOL 4ZSOE 2NR6D 3VWJB 3IDGB 1DE4A 1IGCL 5D1ZA 1FYTB 1N6UA 3DMMD 4UB0L 5EBLB 5GGTL 3KPLB 2XZQL 4PJGB 4YDKH 2X2YA 2OX5A 4NQSB 5B39G 1F4YL 2I9LB 5C0CE 2IFFH 3SE3A 3HG1A 3SKOB 2D4DA 3O45B 4KHXH 3WLWC 2A83B 1VGKB 4CMMB 5DJCA 1TQCB 3TP4A 5DK3A 3ORJA 5DJCB 4GG6B 2IJ0C 3I84A 1A8JH 3TBVB 2CDEA 4M02A 1OCWL 5I1EH 4X9GA 3FB7B 4S1DC 1AP2A 2JJTA 4NOBA 1JK8B 1U91B 3L5XL 2F53D 4Y2DC 3L3KA 2Y06L 3U36B 4PJAE 4M1GH 4LSQL 1NQBA 1RU9H 4Y19D 1NMAH 2R2BA 1QFWL 5HPOA 3DO7A 3TBWA 4P48A 4QXGH 3TYGH 5CD5C 3UP1A 2ZKHH 3U4BL 2V2WA 4GW4B 3IXTA 3V4VL 4M5YH 3OWEA 1A7PH 3SQOH 4I0PA 3IFLH 5AWNL 4TQEH 5EZIL 3VFVB 3T65B 2QADB 1HHJA 5DFVD 1DQTA 3CSBA 1T5XA 3D39D 4M62H 1OTTD 2G2RB 1X5YA 4X5LA 4LCUA 2P48B 2HTLD 2VLRD 2WK2A 3CVHH 4J3XA 4MNHB 1V5JA 1V3KA 3U0WH 4RBPK 4XBPB 4IMLA 3GI8H 2HFFA 4K3HA 2HLFC 1BVKA 4DUXA 1S8DB 1UH2A 3RDTD 2B1HH 2MTPA 1JGDB 1DBBH 3HZYA 4F7EB 3E6FB 2IPKA 2CLZA 4MZ2A 4WHCA 4R90L 1R3JB 4IRJA 3U4BH 3AU1A 1WZLA 1ADQL 1T83A 3CSYA 1H3VA 1GZPA 2ADGB 2R2HA 3KR3L 4U33A 4ZD3L 3T77A 3PWPE 3SCMD 1AGFA 5JQ6L 3VH8B 1AXSA 3O6KH 3JVGC 1S9WA 1CGUA 4XPGH 2X40A 1YEDB 1ZS8B 4GT7A 3LRSB 1S7TA 3CFBB 4H26B 4MYWB 4L4TB 1S7TB 1UCBH 2EYSB 1GC1H 6FABL 1H3XA 3CFDA 4JPWH 1U2CA 2DBLH 1MPAH 4HS8L 2J88H 2SEBA 2J6EH 3IU4L 3E3QC 3U46B 2EDKA 1JPSH 3OKYA 1NAMA 4LCWE 3TZVD 3L3HB 3HUJB 3U4EB 3X3GH 4XCNA 5E56A 3U7YL 3QDGE 5B39A 3VI3F 1QFPA 2FJFA 1YNTA 3K4ZA 1Q94A 2Y1VA 3LPFA 3EYUH 3P0GB 5BVPL 1SYSA 3L95B 4U1SB 3GKWH 3EYSH 5MEND 4LAQL 2VQUA 1FGVH 3TF7C 2IPTH 4UDUB 5KSUB 1AXTH 2F8VA 3S37L 2ITCA 2F54A 2VMFA 4XCEA 2A6KB 4P5TB 5C07A 4HKZB 1BPVA 3QZWG 2FL5A 1FV1B 2H9GA 1T22B 4U6YA 3R4DA 1U3HD 3C60C 1KB9K 4ZUVA 4HJ0D 5FYLH 2HWZL 3T65A 5I18L 4H25A 3QDAA 2E9WA 1JTOA 3BN9C 4YDJB 4XC1L 5EC2A 1BOGA 4GLRH 2HT3C 3HR5A 2VDNL 3WIIH 1JL8A 5C2BL 1WBZA 1N59A 3ARGB 4JHWL 1JZ7A 3WFBH 2J8UA 4WRLA 1AHWA 5AG9A 1U3HA 3D48R 5DSCB 3QB7C 2C26A 2CR6A 1WWWX 4Z7QF 3FRUB 4HC1A 3N1MC 1CDUA 1CG9A 1DQDH 3EHBC 2C1OB 1K4CB 3FT4A 1HSBA 4X4MA 4Z7VA 4PBXA 1T83C 3RTQB 3TIDA 4BH8B 5D9SA 4OZHA 3HTLX 3MYJB 4U6VL 1YEHH 1WEJH 5IROA 3UROR 1S5HB 2GSGA 4RZCA 4ODUA 4AM0A 4YDIH 2JJSC 4K7PH 4XNYH 1ZK9A 1EEYA 2Y7QB 4AM0B 4ONOA 3LS4H 3QQ4A 1GGBH 1FJ1B 4R4BB 1CXFA 1RZKL 4PJCA 1M7IA 1UYWH 4F9PA 5C71A 3BT2L 3TBSA 3SCMA 3UJJH 3HPJB 1HHHA 3HB3D 3F6LA 1I1RA 4AENB 3U1SL 3BIAX 4YUEH 2GTZB 3NMEA 3TBTB 4GRLB 4TUOB 3JXAA 3WKMH 1ZA3A 3CFCL 1WICA 2LU4A 3HE6D 5E7BA 4DTGH 2G60L 3IJSB 3D69A 4GQ9L 4OLUL 3QEUB 5C6WH 3L95A 3O6FD 4HUXB 1JGLH 3ZSSA 3QEUA 3GSUB 2YK1L 1OAUH 2DL9A 1C16B 5I75B 3PWUB 1O5DT 4X9IA 1NBQA 1IT9H 4YBQD 1CE6B 4ZDHA 4PG2C 1DBJH 1YQ2A 4YFEA 4XCEB 1I9IH 3UC0L 3CDCA 4ZNEA 5FKPA 4CU8A 3KNBA 4L8SC 2NY3B 5D8JH 1M6OA 4R9HA 2XZCL 5AAWA 2DDQL 1WC7B 3TWCL 1LO5A 3FONA 2ESVD 4ZXBB 3NCCB 5HJ3A 4YEFA 3DWTA 2G2RA 3TO4B 5L2KD 1FAIH 4ZUVB 2R0LH 5C92A 1XIWD 1CL7I 2Y23A 4Y4FD 3QEQD 2R69L 1T4KB 4OD1L 1SJVA 2CR3A 5IJVB 1KB5A 2JLLA 1MCOL 5IVZB 3MODL 2HH0L 3OF6A 2NY5H 5I8EB 5CUSH 4O58H 5DC9B 2VL5B 4H1LA 1RK1B 4XPBL 5HHMB 2C3WA 3G6AA 4QRTA 1EFXD 4EDWH 3JWOC 5L9DL 4LLQB 4IRJB 5ACZB 2YPLA 3VFOA 3X11B 1CDBA 4WW2C 5JIHA 4I48B 4JRXE 5F1NA 1MWAB 1IFHL 4P2CG 1WUNT 4YDIL 1W72H 3MRQB 3HPLB 3SDCD 3G5XB 4HK0B 3VWJD 3ARDD 2BSRB 1Q72H 1A6AB 1SY6A 4GRMA 4EDXB 3MRKA 2VXUH 1D5MB 5L8JB 2CKNA 3ZMRA 4YWGL 3RGVB 4JG0L 1JUFB 3C6LD 3L5XH 3T0XA 5FYLD 2LABA 5LXGL 1VGEH 4FABL 1F3DJ 1T21A 1NEZA 3BE1H 1A7QL 2X1WL 1AXSB 4PJ5D 4YFLF 4ZFZA 5A2JH 1SJEA 4M6AA 2AQ3A 4K71C 3TJHD 4NOFA 1LEIA 2YD6A 3TCXA 5AD0B 2Q87A 3BUYB 4MXWH 3QI9C 5D1QA 2ZSVB 5CINL 4GRLA 1VFBB 2F53B 3SKJL 3LKSB 3BPNB 4ODVH 4R96B 3DETD 1MCEA 4LPUA 4KJPD 4HUMB 5E8PA 5HYSG 1KCSH 5EOTB 4PUBL 4AH2B 2BSTA 5KG9A 1PGRB 5B8CC 2IH1A 3MRRA 3QUYD 1P4BL 2XFXA 3MGOA 3MV7E 3T2PA 4HCRH 3UTTB 1JTTA 3VXSE 2WWKO 1ZA6A 4TNWK 1J88A 3QXUA 3IS0X 3PWLB 4YR6A 1FRGL 5E2UL 2WV3A 4Y19B 3C2SA 2QQNH 1CD1B 2RB8A 3MACH 4N0UA 5FOBA 3RUGB 2AXGA 2C4FT 3IXAB 3HI1B 4DW2L 1MCLA 1FZJA 4K3DH 1JPST 4HEPG 4HIXH 2NY2C 1A1OB 1A6WL 1VERA 5T1LD 5I1AB 3TESA 2IBZX 2WMPA 2VLKD 5EWIH 2CK0L 5J57B 3BQUC 4H20L 4ZPTA 3D85A 3RGVD 3SOBH 1YPZB 2Q8AH 2CKBH 5HDBF 1ZLVK 4UIKL 3ME0A 4CU7A 1AGDA 5HGHB 3HNTH 4AEIL 3WL9A 3MCKA 4DKFL 3K74B 2DMBA 5ESAB 3IS1X 5FUOL 1FZMB 2DOCA 3FOMA 1RMFL 3PHSA 1UM5L 5HBBA 3MRNA 5SWZE 4EUPB 3VRIB 4OJFH 25C8L 3N85L 1CG9B 5FO7A 3V5KA 2OI9C 2GSIB 3JSSA 1NC2D 4K3DL 2J5LB 1TNMA 1A7QH 1B88A 4NQEB 4V2CB 5TQ0L 3BT2H 3SCMB 5J12C 3VE0B 1UB5A 1EBPA 1CBVL 3BVNB 2HMIC 3NIDE 3CPLA 3VWJA 3O2WH 1CR9L 4NQTA 2V5YA 4JFYB 5HHVL 3PIQA 4FFVC 4X7SH 3TNNA 2W0FB 3RNKB 5IF0A 4RDQF 5IW1B 4KI5C 4P23D 2VXTL 1EMTH 3QUYC 4XPHL 4YXHL 3GJFK 1BQHB 3WHXB 4HT1H 2IBBA 2X4QA 1CDGA 1I7RA 1R3LB 1JN6A 1F2QA 1PYWB 3IJHA 5D71L 5HHNB 5IT2L 4WFGE 4KUZL 4NZRL 1J8KA 3L3IA 3MV9A 5FYKU 1Z3GH 1XGYH 3PWPA 1IGYA 4LCYB 4ORZC 4FQCL 4ZNEE 4JHWH 1S7QB 3EO0A 2PNDA 4OM1H 4Q9QH 4M6ML 2DI7A 5DTFA 3LS5L 1OW0C 3MRLA 2VRAA 1S7XA 3ABZA 1VGEL 5I9QB 3ULVD 5D1ZC 3RUGA 4QRRA 4X0KB 4F3FA 3QQNA 3ARUA 3MBED 1MCRA 5IFAH 4PJGF 1T2QH 1CE6A 2F9BT 2I60L 4PJBA 4YK4C 5EFIB 1LK3L 1SM3L 3MV8E 2LFGA 3ARGD 4HBCL 3ULUC 3BP7A 1X3DA 4E5XA 2P7TB 3RIFK 5J8OA 5KSBA 3BDYH 1WT5A 4JEGB 2HVJA 3MPCA 4U3CA 5ACZA 1UXSA 4YXKL 3VGAC 1K8IA 2VR9A 5GQBA 4KROC 4MNGA 5I66B 4N68A 4PS4H 3ULVH 4DUWA 1W72L 4D9RD 3LZFH 1TJHH 1EUTA 1QLEH 2GITB 1IL1A 1I8MB 1RSFA 2KBGA 2ZUQB 3TT1H 3Q3GA 1I4FB 3IDNB 4RSVA 5JTWA 1IARB 5HHQA 3S97C 1J0HA 5D1XC 1FRGH 3OMZA 5E2UH 1U3HC 2EYTB 5FYJD 1K6QL 2W9DH 5F6IB 1BQSA 2YD8A 2B4CH 5CKGA 1YC8A 3BKYL 4K23H 5T33H 2NNAA 1T1XB 3O2WL 4F9PC 1QEWB 2R15A 3P77A 5DHYB 3KHOA 4AJ0A 5L0QB 2VZTA 2DQIL 3CH1A 3UO1H 1EA9C 3ARBD 3O9WC 2OTUB 1U41A 3ULUD 1LEIB 2GTWA 1K5NB 2A77H 4NM4L 3L5WA 4BH7A 5EU4B 3LRSA 4OCXL 1KEGL 4P59L 2E6JA 5IT2H 4MJIB 2FGWL 2ICWJ 2J6EA 1JGUH 4N5EC 1GGCH 1KN2H 2ZUYA 3GMQB 4Q0XL 5DMKA 3O6FC 4P3CL 3T1FA 5E1HB 2QHRL 1NFDA 5IVNA 3CSGA 4LMQI 1I8LA 1RURH 4DZBA 3BKJL 3H6JA 2O61A 2VKWA 1NCBH 5CILH 5HI4C 5JORB 4GKOA 4NQUA 4JJ5B 3RWJB 3WNOA 4NN5C 3NAAL 1U8MA 1A9EA 3ILPB 3VXNB 2ZCLH 4ONGH 4TVPL 4FNLH 1RD6A 1Y6MR 3HMXA 4LU5L 2FYYB 4JM2A 1LO4L 3GSWB 3LD8C 2GUOA 4J2XA 4NQVA 4UU9B 3EOAA 4GOSA 4J1UA 2VWEC 3EOAB 4MAYD 2F54B 1V8HA 1N5YH 2R0ZL 2EDOA 2Q20A 3ZDXF 4MA7H 2ZPKH 1AQKL 3RHWK 3WUWA 3HE7D 1L9MA 3PNWA 2JIXB 1N0LA 2VO5A 5HHOD 5ICZA 1XIWB 5DK0A 4QEGA 4X99B 5D93B 5J1TC 2DLIA 2R1XB 5DURB 3BN3B 1VACA 4F15C 5C0AE 1TITA 1YJDH 1Q9WA 4K7FA 2AJVL 5KVFH 4FQCH 3FT2B 1LE9A 4MD5B 1AGEB 3HAEA 3VU2A 4YZFF 3ARDB 4MD5A 5GJSH 1BZ7A 2P46B 5C1MB 5JIPA 2ZOLB 5DJ0B 1KPVB 2F74B 3MLUL 1JPTL 4NJ9L 2ZOLA 4JDTH 3G5VB 1MWAA 3RZCA 1A6UH 3FN0L 4NQDE 3OKDB 3KYKL 1HILB 2XKNB 5DJ8A 2VDRH 1G7HA 4U1IB 4WHDA 5A16B 3QDGA 2MCPL 4ELMF 4TNWF 4GG8B 3QEGL 4NM4H 3SDCB 3MZTA 5IMOB 1H3PL 5CMAA 2YEZB 4XH2B 4NSKB 1QO3B 2ATKB 3PIQB 2D7QA 1I9RH 4JFFE 2A9NH 5I16B 3LEXA 4U1KB 5DRXA 4KU1A 3VFRA 1Y6KR 5F21B 1KIQB 3REVA 5E24E 4LVHB 4JY6B 3V7AG 5IJKC 2LVEA 4DEPC 2K9UA 2NY7L 4PBVC 5GGVY 1CICC 5EIIA 4YZFE 4HPOL 3U30B 4LRNL 1G7MB 1WBYA 2O26U 4DCQA 4OF3A 1XF1A 3VGFA 2BC4A 1P9MC 1YEEL 2DI8A 4P5KA 4D9LH 3QHZH 2QQLH 2P24B 2VDRL 3WJJC 1U8MB 1NCAL 4K9EL 5DUBA 2XN9D 3U83A 2EIZB 4NZUL 4L3EB 3VA6A 2DTSA 4P5TA 1ZSDA 1RPQA 3IXTB 3SE8L 3CD4A 43C9B 3SDDD 3V7MA 1NCNA 1JBJA 3OKEB 1WGOA 4N9GB 3IDJA 2OJZL 4PJIE 1NGQH 5CGYD 4OCSH 1YMMD 4CVZB 2VZOA 4R26L 2BVTA 1FZJB 25C8H 3F7VB 4HS3B 5BQ7A 1I3VA 5DFWH 4GAGH 3TYGL 1CFSA 2ZCHH 3DMMC 5DMIH 1MI5B 1N2RA 3O9WB 3RL1A 5HD8D 2FIKA 3EFDL 2BDNL 5T1LB 5DDHA 3I50H 4NPYA 4XXCC 1WFOA 4AMKH 5E94B 4KHTL 3DVIA 1DBMH 3GBNH 5B8CB 3RL2B 3HI5H 2X4SB 3G6AB 2P8PB 3QQ3A 2DQUL 5FM4A 5J3HC 3LMJL 3U48A 1KTDA 5HPMB 3MLZH 4LU5H 4XMLH 5DR5H 1FDLH 5EZOL 5JA9A 4JB9H 1F4XH 4LBEB 3QXWA 5FA3A 4MNGB 1SEBA 3JVGA 4NQED 5GGRA 3G6JE 5CZXC 1P6AB 4AIZB 5JPMA 3OKNB 1I9RL 3DMMA 1HIMH 3ZKQD 1FGNH 4WW2B 4AIZA 2AEIT 4OBRA 5C9KA 1S7SA 2VE6B 5K9KB 2GSIA 3LDBB 4D2NA 4ELKB 4OLXL 3NZ8B 3S3JA 3HAEH 3NIGE 3KPMA 4JFXB 3RVTD 2FJGA 4QF1A 1XH3A 5C0JB 3QISA 1S7RA 2FLRT 4MD0A 4DQOH 1YEKL 2W0PA 1P69B 4L8CA 4QHMA 4XBEL 1SQ2N 4UILH 4UV7L 5KVFL 4BFEA 3MLWL 4QHMB 3ZT6A 4Z7WE 3BPNC 3ZDYE 1TNNA 5ESQA 2VLKA 1YEFL 1E27A 3JUYA 4NP4L 5C0GA 4XHJC 5GRYA 2L0DA 4J3VA 3VXMB 1BOYA 5IK3A 4K71B 5ESVA 3LSOB 4NKIH 3SGJA 1AI1H 3RWGA 5C8JB 4P2QA 3QO1A 1X5ZA 1XF5B 4R4FH 4XP1L 2A9ML 1F3JB 2NX5B 2VDNH 4XVUC 2V7HA 4XP4H 1L0QA 2DQGH 1MI5D 3O9WD 5IQ7L 1INQB 3X3GL 2R0ZH 4LPTA 2PXYB 1R5VB 3NIGF 2A2QT 2J7LA 4F7CB 3C6SB 1HQRA 1AD0B 3WLWD 1P7QD 5IWLC 2NZ9C 4Y0GA 3GEWB 3CX2A 4KGLA 3VRJB 1ORQB 2Z0BA 5IB5A 4JFFB 1MJJB 1OLZA 3VRJA 4X7TB 2LTQC 5E4EB 3H8NA 4NP4H 2DQHH 2MFNA 1EZVY 3P4NB 2EDJA 4N0YH 4O02L 2X4NA 2H6PB 3PP4H 5ECJE 4C56E 4N8VG 5DZNA 1A7PL 5CSZB 3V52H 4LKXA 4HWBL 3QIWA 4OLYL 1T1YB 2MQCA 1YPZA 1IC4H 5B8CA 2YS4A 3HRZB 1DUZB 3V4PL 1G7QA 4BELD 3NCJL 2J12B 3P9LB 2PYFB 1A6ZB 1UKQA 3MYJA 1YY9D 4ENED 3GNML 5GS2D 1VA9A 5FA4B 3G5XA 4HK0A 1A6VH 5CMAB 4KXZH 3U82B 3QIUB 1H8OA 4AZ8A 4HWEH 4K2UL 1EEYB 1C7SA 3W82A 5KS9B 5J12B 2H32A 3KPRB 2VE6A 5SV4A 2Z31A 4JM4L 1JZ2A 5IBLC 4FS0A 3PJSA 3BISA 3VXUB 3CXHJ 4MJID 3MLVH 2X10A 5GISL 3MBEB 1A02N 1P1ZB 3B5HA 4P9HC 5CAYB 2FX9L 4KI5E 2GY7B 2YPKA 2XN9E 3WIFA 1C1EL 2EH8L 5EIIB 4AENA 4LRNH 2BSED 2IFFL 3ARBB 4LLUB 4FQ1L 2RQ8A 5TPWL 4YHLL 4MVBD 3UC0H 2WBWB 1VFUA 1EK3A 1BD2B 4U6TA 1Q9KB 3H9HB 2RR3A 2Z4QB 4LSSL 1UA6H 2IALA 4XAWL 3AC0A 2HJKB 5TF1L 5INDB 5JHDB 3MOAL 3LHPH 1EEZA 1R3KA 4P5MA 3BD5A 1YY8B 4JLRA 1XCTA 1RUMH 3AS1A 5D6CA 4ZDHB 2XV6B 1ZTXL 4EI6B 1VKXA 1B0WA 3DV6B 1OTSC 3NCYP 4L4VE 3L6FB 4I9WE 4N9GA 2VQTA 1N64L 5HJ3B 1HINH 2E9JA 3E2HB 2YUZA 4F7MA 1QR1A 4G7YH 3VD7A 2JIXD 3CDGA 1OAYL 3QUZA 3QEHA 4IRSA 3Q6GL 2R4RH 4JG1H 3WS6A 3EYSL 5EO1A 5FGBA 4I18A 5FFLA 4N1HB 5DQ9B 2UVFA 3P4MB 3SN6N 4DWHA 5JUEH 2DQTH 4URTB 1RZGB 4AEHL 3AY4C 2XT1B 2XKUA 1HXMA 3TJEH 4G6AC 3HE7B 3ILQD 4X7CC 5IHZA 1NCDH 3RWDB 2IAMB 1LO0L 1CIUA 3GI8L 5FV2A 3KXFA 5GZND 4LBEA 3O3EA 2NPLX 4WHTA 5F1NB 3SJVB 5I18H 2Z91A 1FNEA 1ACYH 3O8XD 4G6FB 3ZTJG 4PY7A 2ATPA 3M8OL 4GS7C 4HGMA 1DFBL 3KWWB 5T5FL 4JR9L 1JP5A 5BO1H 3L7FB 3EGSB 4U05A 3T1WA 2LAGB 5CWSA 4XP9H 4EXPX 2AEQL 2V2XB 2YPLD 4PJXE 4WEBL 4L3CA 4QXGL 4NC2B 4Q58C 1G1CA 1OGTB 4L3CB 3CZFA 2FRGP 1XGRB 1KCSL 4MNQB 3SDCA 4HUVB 1INEH 1IGCH 1P1ZA 4ODUB 5D7JA 3OGCA 5BW7C 4LSTH 2ATKA 1HWHB 2ZG1A 3PP4L 5KBNC 5HHPB 1RZIB 5C0AA 4R2GB 3HZVA 4HIEB 1FJ1A 4R4BA 3QAZB 1Z5LB 4KFZC 3WEXA 1ZS8A 2VDPH 4NQCB 1F11B 5E08H 4L4TA 5F8RC 1AD9B 1QG3A 1RUML 1FIGH 5ILTH 3TO4D 3TFKD 4N0CD 1FL5B 4BA8A 4XCYA 1TDQA 1RZKH 4QRRD 1H8NA 1UENA 5GRZA 1OLLA 2UY6A 4UINL 4LHUD 2WBJD 1F4YH 4MXWL 5MERB 1LP9A 4CDHA 2WIIB 2YPVH 5CJQH 4RDQG 1C5CL 3HE6C 4LMQE 2XZAL 4M3JA 3GSUA 3V4UL 4RGOL 3ARFD 1IEHA 4G7VL 4GAYB 4FG6C 1RULL 3A6CH 1KXTB 4FFWC 4NO2A 4P57B 3QCTH 4P4KB 2APWA 3RX5A 1XCQB 5EU3A 4WV1B 4OB5L 1A3LL 4P4KA 1AC0A 3MRHA 1IM3A 4LLDB 5CJXC 5CSZA 2BMKA 2Y5TA 2JCCA 5FCSH 2GJ6A 2DL2A 1JMZA 4PJ9A 2C1PB 2R2BB 1JZ6A 2ID5A 1WZ1L 2CUHA 4G43A 1MJJA 1CS6A 1TVBB 2BSSA 1T1WA 4QY8B 4DOHB 3VDBA 3ULUL 4K8RH 2BNQA 4HLJA 4GW4A 5CZXD 5F88B 1LDPH 4ODTL 4R3SA 3QZWA 4YHZL 1JZ5A 2KZWA 2RFXA 1MREH 4CN1A 3PGCA 2R0WL 1K3ZA 4CN6A 4ZXBD 3WHE0 4EUPA 1LE9B 4POZD 1CFNB 1AKJD 2FHBA 1HINL 4OF8A 1GXEA 1FVEB 2GJZA 1C5DA 1FBIL 2B8OT 5D2NA 5GS2H 1V3LA 3MRGA 4X6CF 1AJ7L 5FGRA 4DN3L 4Z7VB 2N7BA 5J9PA 3ULVE 1W8OA 3P9MB 1BVLA 4V1DB 5DC4B 1PEZA 3BVNA 3MXVL 5HHMD 4HF5L 3UPRA 5T3XH 2ICEA 1QPPA 1E6OL 5IMOA 3EDDA 5K9KA 3I9GL 1CIDA 4U7MA 2WUCL 3DYOA 5I1DB 4I8DA 2AJSH 1F3DH 2FH6A 1XF2B 4M6MH 2JK5A 1UM4L 2NYYC 1C08A 3MO1A 2DLHA 1MQ8A 5F89B 4ZUWA 4PJCB 2PTTA 3CU7A 2PW2B 3WSQH 4UQ2A 1VFOA 2GKIA 3E8UH 2AJXL 3E6HA 4WU5B 5BO1L 4P2RB 3ZE0E 2NX5D 4LK4A 5DYOB 1NAMH 1X5KA 1F2XK 1F42A 4W4OC 3O3UN 3C6LB 1ZWIA 1CE1H 1AFVH 1G7LA 1MH5A 3S36H 4GW5B 3V0WH 4HIJA 4U1SA 3DXAE 2UVEA 4MAYC 4S0TD 3HNVL 4YIQA 4FQIL 5L8LB 4ZD3H 3LN5B 3QJHB 1NFDE 4NC1E 1INDH 4KRPC 3D9AH 2IH3B 3QJHA 4J4PA 4WO4A 4YHKL 1AY1H 1I8KB 4O2FB 2E6PA 4XPAL 1XR9A 3IETB 4Y4KC 3P4MA 4CUCA 1Z6JT 5IW3A 1GZQA 2QKIA 1K8DA 5T3XD 4L4TD 2HTKC 5FKPB 1S7QA 4ALAH 2M1KA 2BVEA 2DBLL 2FD6H 1ZHBA 4JHAH 3FB6B 2XG5A 5E8DL 4PJBF 3O3EB 5JNYA 1AHWC 2FX7L 5D5MA 1T1ZA 4FQJH 2MWCA 4C83B 1OAXH 2FX9H 2Z92B 2NXZC 2IQAA 1FV1A 1P2CA 1QSFA 4YO0A 2FHCA 4Q9CA 2ADJA 5I1CH 4E42A 2BNRE 3ZYZA 3GRWH 2ADJB 1BAFH 4XVTH 4DVRL 5EH1A 4P59H 4PJXA 2HLAA 1CF8H 4QOKB 4YHKH 2X4SA 4X6DA 1KN2L 3STBA 2V17L 5B21A 3O2VH 2XWTB 4KHXL 4Y16D 1BFVL 1YNKL 5C0BD 1J12A 3IFOB 5EULV 3S5LB 5FYKD 4FZ8H 1MQKL 2FBJL 2OTUA 4XNYL 3IDNA 1FG2A 4FQ2L 5CSGA 1ULVA 1KJVB 1JYWA 1A6AA 1HZHH 1DANT 4LRIA 3FCTA 3E3QE 3KPPB 4FQJL 5EPMA 3LKRB 3DI3B 1AR1C 4J7RA 3EOBB 4WHYH 1BREA 1KIQA 3REVB 3SQBA 2HRLA 3FO0L 5BVJA 4MNQA 1QSED 5D9SB 1PG7W 5D96C 4YGVA 3FAXA 5E6IC 5FECA 4L4JA 2WINB 4JO1L 5CIPH 4KQ3L 5C0FB 5AYUH 1PQZA 2R0WH 4OCLC 4XNUH 1H5BC 1A4KA 4A2LA 3QI9A 5D1QC 3CCHA 2DQEH 1FVCB 3MUZ1 5DWUL 1JHLL 4JPIA 1WFNA 4TVPD 1JN6B 1PYWA 1L7IL 2FEEL 4U3HA 4KJPC 5D2LB 1W0WB 1NLBL 4E0RB 3MXVH 4CN4A 5EOCH 4CRPA 1RURL 2X4RB 3U1SH 5LCVL 4TOYH 2BVOA 2MMXA 3O4LB 43CAB 1UWXH 4KRPD 4PGDB 3TWCH 2XQYK 2J1KA 1OSPL 3OAYK 4JDZA 4Y7MA 2AEQH 1CZ8L 1IAIH 4YC2B 5FOBB 4PP2B 4ZUSA 2AEPL 4I4WA 2E3VA 1ZXQA 1E6JH 1VACB 1T03H 2CQVA 1KB5B 4P2OA 2X9YA 4R4NC 2WQRA 4KKAC 3RPIB 4Z7WF 1RUAL 2KUTA 5FUZH 4GMTH 1KFAH 2ED9A 1IRAY 1HHGA 5E8EB 5IMMA 4U1NB 3S36L 3ARDC 4C56B 4R0LC 5KVEH 1X44A 3D25B 3MV7B 2W92A 3UBXB 2VXVH 2XNAB 2Y4SA 2EDTA 1MFAH 2DBJA 4OKDA 3G5VA 4FQLH 4Z5RA 1EFXA 3MRJA 4TNVF 1HN1A 1EHXA 4F7PA 4OAWA 2HLAB 1T1WB 3IFNH 4LSUL 1JZ3A 3S34H 3T8XA 3RWHB 2KQNA 3F12B 3DIFA 3HPLA 5L6YH 3LIZL 1MCOH 3Q1SL 3CUPB 3OF6D 4PS4L 3P4OB 3CMOL 1MEXH 1KC5L 3RI5K 5T1KA 2X4TA 2WUCH 3RIFF 4ELMB 5E2WL 4ALAL 1UJ3A 3F7YA 5E8OB 3MFFA 3U79A 5LBSH 1PG7X 1UEYA 1KPVA 4DN4H 4G8GB 1GPOL 1I1YA 4GKNB 5AYUL 5DHYA 3BW9A 3MRCA 3VH8A 2OL3L 4AIOA 1X5XA 3O11A 1VSCA 2RCSH 2ZJSH 2IC2A 3IFPA 1BJ8A 2XZZA 3QDMB 5DD6A 4U2YA 5HHVH 1JHKL 5FOJA 4M48L 4JKPH 1MFCH 4ZOEA 2W60A 3HC4L 4XXCA 3X17A 1EX0A 1MSPA 2CD0A 5C0GB 1T0MA 1NGXB 4NQXA 2EXWD 3FQUB 3DX6A 3V6OA 4UAOC 5ISZB 1O0VA 1T20B 3SO3C 2PW1A 5EZJA 2NY4D 5SWZB 1CFTA 4P2QB 3HE6A 5SWSA 3MYZA 1U8JB 3AM8C 3I6KB 3BXNB 1AE6L 1BFVH 1N8ZA 4PRIA 2IPUG 2BZDA 1Q9OB 2XICA 1K2DA 1MLBB 1TTUA 1INQA 3UTTA 3L3OB 4JFHE 4OQTA 1NDMA 3IKCB 3L3OA 5LQBL 1DQLL 3QIWC 2EEDA 1UZ8A 1ADQA 1HH6B 3CZJA 4MNQD 2KPNA 4BUGA 1KPRA 4UDUA 1ZVHA 5KSUA 2AV1B 5TDPB 3LRGA 5EC1A 4R2GC 2VTFA 4KI5F 2VN4A 1DUYB 2Z92A 1AJ7H 4JRYD 1CFSB 1XR9B 3U30C 3S3SA 2DWDB 43C9A 4Y2DB 1ZT1B 1TJIL 4HCRL 1MRFL 3VCLA 4YX2H 1CD9B 2AV7A 1RHFA 3RZWA 5B3JF 2W0LA 1GGTA 1A1NB 4L8DA 1FNSL 4NKMA 1LMKA 2DD8L 5D8JL 4FQXA 4U7KA 3O2VL 1NLBH 2C9AA 1UCTA 4JRXA 2R23B 4UTAL 3KXFB 2IANE 1ERNA 4U1JA 4YEEA 3RVVC 4LCCC 2VDQL 1BEYL 3A67H 2DIBA 3F5WB 3NFPB 2B4CL 4QHNA 4EBQL 1JI2A 1HZHL 3SKUD 4UT7H 4DAGH 2XQYG 4OUUB 1DN0A 3LY6A 4Z77B 5BJTB 2V2XA 5AEAA 5BMFH 2AK4B 3N1QC 1HILA 5DD0L 3TYFA 4Z6AT 4I9WD 1BIIA 3UO1L 2CKBL 5AYQA 2WP3O 4N90E 4MXVF 5E1AB 1AGDB 3C8HA 4MNQE 1JNNL 1D6VL 2B0SL 5IFJA 2CIIB 1A7BA 1UB6A 4NWUH 3WS3A 4G6JL 1HXYB 4IOFC 4NFCA 1QO3A 5B3JE 3W2DH 3DMMB 4GSDH 5GGUA 1MF2H 1ZLSL 1CYGA 5J06A 1F6LL 5HGBB 3RWCA 3W0WB 3U0TB 5I73C 1JTPA 4U0RB 5EUOA 3R1GH 1GVIA 4KKLD 1DDHB 2DYPA 5DEFB 4YHMH 2VDMH 2W38A 5CP3A 2GK0B 5J6HA 2Z8WC 4JG0H 1GIGL 2CUIA 4RRPG 5D2LA 3JWDL 1KPUA 3N1PC 4H5SB 4GAFB 4AEIH 3LIZH 3Q1SH 3PHOA 3EZ8A 3MMEA 3G9AB 1KLUB 1ZHNB 4NZTH 1FFPB 1NAMB 1ZA3B 3RDTA 3MV9D 3O4LA 2A0LD 4LPWA 5E00A 3S98A 3QXDA 1K4DA 2HH0H 1BJ1J 1CK0H 2BOBA 2EXWC 2B5IB 4RX4D 4HUXA 5I8OL 3L5HA 3JV6B 4JQIL 4JO2L 3ESVF 5DMJB 5HYJB 2J8UE 4PJ5A 1KJMA 4PJEE 5F7MC 3KDMA 3SDYL 1FSKC 5DJYB 1M7DB 3KDMB 1FCCA 5GZOD 1MFDL 1U92B 3IDIB 3L1OL 5DK2B 3GHEH 3RBSA 1BZ9A 1ETZA 1H0DB 1IM9A 2FB4L 5TE6H 2IPUK 1XR8A 3BGMA 4C4KO 2I25N 1RIUH 5GSVA 1FH5L 4NZRH 3SPVA 3B9EA 5GSVB 4P5TC 5F7FA 3MJ7A 3K4AA 5IFAL 4HXBL 2VQ1A 5D1XD 5HSFA 1J1XL 2P47B 2P8LA 3AVEA 2MHAB 2KL6A 4X4ZA 5M94B 1QFWM 3VH8G 4CGTA 3GMNA 3GKWL 3OR7B 2H32B 3UBXA 3LS5H 4QCIA 4I0PC 2J8UF 1F4WL 1A9BA 4LLVB 4X6BA 3SDYH 4X83A 5EBWB 3QT2A 4Z77A 1K4CA 2R4SH 4E41E 3MJ8A 5EBWA 4OFKA 2LTQB 3MRGB 4HUKB 2DQIH 4LAJH 3WIFB 2XKNA 1EGJH 2X4OA 1WIPA 3DVFA 4UIKH 3KS0H 3QPXL 2AQ1A 1UB6B 1S7SB 3ZKND 2ZUWA 5CZVH 5GZNC 3BZEA 3GJEB 3O41B 1EPFA 5DUPH 4BQ6A 2AJ3B 4GKZA 2FJGB 4GXUM 1K6QH 4NNYB 1NGZA 4LSQH 3CFDB 2XG4A 5HYFA 5GGSY 4K9EC 3W81A 5ADOL 1S9VB 5DJ6A 3M45A 5K9OA 4HKJB 2Q76B 5DRZB 3JWNC 2AXFA 5E2VH 4LF3B 4GG6E 4EJ1C 3V6FA 3GM8A 3OG4B 3KAAA 2CGRL 1EO8L 1QSFD 3RKDD 3O4LD 4TNVK 1RUAH 1OD7A 2NY5C 3DECA 4OCXH 3F7QA 1KEGH 2I07A 1H15A 4ONFH 1YNLH 4RFNC 4F80A 1MFBL 4GUPA 4OSUH 4K3JH 5MENB 1HKLL 5T1MB 2VUOA 1ACYL 3TN0D 2O5ZL 2EO1A 3MNZA 4NBZB 1MLBA 3O81A 2AEWA 4EI6A 2GFBB 5IMLA 4GMSH 1ONQB 1WLHA 3P30H 3EKCA 3QIUD 4H8WH 1LP9E 3SE4C 2CJUH 4Z78A 1YDPA 4Y19A 5JW4M 2ORBH 4GBXA 4NRXA 5IQ7H 2HKFL 1CU4L 4JFQA 5SWSD 4Y5VB 4R0LA 1VEMA 1BQHG 2QBWA 2ZUUA 3LV3B 3C60A 2PO6D 5LBSL 4GG6F 5DD3H 4LFHD 3BGFB 3AMKA 3QEHB 4IRSB 1H5BB 5GRVL 3Q6GH 4G8IB 5DJAB 5D5MB 4X8XA 3S9DB 5DJ2B 2V5TA 1Q0XH 3UEZA 4M61A 4OZHF 5IHUH 1GAFL 1NGWB 4RIRB 3VXSB 4P3WA 4Y2DA 3QA3A 4MAUH 1GH7A 2VZSA 3Q0HA 1RZFL 3KVQA 4U0RC 5IP4A 1C12B 4OZFA 2FH8A 2OLDA 8FABB 1SM3H 1UCBL 2APFA 4K8RC 3RL2A 3GIZH 1BX2A 1DCLA 4PJIB 5E1AA 4BQ8A 5DJ8B 1I1AC 5HY9A 2R23A 4YE4L 4PY7B 5CZVL 4PRID 4TPRL 1OWWA 2HP4A 3MJ9A 1YY9C 1BBJA 3JBG7 5J1AB 4IM8A 1JGDA 3I2CH 4LLYB 3HZYB 3L1OH 3L7FA 1T89C 1AKJA 1T7XA 4JN1L 1BGXL 4QRQB 5FEBA 5F7WC 5I74C 4GXVH 5CWSB 4M6NH 1SY6H 3FRUA 3QAZC 5JPNA 5L7XL 3GB7A 3W9DA 4MS8D 4C58B 3HE7C 3VXUA 1GZPB 2ADGA 2R2HB 2VABB 4IRJC 5HHOB 4H1LG 3O11B 1G7JA 1MHEB 4RBPH 1D9KC 4WTXA 3VWKD 2EIDA 2V9QA 4PB9H 5AZEH 2K7PA 3VFGL 1T7ZA 4OZHE 1I8IB 3BYTA 4PTTA 2GIYA 4P9ML 5JO5A 1O7VA 3DVNA 1C7TA 1UKTA 2UWEF 1XGUB 3UDWC 1LO3H 4XVJL 3FQUA 1FYTA 1W8NA 4HAFA 4LCWB 3Q5TA 2W07A 2VAAB 4HHAA 5T3ZH 1T20A 5H94A 4U6XB 3CDYA 4O2EB 4Y4FC 5GRXG 3QQ4B 4HDIA 5IB2B 3X3FH 4CU6A 3HE6B 1GYAA 4K3EL 4K9EH 5CGYC 1TTGA 4N5UA 5SX5H 4YPGA 2BVQA 3ULVC 5I15H 3BMWA 1G6RB 4PLJC 2EIEA 4P57A 1VKXB 3T4AA 3S96A 1XT5A 5IVXA 5F7LB 2QHRH 4OFDA 2X4RA 3WXVH 3WHE1 2ARWA 3IDJB 1LO5B 3HUJF 2NY1D 1RZ8A 1H8SA 2DLFL 4O02H 2VLJD 1QBMH 5C0EB 1MAMH 3GMPB 5T3ZL 1UACH 2AJYL 1P4LA 5HYSA 3BPOB 4R3SB 4B53A 1ZVYA 3P4NA 5ETUB 3GSQB 1JWSA 4O4YH 4H25B 1XZ0B 1NEUA 2B20A 1RJZA 4B7LA 2XA3A 2CKBA 2X5PA 4PJ9B 3TIEA 3GNMH 1WZ1H 2R4SL 4PGBB 4Z0BH 2E7CA 4IEFB 1OPGH 4LEOB 4E41A 1MRDH 1ROWA 3WXVL 1BX2B 3AS2A 4M1DH 4JQXA 4ONHB 5K9JL 5IVZA 4M6NL 3CAFA 4ETYA 5KANG 1TQBB 2NMSA 4X4XA 5BOPA 1IQDA 2OQJA 4DUVA 4YBLB 4X4XB 1MJ8H 3D39A 1FFQA 3ULUE 2IAMD 2R29H 1HSBB 4AQ1B 4F8TA 3MRNB 4BKLA 3MNVA 1QLRA 4G42B 5DA0B 4QF1B 4BZ2H 3ZKMD 3DUUA 1A9BB 3NVQA 1FNGA 4FFYH 4M8VA 4R8WL 3O8XA 4WEMB 4CVXB 1F6FB 3WS3B 2G75A 3L3DB 5H37H 3QFJB 1NDGA 2GSGB 3DX7B 3Q48A 1KCUH 3F58H 4Z7WB 5E2TL 1RJLB 1MCHA 5KSVB 4HCRA 3L3GB 4XWOD 1N5AB 4PJCF 5D1ZD 1TZGL 3RHWF 3DVNB 2IANA 1T80A 3OKKA 3DSFH 4L8BB 4ODSH 4NQCA 1YEDA 1A7OL 3D3VB 4UBDD 1T0MB 2VZ3A 5F7UA 1AD9A 4NCDA 1MRDL 4GUPB 5ALBH 4F58L 2OTWB 2YD3A 2ZG3A 5TE7L 1MCBA 2RJMA 4J4PC 3LN4B 1UEMA 1NGYB 4OCMC 2X4QB 4YNYB 4KK6C 1NGPL 1MJ8L 1VADA 3QUXC 4X4ME 4Z7VE 3I2CL 2AK4E 5HDLA 3VXRD 2YHGA 4NO5A 2G5RA 1OTSD 4UT6H 5DYOA 1EAPB 5F9AC 1MFEH 1YEFH 3C6SA 4TYUA 4MCYA 5I30L 2W65B 1KLFA 3OJMB 2AAVA 2EKJA 1SYSB 5E8PB 3P0VH 3OJDA 3FB6A 5JNYB 3SQOL 5FDYA 5T1MA 4ESKA 5B38G 4MJ2A 4MMXC 3VXQA 4PJCE 4RGND 3CNKA 3MRRB 1IFHH 2HVKB 2J4WH 4KKLC 2EXYC 4R4FL 4XP1H 4ZO6A 1DBAL 1Q0XL 3H7BA 3CJJA 3KYKH 1HHIB 4KMTH 2VUYA 4XMKL 1UA6L 2L7JA 2LAAA 2JB6A 3MBXH 5T3ZE 3B9KB 4GRWB 1YDPB 3I3BA 2B1AL 5ALCL 5E6YA 5TDNA 1ZOXA 2BVPB 3IDXL 4N5ED 4HT1L 4KZEL 4ZPVB 3KYAA 3S7GA 5TQ2L 2IBGA 3DXAB 2XWJB 1V7NH 3KPOB 4J3WA 3DXAA 1T7WA 4JKWA 5E8DH 1J0ZA 1KXVC 4AT6B 1MELA 5D7IE 4J3OC 5FIEA 4HZAA 4XI5C 5IM7A 2LVCA 3D0VA 4KV5E 4PJHB 5CFHA 4YK4B 1FNAA 3NN8B 2FATH 1KB5H 4QXUH 4S11A 2JJSA 4XNMA 5GSRA 4E42B 5JIKA 1IKFH 4MXQD 3SGKC 4AG4H 5CINH 4X6BB 1ZVSB 1JJUA 3RGVC 5L88L 1M4KA 1Y0LB 3K8KA 3HMXL 2NCMA 1YMHB 3TVMC 3MCG1 2VH5H 5FO8A 3EO1B 1IC4L 5BJTA 4KROB 3G6DL 4G42A 4V1DA 1CL7L 2A74A 4PB0L 3QDMA 5DD6B 4PD4J 4G3YH 5FA4A 4XH2A 1TZHA 1F4XL 4HJ0C 3UCRA 2R9HC 4Z0XA 1X5GA 2H45A 3NABL 4TOYL 3PGFL 4RZCB 2EZ0D 15C8L 2AS5M 3QI9B 2VLRA 3PABB 4JFEB 3VFRB 2YKLH 3U9PH 1KCRH 3TA3A 1IC5H 3WFHB 1NGPH 2NY3C 3KPSA 1PKQE 1I7RB 4KK9D 2YD4A 2XTJD 3NOIA 4HMEA 4W6XB 1S7WB 1R5WA 4MA3B 3TN0C 2PTVA 5D70H 4DCQB 3B5TA 2YPVL 3BWAA 5J4MA 4MA8L 2ED8A 5FYJL 4L4VB 4GW5A 1CDCA 3TBTA 1VPOH 4DK3A 5L2JA 1PG7L 5I8KH 3QUXD 2Z4QA 5IB2A 5IFHH 1FN4A 5GS0L 4TSBL 3MLSL 5C6TH 4Z95H 4QTIH 4L29B 2IH3A 4ZFOB 1UKSA 3FQRA 4YC2C 1EV2E 5HI4D 5KSAB 4LCCA 4GW1A 5D96B 1RHHB 3S34L 1UACL 1X7QB 2VERN 1I7ZA 3QH3A 4NO2B 4J1UB 2DQTL 3OKEA 1BD2D 4WV1A 1KBGL 3C5JA 1EVTC 4WTZA 1RI8A 1V7NL 2X09A 3OG6B 1OAQH 4HULB 2X9XA 5FHAL 3LPWA 3CFEA 4I3SL 5DLMH 6CGTA 1YPZE 5F3BA 1FNHA 2MCG1 1EVUA 4M61B 2AEPH 3GMPA 2IADA 1E6JL 3FT3B 2HFFB 4HGWB 4NZDA 1J8HE 3MGTA 2GAZB 4Z7NE 3ZHKA 3MV8A 5ETUA 2MOVA 4XP9L 5DRNB 5EU6B 1P7KA 3MV8B 5ID0A 4PJ8D 3MV7A 4YDKL 1U58B 4TVPE 4POZC 3RUGF 3DUUB 2GCYB 1RULH 1NCDL 1IILE 3MX0A 4G7YL 2J5LC 3CSYB 2HG5B 2X1PA 4D0BA 3BP5A 3S6CA 2Q3AA 5FYKH 1LO2L 4I48A 5E2TH 4CAGA 3MROA 2I5YL 2ZZUT 4QRQA 1KT2A 2XKSA 4XRCB 1RUKH 4WCYL 2VDKL 5DHXB 4RMVA 3KYMA 1YEGL 4Z0XB 4OZIE 2BSRA 3L5WB 4BH7B 3GSOB 3DNKA 5DJZB 3UTOA 5I17A 1WAAF 5BRZD 3QWQB 2AJXH 2QQQA 4AY0A 1HSAA 5FGBC 3IRPX 1GPOH 2N7AA 4LHUG 2BJMH 5EUOF 1NGYA 1QEWA 4HLZG 4LL9A 5GS0C 3WIHL 4F9LC 1CE1L 2E8YA 1B4JL 5JZ7D 5ERWA 2EC8A 2EDEA 4ZFZB 1QR4A 1BZQK 2W60B 2X70B 3NTCH 1GOHA 5HHPA 4HBCH 4JPIB 4MA1B 3OXSA 4FTVD 3JUZA 2ZCKL 4X6CA 5EB9A 3KPSD 4OI9A 3GSWA 5TDPA 1RZKC 5F1OB 4HH8A 1BWWA 1BJ1H 5TF1H 4PTUA 3T4YB 2BRQA 4QNPF 5KSAA 4KMTL 2DQDH 4HMCA 2DS4A 4XCNB 5FB8A 1ZLUH 4OGYH 1ZT1A 1OM3H 1ITCA 1E4XL 1J05A 2AGJL 1Z0NA 2Z35A 5E95B 1R3HA 4P2RE 4N8CH 4EZMA 3B9KA 5I76B 5K9QG 2VITA 4CW1A 2HRPL 5FYLE 4FP8L 1KCRL 4ZUUA 3DVGA 4YDLC 1GHFL 1PVHA 1PZ5B 4NUGH 3O3AA 4PR5A 4D94A 5CLWA 4I2XE 1JNJA 1E4JA 4XP5H 4OCYH 3SGKA 4X5WA 3RDTC 2EDXA 1EIBA 1DLHB 4G9DA 5JQ6H 1HHJB 2DKMA 3T0WA 1KNOB 3LKOB 3SDXA 4XNMB 1T03L 5IBUB 4ZS7H 1PEWA 1FLRL 4QCIB 5EU6A 5C0IB 4F7PB 1YJDC 4PJ9D 4UNUA 1DUZA 2BVUA 5ICYA 3TGXA 1FQ9C 5GGRY 4M8QA 4RGOH 3ZZ1A 1PY4A 4XPAH 1CXKA 4QNPE 1QNZH 5J11B 4ODWB 4XX1E 1OQOA 2DJUA 3U7AA 5IOPA 1HKFA 4LOUC 2F19L 4QGYA 1FZKB 1QKZL 3QCVL 5EZLA 1OF2B 3SDAA 3U0WL 3HAEB 1JPGB 3F5WA 3JTSB 2R0KL 5L6YL 5CEZL 1ZTXH 2BHZA 2Z8RA 4EVNA 5HDOA 3S4SB 4JFZH 1C08B 1KULA 1A3QA 4LGSB 3KPMB 4D8PA 2DWEB 3UJJL 1P7HL 4LCIL 1J0KA 3D1MC 3QUZD 4X9HA 3CC5B 3UBXG 2DTMH 1ORSB 2YN5A 4EN3B 3UPRB 2H1PH 5TFSH 1DQJA 2CRMA 4PY8I 5D1ZB 4AQOA 4Q7DA 3B3IB 4AMKL 3FKUS 1CDJA 5D2LF 5I16A 4ZYKB 4HIJB 5GS0H 1OAKH 2D9CA 2WQ8A 3KLDA 3GBLA 4HQQH 4YHML 4KTEH 3N50A 1INDL 4P5MB 1PD6A 4G80A 5FUOH 3BHBB 5E08L 2DM4A 4OD1H 4GW1B 2XN9B 5JR1H 1S7WA 4YHYC 4E41D 3E6HB 1R3LA 5LGHH 4B7IA 3N1GC 4OZGA 5CEZH 4A6YA 1F3JA 2NX5A 1ZE3C 2FX8H 4FRWA 3LQZB 4KPHH 3FFCE 5E99L 5CGMA 2PXYA 3CFCH 1OTUD 3GGWB 1JWMB 4JM2D 4JHAL 4XP5L 4IRJD 4AG4L 4M5YL 2DIAA 1YEKH 2R69H 1GGYA 2NXYD 3VW3H 3RNQA 2P5ED 1KJMB 1PAMA 1Q9LB 3NIFF 4Z7UA 4MGXA 4L1HA 4J8RA 2IG2H 3L9RA 2Y25A 4XPBH 4XPHH 5KAQG 5GIRB 2JKXA 2C7UB 4Y19E 2OP4L 3B9KD 3GSQA 1QUNA 3QG6A 3UZVB 3UYRH 4UV4L 1H0DA 2XA8H 5EC2B 1CF8L 3O4LE 4K7PL 5B3NA 3DX9B 2NQCA 2GCYA 3CU1A 4ZSOA 4LLVA 3CFEB 4PRPD 4QKXB 2XXCB 1XR8B 2VDPL 3BGMB 3BP4A 3C2AH 2N4IA 1BQLH 1YUHA 3BMVA 2J8UB 3BZDA 3G5YA 2QTEA 4EN3D 2C3GA 2V9RA 1P2CB 4KAQL 1U9KA 1F58H 3ULUH 2VXUL 3HC3H 1DN0B 4XT1C 2C3VB 4D9QD 4FP8H 4HV8B 1CTNA 1FO0A 1JPGA 1NEZG 3WNMA 5F9WB 3HUJE 2E7HA 1WVZA 3NIFE 3KYOB 4KROD 1WWBX 4RMUA 2DM3A 1URLA 3ZHLA 4YHOH 3G6JA 1S5HA 3VD5A 1SJHA 5FECB 5CS7A 4NBYB 5C86A 3VFSB 2HFEB 1NLDH 1JGLL 1G9MC 4DN3H 1GC1L 3SDAD 3BO8A 4IIQB 1QHPA 1DEEB 4GFTB 1MPAL 2DYPB 5DEFA 1HE7A 2D7PA 3K1KC 2OM5A 1Q8MA 4FQHA 2WBKA 3NCBB 1B90A 4G9FD 3O2DA 3T0EE 3DO3A 4TVSa 4OD3L 3C09B 3IAGC 4H8WC 4L8CB 1U93A 1OCWH 2F19H 3KYNA 4B50A 3LN4A 3OKLA 4RGMC 3RDTB 1N8ZB 4PY8J 3RWFB 2C5DC 3QDME 5F7YC 4WFFE 4YXLL 5EWIL 1VENA 3U9UB 5AZ2L 1D9KA 3CX5J 1ED3A 3OHXB 5DUBB 4HZLB 1CXHA 5SWQB 1MWAL 1X5FA 3TBWB 1PDKA 4LCIH 2YSSA 2BSTB 1X5IA 2JCCF 5IJKA 5FGCB 1H5BA 3JV4A 4I2XA 4YE4H 3GDBA 1SMAA 3S36X 4JFDB 1KCLA 5CJ8A 2O5ZH 3OAYH 3O4OC 1IAOA 4PV8A 2ADFL 3TZVC 4FZEH 1YEIL 3GSXA 1P9MA 3UX9B 1JZ4A 5DJXB 5FM5O 3SOBL 4JDVA 1KEMH 4LCUB 1L4IA 2JB5L 4M1CD 4G43B 2NY6C 4U0QB 1FFRA 4JFFD 2ZSWB 5DMGC 1QACA 4QRRE 2AJSL 4PRDB 1RIHL 4ONHA 5IOPB 4YXLH 2A73A 3S35H 2QV2A 2FIKB 2X89A 1L0XA 2GYSA 3PGCB 2CDGB 4UTBL 4QLRA 2F5BL 5C0CD 4RFOH 1MIEL 2Y06H 2XY2A 4OJFL 2EICA 5E8OA 2PCPB 3MREB 4PGEA 3WN5B 5EA0L 2XNAA 5CUSL 2YWYA 1ZGLM 2VXTH 3ES6A 3MLYH 1I3GL 4YXHH 1QZ1A 3SY0B 5GGRB 4HWBA 1QVOB 4D0DB 3DURB 2YN3A 3F7RA 1ORSA 3WNKA 1EXUA 1NCCH 5J89A 1IC1A 1O7SA 2HT3D 4GG8A 2IANB 3RVWC 4GRWF 2UUDK 3DJ9A 2X1XR 1ZEAH 3FZUC 1VEPA 4OGYL 2D31A 1Q72L 2Q7YB 5F89A 4HUUB 5L2KA 3S35L 5IW6A 4PJ7E 1RZJL 5SWSB 4F2MA 5EN2B 4I77L 5JHDD 1FC1A 2CRYA 4H88H 5BW7A 2XN9A 3B2UD 1JGEA 1SEQH 3KPSB 3CFKA 4KUZH 3VE0A 3MLRH 5ERWB 2Z31C 4HFUL 5JO5B 4JREC 5D7IF 2NY6D 4WUUE 3K2MC 3KJ4B 3T0AA 3MV8D 1T2QL 2X05A 3ZLQC 3ALPA 3EYOB 2AI0L 4FXLA 1JF5A 2F53A 2PN5A 1YYMH 3QYCA 4L4VA 4U6XA 3FFCA 3CVIH 4YFDB 3H9HA 5C70A 3EJJX 4QT5A 2NY3D 5A3IC 4M93C 2BNQE 3OGOE 3KR3H 1MCIA 1D5BB 5H2BB 5TGBB 2OL3H 2X7LB 2HMID 2D03H 4KK6D 1EUUA 5DZOA 1D5XA 5AUMB 5IEHA 5D7SL 4YHNA 5EUKA 5KSAC 3SGEH 5ISZD 1XCQA 4NRYB 4YHNB 2NY4C 5MI0B 1WIUA 4M5ZH 3TVMA 1N6QL 1CGWA 1JF1A 5CEYB 1R5IB 4JM4H 1YJDL 2P42B 1FFOA 3HAEG 3WJLC 3FHQA 1FL3A 2ORBL 1ZKAA 3DRTA 3IDMA 4JRXB 3QDJA 4MXQC 4TUJB 3UTQB 3QDJB 3VJ6A 2JJUA 4KVCL 2AJYH 1YEEH 5HHXH 1RUPL 1U8IB 4S1QH 1AXIB 3MNWB 2H26B 4NYLB 5C09D 1ZANH 2JE8A 1A7OH 3EYUL 1CR9H 2EDHA 1G6RL 1T7VA 4WFED 2Q7NA 3MRPB 4ZAKC 2VXQH 4QTHA 2D2OA 5E9DB 4DFHA 3OPZH 4P2OD 3P77B 4KJQC 5ESAA 4D0BB 1DN2A 3UJIH 1ZEAL 1BWMA 3IFNL 3JTSA 1N5AA 4UNVA 2FDBP 5GGUB 2GTWB 5A2LH 3LS4L 3MR9A 2X42A 3PGDA 2OSLB 4NQDB 3OKMB 4IRZH 2FX8L 3SDXE 1R3JA 4NQEE 5MEQB 3G08B 1YN7B 4KVCH 1XGRA 5BV7L 1RVFL 3LH2L 1QSVA 4XCYB 2JELH 4N0RA 3LQMA 2ICWA 4LCWA 2NTSP 5DHVB 1MIEH 2F54D 1TQBC 3QHZL 3UTTE 1Z5LA 4KK8C 4YHIB 5BS0E 1U8OB 3RVXD 1UJ3C 5EOCJ 4OGXH 2NW2A 3GO1L 4UI2A 3T1FB 4APQD 2NXYC 1P53A 3VXQB 4K3EH 3WE6A 3EJYD 3KYNB 1QA9A 5C07D 3VG9B 4WGWB 1DFBH 5T5FH 4Y88A 5FXCH 5CILL 3G04A 3MV01 3QJFB 4ZS6C 2ZUVA 5DD5H 2CIKA 2D7OA 4G8EB 4N9OB 2XI9A 4HMDA 4KUCF 1K8DB 3MRLB 4AL8H 2R0LL 2XPGB 1QSEE 4IHOA 3ARSA 3MLTA 4LVNC 4R97C 2EC9U 1DQLH 4X7EC 2V5SA 3ARFB 5IVXF 1NFKA 1TMCB 3MLRL 2I9TB 3HMWH 5IJVA 5KAQF 3S8WA 2IADB 4Q6YA 5JMRA 1QSZA 3JZ7A 2J4WL 4BSJA 4GBXC 1J9CT 4XMPL 3CIQA 4Y4KB 2DMCA 3BP7B 4X5WB 4WW2F 2BK8A 4A6YL 4WY7L 3D25A 2JB6B 5EORL 4PFEA 1M6OB 1T3FB 5J11C 4JZNA 3MOQA 3OB0H 1N7MH 7CGTA 4WWKC 2GJ6B 4EIGB 1HYSC 2VLJB 1L6ZA 4E41B 1HYSD 4PJXB 2AABH 3A6OA 5CEXB 1G7QB 3RVWD 1Q9WB 3ARPA 4NNXA 5D2NC 2OR8A 1I9IL 2CLZB 5HDBE 3S37X 1FO0B 5DVKA 2XZCH 4ACPA 1HHKB 2D7MA 5F9JA 1WF5A 1IKFL 1U8KA 5IUSA 4DQOL 3ROLA 3BIKA 5A2IH 4CBPA 1JPTH 3P11L 2ENYA 3QEQE 4NJ9H 5GRWA 3G6JB 3HR6A 2VABA 2VIRA 3PJSB 4ONGL 1FNFA 2NY7H 2DJ4A 4MQXC 1NANH 4PB0H 3BSZH 3EZJB 3H3PH 1A4JB 4BSVA 1VEOA 3C9NA 2P8MA 1EMTL 3BWAB 3GMMA 3D3VA 3DX6B 1J8HD 1ZANL 4LNVA 2P8MB 3S5LG 4OB5H 4WDIA 5C7XH 2IQ9H 1W0YT 1S78C 5L2JB 3QSKB 4P5KB 4IDLA 3PABA 4TSCL 3GBMH 5GS1C 1X5JA 3U2SB 5EIVA 5I1JH 5JLZB 4OI8A 4ZQKB 5DVNA 4KZDL 3UDWA 4G9FB 1EEUA 2VC2L 3R1GL 1P84K 1FP5A 2VYRE 3I75A 1I85C 2R39A 1OGAE 3D3VD 3JWDH 2FJFB 3DTXB 1E28A 4KJWC 4OLVL 4OGAD 4BK4A 3QNYB 1HH9B 1U91A 4UTBH 1AGCA 3AS0A