3OKOB

Crystal structure of s25-39 in complex with kdo(2.8)kdo(2.4)kdo
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
219
Chain Sequence
EVKLVESGGGLVQPGGSLRLACATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQSSLYLQMNTLRAEDSATYYCARDHDGYYERFAYWGQGTLVTVSAAATTPPSVYPLAPGATNSMVTLGCLVKGYFPEPVTVTWNSGSLSTGVHTFPAVLSSDLYTLTSSVTVPSKTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-39 Fab (IgG1k) light chain
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
molecule tags Immune system
total genus 41
structure length 219
sequence length 222
ec nomenclature
pdb deposition date 2010-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okoB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okoB01
1X5AA 4KDTC 4NHCL 1UB6B 5IF0A 5IQ9B 3HZVA 1AE6H 3OAYK 1Y6MR 1KIUA 1F11B 5KSUB 2DM2A 4JHWH 1RJLA 1M7IA 2CKBB 3REWB 2NQCA 3BHBB 3DMMA 3MLWH 2E27H 4QRTB 2LTQB 5TDNB 2X4OA 5T3ZD 3NCEB 4ZS6C 4LHUG 1J8HA 2P5WD 1FZMB 3ES6B 1KIQA 5JNYB 5C0DB 5FA3A 5IBTL 4QXTB 4NNPL 3FO9B 4XP9L 4MDIB 4NN7C 5I0DA 3DUHA 4Y4KA 5HI5C 3P3YA 3C09C 3SPVA 1U58A 3LN4B 1T6WA 4HK0A 4ODVL 1M6OB 1KPUA 3DSFL 3QSKB 4LDOB 3VFMA 5BZWB 4NIKB 2VQ1A 5I66B 3DMMC 4KMLB 3QI9B 4L29A 4NUJB 4XPFL 3GRWA 4KFZC 4MCZB 4JM2B 4NRZA 4PLJD 4L8SB 4KJQD 4G9DA 1B3JA 1AXTH 1VGEH 5LWYL 4Y4FB 5EOQL 4CADB 3QULA 2UUDK 1WZ1H 2IEPA 3GSUA 3IXAA 3U83A 2NNAA 4M7ZC 2FZ3B 2X05A 3QP3A 4JANA 1VGKB 3BJ91 3E8UL 3D69A 1MCIA 4PJHF 1CFVH 1U2CA 4Y4KC 2RGSA 4F8TA 4LVNC 5I74C 4Z95L 4V1DD 5I75C 4WHCA 3UTTD 2YKLL 3DRQA 5KS9E 1G9MH 3T0EB 2OCFD 3T1FB 2QJDA 3SDXE 5F7KC 4OTXH 5TH2A 1DQDH 5IT2L 3MA7B 4PRHE 4IRJB 5HGBA 5FV2A 3CZFB 1KSRA 2WWKO 3RIAF 2MCPH 4G8FA 3QCUH 1XIWB 4F37K 4MNQD 3VWJD 5FOBB 2P5EB 3QO1B 1UH3A 4OGZA 5FYLL 3MR9B 3MJ7A 1S7RB 2ERJB 2MPAH 2OZ4L 4L8DB 8CGTA 5J7CC 4CJ1A 1KJVB 3G6JB 4NWTL 1MRDL 4UNVA 1U8IA 1KBGL 5E1AB 4Y1AA 5CD5C 5I1LB 3CDFA 3FB8A 5I73C 1A1MB 3O8XD 2PYFB 3TC9A 4Q6YA 2C1PB 5F7HA 1RZGB 3HS0B 5C0AA 5E08L 3PWLA 1LK2B 3ABZA 4O02L 4ZFZB 5T3ZH 1IBGL 5CBEB 2DF3A 4UTAH 3WL9A 1T1YB 3F12B 2EDNA 3HI6L 4K8RH 2J1KA 4JDVB 5D8JL 1K8IA 3T4YB 4NKDA 4XWGH 4NM4L 3P0VL 4P5MB 3C5JB 3EO9H 3P4OA 5F7LB 4PJGF 4JZNB 4PS4H 1NCBH 5AUMA 2GY7B 3P30L 4A6YB 2G5RA 5DA4A 4JRYA 3BW9A 3ZT5A 1FRGL 1S9XA 5DWUL 2UWEB 3NA9L 3EKCA 4GS7B 1XR9A 4KRMB 4OFDA 5DURD 3V0WH 3WS3A 1HYSD 2DJUA 2CK0H 2ARJQ 3WNLA 4O9HH 2NR6D 5F89B 5D2NB 3UAJD 3AREC 4H8WC 4P9HC 3WJLA 4JVPA 3D0VB 5D71H 3S36L 4O5LH 5GS2H 5D5MA 4YO0A 1P9MA 3QIUD 4MB4A 4CU7A 4Z7UE 2WLZA 4JJHA 3PWVB 1ACYH 1BFTA 5DT1H 3SDDA 4IOFD 1I1AB 4M6NL 2WSKA 3MCLH 1CXLA 5ERWB 2CIKA 4XVJL 4M8VA 1S3KH 1HXMA 3FQTA 3MLTA 5CJBA 1T21A 1ZT1A 2O5XH 2XTJE 1ZLWK 1RU9H 3ARGB 4FMFA 3K4AA 2AJXH 6FABH 3JWDC 4RFEA 4MX7B 5IG7B 3EYUL 3HC3H 1I1RA 3WJLC 1M1SA 3LKNA 3BIAX 4OKDA 4EI6A 3JUYA 5I2IB 1HQRA 2QQQA 1YJDC 2ZP0T 4ZUTB 3U7WL 3SKMA 2JTDA 1MI5B 1P9MC 3RA7L 3ZL4L 3PWJA 2DQHL 1Q0YH 1EJ6A 5I1DB 2D7OA 5DGQA 1TCMA 5HD8D 4NZUL 5GZOC 1B0GB 2IPTH 4QHMA 4FNLH 5CINL 4NWUL 1RJZB 4RGOH 3REVA 3SDDC 4U3CA 2BJML 5KN5A 2CXKA 4QRPB 3UTSE 4M7KL 1JTOA 5E5RB 4Q9QH 2LFGA 4LHUB 4PJ5B 4PRPE 1UFUA 5F21B 3CFBB 3N9GL 2P5WA 1DL7L 3CX2A 2X9XA 5ESVA 2H45A 3E6FB 3MV7D 5IROA 4NPYA 4U1NB 5JHDE 3UPRA 1CCZA 1PY4A 4ZPVA 1AGFB 3WEXA 1NBYB 3FO0L 4JZJB 3HNSL 1RUMH 4JFQB 1MREH 1OAYL 5F7DA 2XA8H 3NCMA 3QXVA 2YUWA 3HB3C 2GJJA 4HX1A 5EA0L 4JFDB 3LN9A 1PG7X 5F9OL 3M07A 2EIEA 4JRXA 2BY2A 3TZVB 2XV6B 4TNVF 3WUWG 1HH6A 4GXUM 4OSUH 1IQDA 3IFLH 4S1SH 1FVDB 5D70L 4Y16D 1UKQA 5L8KB 5J4MA 4E41D 5IROC 3QXAA 4L4TE 1DVFD 3F7YA 3FB6A 2V7HA 4G7YH 1L9MA 5D9SB 1J0KA 2ICWA 2ADGB 1MQ8A 2ZUQB 2N7BA 3VXTA 2O26U 1LD9B 4WW2B 2XWJB 4PV9A 2WBJC 4V1DA 4X6BA 1WICA 4WRLA 2XG4A 3UTTA 1CXFA 2XA3A 4H26B 4D94A 5A3ID 5MHSD 1GHFL 1A14H 1R5VB 2W0FB 4MD0A 1FG2A 1MWAB 1ONQB 1QSZA 1XF1A 3E6HB 3DO7B 4KJQC 5DQDL 1ZGLM 5IB2A 4LSTH 4KVCH 3VRIB 3PHOB 3L3JA 3LZFL 3QHZL 2XN9D 4PJFA 1YY8A 4MNQA 4Y5YA 3VWJA 3GSNA 3KWWA 5KVEH 2DS4A 4U49A 3R1GH 4I2XA 5CLWA 3CVIH 3WFEL 5AEAA 4JDTH 5LKNA 3GNML 1UENA 1IKNC 3AS2A 1QZ1A 3VW3H 1U8KA 3MYZA 4FXGB 5B38B 1NPUA 3LPFA 3T2NH 4L3CA 4LRNH 3KPPB 3GMRB 5F9JB 3RPIB 1CK0L 3FQWB 4YC2C 3BO8A 4XHQA 4ZO6A 1F4WH 3Q1SL 3FOLA 5EO0B 4LCYA 1YDPB 1QSEA 1GC1L 3OXRA 1JHKH 3KPRB 3MMEB 4XBGA 5FO9B 4Q74A 1H3UA 1CF8L 4RAUA 4HUKB 4GQPH 4NUGH 1A02N 4Q6IC 5GRYA 5J11C 4I3RH 5HSFA 1QSFE 1MHPL 3MSPA 1Z0NA 4G6KL 4Y4HB 3WXWH 3MLRL 3IDGA 2FJFA 1EZVY 4EI5B 3MLXH 3LPWA 2FIRT 2ITDA 2BK8A 4DCQB 3ZYZA 2Q86B 3D5OF 5IEHA 1EGJA 2VSDA 5CMAA 1RFDH 4EQ2A 4KK9D 4TVPL 3LHPH 5DUBA 2ZCHH 5K9OA 1P5VA 1CXEA 4LCIH 1MCWW 1WFOA 2C7UB 4DQOH 3QIUA 2EDKA 3IFOA 3QXUA 3O0RL 1MUJB 2XPGB 3O81A 1R24B 3RL2B 5C0GA 5T5FL 2D31B 3W82A 3IDXH 2ITCA 5TFSH 2AJVL 1QBML 3QPQD 4H5SA 2QSTA 1CFTA 5GGSA 3ZT6A 2O93L 3DHJA 4HMEA 2NR6C 4Z76A 3UAJC 3OZ9L 3MRFA 4LNRB 1UWGH 1QFUL 3SQOL 5I1IL 2E6PA 2UYLA 4PRHD 4MNGE 4YFDB 5IMLA 3D48R 1AHWA 5A2FA 2NY1C 1IVLA 3L95A 4M61A 3LS5L 1SYVA 1MFAH 4YHOL 3JXAA 3S37X 4ZO7A 5ANMA 5DZOA 4AT6A 4BZ2H 3RWCB 4D3CL 3P4NB 5C0FA 1BFSA 1MFCL 1DN2A 4KI5C 4NCDA 3MV7A 5ICYA 2AK4E 4G3YH 2WLYA 2B7DT 4G6FD 4ZUVB 4OCRL 2I9TA 2AQ1A 2CDGB 1RZFH 4K07A 3S88L 1KT2B 1F6AA 1QTYT 2HFFB 4EBQL 1VFOA 5ACLA 1AHWC 1YN7A 4RQQA 5KANG 1UXSA 5IB1A 3ZKXB 2DYPB 5HD8C 2HVJA 3UO1L 1RHHB 4ELKB 1W72H 4FQ1H 4RSVA 1DLHA 1RK0A 1EXUB 4P5KB 3Q6FB 4PGDB 1BZ7A 4I77H 4KXZI 4OD3H 5DEGA 4GXUN 4Y16A 4M48L 1N6QH 3TIEA 1F58L 4X5WA 3WSQH 4NQEE 4KHTH 2BC4A 3B8YA 1ZT7B 1QRNB 3MJGX 4LSSL 4FA8A 5H2BB 4OLXL 5D72L 4OGAD 3LB6D 4FFWD 2B0SL 2K7QA 2DQJH 4XNYL 4CUCA 4TSCL 4KTEH 3FN9A 3SQBA 4NN6B 1NDGB 1IFHL 4R97C 4GLRH 4B53A 3OX8A 1CZ8L 5IBUB 4WTZA 2RFXB 2VDOL 3DX6A 4K9EC 3VXPA 3RVTD 3S9DB 4L8BA 3QG7L 4OM1H 1EEZA 4Y16C 2X89D 3V52H 1UXWA 2XN9A 3TJHD 5E24E 5EBLB 3RZWA 3P11L 1HHGA 2VZ1A 1SJEA 4EVNB 5BO1L 2J4WL 2XTJD 5IF0B 3HZVB 4AIZB 1S7UA 3RWHA 3ARPA 5HHMB 1RJLB 1M7IB 2VDNH 3DMMB 4N68A 1FQ9C 2FX7L 4FQXD 3JV6A 5A3IC 2HRPL 2X4OB 2XKSA 1H5BA 4XNXH 2FX8L 5I1KH 1RVFH 4MAUL 1J8HB 3Q48A 3LH2H 3C8KA 3HAEA 4GBXC 3BEVA 4L5FH 3QRFM 1KIQB 4HXBH 2XI9A 4EZMA 5I1CL 5FA3B 4KROC 3BRGC 3W2DL 4G42B 3HZMA 4M7ZB 2D2OA 1RJYA 3UTSD 2X09A 4PRPD 4JQXA 4XCYA 2H8PA 3MODL 5I74B 3SPVB 1AQDA 1JRHH 1U58B 4IMKC 4KQ3L 4HK0B 4JCMA 2Q20A 5JHDD 1KPUB 2C3GA 1MAMH 4X4MA 4L29B 4L4VB 4DEPB 1A9EA 4NRZB 3I6KB 5KSBF 1FNLA 4G9DB 2FYYA 4HD9A 5JZ7D 3RKDD 1Y6NR 4FP8H 3QULB 3GSUB 3IXAB 5B39G 3MRBA 4UV4H 4XXDA 4HUVA 4NC1E 4JANB 5ADOH 3U82B 3D69B 5ILTL 4JQXC 1EO7A 1BQLH 3NPZB 2PF6A 2FX9L 5ID1A 4HIEA 2UZIH 3IB4A 4L4TD 4IJ3B 4YHML 5DR5L 3U30C 3DRQB 3RUGF 1TTFA 3H8NA 2QADD 5I73B 3V95A 5TH2B 3DXAE 5DVKA 2OK0L 1OSPH 1MQKL 4KGLA 5HGBB 1QFWL 5E7FA 3GHBH 5KS9A 5HDQL 1IILE 4G8FB 4HCRH 4DN3H 3QIBB 4NBXB 1FNSL 4OAWA 4UIKH 3SDXA 1Q0XH 4R0LC 3ARBA 3ARVA 1IAIL 5E95B 3PDDA 3MJ7B 4TTDC 2CDEA 2P48B 4PRHA 1U8NA 1ADQH 4ONHA 2OXGA 2WQ8A 2IGFH 4GJTB 1U8IB 4PJIF 4D0CB 2KPNA 3ISWA 4F37F 3NABH 4Y1AB 3MACL 1AY1L 3SOBL 4L3EE 1YEEL 3RIFK 5C86A 2RJMA 1TFHA 1GGYA 4POYA 2J88H 2RR3A 3QPQC 2EYSA 3SDAD 5C0AB 1OTUD 2B39A 3PWLB 2R9HD 9CGTA 4ZTOH 1REIA 3AXLA 3WL9B 5DJCA 2J5LB 4KY1H 1VKXA 5EBGA 2NY5C 3ARBC 1K8IB 4Y8AA 1KG0A 4NKDB 4OLVL 2XY2A 5HGDA 3DGCR 3P4OB 3HNTL 4EN3D 5AUMB 3GBNL 3VRLF 3F65A 3BPNC 4JRYB 4WEBH 3BW9B 4K9EL 1S9XB 1ND0A 1KJ2A 4N5UA 1TJGH 5MEOA 1IGTA 1XR9B 4JHZA 1IGFL 2W59A 3WS3B 5SX4H 3QPXH 1QSFD 2EDRA 3HC0A 1YMME 5FYKE 2F58L 1F2XK 4NZJA 1WWBX 4DW2L 5GS0D 1FFOA 1OTSC 4S0SD 2R1WA 4RMVA 5D5MB 4CBPA 1A7PL 2X42A 4YO0B 5GGSY 1Z9OA 5E70A 1D5BB 4OCWL 4PD4K 2NZIA 5EZOH 1WWCA 3K3QA 5KZCB 4GH7B 2HA1A 1QHOA 3K4ZA 2CIKB 4HUWA 2VQUA 3FQTB 3MLTB 4BA8A 1ZT1B 4Z7UA 2BRRL 5DFVD 1T0NA 4RFEB 3UTOA 3C2AH 1TNMA 4OZIE 5I16A 3T65A 1X5JA 1TVHA 3LKNB 4KUZL 4EI6B 3HFMH 4C4KT 1HQRB 4M1GL 5KW9H 3SKMB 4FFWC 3TH2T 2ZUUA 4G6MH 3PWJB 1FN4A 4O4YL 3GI8L 1NCWL 1OLZA 1I1FA 2VXTH 4OF8A 4QHMB 3TEUA 2OP4H 1OCWH 4U6HA 1XAUA 4FQXA 1QKZL 5IVOA 2DQCL 3REVB 3T3PE 4UT7H 4DGIH 3QCTH 4KK8D 4KQ4H 5KN5B 3VFGL 5JIHA 4UNUA 2QQNH 3LIZH 3RVTC 4NC0B 2P5WB 1SY6H 4FRWA 1NAML 1FFPA 5ESVB 2AEIT 1LEGB 1HINH 1B88A 3FT4A 4LQFL 2QHLA 4NPYB 2W9DL 3UPRB 1A6PA 3HNVL 3UTSA 3TJHC 3MOAL 3WEXB 4MWFA 4PRPA 3FQNA 4JKWA 3LRGA 3KLHC 5GGQL 2XTJC 4EDWH 1I9JL 4OJFL 5F7DB 3NZHH 1EO8H 2AK4D 3VFTA 5JHDA 1VPOH 4JQVA 3K8LA 4HX1B 4LSVH 1KB5H 4FQXC 5FYJL 1K4DA 1C1EH 2E9BA 3QUYD 1HH9A 4JRXB 1CGSL 4QRQA 4X4XA 1P4BH 3MRQA 5FKPA 1HH6B 1IQDB 2EXYD 5IFAH 4HBCH 5CSZA 4F33A 1T3FA 5EORH 1OD7A 3UJJL 3QXAB 3F7YB 3FB6B 2BVPB 2V7HB 2WUCH 2VO5A 3G6DH 3DX8A 2P45B 5GGUA 4IBLT 5C0JA 2ICWB 3M17A 4M93C 1BD2E 3VXTB 2B4CL 5I15L 3TNMA 5GRZA 2APWA 4NQED 5GS0H 4PV9B 1RIVL 1MF2L 4V1DB 3VA6A 4C54A 4X6BB 3FB5A 3UTTB 4WTZG 4MD0B 1Z9LA 1FG2B 4YHLL 2XKUA 3MRGA 1KGCE 4YC2B 3KHOA 3O2VL 4KJYA 5IB2B 4YH6A 3RKDC 3L3JB 4PJFB 1LHZA 4MNQB 4Y5YB 3VWJB 1FCGA 2IQ9H 3B5TA 3KWWB 2ZCLL 2NYYD 1D9KD 4R6UA 4I2XB 2XXMB 4IRZL 3O6KH 2APTA 5J11B 3OB0H 4C57C 4F7MA 3RY5A 1XF4A 3QNYA 4HIHA 1U8KB 3V2AR 4P57A 3FB7A 3EJZD 2EH7L 4YLQT 2R56H 5BW7A 1K2DA 4L3CB 4B50A 1NLDH 3O8XB 3D2UD 3KYNB 3SDAA 3T04D 4AL8H 4M3KB 3WFDL 3FOLB 3J8F7 2AP2A 4JGJA 1INEL 4Z77B 1FAKT 4LCYB 1QSEB 1Q38A 3OXRB 2V9RA 4XBGB 3HMXA 2QSVA 1NGPL 3BIKA 4RAUB 1KENH 5C0EA 5EU5A 4EN3A 1H3XA 2DM7A 4JE4B 3PG2A 5GJSH 1L6ZA 3U7AA 5BOZG 5EU4A 3IDGB 2KH2B 3CZJA 2FJFB 4AEHH 4FXLA 1L4IA 1ZLUH 5BW7C 4YBHA 2ITDB 2XXCB 1F45A 2ZNWA 5DURB 3IJHA 4GAGL 1QSFA 2G60H 1PAMA 2OYPA 5IEHB 1NANI 1M7DB 5CMAB 3V6FA 3ZE2F 4XHJD 5L0QC 1HNFA 3WE6A 1A7RH 3BZFA 3FL7A 2HG5A 2FCBA 5DUBB 5ADPH 5K9OB 3FN0L 5KTEH 4NM8L 3UEZA 1B4RA 1NDMA 3TH4T 2R2BA 3QIUB 3IFOB 5BQ7A 1U6AL 1L0XA 3CMOH 4ORGA 1UWXK 3SHSA 4BJLA 5E2JA 4JO3H 5C0GB 2FEDD 3AS3A 4M7LL 2ITCB 1S7TA 2DL2A 4H5SB 4UTBL 1CFTB 5GGSB 2L7JA 3MRJA 5FUCE 2BNQE 1RUQH 3ZYJA 5JW4R 4Z76B 1UG9A 4TQEH 4WV1A 3CFKB 3SE4C 3EZ8A 3MRFB 2Y6SC 3DXAD 2UYLB 2EDXA 5C08E 1CDJA 1TPXC 3RX8A 3QZWA 5A2IH 5IMLB 3B2VL 1AHWB 4J3XA 2AI0H 1BM3H 3L95B 4M61B 1SYVB 1MFNA 3HI1A 5CZVH 5E2TH 1X5IA 2ESVE 3PJSA 4N8VA 5ANMB 4AT6B 3VI3F 3IVKA 4MNGA 3V8CA 5F9WC 1MCRA 5C0FB 4JREB 2ZCKL 4X80H 1YEIH 2DLFL 1MCWM 1U3HD 3WNPA 4OD1H 5EZJA 2ADFH 3MV7B 4L3ED 5ICYB 1JF1A 4WV1C 4S1QL 4ZOBA 3WXVL 4CL7A 2I9TB 4NSKB 3ZKSD 5CP3H 1HQ4A 1MCLA 2YWYA 1F6AB 2FLRT 1OGAE 1FGVL 4PJBE 3OHXA 2DQTL 1T7XA 1YN7B 3CFJA 4RQQB 1V7NL 2AK4A 1A6VH 5IB1B 3STZA 4R97B 3OKMA 1UZ6E 4ZOEA 4FS0A 1YEDA 2HVJB 3O2DH 4OZGE 1LO2H 1JHTA 3A6CH 3HR5B 3L3GA 1DLHB 1G6RH 2RHEA 4ZUUA 1RK0B 2AV1B 4KK8C 3QUYA 4QHKJ 4Z8FH 1QLEH 2Y07L 1BZ7B 4FZEL 1EEUA 4OCXH 5DEGB 4Z7QE 4Y16B 3TIEB 4MSWA 3DUUB 4XPHL 4X5WB 3L3KA 1NMBL 4E41B 4HWUA 4OQTL 5AYQA 2BC4B 5MI0B 4PJ8D 4N5EC 1DVFB 3FRUA 4XRCA 3UX9B 2HYMA 4Z7OE 1BZQK 4Z7WE 5FFLA 3PP3K 1QUNA 5IVXF 1YMMD 5FYKD 4N1CA 1IM3A 3DX9A 1CD8A 2HKHL 1DUYA 2FEEL 3RVVC 3OX8B 3DX6B 3IT8D 3VXPB 1FNAA 3WNOA 4PB0H 1OAUL 5CD3A 1DCLA 2OBGA 1EEZB 2EXYC 3RDTD 4MD4A 4KROB 4CN1A 4XP4L 1UJTA 1UXWB 2XN9B 2AK1H 3KLSA 2H1PL 1HHGB 3QFJE 4Q7DA 1D9KA 3U4EA 2HFGH 3NZ8A 1VACA 1S7UB 4XP5H 2DQEH 3GMOA 4XPBH 3QEHA 1L7IL 5EOCH 1KOAA 2VTFA 5ICZA 1I7UA 5D7IA 3WFBH 3JV6B 1H5BB 1HCVA 1XH3A 2HT3D 4JY5L 4P23D 3C8KB 2ZUYA 1NBZA 3HAEB 3D2UA 3EDFA 3BEVB 4W4OA 5CUSL 3RHWK 3SCMD 1EUTA 3E2HC 5F7UA 3HZMB 1MLBA 5TE7H 4YX2H 1INDH 1D9KC 4XCYB 1DQTA 2H8PB 3N1FC 2I5YL 3WN5A 1AQDB 1G6RA 4XVTH 5I71C 2Q8BL 5ETUA 1JGVL 2PCPB 1H3VA 1BHGA 1KLGA 1UJ3C 2WUBH 3NIGF 3VG0H 4Z5RA 1A9EB 3TBSA 2P7TA 4N0YH 5A16A 4LHJB 4NQTA 3UC0H 2FYYB 1BFVL 1BBDH 1F02I 1ZVSA 4QTIH 2ENSA 1AXSA 4ZD3L 5C6TH 1YNTA 3UDWC 5KBNC 3MA9L 4LLAA 4H1LA 1A3RH 1A5FH 5FHBL 5FIEA 1CBVH 3MRBB 4XXDB 4HUVB 3CLEH 5JOFA 4R90L 2I25N 2NXYD 4M9OA 4U1GC 4ZUSA 1GVIA 5ID1B 4HIEB 2AJZA 4UT9H 4CU8A 1OP3H 3F6IA 3VMPA 1BD2D 1JI2A 4OGXL 3HKFA 3EOAA 3FTGA 1I9RH 3EYQD 5D7LE 3QO0A 4ONGL 5LGJA 2E9WA 2HT2C 4AH2A 3QG6A 4FQIL 5KS9B 1NCTA 4Y88A 2GYSA 4HH8A 4ORZC 2VZTA 1WBYA 4OAWB 1PQZA 3SDXB 4DAGL 1NCDH 3BKYH 2VOTA 1QSVA 3BKCL 1QVOA 3DXAA 3QUKB 1KGCD 3QEUA 2CDEB 4PRHB 5C0ND 4ZFOA 2EDTA 3MUJA 4ONHB 3MUY1 1YEJL 2YPLA 2QV2A 1ETZA 4WFEE 4ZOAA 4JPIA 2CJUL 3IF1A 3BI9X 4YQXL 4ODSL 3CC5A 4MHHI 3NCJH 2AW2A 2BNUA 2EYSB 4URTB 3BXNA 4UOW0 1U3HA 3C6LD 2AJUH 1UYWL 4KVNL 1S9VA 3L6FA 2QL1A 1E28A 3AXLB 5J8OA 5IGXL 5DJCB 4G6FB 3RIFF 4CN6A 1VKXB 4PP1C 5BMFH 1S5HA 4Z0XA 5CWSA 3RWEA 1FNEA 1KG0B 4PJHE 3IAGC 4PJAF 5HGDB 3IU4L 1T22A 4KKAD 3L1OH 4LKXA 25C8L 3TM6A 3T0DA 4N8PA 4GG6F 5C2UB 5CJOH 5HDOA 3S35H 1MRFH 3ZKMC 1UA6L 3I50L 1KJ2B 1OM3L 3A0OA 5MEOB 3LD8B 1CS6A 1IGTB 1G7HA 4GXVH 4LASH 4W4NA 4R8WH 3HC0B 1NFKA 1U3HC 3SGDH 2F19L 3KS0H 2BNRE 3CVHA 1NGQL 1UM4H 4NKMA 4XMPH 5F6HJ 1BZ9A 2DJSA 4PJ8A 4BKLA 2A74A 1FFOB 4FXKA 4QRRE 1QOKA 2H2SD 2R1WB 2IFFH 4U7KA 2XQBH 1YMMA 1K5NA 1Z3GL 3LEXA 5TPWL 2D03H 5GSRA 2VC2L 1J12A 1VENA 1MJ8L 2XYCA 1JK8A 4Z7UB 1CXHA 4JB9H 2COQA 2MTPA 1T0NB 1RJCA 1U2HA 4EUPH 3NPSC 1IC4L 2L0DA 4PJ8C 3LAFA 5I16B 3T65B 4TULH 4QEGA 2NY2D 2BSED 2XTJB 3U9PH 2BNQD 1IKFH 4PJGE 1LO3H 1FN4B 1JF6A 4X98A 1I1FB 4OZIA 1Q1JH 4U6HB 4XBEH 4FQXB 1N5YH 5C08D 3U0TA 2Y23A 3WFZA 4LSUH 2BVOB 3L5XL 1O5DT 2IPUK 1FFPB 1KJMB 2ESVD 3FT4B 4UT6L 5M7QA 4H0GA 3SCMA 2BSTA 3FHAA 5CKGA 2LE9A 3MBXL 5EH1A 3GHEH 3UTSB 1X44A 4MWFB 4PRPB 4CU6A 3V6BR 1FNHA 3LKPA 3PV6A 4OCLC 1I1YA 4L3AA 2YMXH 4NFCA 2GCYA 3VFTB 4MA8H 5JHDB 2EEBA 2XTLA 3CX5K 1HKLL 3BGFB 2FBOJ 1K4DB 4X6CE 4EIZC 1OGAD 1HH9B 3RVXC 1Z2KA 5HVHC 4K8RC 4QRQB 4X4XB 5FKPB 1ORSA 5AZEH 4OZHA 4U1HA 2V9TA 3E1F1 5ALBL 3WIHL 4AEIH 5CSZB 4NQDE 4F33B 1T3FB 4HC1H 3DX8B 3SDCD 5FCUL 4M7JH 5GGUB 5C0JB 4HJGA 2VLKA 3M17B 2BOCA 4HWEL 1BAFL 2EICA 3TNMB 32C2A 2DKSA 1KUMA 1JBJA 4L4TB 4WO4D 3FB5B 3DECA 3GKWH 3IJSA 5HBBA 2V9QA 2DQGL 1DQQA 4WY7H 4I18C 2QADB 1RSFA 1BD2A 1S5IH 3MRGB 3VI4F 1AE6L 3GGWA 3EYSH 1EO5A 4KJYB 3V4VH 4JR9L 1PKQE 2QBWA 4HZLA 4LIQE 5I8KL 3MLWL 2E27L 3HE6D 2YZ1A 5EIIA 43C9A 4OCSH 1QFHA 3VG9C 5F1OB 1LVEA 4WW1A 5E8EA 1T5WA 3MREA 1XF4B 4HIHB 5F93C 5IESH 4P57B 3FB7B 4ETQA 3QFJD 5GJTL 4BQ6A 3MPCA 1K2DB 3OAZH 1B9ZA 3IDIA 2X1QA 4FZ8H 1DBMH 1P2CA 1MFBL 5TQ0L 1OSZA 4Y5VA 3WBDA 3TVMC 4NZTH 4BUGA 2PETA 2HKFH 3SDAB 3I3DA 3C6LA 1EVTC 3RWIA 5I6XC 4XBPA 3P2TA 1KYOJ 1KTDA 1JGEA 3VWKC 3EOTL 2XWBA 1ODAA 3HI5H 2NCMA 4RMTA 2AEPH 1A22B 3OG6B 3IKCA 5JLZB 4NRYA 3ULUD 4KJWD 5C0EB 5EU5B 2AV7B 3TESA 1AXTL 4EN3B 1VGEL 3STBA 4KAQH 8FABA 2ZG3A 2VLRE 3RNKA 3SN6N 2H3NA 5EU4B 2Z8VC 5DF0A 5EU3A 4KI5F 4FFYH 4XVSH 4LL9A 2Y25A 1CFVL 5FUZH 1OWRM 4HC1A 3IJHB 4PLOB 4Y5VC 3SDYH 4OB5H 1QSFB 4YJZL 4Y2DD 3C6LC 3HMWH 3V6FB 4C58B 4LCCA 5DJ6A 4HS3A 3WE6B 1XF3B 3BZFB 4MZ3A 1G9ML 2HG5B 3MJ9A 1WK0A 2HTKD 1NBQA 5IUSA 3W39B 3NGBB 4OTXL 1DQDL 4KRNA 1QRKA 1CYGA 1NDMB 3GSRA 4MMXC 2R2BB 2FECL 5BQ7B 4ORGB 3QCUL 1RZIA 4AZ8A 2OR8A 1S7XA 3MLSH 5TQ2H 1S7TB 5D1ZD 2EKSA 5DVMA 2MPAL 3FQRA 4K71C 4WI4A 1IE5A 4DK6A 1AGDA 3MRJB 4NKIL 2BCKA 4ZAKD 3HUJF 1IL1A 4LCCC 4WV1B 4WUUE 3U0PA 3Q3GA 2A0LD 2D7MA 2H2SC 5D7LD 3QZWB 2BNQA 4GRLA 4UILH 2E6JA 5IWLC 1A6WH 4UBDC 5T3ZL 3HI1B 1YQVL 4UTAL 3PJSB 4OGYH 5TDOA 4N8VB 4K8RL 3BISA 5C08A 1PG7W 4MNGB 3T2OA 3IVKB 4XWGL 5HVWA 1F13A 1LO0H 1DDHB 1NCBL 3IDYC 5CEXA 5J89A 3UBXI 2B5IB 2ESVA 2NPLX 5EZJB 1ZHNA 3BPLC 1JF1B 2ZJSH 4WFED 35C8H 3EIFA 3QFDA 3VU2A 3MX0A 4G43A 1N3NA 1HQ4B 1GAFH 3GSVB 3I02A 2NY4C 3CDCA 3V0WL 2E7LA 5FUCC 2CK0L 3OHXB 3QUMH 1QLRA 4GRLC 4O9HL 4OI8A 3CFJB 4U1KA 4LVOB 1ZA6A 2AK4B 3V9FA 3STZB 4N0CC 3OKMB 3QR2A 4G8EA 4PGJA 1YEDB 4YDKH 5E9DA 4ZTPH 5D71L 2G5BA 1JHTB 3L3GB 4O5LL 4ZUUB 3X12A 1OGAA 4UMGA 3QUYB 4YBQC 4PJBA 4BFIA 5JMOC 3WD5H 1MJ7H 3GJFK 1FH5H 3RPKA 1A7NL 1ACYL 3L3KB 1MCDA 5DT1L 4OZGA 4JFEE 4G5ZH 5HGAA 1FL6A 3W9EA 3H3PH 3FRUB 4XRCB 3MCLL 5J6HA 4UQ3A 2VMFA 3SDCA 5F96L 3SY0A 1S3KL 3QQ9C 4OV5A 2E7LC 2BNRD 1IM3B 4RWYH 1KB9J 4NQEB 5L88H 3DX9B 2AJXL 1URLA 4QRRD 4I48A 5DTFB 3HC3L 2VXVH 2CPCA 4Z7WA 3CX5J 3PHQA 4QF1A 4BSWA 2F53E 2VDPH 5CD3B 4O2CA 1Q0YL 4MD4B 2IPTL 4R7DA 3HE6A 2PR4H 2LAAA 4FNLL 4RGOL 3BX7C 4HEME 5C71A 1D9KB 2N56A 3U4EB 4Q9QL 1J9CT 3NZ8B 1VACB 4XCEA 3WIFA 4R7NA 5I71B 4OZFH 3GMOB 3QEHB 4ENEC 1I7UB 1WJ3A 4ZFGH 5ICZB 5D7IB 3QFJA 1AIFA 4XPTH 3R0NA 4I3SH 1V8HA 1XH3B 5E8PA 4UB0H 2Z31D 1RUML 1NBZB 3D2UB 3BKMH 2XA8L 3OKEA 4NCC2 1T4KA 2E7CA 5KAQG 2WNGA 1MLBB 5D7JA 3HE6C 4TSAH 4IRSD 4LLQA 1OAXH 2HFTA 5I9QC 4U1GB 3WN5B 2M26A 3BFOA 4OSUL 3RJQB 1SEBA 3IFLL 4S1SL 3RHWF 1G6RB 1A47A 5JIPA 1CGVA 5ETUB 5DYOA 1RY7B 4W6XB 1W8NA 3NACH 4Z5RB 3TBSB 2P7TB 4LFHD 5A16B 1T03H 2V17H 4BYHA 5IQ7H 5J12B 1G7LA 4ERSH 1AXSB 3BWAA 3EDEA 4Y2DA 1HHHA 1YNTB 4LARH 3T08A 2ZPKL 1F3RB 4P4RA 4H1LB 4U6XA 1A14L 2Y7QA 4EKXA 5D7JC 1MCFA 2ADJA 1RUPH 1MIEH 3C60D 4Z7NF 2XRAH 3ULUC 4ZUSB 4KJWC 1RIHH 1DANT 5CGMA 1VFBA 4NQDD 4FQJH 1JIBA 4KVCL 2AJZB 4LOUD 4E9LA 3QHTC 2VLME 3BH8A 3UMTA 4EUPG 5KVEL 3JWOH 3R1GL 4PGZA 5D1ZA 1J18A 1TIUA 1T1WB 1UC6A 3CVIL 3EOAB 3FTGB 3ZTJH 1BLNA 3OKLA 1VDGA 4AH2B 3QG6B 5H35A 1YZZA 3G5YA 4Y2DC 4MXVF 1WBYB 4EJ1C 2XFXA 3T2NL 3I85A 1QVOB 3DXAB 4LRNL 4UINH 3QEUB 2GSGA 1PJ9A 2VZOA 5D7LA 5L2KE 4ZFOB 4DJMA 2NX5E 4NOFA 5DFWH 4OUUA 4BQBA 1OLLA 1F4WL 2YPLB 4HUUA 3GJEA 1QYGH 4OCNC 5F7WC 3B9AA 4K55A 4QHKI 1JHKL 3CU1A 1ETZB 1FVEA 3TPKA 4JPIB 3IF1B 2LABA 3ZKND 5DXWA 3FFCE 3CC5B 5KSBE 3UJTH 2BNUB 4KC3B 1TZGH 3BXNB 1U3HB 1BIIA 5DMKA 1S9VB 1IEAA 3L6FB 1E28B 3H9SE 3WXWL 1Z6JT 4NYLB 5BJTA 1PYWA 1A6UL 5B3NA 1I7RB 3MLXL 4N0RA 1S5HB 4Z0XB 5CWSB 3RWEB 1FNEB 1RZKC 4WWKC 1AFVL 3JTTA 3IFPA 4PRAA 1T22B 2GJ6A 4LKXB 2EDJA 4LCUA 4S1DD 1A6AA 4Z7UF 4E42A 1FNGA 1RFDL 2X4RA 5EULV 4GQ9H 3RUGE 1TVBA 1WBXA 1JWUA 1VERA 2R4RH 4Y89A 1T66C 2ZCHL 4PJHA 1ZLSH 1VB9A 3EJYD 4S1RL 3T77A 4LCIL 1G7HB 3O6LH 5JXAH 4QXGH 2Z8WC 4DVRH 2VLRD 1CGWA 3DV4A 1JZ2A 5MP6H 3CVHB 2NXZC 4NKMB 1O7VA 1BZ9B 4JM4L 1DBAH 4PJ8B 3SE9L 4BKLB 4FXKB 1W0VA 4YXHL 4BK4A 3IDXL 4JO1H 1TVDA 3O45A 1FO0H 4UAOC 4ODBD 3LRHA 1YMMB 2VJXA 4ZO9A 5IHZB 1EERB 2YN3A 4JFHE 2BNRA 1YQ2A 4PJIE 7CGTA 1K5NB 3LEXB 5DK0A 4QRRA 3U9UA 1EJOH 2ZKHH 3OKOA 4KHXH 5GSRB 1UWGL 2P8MB 2F5AL 1JK8B 3QYCA 1JVKA 1T04A 3RDTB 1MFAL 2WM0A 3KLDA 4OCYL 5IIEA 1A7QH 4BZ2L 3MQIA 1OF2B 3ULSA 3U46A 3E3QE 5LAXA 1X4ZA 2WBKA 1OAZH 4HFUH 2A6JA 4RGNC 4U31A 1WEJH 3MLZH 3VRLE 1BP3B 4WUUD 2E7BA 5C70A 4WHTA 3EJJX 4X98B 4YDIH 4OZIB 2VLJE 1RZFL 4YHZH 3U0TB 4PJGA 3CJJA 2Z31A 2A9NH 3CSGA 2NW2A 4KKLD 2YSSB 5J1TC 2KUTA 3SCMB 2BSTB 4H0HB 2MFNA 1HWGB 1W72L 4FQ1L 4IRSA 5B21A 4FABH 1X3DA 3IXTB 1QFWI 2YD1A 3KJ6H 3PV6B 3LKPB 1I1YB 4I77L 1LQSR 3NCYS 4OD3L 4X4ZA 1H3PH 2GCYB 1IAII 2F8VA 2VZVA 3WSQL 5ACZA 3ZE1F 3B2UC 2EDOA 3KPOA 2MQ0A 1N2RA 3OQ3B 3P9LA 1ORSB 1MY7A 4RZCA 1FO0A 2HWZH 4PTTA 1BJ1H 4RBPH 5HYSA 4BFEA 1KPRA 4X6CA 5E6ZA 3UZVB 5DQJA 3VG9B 5KSVA 3VA2C 3C60A 5T5NG 3LS4H 2VLKB 2MKLC 2BOCB 2NXYB 1ITCA 32C2B 3GMNA 4NQDA 4OM1L 3DI2B 5JQHC 4JFED 2VZUA 2W1NA 4P2OD 4MA3A 1V3LA 3BDYH 5F6IB 3IJSB 3V52L 1DQQB 1YMHA 1GJIA 1BD2B 4FOMA 1IAKA 3GI9H 3GGWB 4OUOA 4MCYA 1ZAGA 3MJ8A 1HI6A 3MO1A 5DLMH 4P9MH 4MJ5A 1NCNA 1MH5A 5E8DH 5EIIB 3WLWD 4GSDH 4XNXL 2F53D 3MV8E 5I1KL 1RVFL 5E8EB 3O4OC 2EXWD 1T5WB 3VFNA 3MREB 1PKQA 4L5FL 2H2PD 1UKSA 4HXBL 1ZXQA 3DSNA 4LKCA 3LY6A 4ETQB 3V7MA 4NQXA 2VISB 3H9HA 3IDIB 4DKDC 1ES0A 1P2CB 1OSZB 4Y5VB 1JRHL 1H15A 1XMWA 3FJTA 5F6HI 4LBEA 3C6LB 3RWIB 1G0XA 4M5ZH 5IMKA 4XBPB 1N5AA 1KTDB 1MCHA 1JGEB 1MAML 4K2UH 3NH7H 4X9BA 3RVWC 2VDMH 2XWBB 3BKJL 3LVEA 3IKCB 5ITFA 4NRYB 3LPGA 4ZG1A 8FABB 3ULVH 1D5XA 3AM8A 4FP8L 1E4XH 3RNKB 3TA3C 4D9LH 1J87A 3UJIH 5EU3B 5SWZE 4UV4L 3STLA 5ADOL 5EDXA 4CDHA 1BQLL 3DBXA 1F8TH 2UZIL 5C0BE 2R29L 2VLRA 3MRKA 4YE4H 5INCA 1ZLVH 5BCAA 4LCCB 5DJ6B 4HS3B 2VXQH 1KCKA 2OJEA 1SQ2N 3HRPA 1ERNA 2NLJB 1JZ6A 5I1JH 4POZD 1OSPL 4DKEH 1KELH 3GSRB 4M02A 1OT1A 4LU5H 4V2BA 4S1DC 4HIJA 1VESA 3GHBL 1FFNA 5LBSH 4DN3L 4HCRL 1RZIB 4P3CH 4J3TA 4KWUA 1NGWA 4YXLH 1S7XB 1A7OH 1Q0XL 5F1IA 2NTSP 2CO6B 1EA9C 3EJYC 3SO3B 2EKSB 3FQRB 1KXVC 1ADQL 1AGDB 2WP3O 2RB8A 4AIOA 3IDYB 2VLMD 3OR6A 2IGFL 2BCKB 1IL1B 3BPLB 4OZFG 4NQSA 3NABL 3U0PB 1GOFA 3Q3GB 1Z5LA 5JORA 2J88L 5E1HB 4TTGA 2NY2B 2BNQB 3LQAC 4XB8A 3PGDB 4WCYH 1U95A 4WUUA 4ZTOL 3I3BA 5TDOB 4KY1L 1G7QA 2A6KA 5C08B 5L2KD 1KCSH 1N0XL 4JY4A 2NX5D 3U7YH 2V2TA 1MJJA 3RZCD 2QHRH 5CEXB 5FYLE 4WEBL 3ZE2E 2ESVB 1ZHNB 3P9MA 1W2KT 3U4AA 4MNHA 1JZ7A 2AJSH 3QFDB 2YK1H 1TJGL 3FFCD 4G43B 1N3NB 2YZ8A 2YA2A 3I02B 3JV5A 1AD0A 4HPYH 5HHVL 2VDQH 4PG9A 1QLRB 1QFPA 1OVZA 3ARRA 3H9SD 4FG6C 2E8ZA 4U1KB 1ZA6B 3AS0A 4G8EB 2QEJA 5E9DB 3NN8A 2G5BB 4GUPA 3ZT7A 3TWCH 2DI8A 3X12B 1AD9A 2PO6D 1OGAB 5K9QI 3UZQA 2X5PA 4PJBB 4BFIB 5E03A 3QDJE 2CKBH 4K7PX 5EZOL 4BSJA 4JKLA 4OZGB 5HGAB 3MBED 1QFWM 1FL6B 1IC1A 2IH3B 3W9EB 1UZ8A 5J6HB 2DBJA 4UQ3B 3SDCB 1E4WL 3ZHDA 5D7IF 3SY0B 4W70A 3VFVA 1PSKH 4OV5B 2Z4QA 1IAIM 1QACA 1C12B 4MQ7A 4C55A 5TF1H 2Q3ZA 4JFEA 3ZTJG 1E6OH 1ZHKA 4P2OA 4WO4B 4I48B 3SJVE 3C2AL 3NOIA 1WC7A 2X10A 4Z7WB 3VI3E 3PHQB 3IS0X 2V2XA 3HFML 3TYGH 1XGYL 4JFHD 4GKOA 1QRNE 4BSWB 4O2EA 3QUZC 4HAFA 1J8KA 4G6ML 1H0DA 3OL2A 1CT8A 1VEOA 2B20A 1M7XA 4JFZH 2VXTL 2CH8A 4R7DB 2OP4L 3HE6B 1OCWL 4DGIL 1DLFH 4UT7L 3QCTL 4KQ4L 2J3SA 2F53A 5I9QB 2QQNL 4ELMA 3LIZL 3G04A 3WIFB 3KPTA 4R7NB 1SY6L 2DTSA 1HINL 5J6GA 4RAVA 4NO0D 5C8JA 6CGTA 3R4DA 4YPJA 3QFJB 1AIFB 5IHBA 4U7SA 2GITA 4AQ1B 5E8PB 4QCIA 4EDWL 4PJXE 3FOMA 4LRIC 3NZHL 1A3LH 3OKEB 5GRUH 1EO8L 1T4KB 3L5IA 3O11A 5IV2A 2WK2A 1VPOL 2VLJD 2XNAA 1FORH 3MUZ1 3QUMB 1ACZA 5AG8A 1KB5L 3BQUA 1C1EL 3Q2CA 2V5YA 5IVXE 1OAKH 1P4BL 5A2KH 3IFNH 1SEBB 5IFAL 4HBCL 3VGFA 5EORL 1EH9A 5DYOB 3WHXB 5FDYA 5BV7C 2WUCL 3G6DL 1PGRB 3JVGC 4CMHC 4KK5C 3GIVA 2GKIA 2WMPA 3DV6A 2BP3A 1G7LB 2APXA 3GZKA 2GI7A 4Y2DB 3OTTA 5HYSG 3AY4C 4P4RB 5J0BA 2Y7QB 4ZSOE 3BQUC 2ADJB 2UUDH 1JGLH 4NJAH 2A77H 4Q97A 1VFBB 4HIIA 4KV5E 5T1KD 2M1KA 2PNDA 3BH8B 4KPHH 4F9LA 2UY7A 2IQ9L 4M1DH 5D1ZB 2YS4A 1F97A 4A6YH 3D0LA 3O6KL 1BLNB 3OKLB 3QXTA 5I76A 3UZEA 4KI1A 4ZAKB 5H35B 3G5YB 3ZO0A 2R56L 1Y0LA 2XFXB 1MCKA 1NLDL 2GSGB 3DETD 5D7LB 2CDFA 4ZXBD 3VD5A 4OUUB 4NO5A 4R2GC 4AL8L 4WU7A 5CEYA 2W9LA 4HUUB 3GJEB 2EZ0D 1DE4A 4KU1A 3MV8D 1B0WA 1FVEB 4XH2A 1KIPB 5L2KA 4LSRH 4KK6C 2NX5A 1A4JA 5F9DC 2GK0A 1KENL 3RZCA 1TJIH 1BIIB 5DMKB 4YUEH 5B3JE 2AEWA 4MAYC 5BJTB 1PYWB 1BJ8A 3B5GA 3H42H 4AEHL 5DMYA 3FFCA 5KSBA 4QRUA 4DOHE 1UCTA 3JTTB 3H6JA 3IFPB 4PRAB 2GJ6B 1BECA 3QQ4A 4IOSD 3X3FH 2GFBA 2G60L 4LCUB 1I7TA 4BZYA 3HE7A 3H9SA 4E42B 1OP5K 2X4RB 4JN2A 3EDKA 5DFTA 4HKJA 1TVBB 1WBXB 1A7RL 1JWUB 5I0ZA 5ADPL 4PJHB 3T77B 3RX7A 3X13A 5J3HD 4I0PA 5LQBH 4QWWD 1YY9C 1NCCL 1HDMB 3RZCC 3DV4B 1G6VK 5SWZD 2EDHA 3RUGA 1J88A 1JMXA 1CE6A 3BE1H 3MBEA 4JO3L 3L5WA 4RFOL 1W0VB 5HVGB 5JDJA 5I8OH 1PDKA 3O45B 4KJPD 3ZMRA 5C0BD 2J8UF 5F8QC 3SKJH 2BNRB 5M95B 3HE7C 5TE4H 1PZUB 2D0FA 1JFQH 4P3WA 5DK0B 4TQEL 4QRRB 3U9UB 2WAHA 3OKOB 5BOPA 5GPRA 3NCBB 4XTRD 4OLYH 2ZUTA 5DO2D 3WIIL 4QRSA 4I0PC 4GW5A 4PJIA 4TVPE 4RA0C 1T04B 4M6OH 1WLHA 4OF3A 4TUJA 4S10A 4QHLA 5CZVL 5E2TL 4I1NB 4JJ5A 2FO1A 1TETH 3ZTNH 3QXDA 4M43H 3ULSB 3U46B 5LAXB 4PJAE 4JFYA 3TT1H 4K3DL 4X80L 5BV7L 5TE6H 5JHLH 1FL3A 4GG6E 1G9NC 1RZJH 2ZWLT 2ADFL 2IANE 3SGKA 1UWEL 3DLQR 4OZHF 1IEBA 2OTUA 4BZ1L 1OAQH 2FH6A 3ECBA 1HZHH 1EDQA 1DEEA 4PJGB 4XXCA 4CNIA 3LQZA 1DEDA 5D7KE 2Z31B 3QCVH 5E6IC 5KVFH 2BY3A 1A6VL 2ED7A 1OD9A 4KRPD 2VLJA 1EVUA 1MWAH 2FBJL 3P40A 4LP5A 1OPGH 1P4LA 3O2DL 1PFCA 1LO2L 4IRSB 4XVUD 1G6RL 4HV8A 1QLEL 5FYLD 4OCXL 3SGKC 5ACZB 3S3JA 2C4XA 2KKQA 3DIFA 1AGBA 3KPOB 1IC5H 1N2RB 4HT1H 4NHCH 3TGXA 4DKFH 3P9LB 3S3SA 4RZCB 2OJZH 1FO0B 1OP9A 4PTTB 1XF2A 5HYSB 3MLPA 1KPRB 4X6CB 1M71A 2E5EA 5DQJB 5KSVB 3C60B 1J1PH 2A1WH 3QDJD 3O4OB 1V3JA 4RRPG 3MYJA 5E2UH 3VGAC 4JRXE 3GMNB 2R0KH 2Q76A 4NQDB 5GGTA 5HI4D 5DJAB 3QIWC 4HQQH 4P2QE 5T1KA 1OQXA 3OR7A 2AK1L 1S9KC 3CU7A 1QLFA 1G0YR 5H37H 3HZYA 1YMHB 2PXYD 3OKDA 1WZMA 3ZDYF 1IAKB 4J12A 2I07A 1HCFX 2MMXA 1KIRB 3ARYA 2DQEL 4XPBL 3SJVD 5EOCL 1MLCA 4MCYB 4CW1A 3QDAA 3WFBL 3MJ8B 1FGNL 1HI6B 3MO1B 4MJ5B 1MH5B 1QRND 4M6AA 4XPFH 4PRDA 3JBG7 1YN6A 3VFNB 3ZLQC 1PKQB 4ZXBA 5LWYH 3WO4B 1VFAA 1CTNA 1QBAA 3BYTA 4LKCB 2VYRE 4PR5A 4NQXB 3H9HB 2CD0A 3MV8A 3OKYA 5TE7L 1ES0B 4HPOH 1INDL 4YX2L 5FA4A 3G08A 4ZS6D 2EE3A 3QNZA 4X9GA 1DBJH 1H15B 4XVTL 5HHNB 5IMKB 3OPZH 1N5AB 1WBZA 2WUBL 1NUFA 3VG0L 3OB0K 5DJ8A 4N0YL 1FYTE 5ITFB 5C9KA 5HI5D 3UC0L 1BBDL 4HG4K 4QTIL 4PRNA 3X14A 4UDTA 5F97E 5C6TL 1D5XB 4O58H 1JV5A 4RFNC 1A3RL 4YHPA 1A5FL 3EYVA 3MNVA 2VUOA 5FYLH 3CLEL 4JFFA 3S36X 4DN4H 1QSEE 3VI4E 2BX5A 3DBXB 2JELH 3MRKB 2VLRB 4XCNA 1CI5A 2UZXB 5DRZA 5INCB 5SWZA 1MCNA 5GISL 3MUGA 4UT9L 2OJEB 3VFSA 4YEFA 4LAQH 4APQC 1F42A 2Q7NA 3CFEA 5HHOE 5CJQL 4Y4KD 1I9RL 4DVBA 2R69H 2DICA 5T3XH 4HIJB 5CZXC 4HJ0D 1ZLUK 4G8GA 3VXUE 3GMQA 2P1YA 4O2FA 1NGWB 1NCDL 3BKYL 3V5DA 5F1IB 3GMPA 2ICEB 2L7UA 3TBYA 1LE5B 2DWDA 5J3HC 3OR6B 3OMZA 4F80A 4QWWC 1NUGA 3P30H 3C08H 3BPCA 5HJ3A 1PLGH 4K7PY 4NQSB 5FK9A 3F7RA 4IIQA 2DQUL 4G6AD 4JFXB 2VNCA 1RUAH 1Z5LB 5JORB 4U1JA 2D3VA 3NCJL 2XICA 4LVHC 2AJUL 1NEZA 3TNNA 4PJBF 1U95B 2V5MA 4WUUB 1HSBA 4KI5E 1HIMH 1UZ6F 5CD5D 5BMFL 1G7QB 4JPVL 4JY4B 2V2TB 1MJJB 1CDHA 3DHMA 2DJ4A 3L1OL 3WFHA 3SGEI 4PREA 5EUKA 5I17A 1DBKH 3S35L 2F5BL 3P9MB 4MNHB 3RP1A 2GW5A 3BUYA 1AD0B 4GXVL 3P4MA 4Z7VF 4QT5A 4R8WL 3IGAA 4NP4H 3VD3A 2VABA 4J6RH 1XZ0A 5HI3C 5I19H 1SMAA 2VITA 2OZ4A 1UM4L 5EB9A 3EYUH 4XMPL 1D5ZA 3THMH 2JCCE 1SJXA 5DC0A 3V7AE 3ILQC 3NN8B 5FAAA 1UT9A 1LDPH 2FR4A 1DQLH 4GUPB 2IFFL 4XC1H 5EZLA 4QNPE 4H88H 5A1AA 3RA7H 3HUJE 1I8KA 4PBVC 2EYTA 2DLTA 5DJ0A 3AAZA 2D03L 3ARED 4NZUH 4KRPC 4LLYB 1UZ8B 3F7QA 4F8QA 4XVUC 3VFVB 2Z4QB 3U6RB 4JB9L 3PWNA 5DS8A 4MQ7B 1DL7H 4JFEB 4P2OB 1ZHKB 3AC0A 2H32H 2P24A 1WC7B 5KANI 4HUXA 5I8EA 1YC8A 4TULL 2PXYA 2V2XB 1FC2D 4BH7A 4N1HB 1DQMH 4N0UE 4O2EB 3U9PL 2VZ3A 1LO3L 1H0DB 1LO5A 3ULUF 3SJVA 4LPUA 3CAFA 1CT8B 4OBRA 1LEIA 4ALAH 1Q1JL 3GRWH 1V5JA 4XX1G 1N5YL 5JQ6H 3LRSA 5FCSH 3DTXB 3NVQA 2F53B 4KDTA 3FAXA 4XPAH 5JXEC 4TVPD 4LSUL 3G04B 3FRPA 3KPQB 5J13C 4K3JH 3CFDA 5HI4C 5J6GB 4RAVB 5C8JB 5E5MA 2KBGA 1JYVA 5GZOD 3SDDD 2LU4A 4CMHB 3GHEL 2GITB 4QCIB 1UH4A 2IF7A 5HTSA 3FOMB 2YMXL 2VB5A 2IAND 3UTQA 5FDWA 3O11B 5IV2B 1MHEA 3OGCA 2XNAB 2MWCA 4RMQA 2X9WA 3DURA 3AB0C 3IDUA 5D7KD 4LMQI 4F7TA 4PJXA 3FT2A 1TTUA 3BSZH 3AUVA 3K2MC 1RQ5A 2NY6C 3LKOA 2EDLA 5AZEL 1NEUA 4AEIL 3JV0A 3HB3D 3I84A 3IDNA 1JNLH 3VFRA 4NHUA 4CMMA 5IVXA 4M7JL 3BZ4A 4YIQA 4YBLC 1J0IA 2ZSVA 5ABDE 3DV6B 3LEVL 5I1GH 1OHQA 2OM5A 5H8DA 1MFEH 1CLZH 3ARDA 4XGZA 2H26A 3QQNA 4PRBA 4WY7L 5DZLA 4CDGC 2H32A 1S5IL 5T33L 4X4ME 4MLIA 4HIIB 3OWEA 3EYSL 3V4VL 4H8WH 4P9HH 4HKXB 5FYJE 1UM6H 2QTEA 2YHGA 3U1SH 4HG4J 2WBJD 2Y5EA 3LMJH 1YEGH 2E8YA 1E6JH 4ZSOA 4GW4A 3EHBC 4Z0BH 4OCSL 4U05A 4UZGA 5C9JA 4Y5XC 1ZT4A 4JRXD 4WEMB 3D0LB 1LO4H 3SKUD 4P2QD 5I76B 2DRUA 5IESL 1I9EA 2J6EL 3RWJA 3SEPA 4OZ4A 3ARDC 3O9WD 1Y0LB 3IRZA 4WUKH 4FZ8L 2A6DA 3JWDH 2CDFB 2ICWI 4NZTL 4DGVL 4NO5B 4PGCA 2HKFL 1C5BL 4RA3A 3VH8A 2DTMH 4OF6A 5FO7A 5CEYB 4HJ0C 1ZSDB 1JYXA 3L5JA 1IEHA 1DE4B 1TJHH 1CL7H 1YJDH 1FSKC 1X6LA 4XH2B 1WVZA 3HI5L 4WI6A 4D9RE 5L2KB 2NX5B 2AEPL 1A4JB 4JAMA 5IB4A 2GK0B 3TO4D 5FV1L 3EUUA 3RZCB 3UBXA 2EDDA 4KAQL 5T1MA 3MRIA 2ZUSA 1NMCC 3B43A 4Z6AT 3FFCB 5KSBB 5CCKH 4QRUB 4XVSL 4Z7NE 4G6AC 3WKNA 1CVRA 3PL6C 5FUZL 2AJVH 3QQ4B 3SDYL 4OB5L 2GFBB 3QDME 1I7TB 5I30H 3H9SB 1CGXA 3HMWL 4NC2B 3SGJC 5IJKA 3L3OA 4JN2B 2J8HA 5B38G 1O0VA 4HKJB 1FYTD 5HDLA 1E27A 4JO2H 2PO6B 3X13B 2FGWH 4MA7H 3KNBA 1W8OA 3CK0H 2HMIC 1P84J 5F7YC 2WWKT 3RUGB 5DRNA 3HHRB 4MXVE 3CPLB 2X4NA 5MENE 1CE6B 3AREA 3MBEB 5CIPA 3L5WB 1QSED 3MLSL 5TQ2L 4LDLB 5H37G 5C0IA 1EHLH 1TZHA 4XCFH 3KPNA 2LAGB 5E4EC 3X11A 3TBWA 5IJKC 3ARTA 3Q5YA 5HHOD 2OL3L 4OCRH 4PY8J 3O3EA 3Q0HA 4GG8A 1OGTA 2AABH 4QRSB 5FOJA 5EPMB 1LGVA 2VE6A 4PJIB 4UILL 1J0YA 4XP6H 4TUJB 1A6WL 1CFSA 3VXUD 3RX5A 4QHLB 1F2QA 3L3HA 1FBIH 4JJ5B 4OGYL 1W0WA 2YA0A 3QXDB 3T0XA 5F7MC 1TITA 4JEGB 4JFYB 1A4KA 1LO0L 4A2MA 2IMNA 5CSBA 5EN2B 5DJZA 5C2BH 1KNOA 4OLUH 1GC1C 3BIBX 1U8MA 1FL3B 2NY1D 1T20A 3NAAL 3S4SA 2R0LH 4NO0B 1IEBB 2OTUB 2Z9TA 2ZJSL 35C8L 1B6DA 1B0RA 2D7NA 3ECBB 4PJAA 1DEEB 1GAFL 3ZDZF 4X6CF 4CNIB 3N85H 1LEKA 3LQZB 4WGVB 3VXRE 4YDLC 4DUXA 1EMTH 4GG6A 1B6UA 2LU3A 2YPVH 1EHNA 3QUML 4K3EH 4HLZH 2IANA 3C5ZC 4XNYH 4TSCH 3BP5A 4KI5D 2VL4A 2VLJB 4WTXA 5EZIH 4YDKL 4ZTPL 1P4LB 5DC4B 3ARFD 3H3KA 2BFVH 2J7LA 2CLVA 4PJDF 4F7EB 5E2WH 4F15C 3WD5L 1MJ7L 1NC2D 4HW6A 4NNXA 3QG7H 5ESAA 2HJKA 2BRQA 1FH5L 1JTTA 4EDXA 5DJYA 3GSNH 4G5ZL 1IARB 4NKQB 3H3PL 1JPGB 3WCYA 2HLAB 1Q9OA 3DIFB 1AGBB 1JZ5A 2J4WH 5DHVH 5AZ2L 3S97C 1GGTA 4NQVA 1RMFH 4RWYL 4GKSA 3RRQA 5L88L 1FFRA 1XF2B 3ZZ1A 2VXVL 3PWPE 1M71B 4ODUA 3V5KB 1CU4H 1XF5A 1X4YA 3O3DA 3RL1A 4HFWA 3MYJB 1DFBH 2FB4H 4OQ1A 5EOCJ 2VDPL 2Q76B 3JSSA 1NH6A 2FSEA 4U33A 2WBJA 5T1KB 3OR7B 2PR4L 2ENYA 4P59H 1T0PB 1EEQA 3HZYB 3OKDB 2QQKH 3H9YA 2I07B 4JG1L 1TTGA 3MODH 3MRHA 4GKNA 3RWDA 1JHLL 4QGYA 2FDBP 4MJ6B 3B3IA 4P2QA 2Q3AA 1MLCB 3UROR 3AROA 4CW1B 4ZFGL 1XGPA 2M2DA 1P53A 5JR1H 4XPTL 3O9WA 1I9IH 1R5WA 5ELIA 4I3SL 3BT2L 3FZUC 4PRDB 4PJCA 4UB0L 1YN6B 1EGJH 1A21A 1E4KA 2QQLH 4ZXBB 4TSBH 2FO4A 5DVOA 1IKNA 1VFAB 1LP9F 3UTPE 4HHAA 4RFNB 3S5LG 3PGCA 3ZE1E 5E7BA 3MV8B 5IBUG 1R3IH 1OAXL 3I9GL 3G08B 4BQCA 3QNZB 3TO4A 2FX9H 1BEYH 4GBXD 5IFJA 1J0ZA 1CGYA 5M94B 3MXWH 4WWID 2SEBA 4KROD 5DR5H 4HS8L 3GUTA 3O3AB 1WT5A 1Y18A 1F6FB 1WBZB 3NACL 3O9WC 4Y8DC 5DJ8B 1T03L 2V17L 5IQ7L 1MQKH 1DZBA 1E4KC 4PRNB 3X14B 4Q6IA 1ZMYA 3SE8H 2X7LA 5DHVA 4LARL 1JV5B 2BDNH 3S34H 4YHPB 1FIEA 2VR9A 3EYVB 3MNVB 1FYTA 4P2YA 1RUPL 1PG7H 1MIEL 3DUSA 4MLSA 2XRAL 1ZEAH 2DWEA 2OR9H 1RIHL 3TO4C 3VGDA 4FQJL 4XCNB 5DRZB 4ISVB 3NIFE 2X70A 5SWZB 3MUGB 2AXFA 3VFSB 2PTVA 3WO3B 1WT5C 3SOBH 4XP1H 1YEEH 1RZ8A 3CFEB 3JWOL 3QEGH 1ITBB 5C0BB 4DVBB 3OJVC 1WF5A 2VZSA 4UQ2A 4G8GB 3UYRH 3GMQB 4O2FB 1HXYA 5HHOA 4X9FA 1MCEA 4HMDA 5CHNA 3V5DB 4KTDH 1UWXH 3GMPB 3CFCH 1YEFH 3OB8A 5F44A 5HXMA 3TBYB 5FYJD 2IADA 2ZUWA 2DWDB 1QBBA 4X0KA 5D1QA 5D93B 3D6GA 1B90A 1I3UA 3BPCB 5HJ3B 4GW1A 3VXUA 1QYGL 1KEMH 5EOTA 2F15A 1MVUA 5FK9B 4PGEA 3WDJA 4IIQB 3VJ6A 4G8IA 3T8XB 4TTDD 4U1JB 1IGFH 3UJTL 3VFPA 4GLRI 1JPTL 1NEZB 3TNNB 4P48A 1HSBB 1AC0A 3PWUA 3A67H 4K94H 3DVFA 4MQXC 1MAJA 3G5ZA 4JVUA 1PW3A 5F7NC 3WFHB 3KS0J 2KQMA 4PREB 5D1QC 5EUKB 5I17B 4KKNA 1MCCA 2EC9T 5JW5A 1A6TB 4GQ9L 4KRPB 4X7FC 4D9RD 2DQFA 2R4RL 1ZLSL 1HHJB 3VXNA 3ARFA 3BUYB 3K1DA 3ARBD 5JXAL 3P4MB 4QT5B 4QXGL 3IGAB 5BZDA 2VABB 1NC2A 4DVRL 1XZ0B 2ED8A 1F3DH 2IH1B 3HZKA 4TNWK 5DD6A 4ACPA 1HILA 2VITB 5GGRY 4XMKL 1IAOA 1RUKH 1D5ZB 3BN9C 1DBAL 3RGVC 2A83A 4KUCF 2FR4B 4JO1L 5EZLB 1FO0L 3QDMD 5HHPA 5C6PB 3D3VE 1AQKH 5C7XH 4ELMF 1Q8MA 1I8KB 4F7CB 2JCCA 1ZVYA 5DJ0B 3AAZB 3MRCA 4MDJA 1EJOL 1XGTA 2D7TH 2ZKHL 4KHXL 1JRHI 2EE6A 4X9IA 1QKZH 2AKRA 1OARH 1OTSD 2ZZUT 4PG2C 3ARFC 3HAEH 3QDJB 5F9AC 5JA8B 4OM0H 1JNJA 3HUJA 3PWNB 3T0VA 5DS8B 2NY0C 1SBSH 3CXHJ 5MEND 3SBWC 4AENA 3TH3T 1IJ9A 2P24B 1A7QL 5F71A 4HUXB 2PXYB 4HF5H 1ZANH 5JW4Q 4BH7B 1OAZL 4HFUL 5GGQH 1F3JA 2NY3C 1I9JH 1WEJL 3MLZL 2MKWA 1LO5B 4PB9H 3I2CH 3SJVB 1KN2L 1DUZA 1LEIB 1CFQB 4YDIL 4E0RA 4HXAH 2WW8A 1TQBC 3AB0B 2UVFA 3LRSB 5E4IA 4N0UA 3VGHA 4W6YB 2A9NL 5ENWA 3P9WB 3FAWA 4WHYH 4PRIE 3CFDB 1S78C 5E5MB 3S37H 1JUFA 3S5LB 2Y5TA 4YBLB 3CMGA 5IMMA 1X6NA 4HGWA 4YNYB 3EYFA 5FDWB 4GBXA 3UTQB 2EKJA 4O51A 1JYWA 1H3PL 3U0WH 3RVUC 1RIVH 1MHEB 3OGCB 4RDQG 1H3GA 5IBLC 4X7CC 3BP6A 3DURB 3VXRD 4F7TB 5D7IE 4PJXB 1XGQA 3FT2B 4NN7B 3KLHD 3T3MF 3C5SA 2UZYB 4QXWA 4IDJH 3C09B 3LKOB 1PD6A 3ET9F 4IMKA 5KSUA 3RI5K 2HWZL 2CGRH 1D3CA 2NY5H 3MC0A 3FFDA 1PY9A 3IDNB 4QRTA 3DVNA 4PYHA 1BQHA 4NHUB 3VFRB 4CMMB 5IVXB 2Y1VA 3BZ4B 4YIQB 4KKBC 3LS4L 2ZSVB 4B5EA 2EECA 5K9JH 2CMRH 5JNYA 1IGCL 3BDYL 2M8XA 1HOCA 4XGZB 2H26B 1NAMA 1CLYH 5IHUH 4PRBB 2H32B 1OQOA 3GI9L 1KJ3H 4Y4KB 4LVNB 4CVUA 5GRXG 4L4JA 2I60H 4AMKH 5I75B 3PWPD 43CAA 5D7SH 4IMLA 4ZSOB 5BZWA 4GW4B 5SX4I 3VFMB 5I66A 5DLML 4P9ML 2VQ1B 4ZQKA 2LTQC 4XPGH 1ZT4B 1WTLA 2I26N 3VD9A 3KXFE 3O41A 2AJYH 5C3LD 2VXUH 5E2VL 2YBRA 1KJ2H 3RWJB 5GZND 4OZ4B 1YECL 1FP5A 4QKXB 2NNAB 4R0LA 2BERA 2A6DB 4CRPA 1JCKA 3MRRA 4PGCB 1AC6A 2YPKA 3VE0A 3VH8B 1D6EA 4WI3A 4HLZG 4LF3A 4K2UL 3NH7L 1I3GH 2VDML 5F7FA 4JAMB 5IB4B 2OR7A 4JM2C 4OFIA 2YOCA 3UTPD 4NZRH 3UBXB 2H6PA 1ZHLA 5T1MB 3ULVL 4Y4FC 1DQJA 1ULVA 1U6AH 3MRIB 3KAAA 2W60A 4D9LL 3UJIL 5D1XD 2YPLE 5J06A 4CKVX 3KJ4C 4HUMB 3OJMB 4OCMC 2DM4A 1F8TL 2O5YH 2LVCA 4YE4L 2AQ2A 5E4EB 1LE9A 4G7VH 4U3HA 5LVEA 4HK3J 3L3OB 2VXQL 4UNTA 1EK3A 5L8LB 2B4CC 3DPBA 4LK4A 4DOHB 3T0EC 1NFIA 1E27B 3ALWA 3FB8B 3K80A 4J1UA 3QDMA 5I1JL 1KV3A 1KELL 3KNBB 3IYLW 4Q2ZA 1TNNA 5DRNB 3BGAA 2W38A 5LBSL 3GSXA 2BVQA 3FKUS 4P3CL 2X4NB 3AREB 3TBTA 1XIWC 4YXLL 1A7OL 4N9GA 3D39E 5C0IB 4IM8A 2DAVA 2ERJC 1TZHB 1AJ7H 2DLFH 2KDGA 3KPNB 1GPOH 3X11B 3QT2A 5MENA 3TBWB 2V5SA 5KAQF 1T1ZA 5KJRH 4HZAA 2R1XA 5FM8A 3O3EB 2XKNA 1F4XH 4GG8B 1OGTB 2W0PA 4YDJA 1FGVH 2VE6B 1SEQH 3BMWA 4YR6A 1CFSB 1V7NH 4WCYL 2XOTA 3L3HB 4QY8A 4FQLH 1WISA 1W0WB 3GDBA 2Y6SD 1KCSL 3U7YL 1A4KB 1QQDA 5DJZB 1KNOB 2QHRL 1U8MB 1C5DA 3RY4A 1T20B 3MLUH 3S4SB 5JPMA 1T2JA 4OQTH 2AJSL 3SDDB 1B0RB 1P4IL 4PJAB 2XT1B 2H9GA 4HPYL 1L7TH 1LEKB 3MZGB 4UUJA 4GG6B 3CIQA 1HXMB 2VDQL 3HLAA 1T21B 1J1OL 2IANB 3K7UA 3QBTB 5D2NC 2GSIA 3TWCL 3VXRA 4HWBL 2CLVB 2XIDA 2J8UE 3CGTA 2DLIA 1RI8A 1X5LA 2CKBL 4NNXB 5ESAB 1MI5A 2HJKB 2C3VA 1ROWA 4EDXB 2IJ0C 2IWGA 1D6VL 2E9JA 1NCUA 5DJYB 5EIQA 1SVZA 1MIMH 1WCBA 1B0GA 1RJZA 1I85C 4QYOA 1KFAL 1I1AC 1Q9OB 5CILL 2XZQL 5LGHH 3DYPA 5BXFA 5L7XH 2DN7A 1PSKL 4X99A 1MJUH 3DVIA 4LHUA 4NQVB 3T1WA 4GKSB 1Q72H 5TF1L 1E6OL 4LQ1A 4N5ED 3D87B 4ODUB 4CVZA 4YWGH 4OLWH 1XF5B 4ZPVB 3D3VD 3CCHA 3TYGL 3TO2A 3O3DB 3RL1B 4HFWB 1F4YH 3WNKA 2FSEB 2WBJB 5LXGH 3PWPA 4JFZL 4OZHE 4XAWH 3MCG1 3HMXH 3RVVD 1DLFL 1FZJA 3RAJH 4UDUA 4LCWE 1H9VA 4UV7L 1AGEA 5DJDA 1KPVA 3MRHB 4GKNB 1C7SA 3RWDB 4BSVA 1ZS8A 1O7SA 3B3IB 2VLKE 4P2QB 4AYFA 1YEHH 4J2XA 3LQMA 3O9WB 1X9QA 4GO6B 1R5WB 2ARJA 2EH8H 1BOGA 4OQTA 4LLUA 2ADGA 4JZJC 1JE6A 1A3LL 3B4NA 4WW2A 2FO4B 5GRUL 3WYRA 2I9LA 4HHAB 2HJLA 1WTGT 3PGCB 4BFGA 3GSWA 5FHBH 2F8XC 3LKQA 5GHWH 1MFDH 4L9DA 4K3GA 4ODHH 2DL9A 1NFDA 3O6MH 1OAKL 2VQTA 4PRID 3TO4B 3TZVC 2Z0BA 3IFNL 5IFJB 4BH8A 5JA9A 1GCFA 2SEBB 3BMVA 3MUHL 2YRPA 5GZNC 3GUTB 4YAQA 5D1XA 2DBLH 1Y18B 3IS1X 1YY8B 2FD6H 3A6BL 4X7DC 3GSNB 4WFFE 1XEDA 1PBYA 4OGXH 3WKMH 4Q6IB 4WW2C 2HLFC 2X7LB 5DHVB 5FGCE 5IHLB 4PY8I 4OKVA 4ODTH 1FYTB 3RFZC 3DUSB 1JGLL 3ZDYE 2ID5A 4NJAL 4U0RC 3NCYP 4J4PD 5F9JA 3RNQA 2DWEB 1WV7T 2A77L 3HAEG 4PJ7E 2Q6WA 2BOBA 3FQWA 3MGOA 1AR1D 3BO8B 1DBBH 2IQAA 2AXFB 4KPHL 5BVPH 5D1XC 2JB5H 1RZ8B 5C0RH 1YEKH 3MMEA 5FO9A 4YQXH 4ODSH 4A6YL 4IDLA 1PX4A 1J5OH 2OSLA 3AVEA 1MPAH 1NGXA 4DTGH 1OTTD 3BDBA 4IS6A 2DI9A 4H20H 15C8H 3X3GH 1JPST 3CNKA 4WI5A 5A43C 4UQ2B 1TENA 4Y4HA 4I13B 2EE2A 2DOCA 1HXYB 3WJJA 5HHOB 4L1DA 5JIKA 4JPKH 3IU4H 2IADB 4X0KB 5D1QB 3M8OH 2HT2D 4WENB 3VXUB 4WHYG 2DD8H 5EOTB 1MVUB 3FCTA 4PGEB 2YXFA 3VJ6B 3SE4A 1T80A 3B6SA 4LSRL 4G8IB 3VFOA 3KXFD 3BEWA 1NMAH 3VFPB 4H25A 3RTQD 4X9HA 2GAZA 4P2CG 2NY1B 4YUEL 2ATKA 1FC1A 3V79C 1MUJA 1NGQH 4Y4HC 3SKOA 1V7MH 1QP1A 2ADIA 3PWUB 3N1QC 3WJJC 3H42L 4G6JH 4EI5C 4WI7A 3WS6A 3MTRA 5SWSA 5EU6E 1PX3A 3G5ZB 4TVSa 3OV6A 3X3FL 5DA0B 5DD1H 5CJXA 5ITBH 4M1CD 3TCLA 4CJ0A 5JW5B 3B9KA 3BGMA 3TLRA 2DQFB 4RMRA 5LJYH 1R3HA 5ECJE 1ZOXA 4PP1D 3VXNB 3ARFB 1BF8A 1C5CL 5LQBL 4JHAH 3N1PC 5BZDB 1NC2B 2DIAA 3FMGL 1TDQA 4FFVC 3HZKB 2FLBT 1HILB 1IC4H 1IAOB 2YPLD 4ZS7H 3ZKMD 2OMBA 3BE1L 3PABA 2A83B 5I8OL 2BSRA 3WS6C 3R8QA 1U8QA 5HHPB 3SKJL 4TNWF 4M5YH 1II4E 3CLFH 2AXJA 5TE4L 1EX0A 5GS3A 1JFQL 2JCCB 5CJXC 3GJFH 3MRCB 4MDJB 3B9KC 1XGTB 1TQBB 2AKRB 4K7FA 2WWMD 2V5RA 4YFLI 3D3VA 4OLYL 5E9DE 4Q9CA 3QJFA 1K3ZA 3L5XH 3HUJB 2CRZA 4M6OL 4QHNA 5H94A 4AENB 1UXSB 1ZVHA 1TETL 3D39D 3ZTNL 4M43L 3OBAA 3FN3A 1UH2A 2ORBH 2XACC 2MCG1 3D9AH 1EPFA 1F3JB 2AQ3A 5TE6L 5JUEH 4PJXF 5JHLL 3WUWA 1RZJL 2MQCA 3VGEA 4P5TD 1DUZB 5IVNA 4E0RB 1HHIA 1OAQL 2C3WA 1HZHL 1IGIH 4N0UB 2R39A 4XZUA 4Z7VE 5EO1A 1D5IH 3QCVL 5ENWB 5KVFL 5I18H 3RBSA 5ALBH 4H1LH 1MWAL 1JUFB 1OPGL 5SX5K 4EEEA 2Y5TB 2GY5A 1UQSA 5IMMB 4HGWB 3DOSA 4PRIA 3EYFB 5F1SA 4GBXB 1BJ1J 4L8BB 4O51B 5AWNH 3CSYA 3JTSA 4YHYC 1FFQA 1YNKH 4JGMA 4Z18A 4JFOA 2DQGH 3BP6B 3NCFB 5EBLA 3MV01 1IC5L 1SJEB 1TXKA 1XGQB 4HT1L 4DKFL 3W11C 1IGMH 3C5SB 4AIZA 5BS0E 2GT9A 1U42A 2GTZA 2OJZL 4JR9H 3RWHB 3KVQA 5IEKA 4J3SA 4KV5F 5I8KH 3FFDB 4NN6C 2Y36H 4AY0A 2NMSA 3DVNB 1BQHB 1UJ3A 1J1PL 2A1WL 3BESR 3GJFA 3RVXD 3BAEH 3BP7A 2YD9A 4J4PA 3PHSA 4K8RD 5E2UL 4AEFA 1FCCA 2R0KL 2AJ3A 3RI5F 2KZ1B 1FLRH 3ULUE 1S7SA 4HQQL 3IKKA 3UDWA 2FH8A 4G42A 1HOCB 3AS1A 5GJTH 1LNUA 1NAMB 3N1GC 1YNLH 4PFEA 1RJYB 2Z8SA 1CDCA 2QKIA 1N6VA 2AGJL 4J8RA 1MFBH 4WNQA 5TQ0H 5JMRA 4F9PA 5GSVA 1DR9A 3L9RA 43CAB 4IMLB 1T7VA 4OLEA 1UVQA 3U30B 3LSOA 3F58H 4ZQKB 3EOTH 3KPMA 3PP4H 4L4VA 1CQKA 1N59A 3SGDI 3I6KA 3T09A 3O41B 4J4PC 5GS2D 4HLJA 5IKCA 1AR1C 2YBRB 4JPWH 5ALCH 5B3JF 2BY0A 4LCWD 4JZOA 3WIHA 3KJ4B 4R0LB 3PXHA 4HPOL 3KXFA 5CEZE 1X5FA 1DBJL 2VLKD 4M4PA 3MRRB 3R0MA 3CVHH 4F9PC 2YPKB 3VE0B 3RTQA 1OTTC 5EG6C 1D6EB 1XCTA 1Y6KR 2DMKA 3OPZL 4X7SL 1R5IA 1EFQA 4LF3B 5CJ5A 2IPUG 5D2LF 4KMQA 4DEPC 4J7RA 5FYKH 1Q9KA 4TRPH 3TVMD 2A9ML 4F2MA 2H6PB 1ZHLB 1DQJB 4O58L 2X44D 3MNZA 1P6FA 2W60B 1DJSA 1KYOK 1J7VR 3QIBA 3VWKD 2DQDH 4MQTB 4K23H 4DN4L 3ARBB 1GGIH 4MS8C 1U8NB 2JELL 2CSPA 4NKIH 1LE9B 3RTQC 3BPNB 3K8MA 3TFKC 4D0CA 4IJ3C 4LPCA 3BD5A 3I75A 4LAQL 4WFFD 3V0VA 1NFIB 2VSCA 1NSNH 5EUOE 1ORQA 4J1UB 3N1MC 3QDMB 2R69L 5T3XL 3T0WA 1U41A 1E4JA 4Q2ZB 4YGVA 2GJ6E 3GSXB 1YQVH 2BVQB 5B4MD 2DLEA 2EDWA 4M1CC 1CE1H 3TBTB 3QIBC 4N9GB 4XI5C 3ZHLA 5I1EL 1BQSA 3V6OA 4RCAA 4JKPH 1J11A 1KCVH 1HN1A 3C08L 5MENB 1PLGL 5DD0H 2DQIH 1FVCA 3D39A 5IB5A 1ND0B 1T1ZB 4JCLA 2R1XB 1RUAL 2MNUA 3GK8H 4WU5A 1BOYA 2XKNB 4IEFB 3V8OA 1MCPH 1L0YA 2X40A 2GTWA 4YDJB 3CH8A 2GUOA 4RGNE 4YR6B 1LWRA 5F7EH 4P5TA 3K1KC 4QY8B 1U8HA 2X1OA 4QO1A 2Q87A 1HIML 12E8H 2NY7H 1I8MA 2OXHA 3NCCB 2J5LC 4QHUA 2WWMC 1KEGH 1T83A 3QHFH 1QQDB 3V6OC 1MNUL 4MQSB 4BFBD 1V05A 1C5DB 3S3PA 1D5BA 4UBDD 1DBKL 1NLBL 1A7NH 4WJ5A 5JPMB 1BX2A 3M1BA 3QEQE 3PQYE 1MSPA 5ISZE 5C3TA 1KCUH 3ME0A 2HT4C 2H9GB 5F96H 4UUJB 4HUWB 4NP4L 3HLAB 4J6RL 1BFOA 4Q9RH 5A2LH 5I19L 2ICCA 4KRLB 1S7QA 4R4BA 4P5TC 3THML 1A0QH 2GSIB 1LDPL 4IHOA 1DQLL 2YWZA 2YD8A 4WEUD 5EU6D 3VXRB 1NL0H 4AIXA 4XC1L 1TVHB 3NFNA 2NY4D 1T83C 2IG2H 3QZWG 1WQVT 1G9MC 1N0LA 2ED9A 2D7PA 4WI9A 2HAZA 4H88L 4GRLD 5DMIH 5DHXB 2C3VB 2IBGA 3I6LE 3F6LA 1R0AH 4LSPH 4N0CD 1QPXA 1WCBB 1F90H 4N8VG 4QYOB 3KLAA 3QB7C 5HPOA 4HKBA 2J8UA 4MB5A 5BXFB 3G9VA 4YBQD 4X99B 2H41A 3N50A 3OSKA 4R26H 4D9QE 3MOQA 5DRXA 1BGXH 4PJCF 1LEGA 1IGYA 3ORJA 4BQ9A 4YGAB 4CVZB 4OIAA 1RK1A 3CCHB 4BM7A 3FQNB 1DQML 1PVHA 4GRWF 3QQ9D 3TO2B 4M93B 4J23A 3V4UH 1KB9K 1CFNA 4U7MA 1WFUA 2FATH 3PWPB 4ALAL 4X6EA 5T1DH 3GRWL 3TIDA 4EIGB 5JQ6L 4NQCE 3H7LA 1SYSA 5E9DD 2F74A 1FZJB 4NFDA 4UDUB 4I18A 1A7BA 3ZDZE 2PYEE 1AGEB 4XPAL 5DJDB 1LMKA 3PDOA 1KPVB 1JGUH 3KPSE 4BSVB 3MRQB 1ZS8B 2GJZA 4K3JL 4A2LA 2YUVA 1ZGLA 1UACH 2BVEA 2BVPA 2R2EA 1YYML 2ARJB 4LCWA 1NBVH 1BOGB 2O5ZH 5B39A 4PJDE 3K81A 1IZJA 5GRWA 2GIYA 4LLUB 4X5XA 2D9CA 2E9IA 2I9LB 3MJ9H 2ZPKH 4ENED 2HJLB 5K93A 3GSWB 4JQIH 3LKQB 3LOWA 4U0RB 5DUPH 2XZCH 1NFDB 3BSZL 4PLJC 5T1LD 4R96A 1J05A 3TVMA 4BH8B 4RGMC 4C56E 1RZ7H 3FONA 4JHWL 4Y19E 1JNLL 4YAQB 5D1XB 3VWKA 2R0ZH 1IC7H 1JWSA 5KVGH 2BHUA 1N26A 5ESQA 3TBVA 1AGCA 5I1GL 5C07E 4F7MB 1MFEL 1N4XH 3QNYB 1CLZL 4OKVB 1JNHA 5BS0D 3O8XA 3RNQB 2BSSA 3KYNA 3AMLA 2Q6WB 2BOBB 4Y7MA 1B4JH 3MGOB 4H8WL 4P9HL 1UM6L 3U1SL 3LMJL 1YEGL 1E6JL 2IQAB 3QRGH 5L0QB 4Z77A 1BMGA 4Z0BL 5D7JD 1A2YA 1CDGA 4Y5YC 3VWJC 1JYNA 3QWRD 4PJ7A 1LO4L 5IOPA 5L8JB 2OSLB 4JRWA 3QWOA 3BIKB 4LSQH 1NGXB 4X6DE 2W0LA 1LP9E 4IS6B 5EWIH 5IJVA 3CDGA 3FO1A 3PF2A 2F9BT 1WZ1L 1A6UH 1AO7E 4WUKL 2EIZA 2J12B 3ULVF 4XNZC 2MJWA 3O8XC 1AFVH 1S9YA 3JWDL 3H3BC 3MV9E 3CXDH 2DTML 1M7DA 3HPLA 3KYKH 4HH9A 3QH3A 3FCTB 3NA4A 5B4MC 4H1LG 1TJHL 1CL7L 1YJDL 3OJDA 4GT7A 3B6SB 3IJYA 3Q6GH 3VFOB 2Y06H 4S1RH 2HRLA 3BEWB 3RGHA 1J86A 1TPXB 4H25B 3O3BA 4CVWA 1SHMA 2GAZB 5IWLA 2ATKB 1BQUA 3SKOB 2ADIB 4JM4H 2MCPL 5L6YH 3SE9H 5CEZD 2JCCF 3DROA 5JO5A 1KXTB 4YXHH 5CCKL 4TPRH 5SWSB 5F9WB 3ZSSA 4ODXA 4PYGA 5I30L 1HYSC 4AJ0A 4QNPF 2C4FU 3TCLB 2VR5A 5BRZE 1CFBA 3B9KB 3BGMB 1M05A 3CFKA 4DUWA 1R3HB 2UVEA 4HAGA 5FKAA 5HYJE 5EU6A 4JO2L 4U6TA 2F5AH 4WWKD 2FGWL 4MA7L 3T2PA 5IP4A 2WIIA 3CK0L 3DYOA 3QIUC 5CBAA 5AYUH 4OCYH 2IFGA 3PABB 4XNUH 4IOFC 1T66D 4P46D 5HY9A 5EBWA 2BSRB 4W6WB 1U8QB 1X5XA 4XCCH 1EHLL 1EHXA 3EO9L 4LAJH 5CZKA 2VXSH 4XCFL 5FB8A 4PS4L 5D6DA 3NMEA 3L7FA 2GQHA 3VRJA 2NXZD 1MCSA 1NJ9A 5C0CE 1HYRC 1GIGH 1I75A 1X5GA 4K7FB 4NSKA 2DLGA 1OOAA 3D3VB 4OIBA 3QJFB 2AABL 1QA9A 4ZPTA 2GJ6D 5C09E 2K7PA 4XP6L 2RIKA 4QHNB 5H94B 2IMMA 3S7GA 1FBIL 1T7WA 5BVJA 3ULUH 5CS7A 1U3YA 4K3HA 3HR5A 5E99H 1SJHA 2AV1A 4B7IA 4XWOD 1RURH 4JREC 1G7PA 5C2BL 1JPSH 4OLUL 3GO1H 3WUWB 4E5XA 5D6DC 4YHKH 3DUUA 4YHYB 2R0LL 4MSWB 4E41A 1HHIB 3KR3H 5I1AA 1WAAF 1DVFA 4X83A 1JP5A 1H8SA 4XZUB 3N85L 4RGND 1EMTL 1WWAX 1FPTH 5EO1B 5FO8A 3FT3A 2YPVL 2O5XL 4K3EL 1RU9L 3K46A 6FABL 5FHAH 3M45A 1NAKH 5EZIL 2EIBA 1VCAA 1DUYB 3V5HA 2X4PA 2BFVL 4KMTH 4Z7VA 1UQSB 4OD2A 5E2WL 3OGOE 4PRIB 5T1LA 3HTLX 2Y72A 4TUKH 4ELME 3CSYB 3QEQD 3PIQA 3PQYD 5CEZH 1S7VA 2WBWB 3JTSB