3OL0A

Crystal structure of monofoil-4p homo-trimer: de novo designed monomer trefoil-fold sub-domain which forms homo-trimer assembly
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
43
structure length
43
Chain Sequence
HHHPVLLKSTETGQYLRINPDGTVDGTRDRSDPHIQFQISPEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords de novo designed monomer trefoil-fold sub-domain which forms
publication title Experimental support for the evolution of symmetric protein architecture from a simple peptide motif.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 5
structure length 43
sequence length 43
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.260 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3ol0A00
3OL0A
chains in the Genus database with same CATH superfamily
1YU6C 2JA1A 2JW6A 1HPTA 2DKVA 2NU4I 3VDPA 3SGBI 1NXUA 2N1AB 1BUSA 2KMQA 5HI7A 1DS2I 4E1RA 4FKDA 1OMTA 1H0ZA 1LR8A 1R79A 2SGFI 1HEVA 3UFFA 1NUBA 2YUUA 3FSYA 3R5CA 5E3PA 1IY6A 1V1IA 3HH2C 1Y1BA 3R5AA 4DNCA 1SGEI 2QQCA 3UEJA 1PTRA 1S20A 3TJQA 5J8CA 1W4RA 2WVJA 5J8FA 3UEYA 1CSOI 4B6DA 3QAHA 2UZ3A 1XX6A 5JHWC 2QQDA 2SGPI 1X4SA 2UVOA 3E2IA 1M8CA 3KY9A 1WGCA 2V1CC 5FUXA 1MJ9A 1UHAA 2WGCA 9WGAA 3TOAA 2V53A 1MJBA 1TGSI 2KCXA 2XRCA 5E3RA 3UGIA 1TURA 5EX3A 3OXGA 1OMUA 2WCYA 3RU0A 2RC4A 1HDLA 1OYVI 2LB7A 2W0TA 3QTLD 1CGJI 3R5BA 3TO9A 1AN1I 3OL0A 1TBRR 5FUVA 1N13A 3TO7A 4GI3C 1IY5A 2F3CI 2LEOA 1SGNI 3QWPA 2Y0MA 1K7UA 2CJSC 2B8TA 2SGEI 2KMOA 4E1PA 2DIPA 3R5DA 1RFHA 1WKXA 5EX0A 1CT0I 3SEKC 2X52A 4UXHA 3OVOA 2QPOA 5CCMA 1CHOI 2VRWB 1FY7A 1MT1A 2OVOA 2L7XA 3D00A 1TUSA 3GOXA 1DS3I 1SGQI 2SGQI 7WGAA 1XA6A 1M8BA 2OD1A 3VDUA 3SGQI 1Z2IA 1HJAI 4A24A 3B4VC 2ARPF 3UGLA 5CCLA 1P9GA 3OXFA 2GVIA 2KMRA 2ENZA 2DB6A 1TBNA 1CGII 2CWHA 2ERWA 1SGDI 1K7VA 1UUCA 1OVOA 2OU2A 3FC3A 1UVGA 2J87A 2M5XA 1Z7KB 5FUYA 1TBQR 2QQ0A 2N71A 4JCVE 1UVFA 3MEKA 2J9RA 1R0RI 1FYBA 2ORWA 4WP4A 4MPIA 1K7TA 1ULNA 2L8EA 2ODDA 1X74A 2JXDA 2ORVA 2PQ8A 3VE5A 1PPFI 5DAEA 2X3TA 1P9ZA 2JZMA 2P6AC 3BJIA 2B0UC 1FAQA 1Y1CA 1PJUA 2GIVA 2NU0I 1CE3A 2KMPA 4OVOA 1YTPA 2E73A 1KMAA 2FNFX 5E3QA 1TOTA 1KBFA 1FARA 2SGDI 3CXLA 1PCEA 1U5KA 1WGTA 1SGRI 2QQEA 3OXLA 1PTQA 2ENNA 1BMOA 1SGYI 1WTJA 2ELIA 1CT2I 1VDDA 1ULMA 2OZUA 2YQPA 3PDNA 2N52A 2BUSA 1XBTA 4SGBI 4UXIA 3TOBA 4AMLA 5HQ8A 1LR9A 2K9HA 1TBOA 2E5RA 4L9MA 1ULKA 2CWGA 1W3SA 1LR7A 2GKRI 2GKVA 3TO6A 1IW4A 4HGUA 3E59A 2NU1I 2NU3I 1Y8FA 2LUYA 2NU2I 2ROWA 1Q9BA 1TIHA 1MJAA 2RIJA 2A20A 1CT4I 3FSXA 3UOEA 1SGPI 1V1HA 5FUWA 2GKTI 2CWFA 2JYYA 1KBEA 3UGDA 4UXJA 2N17A 2V1CA
chains in the Genus database with same CATH topology
1YU6C 2JA1A 2JW6A 1HPTA 2NU4I 3VDPA 3SGBI 2N1AB 1BUSA 2KMQA 5HI7A 1DS2I 4E1RA 4FKDA 1OMTA 1H0ZA 1LR8A 1R79A 2SGFI 3UFFA 1NUBA 2YUUA 1IY6A 1V1IA 3HH2C 1Y1BA 1SGEI 2QQCA 3UEJA 1PTRA 3TJQA 1W4RA 2WVJA 3UEYA 1CSOI 4B6DA 2UZ3A 1XX6A 5JHWC 2QQDA 2SGPI 1X4SA 3E2IA 1M8CA 3KY9A 2V1CC 5FUXA 2V53A 1TGSI 2KCXA 2XRCA 3UGIA 1TURA 5EX3A 3OXGA 1OMUA 2WCYA 3RU0A 1HDLA 1OYVI 3QTLD 2W0TA 1CGJI 1AN1I 3OL0A 1TBRR 5FUVA 1N13A 4GI3C 1IY5A 2F3CI 2LEOA 1SGNI 3QWPA 2CJSC 2B8TA 2SGEI 2KMOA 4E1PA 2DIPA 5EX0A 1RFHA 3SEKC 1CT0I 4UXHA 3OVOA 2QPOA 5CCMA 1CHOI 2VRWB 1MT1A 2OVOA 2L7XA 3D00A 1TUSA 3GOXA 1DS3I 1SGQI 2SGQI 1XA6A 1M8BA 2OD1A 3VDUA 3SGQI 1HJAI 4A24A 3B4VC 2ARPF 3UGLA 5CCLA 3OXFA 2GVIA 2KMRA 2ENZA 2DB6A 1TBNA 1CGII 2ERWA 1SGDI 1UUCA 1OVOA 3FC3A 1UVGA 2J87A 2M5XA 1Z7KB 5FUYA 1TBQR 2QQ0A 2N71A 4JCVE 1UVFA 3MEKA 2J9RA 1R0RI 1FYBA 2ORWA 2L8EA 2ODDA 1X74A 2JXDA 2ORVA 3VE5A 1PPFI 5DAEA 2P6AC 2JZMA 3BJIA 2B0UC 1FAQA 1Y1CA 1PJUA 2NU0I 1CE3A 2KMPA 4OVOA 1YTPA 2E73A 1KMAA 2FNFX 1TOTA 1KBFA 1FARA 2SGDI 3CXLA 1PCEA 1U5KA 1SGRI 2QQEA 3OXLA 1PTQA 2ENNA 1BMOA 1SGYI 2ELIA 1CT2I 1VDDA 2YQPA 3PDNA 2N52A 2BUSA 1XBTA 4SGBI 4UXIA 5HQ8A 1LR9A 2K9HA 1TBOA 2E5RA 4L9MA 1W3SA 1LR7A 2GKRI 2GKVA 1IW4A 4HGUA 3E59A 2NU1I 2NU3I 1Y8FA 2LUYA 2NU2I 2ROWA 1TIHA 2A20A 1CT4I 1SGPI 1V1HA 5FUWA 2GKTI 2JYYA 1KBEA 3UGDA 4UXJA 2N17A 2V1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OL0 A; 
#chains in the Genus database with same CATH topology
 1YU6 C;  2JA1 A;  2JW6 A;  1HPT A;  2DKV A;  2NU4 I;  3VDP A;  3SGB I;  1NXU A;  2N1A B;  1BUS A;  2KMQ A;  5HI7 A;  1DS2 I;  4E1R A;  4FKD A;  1OMT A;  1H0Z A;  1LR8 A;  1R79 A;  2SGF I;  1HEV A;  3UFF A;  1NUB A;  2YUU A;  3FSY A;  3R5C A;  5E3P A;  1IY6 A;  1V1I A;  3HH2 C;  1Y1B A;  3R5A A;  4DNC A;  1SGE I;  2QQC A;  3UEJ A;  1PTR A;  1S20 A;  3TJQ A;  5J8C A;  1W4R A;  2WVJ A;  5J8F A;  3UEY A;  1CSO I;  4B6D A;  3QAH A;  2UZ3 A;  1XX6 A;  5JHW C;  2QQD A;  2SGP I;  1X4S A;  2UVO A;  3E2I A;  1M8C A;  3KY9 A;  1WGC A;  2V1C C;  5FUX A;  1MJ9 A;  1UHA A;  2WGC A;  9WGA A;  3TOA A;  2V53 A;  1MJB A;  1TGS I;  2KCX A;  2XRC A;  5E3R A;  3UGI A;  1TUR A;  5EX3 A;  3OXG A;  1OMU A;  2WCY A;  3RU0 A;  2RC4 A;  1HDL A;  1OYV I;  2LB7 A;  2W0T A;  3QTL D;  1CGJ I;  3R5B A;  3TO9 A;  1AN1 I;  3OL0 A;  1TBR R;  5FUV A;  1N13 A;  3TO7 A;  4GI3 C;  1IY5 A;  2F3C I;  2LEO A;  1SGN I;  3QWP A;  2Y0M A;  1K7U A;  2CJS C;  2B8T A;  2SGE I;  2KMO A;  4E1P A;  2DIP A;  3R5D A;  1RFH A;  1WKX A;  5EX0 A;  1CT0 I;  3SEK C;  2X52 A;  4UXH A;  3OVO A;  2QPO A;  5CCM A;  1CHO I;  2VRW B;  1FY7 A;  1MT1 A;  2OVO A;  2L7X A;  3D00 A;  1TUS A;  3GOX A;  1DS3 I;  1SGQ I;  2SGQ I;  7WGA A;  1XA6 A;  1M8B A;  2OD1 A;  3VDU A;  3SGQ I;  1Z2I A;  1HJA I;  4A24 A;  3B4V C;  2ARP F;  3UGL A;  5CCL A;  1P9G A;  3OXF A;  2GVI A;  2KMR A;  2ENZ A;  2DB6 A;  1TBN A;  1CGI I;  2CWH A;  2ERW A;  1SGD I;  1K7V A;  1UUC A;  1OVO A;  2OU2 A;  3FC3 A;  1UVG A;  2J87 A;  2M5X A;  1Z7K B;  5FUY A;  1TBQ R;  2QQ0 A;  2N71 A;  4JCV E;  1UVF A;  3MEK A;  2J9R A;  1R0R I;  1FYB A;  2ORW A;  4WP4 A;  4MPI A;  1K7T A;  1ULN A;  2L8E A;  2ODD A;  1X74 A;  2JXD A;  2ORV A;  2PQ8 A;  3VE5 A;  1PPF I;  5DAE A;  2X3T A;  1P9Z A;  2JZM A;  2P6A C;  3BJI A;  2B0U C;  1FAQ A;  1Y1C A;  1PJU A;  2GIV A;  2NU0 I;  1CE3 A;  2KMP A;  4OVO A;  1YTP A;  2E73 A;  1KMA A;  2FNF X;  5E3Q A;  1TOT A;  1KBF A;  1FAR A;  2SGD I;  3CXL A;  1PCE A;  1U5K A;  1WGT A;  1SGR I;  2QQE A;  3OXL A;  1PTQ A;  2ENN A;  1BMO A;  1SGY I;  1WTJ A;  2ELI A;  1CT2 I;  1VDD A;  1ULM A;  2OZU A;  2YQP A;  3PDN A;  2N52 A;  2BUS A;  1XBT A;  4SGB I;  4UXI A;  3TOB A;  4AML A;  5HQ8 A;  1LR9 A;  2K9H A;  1TBO A;  2E5R A;  4L9M A;  1ULK A;  2CWG A;  1W3S A;  1LR7 A;  2GKR I;  2GKV A;  3TO6 A;  1IW4 A;  4HGU A;  3E59 A;  2NU1 I;  2NU3 I;  1Y8F A;  2LUY A;  2NU2 I;  2ROW A;  1Q9B A;  1TIH A;  1MJA A;  2RIJ A;  2A20 A;  1CT4 I;  3FSX A;  3UOE A;  1SGP I;  1V1H A;  5FUW A;  2GKT I;  2CWF A;  2JYY A;  1KBE A;  3UGD A;  4UXJ A;  2N17 A;  2V1C A; 
#chains in the Genus database with same CATH homology
 1YU6 C;  2JA1 A;  2JW6 A;  1HPT A;  2NU4 I;  3VDP A;  3SGB I;  2N1A B;  1BUS A;  2KMQ A;  5HI7 A;  1DS2 I;  4E1R A;  4FKD A;  1OMT A;  1H0Z A;  1LR8 A;  1R79 A;  2SGF I;  3UFF A;  1NUB A;  2YUU A;  1IY6 A;  1V1I A;  3HH2 C;  1Y1B A;  1SGE I;  2QQC A;  3UEJ A;  1PTR A;  3TJQ A;  1W4R A;  2WVJ A;  3UEY A;  1CSO I;  4B6D A;  2UZ3 A;  1XX6 A;  5JHW C;  2QQD A;  2SGP I;  1X4S A;  3E2I A;  1M8C A;  3KY9 A;  2V1C C;  5FUX A;  2V53 A;  1TGS I;  2KCX A;  2XRC A;  3UGI A;  1TUR A;  5EX3 A;  3OXG A;  1OMU A;  2WCY A;  3RU0 A;  1HDL A;  1OYV I;  3QTL D;  2W0T A;  1CGJ I;  1AN1 I;  3OL0 A;  1TBR R;  5FUV A;  1N13 A;  4GI3 C;  1IY5 A;  2F3C I;  2LEO A;  1SGN I;  3QWP A;  2CJS C;  2B8T A;  2SGE I;  2KMO A;  4E1P A;  2DIP A;  5EX0 A;  1RFH A;  3SEK C;  1CT0 I;  4UXH A;  3OVO A;  2QPO A;  5CCM A;  1CHO I;  2VRW B;  1MT1 A;  2OVO A;  2L7X A;  3D00 A;  1TUS A;  3GOX A;  1DS3 I;  1SGQ I;  2SGQ I;  1XA6 A;  1M8B A;  2OD1 A;  3VDU A;  3SGQ I;  1HJA I;  4A24 A;  3B4V C;  2ARP F;  3UGL A;  5CCL A;  3OXF A;  2GVI A;  2KMR A;  2ENZ A;  2DB6 A;  1TBN A;  1CGI I;  2ERW A;  1SGD I;  1UUC A;  1OVO A;  3FC3 A;  1UVG A;  2J87 A;  2M5X A;  1Z7K B;  5FUY A;  1TBQ R;  2QQ0 A;  2N71 A;  4JCV E;  1UVF A;  3MEK A;  2J9R A;  1R0R I;  1FYB A;  2ORW A;  2L8E A;  2ODD A;  1X74 A;  2JXD A;  2ORV A;  3VE5 A;  1PPF I;  5DAE A;  2P6A C;  2JZM A;  3BJI A;  2B0U C;  1FAQ A;  1Y1C A;  1PJU A;  2NU0 I;  1CE3 A;  2KMP A;  4OVO A;  1YTP A;  2E73 A;  1KMA A;  2FNF X;  1TOT A;  1KBF A;  1FAR A;  2SGD I;  3CXL A;  1PCE A;  1U5K A;  1SGR I;  2QQE A;  3OXL A;  1PTQ A;  2ENN A;  1BMO A;  1SGY I;  2ELI A;  1CT2 I;  1VDD A;  2YQP A;  3PDN A;  2N52 A;  2BUS A;  1XBT A;  4SGB I;  4UXI A;  5HQ8 A;  1LR9 A;  2K9H A;  1TBO A;  2E5R A;  4L9M A;  1W3S A;  1LR7 A;  2GKR I;  2GKV A;  1IW4 A;  4HGU A;  3E59 A;  2NU1 I;  2NU3 I;  1Y8F A;  2LUY A;  2NU2 I;  2ROW A;  1TIH A;  2A20 A;  1CT4 I;  1SGP I;  1V1H A;  5FUW A;  2GKT I;  2JYY A;  1KBE A;  3UGD A;  4UXJ A;  2N17 A;  2V1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...