3OL0A

Crystal structure of monofoil-4p homo-trimer: de novo designed monomer trefoil-fold sub-domain which forms homo-trimer assembly
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
43
structure length
43
Chain Sequence
HHHPVLLKSTETGQYLRINPDGTVDGTRDRSDPHIQFQISPEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords de novo designed monomer trefoil-fold sub-domain which forms
publication title Experimental support for the evolution of symmetric protein architecture from a simple peptide motif.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 5
structure length 43
sequence length 43
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.260 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3ol0A00
3OL0A
chains in the Genus database with same CATH superfamily
2YQPA 5HI7A 2F3CI 4AMLA 1XA6A 2B0UC 2ELIA 2UVOA 2CWGA 2JW6A 3UEJA 1UUCA 3HH2C 1MJ9A 1TGSI 1NUBA 2FNFX 5FUXA 3FSYA 5JHWC 1W4RA 1FYBA 1HJAI 1FARA 1XBTA 4MPIA 3QAHA 1TIHA 2QQDA 3TO7A 3UFFA 1CGII 1VDDA 2ERWA 2N17A 5E3PA 3TO6A 2KCXA 2M5XA 1M8BA 3UGIA 2JA1A 1R0RI 3R5AA 1P9ZA 3UGDA 3FC3A 2DIPA 2SGFI 1TBQR 2E73A 1H0ZA 2GKVA 5FUWA 1S20A 2ODDA 2CJSC 4UXHA 1MJAA 3TO9A 1BMOA 3TJQA 1Y8FA 5E3RA 1K7VA 2RIJA 2SGQI 1SGQI 2BUSA 2N52A 2SGDI 2ENZA 3UEYA 1PTQA 1PPFI 1TBOA 3TOAA 1HPTA 2V1CC 1HEVA 2KMOA 9WGAA 1KMAA 2KMRA 2QQEA 3KY9A 2ORWA 1Z2IA 1WTJA 2WGCA 2K9HA 1PTRA 2J9RA 5EX0A 5J8CA 2JXDA 4B6DA 4DNCA 2NU4I 2V53A 3OXFA 1M8CA 4FKDA 4E1PA 1CT2I 1U5KA 1YTPA 3OVOA 1PJUA 1R79A 4L9MA 2OD1A 1ULKA 1TURA 2YUUA 1SGYI 2V1CA 2WVJA 3CXLA 5FUYA 2GKTI 3B4VC 3OXGA 2KMPA 2W0TA 1TBNA 3UOEA 1TBRR 1CHOI 2A20A 1HDLA 5DAEA 2P6AC 3PDNA 3GOXA 1RFHA 4UXIA 4UXJA 4A24A 2ORVA 1P9GA 1MT1A 3TOBA 1LR7A 1OMUA 2OVOA 3UGLA 5CCLA 2OU2A 2GIVA 1KBFA 2N71A 3R5CA 1CSOI 1OYVI 2NU3I 1MJBA 2ENNA 2X52A 1PCEA 2J87A 3D00A 3MEKA 1BUSA 1CT0I 1FY7A 2CWHA 1V1HA 1SGRI 3QTLD 2JZMA 1SGNI 3E59A 2QQCA 1TUSA 2PQ8A 3RU0A 4E1RA 1UHAA 4HGUA 1DS2I 3VDPA 2E5RA 2LEOA 2ROWA 2VRWB 5CCMA 2L8EA 2ARPF 1WKXA 3R5DA 2DKVA 1UVFA 5EX3A 5J8FA 3OXLA 4JCVE 2SGPI 3BJIA 1TOTA 1Y1BA 2QQ0A 2WCYA 3VE5A 1CGJI 3SEKC 3E2IA 3SGBI 2UZ3A 5E3QA 1Z7KB 2NU2I 1AN1I 1WGTA 1Y1CA 2QPOA 2XRCA 1OVOA 1IY6A 1WGCA 1FAQA 5FUVA 2DB6A 1LR8A 1W3SA 1SGPI 2X3TA 1X74A 1ULNA 2B8TA 1K7UA 2GKRI 2LB7A 1N13A 1LR9A 2LUYA 2SGEI 2NU0I 1X4SA 1Q9BA 1XX6A 2JYYA 2GVIA 4SGBI 3SGQI 4OVOA 4WP4A 2OZUA 2RC4A 2NU1I 1KBEA 2Y0MA 3OL0A 4GI3C 1CE3A 5HQ8A 1SGDI 1ULMA 2L7XA 1OMTA 1IY5A 2KMQA 3QWPA 3FSXA 2N1AB 3VDUA 1CT4I 1IW4A 1K7TA 7WGAA 3R5BA 1V1IA 1NXUA 1YU6C 1SGEI 2CWFA 1UVGA 1DS3I
chains in the Genus database with same CATH topology
2YQPA 5HI7A 2F3CI 1XA6A 2B0UC 2ELIA 3UEJA 2JW6A 1UUCA 3HH2C 1TGSI 2FNFX 1NUBA 5FUXA 5JHWC 1FYBA 1W4RA 1HJAI 1FARA 1XBTA 1TIHA 2QQDA 3UFFA 1CGII 1VDDA 2ERWA 2N17A 2KCXA 2M5XA 1M8BA 3UGIA 2JA1A 1R0RI 3UGDA 3FC3A 2DIPA 2SGFI 1TBQR 2E73A 1H0ZA 2GKVA 5FUWA 2ODDA 2CJSC 4UXHA 1BMOA 3TJQA 1Y8FA 2SGQI 1SGQI 2BUSA 2N52A 2SGDI 2ENZA 3UEYA 1PTQA 1PPFI 1TBOA 1HPTA 2V1CC 2KMOA 1KMAA 2KMRA 2QQEA 3KY9A 2ORWA 5EX0A 2K9HA 1PTRA 2J9RA 2JXDA 4B6DA 2NU4I 2V53A 3OXFA 1M8CA 4FKDA 4E1PA 1CT2I 1U5KA 1YTPA 3OVOA 1PJUA 1R79A 4L9MA 2OD1A 1TURA 2YUUA 1SGYI 2V1CA 2WVJA 3CXLA 5FUYA 2GKTI 3B4VC 3OXGA 2KMPA 2W0TA 1TBNA 1TBRR 2A20A 1CHOI 1HDLA 5DAEA 2P6AC 3PDNA 3GOXA 1RFHA 4UXIA 4UXJA 4A24A 2ORVA 1MT1A 1LR7A 1OMUA 2OVOA 3UGLA 5CCLA 1KBFA 2N71A 1CSOI 1OYVI 2NU3I 2ENNA 1PCEA 2J87A 3D00A 3MEKA 1BUSA 1CT0I 3QTLD 1V1HA 1SGRI 2JZMA 1SGNI 3E59A 2QQCA 1TUSA 3RU0A 4E1RA 4HGUA 1DS2I 3VDPA 2E5RA 2LEOA 2ROWA 2VRWB 5CCMA 2L8EA 2ARPF 5EX3A 1UVFA 3OXLA 4JCVE 2SGPI 3BJIA 1TOTA 1Y1BA 2QQ0A 2WCYA 3VE5A 1CGJI 3SEKC 3E2IA 3SGBI 2UZ3A 1Z7KB 2NU2I 1AN1I 1Y1CA 2QPOA 2XRCA 1OVOA 1IY6A 1FAQA 5FUVA 2DB6A 1LR8A 1W3SA 1SGPI 1X74A 2B8TA 2GKRI 1N13A 1LR9A 2LUYA 2SGEI 2NU0I 1X4SA 1XX6A 2JYYA 2GVIA 4SGBI 3SGQI 4OVOA 2NU1I 1KBEA 4GI3C 3OL0A 1CE3A 5HQ8A 1SGDI 2L7XA 1OMTA 1IY5A 2KMQA 3QWPA 2N1AB 3VDUA 1CT4I 1IW4A 1V1IA 1YU6C 1SGEI 1UVGA 1DS3I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OL0 A; 
#chains in the Genus database with same CATH topology
 2YQP A;  5HI7 A;  2F3C I;  4AML A;  1XA6 A;  2B0U C;  2ELI A;  2UVO A;  2CWG A;  2JW6 A;  3UEJ A;  1UUC A;  3HH2 C;  1MJ9 A;  1TGS I;  1NUB A;  2FNF X;  5FUX A;  3FSY A;  5JHW C;  1W4R A;  1FYB A;  1HJA I;  1FAR A;  1XBT A;  4MPI A;  3QAH A;  1TIH A;  2QQD A;  3TO7 A;  3UFF A;  1CGI I;  1VDD A;  2ERW A;  2N17 A;  5E3P A;  3TO6 A;  2KCX A;  2M5X A;  1M8B A;  3UGI A;  2JA1 A;  1R0R I;  3R5A A;  1P9Z A;  3UGD A;  3FC3 A;  2DIP A;  2SGF I;  1TBQ R;  2E73 A;  1H0Z A;  2GKV A;  5FUW A;  1S20 A;  2ODD A;  2CJS C;  4UXH A;  1MJA A;  3TO9 A;  1BMO A;  3TJQ A;  1Y8F A;  5E3R A;  1K7V A;  2RIJ A;  2SGQ I;  1SGQ I;  2BUS A;  2N52 A;  2SGD I;  2ENZ A;  3UEY A;  1PTQ A;  1PPF I;  1TBO A;  3TOA A;  1HPT A;  2V1C C;  1HEV A;  2KMO A;  9WGA A;  1KMA A;  2KMR A;  2QQE A;  3KY9 A;  2ORW A;  1Z2I A;  1WTJ A;  2WGC A;  2K9H A;  1PTR A;  2J9R A;  5EX0 A;  5J8C A;  2JXD A;  4B6D A;  4DNC A;  2NU4 I;  2V53 A;  3OXF A;  1M8C A;  4FKD A;  4E1P A;  1CT2 I;  1U5K A;  1YTP A;  3OVO A;  1PJU A;  1R79 A;  4L9M A;  2OD1 A;  1ULK A;  1TUR A;  2YUU A;  1SGY I;  2V1C A;  2WVJ A;  3CXL A;  5FUY A;  2GKT I;  3B4V C;  3OXG A;  2KMP A;  2W0T A;  1TBN A;  3UOE A;  1TBR R;  1CHO I;  2A20 A;  1HDL A;  5DAE A;  2P6A C;  3PDN A;  3GOX A;  1RFH A;  4UXI A;  4UXJ A;  4A24 A;  2ORV A;  1P9G A;  1MT1 A;  3TOB A;  1LR7 A;  1OMU A;  2OVO A;  3UGL A;  5CCL A;  2OU2 A;  2GIV A;  1KBF A;  2N71 A;  3R5C A;  1CSO I;  1OYV I;  2NU3 I;  1MJB A;  2ENN A;  2X52 A;  1PCE A;  2J87 A;  3D00 A;  3MEK A;  1BUS A;  1CT0 I;  1FY7 A;  2CWH A;  1V1H A;  1SGR I;  3QTL D;  2JZM A;  1SGN I;  3E59 A;  2QQC A;  1TUS A;  2PQ8 A;  3RU0 A;  4E1R A;  1UHA A;  4HGU A;  1DS2 I;  3VDP A;  2E5R A;  2LEO A;  2ROW A;  2VRW B;  5CCM A;  2L8E A;  2ARP F;  1WKX A;  3R5D A;  2DKV A;  1UVF A;  5EX3 A;  5J8F A;  3OXL A;  4JCV E;  2SGP I;  3BJI A;  1TOT A;  1Y1B A;  2QQ0 A;  2WCY A;  3VE5 A;  1CGJ I;  3SEK C;  3E2I A;  3SGB I;  2UZ3 A;  5E3Q A;  1Z7K B;  2NU2 I;  1AN1 I;  1WGT A;  1Y1C A;  2QPO A;  2XRC A;  1OVO A;  1IY6 A;  1WGC A;  1FAQ A;  5FUV A;  2DB6 A;  1LR8 A;  1W3S A;  1SGP I;  2X3T A;  1X74 A;  1ULN A;  2B8T A;  1K7U A;  2GKR I;  2LB7 A;  1N13 A;  1LR9 A;  2LUY A;  2SGE I;  2NU0 I;  1X4S A;  1Q9B A;  1XX6 A;  2JYY A;  2GVI A;  4SGB I;  3SGQ I;  4OVO A;  4WP4 A;  2OZU A;  2RC4 A;  2NU1 I;  1KBE A;  2Y0M A;  3OL0 A;  4GI3 C;  1CE3 A;  5HQ8 A;  1SGD I;  1ULM A;  2L7X A;  1OMT A;  1IY5 A;  2KMQ A;  3QWP A;  3FSX A;  2N1A B;  3VDU A;  1CT4 I;  1IW4 A;  1K7T A;  7WGA A;  3R5B A;  1V1I A;  1NXU A;  1YU6 C;  1SGE I;  2CWF A;  1UVG A;  1DS3 I; 
#chains in the Genus database with same CATH homology
 2YQP A;  5HI7 A;  2F3C I;  1XA6 A;  2B0U C;  2ELI A;  3UEJ A;  2JW6 A;  1UUC A;  3HH2 C;  1TGS I;  2FNF X;  1NUB A;  5FUX A;  5JHW C;  1FYB A;  1W4R A;  1HJA I;  1FAR A;  1XBT A;  1TIH A;  2QQD A;  3UFF A;  1CGI I;  1VDD A;  2ERW A;  2N17 A;  2KCX A;  2M5X A;  1M8B A;  3UGI A;  2JA1 A;  1R0R I;  3UGD A;  3FC3 A;  2DIP A;  2SGF I;  1TBQ R;  2E73 A;  1H0Z A;  2GKV A;  5FUW A;  2ODD A;  2CJS C;  4UXH A;  1BMO A;  3TJQ A;  1Y8F A;  2SGQ I;  1SGQ I;  2BUS A;  2N52 A;  2SGD I;  2ENZ A;  3UEY A;  1PTQ A;  1PPF I;  1TBO A;  1HPT A;  2V1C C;  2KMO A;  1KMA A;  2KMR A;  2QQE A;  3KY9 A;  2ORW A;  5EX0 A;  2K9H A;  1PTR A;  2J9R A;  2JXD A;  4B6D A;  2NU4 I;  2V53 A;  3OXF A;  1M8C A;  4FKD A;  4E1P A;  1CT2 I;  1U5K A;  1YTP A;  3OVO A;  1PJU A;  1R79 A;  4L9M A;  2OD1 A;  1TUR A;  2YUU A;  1SGY I;  2V1C A;  2WVJ A;  3CXL A;  5FUY A;  2GKT I;  3B4V C;  3OXG A;  2KMP A;  2W0T A;  1TBN A;  1TBR R;  2A20 A;  1CHO I;  1HDL A;  5DAE A;  2P6A C;  3PDN A;  3GOX A;  1RFH A;  4UXI A;  4UXJ A;  4A24 A;  2ORV A;  1MT1 A;  1LR7 A;  1OMU A;  2OVO A;  3UGL A;  5CCL A;  1KBF A;  2N71 A;  1CSO I;  1OYV I;  2NU3 I;  2ENN A;  1PCE A;  2J87 A;  3D00 A;  3MEK A;  1BUS A;  1CT0 I;  3QTL D;  1V1H A;  1SGR I;  2JZM A;  1SGN I;  3E59 A;  2QQC A;  1TUS A;  3RU0 A;  4E1R A;  4HGU A;  1DS2 I;  3VDP A;  2E5R A;  2LEO A;  2ROW A;  2VRW B;  5CCM A;  2L8E A;  2ARP F;  5EX3 A;  1UVF A;  3OXL A;  4JCV E;  2SGP I;  3BJI A;  1TOT A;  1Y1B A;  2QQ0 A;  2WCY A;  3VE5 A;  1CGJ I;  3SEK C;  3E2I A;  3SGB I;  2UZ3 A;  1Z7K B;  2NU2 I;  1AN1 I;  1Y1C A;  2QPO A;  2XRC A;  1OVO A;  1IY6 A;  1FAQ A;  5FUV A;  2DB6 A;  1LR8 A;  1W3S A;  1SGP I;  1X74 A;  2B8T A;  2GKR I;  1N13 A;  1LR9 A;  2LUY A;  2SGE I;  2NU0 I;  1X4S A;  1XX6 A;  2JYY A;  2GVI A;  4SGB I;  3SGQ I;  4OVO A;  2NU1 I;  1KBE A;  4GI3 C;  3OL0 A;  1CE3 A;  5HQ8 A;  1SGD I;  2L7X A;  1OMT A;  1IY5 A;  2KMQ A;  3QWP A;  2N1A B;  3VDU A;  1CT4 I;  1IW4 A;  1V1I A;  1YU6 C;  1SGE I;  1UVG A;  1DS3 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...