3OLQA

The crystal structure of a universal stress protein e from proteus mirabilis hi4320
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
306
Chain Sequence
EKYQNLLVVIDPNQDDQPALRRAVYIVQRNGGRIKAFLPVYDLSYDMTTLLSPDERNAMRKGVINQKTAWIKQQARYYLEAGIQIDIKVIWHNRPYEAIIEEVITDKHDLLIKMAHQHLGSLIFTPLDWQLLRKCPAPVWMVKDKEWPEYGTIVVAANLSNEESYHDALNLKLIELTNDLSHRIQKDPDVHLLSAYPVAPINIAIELPDFDPNLYNNALRGQHLIAMKELRQKFSIPEEKTHVKEGLPEQVIPQVCEELNAGIVVLGILGRTGLSAAFLGNTAEQLIDHIKCDLLAIKPDGFTCPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Universal stress protein E
publication title The crystal structure of a universal stress protein E from Proteus mirabilis HI4320
rcsb
source organism Proteus mirabilis
molecule tags Structural genomics, unknown function
total genus 100
structure length 306
sequence length 308
ec nomenclature
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00582 Usp Universal stress protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3olqA00
4R2JA 3CISA 3MT0A 4WY2A 3OLQA 3AB7A 5CB0A 4R2KA 3AB8A
chains in the Genus database with same CATH superfamily
4R8LA 5DN6A 4RZQA 5JCXA 3FNHA 2ONZA 3UEOA 1FZQA 1PNQA 3NHPA 4Q34A 4KG7A 1N2EA 2ODWA 3MGAA 1TTQB 2PZLA 4OHYA 4X6LA 4JYBA 3C16C 4MUFA 3QPDA 2JFNA 3A2LA 3UAWA 2APJA 3E84A 1V43A 1J00A 4U4AA 5FQNA 4C7OA 1O0CA 1IAVA 5LBTA 4HDOB 2BZSA 4DMRA 1NW7A 4L0QA 1QYVA 5LCXA 1XZNA 1RMTA 5DCWA 1OPRA 1E0DA 2I5PO 1JTVA 4E88A 4YUVA 5C18A 5AUPB 1KO1A 3K8YA 4KWCA 5TGTA 5A62A 2XOKD 4ZQHA 4AJKA 5J47A 1KRHA 2CJWB 2O2XA 3F9IA 3GJRA 4ZVUA 4RCVA 4FSDA 4N41A 1HDCA 5FOSA 1K98A 1XJCA 5I7FA 5DZSA 3Q2KA 2PKEA 5EY5B 3R0ZA 5TQ0B 1C2YA 3C4QA 2NN3C 1T1SA 3AFNA 1F5NA 4UHJA 3EIQA 1PUJA 3RT7A 3LT1A 2CNDA 4BCCA 3INGA 4BQSA 1YFZA 4B46A 4C0SA 2ZWAA 5K8TA 3PDHA 4E5KA 1CE8B 2V7GA 5CW2A 2PFGA 3UUWA 2QTAA 2IYTA 2JIOA 3O92A 1Y7IA 1DKRA 1B2RA 1SUEA 2Y6UA 3TGPA 5AM0A 3NDIA 4MGHA 5CGQB 2GBIA 1PLKA 3D6UA 1IIBA 1OKKD 3EXHA 3Q8MA 3EWIA 4QWMA 5E6UA 4QHSA 4TL7A 5LQAA 5COBA 1O8BA 3LG2A 4MUKA 1N0HA 2W6ID 4XWYA 4DVGA 4KOAA 4M1MA 1NVWQ 4EUSA 3TF5A 3Q3GE 3F2VA 4DV3B 4CF3A 4DPKA 3DD1A 5HIIA 3FOCA 4MV6A 1S2GA 3EDRA 4CLOB 1DU4A 5G0UA 4XGNA 4WCVA 4F2DA 3PRKE 2FSHA 1EA5A 1VL6A 1QJCA 4WASA 4JQYA 2I4RA 4QUHA 3ILVA 4P08A 4JX9A 4XB2A 1CKEA 1XYGA 4B3GA 5IDVA 4ALJA 2XI4A 4NCBA 1D1QA 3PC2A 1EGQA 1G3UA 3PZBA 2AUMA 2C4WA 4ND6A 1QCYA 3DMDA 1IZ8A 5F1KA 1DTWB 4AKTA 4CDNA 1NBHA 3IELA 3QBTA 2IYXA 2JAUA 3T94A 4GX0A 3AL0C 2IPXA 4MWGA 4YMTA 2ONYA 3P1JA 4N18A 3M49A 4JGGA 4N5MA 4UDXX 4HGQA 3WMFA 3WIUA 1ZNZA 2FWIA 2Q9BA 4TVSA 1IQRA 2JLBA 2ID4A 1K8ZB 3E22A 5IWAB 3CZ4A 1NVFA 1NRIA 2A1TR 4M1SA 4RMJA 2B0CA 4I5GA 3KXIA 3KO8A 4PWYA 4Q1VA 2OY0A 3Q0IA 3TQRA 3D3WA 4AKSA 4KR0A 5DGIA 5LA6A 2WU4A 3KPWA 3RU9A 5JRZA 3I09A 2O0JA 3BZBA 4QDZA 1EQUA 2UZAA 4N3CA 2GEDA 3HA5A 4HYYA 3RPEA 5AIBA 2HRQA 3OIUA 3B53X 2C98A 4GSKA 4FDVA 2Z83A 1B6RA 1E4VA 3N8NA 4R05A 3NHBA 1ISGA 1LX7A 2PUJA 1RWWA 1RQXA 5EHZA 1EHIA 1T0UA 2CBGA 2F67A 4FFPA 1NBAA 1XXLA 4FYVA 2F8MA 4ID9A 3FX2A 3K94A 3HUTA 1J4AA 1DAPA 1IG3A 3K9HA 1OFIA 3WI7A 621PA 5JUWA 1SUSA 2B99A 4MQEA 1DG1G 1W5EA 3NCHA 1TF5A 4FBMA 1MVNA 3L8GA 3QXHA 4NS1A 3R7DA 1S2NA 1IHXA 4IDEA 3W9BA 4UBJA 2AKYA 2OXTA 4BFCA 5CBKA 3WHLA 1B0PA 1AKYA 5LLTA 4CNBA 3ADDA 1WBDA 5COQA 1BMFA 2ECQA 3FWPA 3G89A 1HG0A 2HT6A 1F2DA 3F7MA 4V0MA 3U13A 3W7AA 3GR6A 3B1ZA 2QD4A 4O2BF 3LQQA 4KC0A 4Y2GA 2OB1A 2QQEA 5EMJA 4MPPA 3RK1A 5A5VA 3PVSA 5ICSA 4LJ7A 2QRZA 4QJ4A 3ITKA 1OBOA 2DCUA 1NXTA 2Z0MA 4YK7A 4R4JA 2Q28A 3DFUA 2F8SA 2GBGA 1WXEA 4ZO6A 5T5QA 1V2HE 2QRUA 4C2TA 1RTKA 1T0BA 2Y4NA 3DO5A 3E18A 1AQNA 4BMCA 3GBPA 2ZBDA 4WIAA 3WS7A 4S24A 1W4AA 1U1FA 1ST2A 3BD9A 4FFBA 1TU4A 3KU1A 4MS1A 4RK7A 1J22A 2PGAA 3GQBB 2PGIA 1J33A 4UCFA 1W44A 1LZKA 2OCGA 3W2TA 1NHGA 5MFZA 4EDHA 3WJ2A 3CJQA 4AI6A 2YWRA 1QWSA 2FTKE 4YX9A 3COWA 1AS0A 1NN3A 2D4HA 3SM9A 3SYLA 1N2GA 2Q9CA 4MYUA 2Q9UA 4TTVA 5IMBA 4D9KA 4J1TA 5DHUA 4K6KA 2Z8YA 1JI0A 1RHKA 2ACEA 2DQKA 2FHSA 2HEIA 1QIFA 2IVZA 3AZPA 5E2BA 1ML3A 3ZQJA 4WK6A 5B4VA 2IC5A 1KQPA 4YJ3A 3KSMA 1JWBB 4EJ2A 4LXYA 1RLUA 3IMKA 3HKEB 1KAEA 2C1ZA 1PG0A 4GLFA 4DY4A 4L5CA 3R3VA 4R0MA 3ZCSA 1E89A 2EU8A 2I2WA 5KVQA 3KSZO 1T3HA 1I80A 1MC1A 2VHUA 3HBMA 4G1VA 4LOIA 5FUWA 4E1BA 1L5QA 1XYYA 2Q2QA 3UJ6A 1RCUA 1JIJA 2JFYA 4IX1A 4WY5A 3E7DA 4TKUA 1JZTA 3G2NA 3FN4A 4XR4A 3BE5A 4U5QA 2V8OA 4BKPA 1SO8A 2GM9A 3ASYA 1GZUA 3L79A 3SLKA 3ZWKA 4FB4A 1BRTA 4ZT5A 3D4BA 4CRWB 2C03A 3GNQA 1W4ZA 4ZFNA 5EIEA 1SHTX 3Q8KA 3EQ7A 5BSRA 4UOZA 3R5FA 1XCJA 2I03A 4DB4A 4AJNA 1Z07A 1UOOA 1D2NA 4ETIA 1WDMA 3V1TC 1SHUX 3ZJVA 2ODBA 3OT4A 5IM5A 5HVNA 3HJRA 2VXCA 4DQ0A 4HY3A 3OUUA 3S44A 4OO3A 1V1RB 3CWCA 3PD7A 2O1WA 3FWNA 2WABA 4L73A 4P36A 2H3EA 3E3MA 3H5IA 3EXIB 1VYTA 2TMGA 4ZVQA 3K9CA 1ZD3A 5A05A 3H1TA 1MG5A 3D02A 1AO3A 3UT0A 1UM9B 2JGKA 2ZSBA 1GRVA 3TTTA 2R8BA 2PX6A 3ADCA 1U90A 5LYJB 1QP4A 2PX0A 4RLHA 4D0SA 1X7WA 4RENA 1CV2A 5BN5A 1VLQA 2OUKA 4QAJA 1GPJA 2VDNB 1CC1S 1PYGA 5B7QA 2ZRDA 3NALA 4XOUA 1TL7C 5EVJA 2VYVA 2V7QD 1UP7A 3OZBA 2HJWA 1D6JA 3VPCA 1X8XA 4G86A 4F38A 1P0IA 3W2IA 4OQ4A 3VKVA 4IPTA 1PX2A 3EC7A 5G0VA 3EVBA 1TTPB 2H4FA 2CHGA 2JGMA 3QHAA 4LNHA 4LNUA 2WWFA 4XJXA 2RGYA 4CLEA 1H22A 2C61A 1QRUA 2FOXA 2HNKA 4Q9KA 5LNK1 2ADMA 3CIFA 3PPWA 3QFRA 4HB3A 4B3MB 2IS6A 3EUAA 1X1SA 1Z6QA 5ALNA 1Q6ZA 4EPWA 1D9XA 4EG8A 1SXHA 1OLXB 1FS4A 3VSCA 5TV2A 3ZWMA 1MIOB 1PVDA 2JPDA 3TMYA 4DV7B 3FNGA 4AW9A 1G8FA 1XVUA 3KOYA 2P6UA 1BMDA 2B36A 3LBHA 4MR8A 2E48A 1KVUA 2D0IA 4FDLA 4L8LA 3WYNA 4NR0A 2EYQA 3GC6A 1BXRB 3TI7A 1NAHA 2ODEA 3KKLA 5KYTA 3HNRA 2B7LA 3OF5A 1E9CA 2REOA 1KFBB 4L15A 3WWEA 3LK6A 1WPQA 2HMAA 4PZPA 3G0HA 4ZCLA 1CQXA 3B36A 5TJ9A 1ESEA 1DEOA 5IHXA 3UAZA 4NP6A 1DEAA 1JGTA 1TC2A 1Y80A 2JLXA 4W1PA 5EE9A 3ZD8A 3VV3A 5C51B 5LQCA 4WJLA 3O4IA 3ZK9A 2WKPA 2D7DA 4KO2S 3HEMA 4M1QA 5CLIA 5AKEA 4KMOA 2FWRA 4TROA 4V0ME 3ESAA 5DLPA 5HTKA 2VJMB 4B2YA 1WXFA 1VIMA 5LP1A 2FR8C 2H8GA 3UFXB 3H11A 3ZOKA 1KP9A 1FMCA 3C1TA 3FLAA 3BA6A 1QUEA 1XUOA 3QVGB 4L7VA 4E51A 5CDTA 3D7MA 1MRNA 2XVAA 1EFAA 4KUEA 3EF0A 3JD0A 3KR2A 4YDSA 2X4LA 3KZVA 3W3ZB 4J43A 3CUUA 3LA6A 2HRRA 3B52X 4BWYA 3C5HA 1NMYA 5IP5A 1I5RA 1SCQA 1Y63A 5BQXA 3SE0A 3NGMA 1GQOA 2PXCA 2FK8A 1WCIB 4Z3DA 1GR0A 5DCYA 2EC5A 5EEGA 3T7AA 4RTQA 5J2UA 1I1NA 3MMNA 4URHA 4RC9A 1K0UA 4Q4HB 3ADPA 1W88B 2N1BA 2XUZA 2VDKB 5BN1A 1U3TA 2F8TA 4OQZA 1YVPA 5EE3A 1ML4A 1T3TA 3NWBA 2BEWB 4EZIA 3SWWA 5T41A 5CAEB 4TL9A 1ODCA 1S2IA 4WE3A 3N75A 5TPWB 3V9AA 2W7TA 3Q87B 3RNLA 1IJEA 2NTYC 2ZJ7A 1BWSA 2ZANA 3IV7A 2RHLA 3GH3A 1ZJZA 2GB4A 2NPIA 2P5SA 5CB4B 3R6GA 4HWOA 3C5CA 1EWYA 4XGQA 5E1MA 3STUA 4BPRA 2UUAB 1JJFA 3AHCA 3JAMA 1OT3A 2IPLA 1ZKDA 3PFFA 2HV8A 4JQSA 3WK7A 1F1JA 4PAMA 3OTQA 3PYXA 4CCSA 1LPOA 1P18A 4ER0A 2VR1A 3LBYA 1JHZA 3IP6A 2CFSA 1GNLA 1P1FA 3ZNQA 4QM6A 3LQRA 3UB4A 1TM3E 4M0MA 5CYGA 4OXQA 3GFQA 2AWOA 3O47A 1ISHA 2PMBA 3TW0A 4Z4EA 3OFSA 4WZBA 4I1PA 1YB6A 1NXWA 2WUGA 4MWEA 1VDMA 4JLOA 3R0JA 3KOMA 3QWBA 4V2UA 5DTEA 4HT3B 4B4DA 2Y1CA 3CW8X 2CGEA 2VBFA 3ONFA 1JQ3A 3OJLA 4ALIA 4PZ9A 3DZKA 3PDIB 4DIEA 2FB9A 4LYEA 4WESB 3QF4B 3CURA 3PGA1 1MVOA 5KYUA 1SBQA 2OHJA 1M7GA 2VPIA 3FTDA 4C7VA 5LLDA 4JXZA 2GLTA 1RKVA 2ZVDA 3AF3A 2P6OA 3A4TA 3V1NA 4BNDA 2IY8A 1GPBA 2GYYA 4CIXA 1XF1A 4IAOA 1SVOA 3IEXA 4GXNA 2CJPA 3T8YA 1VLZA 1IG0A 1XHEA 3G88A 4YC7A 5DT9A 1UJNA 3JD4A 3FSJX 2QX7A 1I3LA 4J1TC 4WLOA 1QRTA 3C6XA 3OEHA 1RWKA 1NT4A 2ORYA 3FD8A 5ERGB 4CKCA 5HUJA 5TQ2A 3UWDA 3UXYA 1F2UA 1WXDA 3W8RA 3BORA 3V33A 4KFSA 3DL0A 3R40A 5LBIA 1DBSA 1QIDA 2EX0A 2BFNA 3PDWA 1QRDA 5IARA 1P5ZB 1QF9A 3FI0A 4NY1A 3TOSA 5KWVA 3KVRA 5EUQB 2GUGA 3WHPA 5F7OA 2PFKA 3ZU6A 4O3FA 2G5PA 3BICA 1X7YA 1GAXA 4MQFA 2MU1A 4FS3A 4MIOA 1GFSA 1W0CA 3QKRA 5BW8A 1H3EA 1FUUA 3EF3A 1SXJA 2Y8EA 4HYEA 4ZTUB 1ZQ9A 3IODA 2GCEA 4IIFA 1GUAA 3DNMA 3IB6A 1ECPA 3MUEA 1DVRA 4YVFA 1WDWB 2YBEA 2NQTA 3DDWA 3AC0A 1D2GA 3EDQA 4WKNA 2V03A 2G36A 3N6XA 1TQHA 1GEGA 1BHSA 3S70A 3TSWA 5JFTA 2BTQA 2LNDA 2ZKIA 2HHHB 3PC8A 5GJCA 4HQ6A 2WFLA 3DC7A 3VPDA 3H8WA 1YB1A 1XN4A 2DPGA 3DPSA 4HH3C 1GPKA 4QU0A 4ZVNA 1LKZA 3U60B 3V00A 2X6TA 1CWUA 1G8SA 2OBNA 2TSYB 2GN9A 3ETJA 3V97A 4OLAA 2W90A 3R7FA 2YJ5A 4KJXA 2GBPA 1T1RA 2OSVA 1P6UA 3V4ZA 2V5UA 1UJ5A 3MZ0A 1LV7A 4L4UA 4DSAA 1DPFA 2BGIA 5K4GA 2F59A 5IRCD 3SHWA 4HEA1 4KFTA 2JANA 3LYHA 3TLJA 3OHSX 1WOYA 2WVJA 5WRFA 2ZAIA 1HRDA 3ZX4A 1VRWA 4TUYB 3THYB 3WL4A 1TE2A 1WQ4A 2WHYA 3UK1A 1CJSA 1X94A 2G28A 2CDRA 3S55A 1NE7A 1ZNQO 2C59A 2EKPA 3L4EA 3NHSA 4WK4B 2OM2A 1BN6A 3E9EA 3MJRA 3Q6NA 3FOFC 4FGZA 1JR3A 1BU8A 2H57A 5J4KA 3N8HA 3MT9A 1HYBA 1YZKA 2RSLA 2WF6A 3E2IA 2Z5VA 3GD5A 1PK7A 1WUKS 4GXRA 1J7KA 1E2HA 3M1AA 3WGOA 2WU1A 4MVCA 3BMOB 4EWLA 4O4JB 1Z5WA 5CH3A 3NBKA 3AW9A 4EB6B 3K6KA 3VU9B 4NENB 4AZTA 4BDTA 3EZGA 1ZFNA 3PITA 1VJ0A 2ANCA 5E8RA 3G2KA 4DV2B 1W5TA 1L4NA 3RRMA 5L3QA 5J9FA 1RCTE 5LOVF 2DWPA 5CDFE 2F1JA 1BX1A 3HFSA 3DCYA 1KFKB 1PBTA 5KREA 2C2GA 5LJLA 3AHDA 3MCVA 1XALA 2AR7A 4FOLA 2ES4A 4XASA 5G41A 3PPVA 4W8HA 1ENPA 4RV5A 3VYWA 4BO5A 1U9ZA 5TMDA 1OYOA 4MIKA 2AHOA 2DFTA 1E2GA 5FOQA 1K5PA 4OJKA 2IYVA 2AJLI 2GN6A 3AEKB 3C41J 4KK3A 3MJDA 4LJ8A 5EMMA 4BNGA 3ABZA 4W5JA 9LDTA 2BCGY 3FLBA 1ULAA 1JT2A 4BX2A 2CV1A 2PUAA 2FPOA 4C7OB 2PD6A 4MV5A 3LYAA 1P77A 4RY2A 1RKBA 1O94C 3X1YA 4EFMA 1SGWA 4M1KA 1WUYA 4A27A 2C3OA 2RKOA 2BEKA 4H7FA 3M7IA 4WKBA 3BMNB 4B48A 5LFAA 3BDAA 4B0OA 2C94A 1H0SA 3LZCA 1TIPA 3OZVA 3GEEA 2QLJA 3EQ8A 4GMHA 3ZS9A 3DL4A 2W43A 4I9GA 1CVLA 5JNVA 3M9WA 4WZBE 2XLBA 3A11A 1BEUB 1GJRA 2CNKA 1BVHA 1TEHA 2C5HA 2GCIA 4HQKA 4ZEWA 2IV7A 4C78A 4CUKA 4E0BA 4PSAA 5AXAA 2JJQA 1FFSA 5EQFA 4OXRA 3LVQE 2CCJA 4ZZ0A 4NONA 1FDOA 2VYFA 4E15A 5KKNB 4NZPA 1CJMA 4XKJA 4J0JA 3W8NA 2W2OA 4TLLB 2PT5A 1K86A 2AKEA 1I4LD 5SICE 2H1HA 3HWX1 3Q40A 1Y1PA 4H16A 4QAQA 1GZ4A 1R0KA 3EXHB 3FRIA 3PX3A 2Z09A 4HF7A 4BGUA 4MO2A 1CB0A 1EBUA 4RHUA 4JZKA 3U1TA 1TZKA 1ZRNA 1PL0A 4UKDA 4NFSA 2HJHA 1TUGA 3T54A 3WJ1A 1Z34A 4F71A 4ERNA 5FAKA 3HY4A 4N3NA 3EBPA 1USGA 2H9YA 4MYCA 3GUHA 1W5BA 3DOIA 1P0CA 1OA0A 3TVYA 1Q0SA 2XA1A 1PEDA 1AE1A 1BKDR 1FRVA 1P2VA 2A5JA 4R6WA 4AJ1A 1NJ1A 1RZUA 4KKVA 5B6JA 5HRCA 1CRWG 4OQYA 2HQOA 1D8AA 2O7QA 4G4IA 4MA0A 4P92A 3GLGA 1AU9A 2IZ0A 3EZXA 4BB0A 3AHHA 3T3DA 2X4GA 1QPBA 3A1VA 1JYEA 1R64A 3ZDBA 2VK1A 3QVLA 3FY4A 4O6VA 2CLKB 3TIFA 1M7HA 3BKWA 3FNRA 3RF6A 1EI9A 2QMUA 1BW9B 4OLHA 1UADA 2CF5A 1RI2A 1LS1A 2FQQA 2W6JA 4E07A 5LIPA 1KZ6A 1W6RA 2AOVA 2BKAA 3AU8A 2B61A 3GK3A 3BXFA 3GYBA 3WLKX 2RK3A 2RD2A 4AIRA 2C88A 4EY3A 2IHUA 4P4LA 2F7SA 2Q6KA 2KBEA 4A3SA 3SBEA 5DBHX 4FOSA 2CXQA 5DK6A 3ED5A 5JD4A 4CQMA 2A0UA 2CXXA 2GZ3A 4UC0A 3EEFA 1LVHA 5AW9A 3U37A 1VDZA 2X0FA 2FSVA 3E82A 3D6TB 3MTAA 4N1AA 3EPPA 1U0GA 3OJXA 1OUMA 3H2KA 2HBYA 1GPNA 2ZIEA 4E4TA 3JW8A 1X9GA 4IDHA 2B7BA 1PNTA 4BVLA 4KPFC 1C7JA 4JBLA 3LXRA 2YRFA 3I61A 1GD1O 4MQEB 4NPHA 1G3RA 2WYWA 4FHGA 1KJNA 2WKWA 3PWZA 5CCDA 2DEUA 4DB2A 4YAKA 1ZQ1A 3U09A 2AB0A 1MUUA 5CT6A 5KOIA 3GA0A 5GADl 3AVQA 5HPYB 4TVBA 2BMVA 3WLQA 4BNTA 2XWJI 5CFPA 9MHTA 4HUQB 3PI6A 2II6A 1ZIYA 4YB8A 4HKTA 2XB4A 1M6VB 3D6HA 3T5MA 2J0EA 5IXJA 3X0DA 3KKEA 4KSCA 2OCLA 1YJAA 4FJ0A 1WY5A 5B64A 3QU5A 1FSPA 1JDTA 2GBLA 4WLFA 2XTZA 3M9LA 2CBZA 4BIIA 5JS7A 1CETA 3DZHA 3RSSA 3HZRA 4QX6A 3NHMA 4ADSG 2HW8A 1ZH6A 1E4OA 3E03A 1T1GA 3PQEA 1PFGA 4HEHA 3D1JA 1BXGA 1W2WB 4OJYA 1SXJC 3M4JA 4YHHB 2DX7A 2BGRA 1VKHA 3LCMA 4FFBB 4MS1B 5B6PA 1VXOA 2NO9A 4RNCA 1XRPA 5HUHA 1KJYA 4X92A 3RIYA 3BWYA 3WBKA 5HKKA 1HEUA 1YI0A 1N5RA 2D62A 2BP7A 2REBA 4IXDA 2QNBA 2XMQA 1T0JB 1ZM4A 2ZKLA 2HFJA 1H94A 2L2QA 3O95A 1YA8A 4QYXA 1IK6A 5FLXA 4RF4A 1N6NA 2HRBA 1BS1A 1W0KD 1ZH0A 4MVJE 5E3JA 2L0XA 2ATVA 2X5XA 2QLLA 1NATA 3N0XA 3RF7A 2PZMA 3RRXA 3ZHZA 2AYYA 4BCBA 3TOVA 2VJYA 5JZ9A 2PUBA 4A6EA 1YR6A 2HDHA 3OJOA 4GX5A 2Z1NA 4YRCA 4Z2AA 1FFGA 1C4XA 1G7TA 2PQ0A 3U7HB 2VBGA 4PSUA 1JDZA 1PDWA 4Y1RB 4YCNA 2YHUA 2H1SA 3JRNA 4UMDA 5K3DA 4RELA 3HVUA 3D6VA 3ZQKA 3H86A 4D43A 4IZ6A 3NYWA 4LF4B 1H0KA 3KZCA 3NONA 3D8UA 2QVCA 3NOOA 2Y3IA 2BONA 3H2SA 1H2YA 3J81A 2DTEA 3KWFA 1Z2OX 4FZJA 4TKUB 4KTTE 1X9HA 2VF2A 1ZO8A 1W94A 1HMYA 2M9MA 2XA2A 3FWYA 1FTYA 1P1IA 1J9EA 2H4JA 2XB9A 3EGDA 4Q19A 4V24A 3FPFA 4DIOA 3IJRA 4G2NA 2EFHB 1ONPA 1W52X 1JJVA 4V0KA 4IUYA 4QYIA 5BSWA 3BL8A 3DMNA 1JXOA 1YL6A 2WYVA 1U0TA 2C2MA 2QENA 5FXMA 3TLCA 4QVIA 1RDFA 1N4AA 1M0EA 1AHIA 1KEZA 1M2JA 1KJJA 2EZ9A 1B6SA 4Y0VA 2WD9A 2JK1A 1RXUA 4IDFA 3W04A 3U56A 1NP3A 1T2DA 4QBKA 2C8JA 4PYIA 5F21A 1DDOA 1Z0UA 4JJAA 3CT6A 4OYRA 1YRAA 1M76A 4NOKA 2OXRA 3KDPA 2HCJB 1UKVY 3OOSA 3VC7A 2OV8A 2I6GA 3WP0A 3BK1A 2CDAA 1GYRA 3K4QA 4WLEA 1JHUA 1WUIS 2VRCD 4IKOA 4PRLA 3W5UA 4ZYLA 3GLGE 4NU5A 5JU6A 4PZ0A 2VATA 2IH5A 2JCYA 4LS3A 5CLJA 2VXBA 4FZRA 1XNHA 5LXTF 1Q17A 3KAJA 1G6Q1 4DCVA 3IEUA 5BRJA 1VSTA 3NEYA 4C29A 3INNA 1JQDA 4XSVA 5E4FA 4DF3A 2GO1A 1YU6A 3WLHA 1NQOA 2AYZA 4LNUB 3WIBA 4BU1A 1YTUA 1Y8ZA 1UPTA 3ELWA 4L75A 1B1AA 1H4TA 1MENA 4IDPA 3LCVB 3BXOA 1G5IA 4QWWA 4U7HA 2WQ7A 2V9CA 3MNFA 3GLQA 3B9QA 2VAVA 3HXLA 4GPBA 2R5NA 4HQRA 4Q16A 2HJVA 2SBTA 3KKOA 1WPXA 1RAFA 1USVA 1GTVA 3MAJA 1GL7A 1UBLS 2AC4A 3HZOA 3OPVA 1O6BA 1TKBA 1KARA 4AMUA 5JSFA 1JQKA 4B3TB 4EATA 2JFPA 3SQXA 4W5TA 1RQGA 4A1OA 3I9OA 3P0JA 1Z6AA 3WRWA 3TAHA 4Q4JA 3IAXA 2JZCA 1IUKA 4CHTA 1IY2A 4JCCA 4F2PA 5ADWA 4WUVA 5JNTA 4WADA 5DX0A 2ONJA 4G5YA 2WUFA 2GJ9A 2IPNA 2WTNA 3CEHA 1LI4A 4E14A 4DADA 1J97A 1V5EA 4GPIB 5JHHB 4EW1A 1M5RA 5C7LO 4BQIA 4AT1A 1WX1A 5CCBA 3TTXA 3EFEA 1Z7EA 3UQYS 2IUFA 1C3XA 4G8CA 4M1TA 4UCWA 2LBPA 3C1UA 1W76A 5I9SA 2DFPA 3BSFA 1AUVA 3F73A 2DLDA 3ND5A 2JASA 1NQTA 4JMLA 3SX4A 1Z7YA 4BTVA 5HFNA 1QKJA 4CEJA 1E66A 4L07A 3H1AA 3EUWA 1H1TA 4P7BA 1FQWA 5ANRB 3LOPA 3AUAA 3V1MA 5SYAA 2ZZNA 4D1YA 3WGQA 5LNK6 3SKXA 3QBDA 3I01A 3FPLA 4JXXA 2BEUA 3PT9A 4UHEA 2X9VA 4HMOA 3IHWA 1EVZA 1Z3CA 3LBNA 5J2UB 1ST3A 3CNBA 3SZOA 4B0PA 2OO5A 2YQZA 2RKWA 3AETA 1GSOA 3GFFA 4FFRA 3ZZUA 2Z6UA 4P4TA 1P2BA 1HBJA 1NE2A 3B51X 1U0RA 1J0BA 4DMHA 3RR2A 3I6ZA 1UJMA 1HUQA 4DLTA 4J0IA 1K5DA 3LHSA 2B6NA 1R2QA 1N1GA 4HDAA 2BTOA 2Q1SA 4LK2A 3V6LA 1Z7BA 2O07A 3T5CA 3WRXC 4GECA 1YJCA 4MVXA 3E0QA 4QC2A 4PIVA 1L5HA 4FCWA 5A1JA 4CLRA 5IJ0B 1FUKA 4EAAA 1V9SA 3TSOA 5AKXA 4X7MA 1G59A 1NG1A 4G1EB 3O26A 4JI2B 2V0CA 4WFJA 4AL4A 5JFOA 2DFVA 5ECGC 5HIMA 1W85A 3AR3A 1ZJJA 3V2HA 5DTQA 3DBVO 4GR5A 1RR6A 5ENVA 4I66A 1Q0UA 1T25A 4Q1CA 4XSHA 3ZHOA 1YUBA 4D8UA 2IPOA 2ESRA 4MVJM 1UBJS 3F8TA 1U0JA 3IAM1 4LMRA 2QMQA 5AKIA 5KDLA 1Q6YA 3W79A 1I5EA 4B3XA 3VR3D 5JYBA 2BOVA 1UEIA 5A4MS 3K6SA 2GNOA 2IYFA 2GAAA 4KE7A 3TTUA 2AI2A 3UCXA 4XGIA 1NSFA 2FEOA 2RMKA 4MVJH 3CRMA 3GXBA 1Q0RA 3ZDFA 4FC7A 3VR0A 3GMIA 4WZBB 4WI1A 4DKXA 3LGAA 3HXMA 1HK7A 1OC2A 4KMSA 1OR8A 4KPGA 2FOIA 3I12A 4UCQA 4WAUA 3ZQ6A 2ZRFA 2F3UA 2K4MA 3RIXA 5BUSA 5BSHA 3PIIA 2N0SA 3GPLA 1Q0HA 4U8HA 3HUEA 1LLUA 1RIFA 1XDWA 2PGOA 4FGWA 1UJCA 4DV6B 2GPTA 5DP2A 2RBEA 1XKLA 2EP8A 1K27A 2EFYA 4RK1A 1VG9B 2FAXA 3GT3A 5AHWA 5I3ZA 1DQSA 2J0UB 4YAOA 4F0JA 4ARIA 3IQZA 5HEKA 3A58B 5BVGA 5JAUA 1XD2B 4J0FA 3R23A 1NVUQ 1QIJA 2WVHA 3MWYW 5ENDA 3IAFA 1ULHA 3ZDXB 3AHJA 4LPSA 4HDKA 1QK5A 4Q4DA 5JNWA 3AWIA 4YEDA 1Y6QA 1CUYA 4BNDB 3VKFA 2ZRKA 2VOEA 4PC6A 3OFKA 5IDYA 4A8HA 1LSJA 4JC8A 1LTHR 1TYCA 3L9WA 3PFHA 1I10A 3MUOA 4G8BA 2C7BA 2JHPA 4U2CA 3UTCA 1QH1A 2J3MA 4PG4A 4XD7A 4EJSB 4GXQA 4JDPA 1TZJA 3AR6A 4JSRA 4Q3LA 4AO8A 4CKCB 1V5WA 5IF3A 4DNXA 3I9NA 1O57A 4Y98A 1F2UB 2AE2A 2H1LA 4DJJA 3A9RA 3RT1A 1MLDA 5FPYA 5D3MA 4TT3A 2WHPA 3W3AD 2JCVA 5CH5A 4YJFA 3LY9A 3SEFA 2C3PA 2M6RA 3OZ7A 1ZU4A 3M5DA 3SGLA 5DM70 2P4SA 4YMUA 1DPGA 4KXMA 1WXQA 1JMVA 3ORSA 2JI6A 1PR9A 4M0EA 3KHTA 3CE6A 3ROGA 3PBKA 4X1KA 3TR5A 2GPNA 4ZHQB 2FSIA 3OQMA 1CY8A 1NXXA 2RC6A 3QXGA 4GZ5A 1QHYA 3VKGA 3NAZA 1JPNA 2G4VA 3C48A 2BTQB 2BFEA 3BMQA 1M9NA 4H1HA 3ZZNA 3DWGA 1KKMA 2WFLB 2X2PA 5GJWC 3SYMA 1X15A 1R0XA 2H08A 1KJZA 2OBMA 3IP5A 3G23A 2G72A 1RI1A 1XQXA 1ZN7A 1NQWA 2PV0A 4J0KA 2HHAA 3TNFA 1I2MA 3C7KA 3BE4A 5HOEA 4GO1A 4J2OA 2I4IA 2LE0A 2KWIA 4W7HA 4N39A 3IBCA 2VJQA 3KEFA 2VG8A 5J4YA 1OLUB 1VE1A 1EWKA 3AEUB 3CBQA 3OZRA 4UM8B 3T99A 1EM8A 4G5FA 1XMOB 3B9BA 1KO4A 2VA9A 1JKFA 1FU7A 1UZUA 1ZK2A 4DLUA 3EG5A 3RIGA 2O1EA 3UY4A 4DIFA 3ELDA 5DIFA 5ALKA 4QSHA 1Q50A 4NC9A 3L8FA 3PRJA 1MX9A 4PO3X 1G60A 1SRRA 1GU0A 4FFDA 5H4HA 3TQFA 4ECAA 4L2IA 2XD9A 1MVLA 1LPPA 2J4CA 3IRVA 4ZT7A 1MNAA 3KP1A 3HJTA 3KJIA 4I1UA 1VIYA 5ERYA 1WB9A 1S9DA 4TGLA 1GWNA 4X95A 2RAUA 1GTL1 3DMFA 2HN9A 3THXB 2WKSA 4OJMX 3D3QA 3IP3A 3DE7X 1ZGJA 4HDMA 3AF5A 1JX6A 2YWJA 2P5YA 1UAYA 3FCAA 3E58A 3IERA 3GEPA 3NIBA 4ZCPA 3T7EA 4Z9AA 1Z22A 4MJXA 4Z9FA 5ILOA 2Y92A 2DRIA 1JJBA 1JHXA 4AJ4A 2RGXA 3M4XA 2B94A 4BBPA 3X1KA 3H5VA 1ECBA 5JMWA 1XKTA 3O1JC 1WPRA 4AWBA 4U3JA 2J6BA 1CQPA 4G81A 3JWIA 1NOJA 2YYAA 4N8DA 2ZSJA 5JCOA 2D2VA 2GCOA 3KEGA 4GI5A 4RIFA 3SJCA 1NX6A 1MPXA 2G9QA 4TLAA 3QEOA 3L6EA 2IY9A 1KOFA 2J5RA 2D5AA 3PXCX 2B8EA 3JQ8B 1T8PA 2B1RA 4HEA6 4NQZA 2A4KA 2ERXA 4PN7A 1VJRA 2PKYX 4FFVA 4ZQIA 4B9EA 1SEPA 5JASA 3GLFA 1Q83A 4R1PA 2O52A 2IL1A 1GZ3A 2AZDA 3TFQA 2VKTA 2VP6A 3T1NA 5A3SA 2CNNA 1C7IA 3GGOA 4CQLB 3L0BA 1CIVA 2DUJA 3C3DA 1R5OA 5KYWA 3TOZA 2AW3A 1L4UA 1N5OX 1W49A 2IQIA 3N2IA 3ZZ1A 1QR2A 4L5JA 1KMQA 1AHNA 4RM3A 1JR6A 1SVMA 2H6EA 2QIPA 4G5RA 4TMVA 1GTJ1 1JJ7A 1TQ4A 3DAPA 3CWQA 4P5PA 4PS1A 1SQGA 5IW8A 3RV4A 3ES9A 4J6FA 4EKGA 3OOEA 1U5AA 1NF9A 1RP1A 1P60A 5IEJA 1N57A 4RNDB 5FP0A 1U02A 1MNQA 4LOJA 3QOXA 3HR8A 3GBSA 3AF4A 1J0DA 3HWSA 1H2ZA 2VHXA 1WW2A 2PA0A 1E79D 1GRNA 1FNSA 3H18A 1PL8A 1P29A 4INAA 2E4AA 1QAMA 4F5ZA 5BYJA 3L7BA 3THWA 1WO8A 2OBLA 2OLKA 3BSWA 4ED9A 1FZTA 4TQ9A 1WZUA 3IQEA 2QU8A 3SVLA 4AC9A 2B5VA 1JWAB 3DEKA 1XIVA 1TECE 3G6WA 2Q21A 1ZW1A 1F4LA 4BDSA 1XZLA 1LBHA 4O08A 5JE8A 4BPBA 1OW3B 1RQ2A 1AUOA 2OHOA 1NDUA 4DIKA 4LZAA 4ME6A 4LUCA 3P0HA 2JGRA 1E8NA 1O1YA 3PQ3A 2NZ2A 2QR3A 4PYRA 3TR6A 4CM3A 1Q7BA 3ENKA 3RTDA 4MQLA 1NG9A 1M1ZA 1N2SA 2QW8A 2Z30A 5FFMA 4Y1FA 3GLGB 3ZNNA 3M34A 5CR9A 2P77A 5JAZA 3WAGA 1XL1A 1WP4A 1J1IA 2ORIA 2ANBA 4IINA 5BRAA 1B00A 3FHJA 4J9VA 1CZLA 1Q11A 3FFBA 1E96A 3GGSA 1CW2B 1HFJA 3P9RA 4GOMD 2AD5A 2V98A 5F2KA 5A02A 2QGNA 3EGIA 3JQ9A 3CUKA 3MBIA 5G0TA 2HA3A 4DR7B 2C9CA 3B1FA 3DMGA 4RIGA 1T2FA 5TS2A 1AGRA 4EPRA 2M98A 3MOSA 2MWMA 2XNKA 2WSSD 1Q7CA 2X8JB 4X54A 3C0KA 4XDHA 4ESOA 2HXYA 1P81A 3WWOA 3FHOA 1YRWA 1TCCA 2GLUA 3EUEA 4JJ4A 2XIJA 5E4TA 4UDYX 2GGSA 3IVCA 3AUUA 1N0IA 4N76A 3UT5A 2VJBA 3ABRB 4X8LA 2IDMA 1BWPA 2PD4A 1E2JA 1EUCA 5BMVF 3VISA 1YKFA 4YP6A 1FA9A 3NWEA 5FI1B 2OORC 4R41A 1SKBA 4OGGA 1LTQA 1TEZA 1NQVA 2Y0CA 4AULA 3WZLA 1GNVA 3C7AA 4XX1A 3O8OA 4IS3A 1DIAA 2MMGA 2QY6A 2XUPA 1GR1A 1NFQA 4UVIA 5E9QA 3KYJB 3ORRA 1XVIA 1EFVB 1O4VA 3N3AC 1UQRA 4C7BA 1P2SA 3I1JA 3TM4A 4M1ZA 3HABA 1R18A 3GP3A 5DWDA 5JARA 4OHBA 1KXZA 5A0TA 5HBGA 2GF2A 1NY6A 5C1OA 2FW7A 3AM3A 1FP7A 3REGA 4QVGA 4DDUA 2GCNA 4Z99A 4EM6A 3HCOA 2JLSA 3EGCA 1M8FA 2B2XA 3UMBA 4TMXA 1O89A 3BERA 1WAMA 1PR0A 1U5BB 1WZCA 1I94B 4KQXA 1RAIA 1T2CA 4U0KA 3OKAA 4O2RA 3EIUA 4JC0A 1Q3TA 1JIKA 1JYFA 1UUFA 1Y8QA 2G77B 1J2YA 2KBFA 4FI3C 5ALSA 2PH3A 2Z2IA 5DX8A 4EY5A 5JADA 1YWGO 2QAJA 4TYPA 2HWXA 1CRZA 4Y2PA 5MHTA 3HSSA 5KJCA 3H1FA 4KGDA 3I5AA 5I5GA 1L3IA 5DHTA 1TK9A 3QI7A 3MMZA 3KOXA 3N0TA 3PUJA 4WINA 5TE9A 3X2EA 1XMQB 1Z4MA 2C2HA 1PNVA 3ICQB 3OA0A 3U7EB 4LZNA 2Z08A 3LKDA 1X1CA 2W6NA 4S1TA 3TMAA 1IPHA 4G0NA 4KCGA 2QL6A 3T4XA 1IK4A 3D8NA 5CUQA 4DR4B 5F52A 4NICA 1U63A 3CUTA 2X3FA 4KVAA 1RRGA 1RWQA 3DULA 4MKXA 2WF5A 1QTRA 3DKRA 5EXTA 4EECA 2Q5OA 5FWNA 2QNRA 4IHJA 1T5HX 1RRVA 2GCGA 2PLAA 2FWAA 3L7MA 3M6WA 3PTZA 3QH4A 3L01A 3PV0A 4CM1A 4QTZA 3S0JA 4J0QA 3M9XA 3PC4A 4M55A 3TB4A 3ZE8A 4AG5A 5AKLA 3FOAA 2AK3A 1L5MA 3DBLA 3HKBA 4M1YA 4IIUA 3CS3A 3OAAA 3ZEAA 4AQYB 2JZNA 1ENOA 4XVUA 2HTFA 1LLQA 1ZIDA 2WB4A 2EGHA 2RCYA 3KXLA 3OZWA 4V03A 5AOCA 1WMEA 2ZYWX 4OL0A 5ENZA 2Z5GA 1XPRA 1GTSA 3QELA 3PNOA 4Q7MB 1YIDA 2H5IA 3C24A 2ZYHA 1JU9A 3I6YA 3RVNA 2OHXA 1K2WA 4ZYVA 4KHPB 4BGIA 1GQRA 4OSPA 2PS3A 3TDNA 2JAHA 4Z3OA 4EYOA 3IIKA 2CD7A 1XWWA 4LOLA 5LOVB 4JELA 2R11A 1QFJA 5HK9A 2OOKA 2CNOA 4P35A 2VYND 3AI2A 5F2EA 3RTCA 2W8BA 4BATA 1WMBA 1G8PA 2G0NA 4LHVA 3KT0A 4POAA 4U1RA 1N7GA 1FRZA 1DRUA 3NUZA 5F7JA 1CY1A 2ZYAA 3ZZMA 1I0IA 3H2JA 5IVIA 4A2QA 3T3OA 4HDSA 5EEHA 1EP3B 3M70A 3VNSA 4CM9D 1LQUA 5C8DA 2R87A 1E3JA 2IDJA 1W19A 3T0GA 4CIVA 3OE7A 3ZXUB 3GNTA 5F35A 4IP0A 2B35A 3BD6A 5TMPA 3U62A 2PRIA 1FJXA 1G8HA 1SUCA 1WB6A 3NOVA 5CW1A 3UMSA 2X6QA 3LPCA 3RH0A 3DCJA 3PE4A 3I30X 3KEQA 4ZPJA 1VJTA 2DUNA 1CUIA 3DAHA 3I5MA 4MWOA 5EINA 5TJHA 1LV8A 1R6TA 3GJ8A 2A0YA 3F8SA 4HNQA 4J76A 3A06A 2VI5A 2W2LA 3LCJA 3QW4B 4QUDA 1C7EA 2YKGA 4U7FA 4IFBA 4NRDA 2FZ4A 2PO7A 4RVOA 4YRQA 3ECSA 4OIMA 1ZJ6A 1OX6A 3HBFA 2H1CA 4U2EA 2IUYA 3DDUA 1H6AA 3I2JA 1TTHA 3PB3A 3S2SA 1OXUA 1VPTA 3G5LA 2XVZA 3O4HA 2Q1UA 3FM9A 5L40A 2P91A 3VR6D 3OJWA 4KMMA 2ZSIA 3SXPA 1GN9A 4F4IA 1MQSA 1CEEA 3VYVA 2JGEA 4JI7B 1T3SA 4YJ3F 5KTSA 4X44A 3MAAC 3FHCB 1JH9A 1G9XA 1THMA 4I46A 1GVHA 2HAEA 4R2IA 3ZWOA 1PS0A 2C5EA 4M9ZA 3D6FA 2GM5A 4EGFA 2J9ZB 1KAQA 1XEXA 1GTZA 4U63A 4I8XA 3ANXA 3UM9A 1KHHA 4ZZ2A 4B6RA 1IOWA 2ISCA 1G6HA 2ZWMA 1OWNA 3GT4A 4FT4A 4PZDA 4URUR 2VH5R 5IJAA 4LWPA 4B6FA 4Q4JB 5JYEA 1YIAA 4LY6A 3V2IA 1YOBA 1J2TA 3DLPX 2GZSA 1W87A 3AZQA 4LJ4A 1F51E 1A8HA 2WM2A 1TEXA 1Z4NA 2IZ1A 3JD2A 2HWUA 3ZV7A 1JR2A 4UBNA 3BWEA 2XYHA 4G0YA 3IUNA 4R7TA 1EZ4A 3KL4A 1AQJA 3C15C 4KAXA 3GAZA 1D1PA 4PQYA 4KVGA 5TQVA 2GZDA 2X19A 5FL3A 3PUVA 5AVUA 2J0SA 5DLQC 5CA0A 5T3UA 2H4WA 3UMCA 1PJRA 2WOJA 4GI7A 1F20A 1Y7PA 3VNRA 1U0HC 1FQJA 2J5KA 4BNXA 1T26A 1QF7A 1JDSA 4ZVSA 1UEXC 1JVBA 2PL5A 1KZ7B 3A32A 5J58A 1XEWX 1G8YA 2D5BA 4QO8A 4E30A 4JI6B 2A58A 2QR5A 1JJIA 1EWRA 3PE6A 2JEYA 4KIFA 4ND7A 2EDCA 2VPWA 3CEJA 1D2AA 2CXOA 3R5KA 3FIJA 3LVFO 4ICIA 2I8AA 4LMAA 4MLPA 4F4UA 3CO5A 3D1LA 3SAJA 2OESA 2YWXA 3DVAB 1A9SA 2BEUB 4GBMA 3K16A 2VQ3A 3S2IA 3GZJA 4QA9A 3K0EA 4RPGA 3SICE 3KKNA 1MOQA 3DOEA 3AETB 4GMKA 3LUAA 3BRQA 1SBNE 3U3ZA 2KHZA 1QIMA 4XX0A 4GW3A 1B23P 3OCXA 3MLEA 3G85A 1SC9A 2OENG 3QKSB 1COWD 2VZ0A 5CLHA 1YCFA 2JGFA 2NXJA 1GPWB 2R66A 4PO9A 4P0PB 1XLVA 3BMXA 2XA9A 2OVFA 2J32A 2UYOA 3GAFA 3H8JA 2QORA 5IFKA 1ZHHA 3LP8A 1EJ2A 4NZNA 4Q9LA 1L5HB 2PD3A 4CLRB 5BSVA 3BWXA 1JAYA 4YYZA 3OEED 2IHJA 1U6IA 2HKIA 2GA9A 3ZTWA 4QT4A 1MB0A 1RACA 3CN7A 2RH5A 3BFJA 4W9MC 1W85B 2VCYA 2PMEA 3TW4A 4KXWA 3R3UA 1MC8A 2XUGA 3OJFA 4R40A 1YZGA 2FLKA 5IPFA 1KNQA 3NI2A 2W2PA 1T0PA 1P7PA 3I39X 3USES 1QH9A 4KPUB 2WINI 1N7JA 3JRXA 3EWSA 3OMWA 5GGXA 2AOUA 2X4IA 1N2OA 3MJCA 4RDCA 2Q1TA 3EEIA 1YRQA 4FN4A 1UR5A 4G4SO 2BKUA 3AYXB 5I4IA 4EO7A 2BMEA 4TWZA 4NTZA 4KV9A 2I2FA 3O3CA 1ZVJA 2N1MA 4L6AA 2C83A 2BZGA 2NVBA 5L3ZA 3AR5A 1UFKA 1N25A 1P5FA 2ONCA 2R47A 2FG7C 2J6HA 3N8IA 5THQA 1ECFA 4Y6PA 4OUDA 3TIVA 1ISPA 1W29A 5HG0A 2WK1A 4V1CA 1G3IA 1ZOPA 1M2FA 1N2HA 3H04A 4J1NA 3K0CA 5EQTA 4CKYA 4HNVA 5JMOA 4B82A 1BIFA 1XZBA 1YZNA 4YCBA 5I8ZA 1ISRA 1UKCA 3H05A 1U8CB 4HDKB 4D9BA 4V2IA 3HN7A 3G0GA 4RVCA 2F48A 1B4DA 3GQVA 3LWZA 4DMKA 2A7XA 1LJUA 4AZSA 1FDWA 1LF5A 3NNSA 4U7TB 3AUYA 1HR0B 4UUMA 3WKBA 4TM7A 1XQYA 2HUPA 2IDKA 1AKVA 1MAUA 1J7JA 2YZNA 4H59A 1QB8A 2LPMA 1QH1B 1GSAA 4O4HA 4OBBA 4PLPA 4R3NA 2EL9A 5GONF 1ECCA 3DEZA 2QJTA 2QBYA 3IAM6 2Q5CA 2H8KA 3SEQA 4FM9A 2H5JA 3O82A 2IYYA 1DLJA 3Q7SA 2X7XA 2B34A 1SK8A 1OIWA 1F9AA 3AESB 1HYHA 1TD1A 2XMCA 3CTPA 3NBZC 4EMUA 4MGZR 1IM8A 1QCCA 1UZAA 1JFFB 2POCA 5H8WA 3NRJA 1DXYA 1US8B 1L4HA 4IGKA 2Y4OA 4BFLA 3ZDQA 2P9ZA 3RC9A 1QWOA 4Y9DA 3O73A 2YVQA 4KIUA 4AX8A 1GA4A 1QHFA 1RE0A 3D3NA 4MINA 4B44A 4DA7A 4DRXA 2P0EA 5F5NA 2C07A 4R6XA 4PNEA 5AW4A 3A3OA 5KINB 2ZRPA 1DUIA 2BFEB 4J0CA 2XAUA 3F96A 4ENRA 1T4DA 5FWYA 1XAIA 4WOKA 4RTNA 1DV1A 1JHAA 1KZGB 3MYYA 1T91A 3QG1A 1EESA 1P7CA 2PYZA 4QTXA 1UPBA 2JKVA 4MIEA 4JR2A 4RKEA 4EA8A 1FFDA 4JP3A 2MCFA 4D57A 4V3BA 4DQXA 5KUTA 2PRJA 4GHWA 4L4SA 1G0OA 2FPLA 4ZJPA 1G9SA 5EMNA 1EM8B 3CPSA 3UATA 1DO0A 3ZXYA 3RYCB 5EIBD 3OY7A 2C99A 4IVRA 4JI3B 3JYLA 4N12A 1MQAA 3OECA 4MW4A 4EG1A 1E1MA 1R0SA 4CYMA 3SP1A 2NTNA 2QTVB 5CB0A 1ZWKA 5BR8B 1PD1A 5AXDA 3CH7A 1PJZA 1A77A 4C06A 1GYQA 2G88A 2WG1A 4L2IB 4A8JC 1Z47A 4BC1A 1CHNA 4DJDC 2ISSD 1Q2XA 4RJLA 5K8IA 5FLEX 2GHTA 3PPYA 5E1OA 3M3DA 2JFVA 3TCXB 1H93A 3OLWA 4KWIA 1OB5A 1PTKA 3CQ9A 2PXHA 4R2WA 3GV0A 4W7IA 1PQ4A 2GSWA 2H2WA 3I9MA 4XE5A 2A0FA 1J2JA 1X8JA 1K08A 2XQKA 2GM4A 2VKQA 1TQ2A 5CVTA 1VLHA 4EFDA 4FWTA 3L43A 3HCWA 4N6NA 4NMLA 2Z6AA 5LIRA 3BGWA 2E1PA 3JTMA 3ESQA 1WS6A 1WSAA 4BLSA 3N59A 4G1FA 1Z0KA 1P4HA 2NQ8A 2QVLA 2Y0DA 1ORHA 4NZOA 4WCFA 1XZ8A 2ZE8A 3A6KA 4A9AA 4C4PA 1XZJA 1WF6A 1R15A 4B2PA 2XODA 4R01A 4TMZA 1QX4A 3F5QA 5CEFA 2GCOB 3S8EA 4IIYA 3W1WA 3JWPA 5E6RA 1YVRA 3AUTA 3I42A 3MIZA 1J2UA 2QSUA 3I4CA 4Y2VA 4LISA 4LJLA 4YP9A 1X0XA 3R8FA 3A6ZA 3BQ9A 4P32A 1GNPA 5CPFA 3TLAA 2XBLA 1KFJB 2VHZA 4BB5A 1Z5UA 5FTKA 5DIZA 2O23A 2HK8A 2BD0A 3SYKA 1FVHA 5A1TA 2NXNA 3LC2O 2LIVA 4GVPA 1KO5A 1XCMA 3AJ9A 3R41A 5FV7A 1UM8A 2I9KA 2IELA 1BFUA 5G4KA 5JO0A 2IU0A 3CRQA 3BAFA 3P9NA 3EAQA 1BRMA 2WSMA 3LF1A 1W30A 5LD2C 4RF3A 2QTRA 5KBYA 3ER6A 2DQ4A 3Q7EA 4HEQA 3WAKA 1JIQA 4XARA 2IOYA 3DEFA 1E62A 3UMJA 1H6CA 2HF7A 5CDHA 2CDBA 1ZVVA 3UGQA 4LZJA 1KMIY 3FDZA 5FNVA 3BJEA 3IUJA 3B3FA 3MINA 4OX9B 1LFDB 4CF4A 1WHSA 5K9ZA 2CL6X 1R6BX 1RPJA 1X92A 2H2FA 1IVSA 4Y30A 2PIAA 3HR4A 5CM8B 4I2VA 2YQ5A 4UHFA 5F23A 4MB0A 4O4IF 1K75A 4LVNA 4R1LA 2PUFA 3CH4B 2NOAA 4QNMA 3UJCA 3VR5D 3ZJTA 4TZ0A 3UWOA 5FKJA 3VPFA 3AX6A 1JQJC 3K3PA 2O5EA 1RQRA 4EAQA 3HL4A 3H5OA 3E7PA 4QODA 3T41A 3TZKA 5CFOA 1NUTA 2AKAB 5AW8A 4E2WA 1Q92A 2FV8A 3P9CA 4I4LA 5AKGA 4FDAA 1VBNA 4C7KA 2ALJA 4HTFA 1W5FA 2CC2A 3TDKA 1RPTA 3JVVA 3PI7A 4FNGA 1BX0A 4H3KB 3FF4A 1JFRA 3LHKA 4BO0A 1E9EA 4Q1BA 3K0HA 1D5WA 1P0PA 2Z4SA 4YAJA 3UBMA 4ZIRB 5BW6B 3T5AA 1LQ2A 2VAMA 3RUFA 3BFKA 3CH5A 3KZNA 4IVQA 4XOIA 3Q15C 5F64A 4H4DA 4OL9A 4YRKA 2ZI5A 4L7QA 2W11A 5FA6A 4TZKA 1YULA 2IPMA 5FPPA 5AJWA 3V1YA 4ND8A 1GM5A 2AFHA 3KC2A 3S2FA 2IJGX 2ZTUA 3IIEA 3GRAA 5BYKA 1EUCB 3UF0A 2HLDD 7AT1A 2IODA 5KWEA 2I4NA 1NI3A 1RWNA 4JLMA 3EVDA 2GNPA 1OIXA 3M4YA 3DPIA 4K6GA 1K9SA 1KVSA 4LC9A 4UQOA 4CODB 4QKQA 1DJMA 1NPDA 3G2PA 4A73A 4EVIA 2C8KA 2W6QA 2DKOA 2JLZA 1ATZA 3CE9A 3NFRA 2EF0A 3DVQX 4NCXA 4K3VA 1SXGA 4LYDA 1K68A 3RBZA 3PHLA 1PEAA 2QA5A 4G0VA 4AF6A 1VMDA 1GRCA 4Y6GB 4G0WA 1SKYE 2XOXA 1TYZA 2FJ0A 1BKYA 2R97A 1PR5A 3TLGA 4JXKA 2R6HA 1U7UA 1U3WA 2I80A 3B6EA 1BJRE 4I4TF 2QE7D 3K1AA 3TOCA 3ZHCA 4HBZA 3AR8A 1L5ZA 3KYIB 4Q3DA 4TV8F 4X0EA 4AN1A 1O95A 1TX4B 1XAGA 2EWMA 3BXGA 4ENSA 721PA 5MN5A 2IE8A 1C0LA 7MDHA 4BX8A 4HDRA 1J56A 1TO2E 3RUAA 3WB2A 4BZPA 3VDRA 1AGPA 2UYQA 1H3NA 1DXHA 1YS7A 3LLSA 1KDZA 1WV0A 2BMAA 3UWSA 1R0YA 1UK9A 5HCIA 1X70A 2ZRLA 3HLTA 4M6WA 3D7LA 1Q1QA 4YR7A 1EFPA 2ZI6A 3H4TA 2G83A 3B7PA 2DTXA 2MYUA 2HRDA 2PWPA 1N3IA 2VUSA 3KHUA 4KX5A 3ZHSA 2PL1A 2AFIB 1Z6PA 4BRWA 1HKHA 2JK0A 3FFXA 5HMMA 1DUVG 3V55A 4CN9A 4IO1A 1I36A 1PJCA 4NU8X 4YBZA 2GNAA 4YPVA 4TTRA 2RGDA 1QFXA 4TV9A 5BR7A 5K03A 5HGXA 2Y2UA 3TZLA 3WBJA 1I6KA 1FFWA 3MQFA 2CFTA 4HAYA 5FFFA 5DBIA 4YRJA 1Z5OA 1MDBA 3Q5DA 2XUJA 4QZVA 2RBKA 1JA9A 3DL7A 4WJZA 2ZTVA 3FMVA 1X13A 1B3RA 1RJGA 1L4GA 1AK1A 1XA4A 2ILVA 4IHJB 3AF1A 1ZNYA 3UG7A 3EGEA 3HO8A 3N76A 3NHRA 1U0EA 4FD3A 3DM9B 1L4FA 1MX5A 4RJKA 3L7AA 1XP5A 2W6OA 3RSOA 1IBLB 1XX6A 5DHFA 2PS0A 2QPTA 4LXHA 2DT5A 4FX2A 1JVNA 2DPMA 3DBLB 4QJ3A 5B5SA 4RE5A 5HXAA 1FLAA 4OATA 5K4HA 2LV8A 4GKJB 4QLOA 2OC9A 1KP3A 4UMEA 3RREA 4CE6A 1J9ZA 1BX3A 3EZFA 1JLMA 2ZR0A 2HT1A 2HK9A 1JZSA 1NKTA 5F3DA 3QELB 3T52A 1CUAA 2HZBA 4ASUA 4DIBA 3MBOA 3K9QO 3LY8A 2XMBA 1ZK4A 2F1KA 1W73A 3TLZA 4KK4A 4UUOA 5EQJB 1N7IA 4UW9A 4A0GA 3A1WA 2DHDA 4K7JA 1YGPA 5DULA 1V8FA 5C5EA 3OD1A 1ZW6A 4MUYA 2OLJA 1NNSA 2PQMA 4QVKA 1YJXA 2DPHA 2PZKA 5FQOA 3BRSA 2ZYRA 1ZSVA 3OO0A 3SKVA 5K8VA 4S1PA 2W8BB 4QOSA 4CMKA 5K6TA 1SIUA 1VMIA 3B8HA 3EY4A 1Q15A 4LHSA 5IVKA 2YFYA 1E58A 4RGQA 1EFTA 3WIOA 1H2AS 2SHKA 2HSJA 3SY8A 3W90A 4Q7KA 3SNHA 4CI9A 3HO1A 1ZMXA 4M3NA 5J63A 3RJZA 5JBQA 1BE1A 1HDEA 2ZYUX 3PP8A 3QENA 1MJ5A 1NR5A 4AS2A 5AM3A 1M2GA 2Q99A 3ESBA 3DE3X 3QLJA 2G25A 3OLQA 2D3WA 1RJWA 2FPIA 1XVLA 2EERA 4Q9DA 5HCNA 3QBJA 1HDGO 1WD7A 1KMHA 1X77A 2D8MA 2JVKA 1XDBA 3COSA 1VL5A 4F04A 3LQ2A 4F9TA 2HSWA 1GNTA 1F38A 2FQXA 4YP7A 2X6RA 3P2OA 4JBXA 3ZGVA 4GP6A 3PSAA 1YZLA 1NA5A 3Q85A 3VH2A 2PXAA 1PZNA 4M0KA 1FTGA 2FFRA 1LX6A 1T9GS 2GXSA 2XE4A 3JQAD 4QEDA 1MXHA 5CIWA 5CLFA 2EV9A 4LY3A 4YACA 5J5CA 1SU8A 1GPDG 4PFSA 1A4IA 3ASVA 4UNSA 3SPXA 4UTXA 3GFRA 3EGWA 2CCKA 4MMYB 1VMKA 1L7RA 3BSYA 3N8KA 3T9FA 1OXXK 4L50A 1AGXA 4EEKA 3AB3A 1XLUA 2HU2A 1UFOA 2SKCA 3O6VA 2GQ0A 3OM1A 1X2EA 4HS9A 3AERB 5JWHA 2QUJA 3VXKA 1MZVA 1VPWA 3P97A 4EQ6A 3DTVA 1PFKA 4DYDA 1C3OA 2PR2A 2V7TA 2WQZA 4WK2B 3HM9A 2GTIA 3QMWA 4Q82A 5HQTA 3EXFB 4H3SA 4IRUB 2V3WA 1SZJG 2O54A 4FW9A 2J3KA 1XEXB 2DH5A 3HZHA 4H60A 1JFVA 5JXWA 3EDMA 3D8BA 2JJ8A 3ZWCA 4E7PA 1EVKA 2G82A 5HOQA 1F1BA 4Y2SA 3GCDA 1YQUA 5AI8A 3UXMA 1A9TA 1H2BA 1MB2A 3LVRE 1RXWA 1XWIA 1LSOA 3VZBA 1YDFA 3HKDB 4RZHA 3E23A 4IEIA 2IHZA 2DP4E 4OCZA 4F3RA 2NO5A 4N5LA 1W6UA 3MSCA 5BQ5A 1KP2A 2XB8A 3AUKA 2RARA 4BV8A 3QKTA 1BMTA 3CZQA 3QX8A 4FR0A 4B09A 1QCZA 2CXTA 4OVKA 1RD4A 3WDSA 5CD9A 3IHLA 1D4ZA 2P9HA 3AKDA 1XFAA 1BEZA 1P1JA 1QDLB 4E4RA 3KT8A 1MAVA 3M2PA 3WYCA 3TLYA 5BORA 4KW7A 1XP8A 2VJCA 3GUYA 1LTKA 5DI9A 4ASUD 3L84A 5JRDS 2H4ZA 1PWYE 1XBTA 3R5TA 3IP1A 3SE7A 4YRPA 4M8SA 2BI8A 1UBCA 3MELA 3NAGA 4HRAA 3SC3A 1HG1A 4MICA 1OZ0A 2R7MA 4JBGA 2MSKA 5J43A 4NV0A 1JE0A 2IUUA 4BN0A 3I72A 3ZE1B 4FHFA 3FKSA 2DTDA 3ILHA 4X65B 3MQ2A 4KDEA 5F12A 2OZLA 3TJMA 2QN7A 1TUEA 3IHTA 4R8KA 4D46A 5A4AA 2JA2A 1TKCA 5EZYF 2DSTA 1ZPDA 1WKCA 1E4YA 4QYMA 1RZ3A 3AOEA 5EP3A 4IXNA 4XX0B 2Q2VA 3IS3A 4AZ0A 4CLXA 3EY9A 4JUCA 5L3SA 1ZGGA 5AOBA 3RVRA 2YC4C 3SKYA 2JBWA 3N0VA 1BMFD 3A05A 3A1DA 3CNEA 2EAUA 2XRZA 3DBHA 3MWEA 3ZOZA 1PV1A 4WN9B 2C9ZA 2P90A 3HHEA 5EE1A 1IN8A 1JHYA 1K8RA 1T36B 3OX3A 1OWLA 5A7GA 2JH9A 4BNLA 2O2HA 3I2GA 5IJ9A 4KDCA 1JHVA 1WMDA 2GD0A 2AJTA 1Y8AA 3T0FA 2WNHA 2DH6A 4OP2A 4K1XA 5EHXA 3ZI4A 1LNQA 2OG2A 2V96A 3OC6A 1QR6A 3P8ZA 4OXIA 3B3JA 4WZ6A 4CEIA 4PZLA 5CFMA 2A9KA 4UBLA 1Z15A 4DUPA 3QFHA 4BE4A 1HSZA 1T0HB 1RMQA 3CUSA 3QWHA 4KITB 1QVZA 3L8YA 3AM1A 1P7WA 3QFTA 4JJ8A 1FSGA 4QARA 3RC2A 3LNCA 1EK0A 1UC9A 1KGSA 3RROA 2ZBPA 5DXAA 3G2LA 1Z4PX 2IY7A 2KJQA 2PLFA 4EMTA 3KQQA 4ZDIA 1J20A 3EK2A 4TYMA 1Z2AA 3HRHA 4NVRA 4QU8A 2GEFA 1XE3A 3EZYA 1IB0A 3FYUA 2I55A 3E2MA 3FWZA 3Q12A 4RHCA 1IDN1 3V4SA 3KL2A 1C4OA 1JMYA 1TW3A 3IEIA 4PSDA 4W99A 4ZAVA 1XQVA 4D3SA 2V9PA 1KI2A 4G09A 3R3HA 4Q1DA 5FBHA 5FBRB 4Z2YA 2AR9A 1FYWA 2ECFA 3OLZA 2BI4A 4FFWA 4OUDB 1EK5A 5HKBA 2IYPA 2F55A 2BBWA 1E7RA 3DNFA 3L8CA 4K6CA 3H5WA 4Q5IA 4KDRA 5BNWA 5I8PA 4TS3A 3BB1A 2VRNA 2FSUA 1TM1E 3HXPA 2RHTA 3KUCA 4IGAA 4PNPA 4PAOA 1L5VA 3SJZA 3SR0A 2QRKA 3CKMA 4HRXA 4HNSA 4RZ2A 1E3LA 4ZGWA 2F3RA 1QO9A 3QEJA 4N7BA 2QNIA 5BR1A 2DULA 4MP3A 3GDHA 3VO2A 1EIZA 2WWWA 2YOHA 2BFMA 3MK31 3T12A 3ROKA 2XSZA 3HYLA 1M2KA 1V8PA 3QKUA 3QPWA 5GP1A 1ESZA 2IYZA 4US2R 2QBYB 4ZKEA 1HQDA 1YGYA 4JHXA 1VKZA 2OCXA 1ORTA 1IY1A 2IV2X 4W5NA 2JGDA 4JLNA 3OZUA 4FSXA 1MORA 1JVSA 1Z8NA 2AOWA 3G49A 3WYAA 4BJ1A 1LNSA 1G21A 2B8TA 3NYIA 1JG1A 3NATA 1AG9A 4FOTA 1UEJA 2J3IA 3T1YB 3P19A 4NH0A 3IR7A 1ZGAA 4KLZA 1N78A 4XUCA 2H07A 4QFBA 5HRUA 1S6YA 2DG2A 2VQDA 3TW8B 3DZCA 2WJZB 3GFVA 3P4YA 3EIEA 1O0BA 1LDEA 1OREA 2FWBA 2Q5FA 3HPQA 4YMIA 4F91B 3FPGA 3A1FA 2WTMA 4DRXB 1Y4SA 3CUYA 3H7AA 2ZXUA 1R9JA 2AG5A 3DUFA 3Q88A 8ABPA 4JQOA 5EKDA 2PSHA 1O5OA 4X7PA 2IHVA 1N8SA 4JIMA 3OPMA 4X85A 3O8RA 1EFRD 4NJOA 3LUCA 2CE7A 4RKRA 4QTTB 4RACA 1YAJA 1P5HA 3QVSA 4M8IA 4YJGB 5KVAA 3ODGA 3OKFA 4MRMB 3SQMA 2O2JA 2WG2A 5LZ8A 1INLA 3NDPA 1DL5A 2ZR9A 1I5OA 3D5QA 3HUUA 1S8OA 2Q62A 3NBAA 4KX3A 4MH0R 1SKYB 3H4VA 1LRKA 1V16B 3PWTA 4M0DA 1O5IA 1CZHA 4DIUA 1OFUA 5BSTA 2J3LA 2O1SA 1LBEA 2D0DA 2SCUB 2WT8A 3L41A 3F90A 3HV2A 2R62A 3COZA 5K3FA 5EGNA 2WA1A 4L5IA 3ETLA 3DYBA 3T06B 4BMVA 2D2IA 2NXWA 4XDYA 2NACA 4MV7A 3ZVKA 3NTQA 2Z2ZA 3U4DA 5ESDA 4W1QA 3ANSA 1XKQA 3VPAA 4CCAA 1JDBB 1QBKC 1YMVA 4G56A 4NV1A 3AV3A 1GZSA 4OUKX 1HLFA 1TIKA 4RVNA 4XYEA 2CFRA 5FA5A 4ZRMA 3VZQA 1CUVA 1T8RA 3HYRA 3HZZA 3KTOA 3S2YA 2VHYA 3KQSA 5IT5A 4DA8A 2GPJA 4FKMA 2XZOA 2OG1A 4JLJA 4FI3F 4MS3A 1T6BY 4BEBA 4B4VA 1F8FA 2D59A 2RHOA 1KSHA 1CZRA 3R0VA 4KYUA 1ZOLA 2YMMA 3QRWA 4JNKA 1O94D 1ZXBA 4M86A 1AKUA 4GLOA 4N3BA 4PYLA 4WCFB 4X71A 5K0EA 3ZVLA 3JQRA 1FTSA 3ZUGA 2PGNA 1DINA 3L7KA 2OPBA 4LJ5A 3Q7RA 2XYVA 3K70C 2HBZA 1KOGA 2EATA 3CINA 2Q4DA 5E6RB 3E9MA 5DJ5A 1GZ7A 5I7HA 2A9JA 1LWOA 5I45A 3L6BA 3NYQA 3SBXA 1XQ9A 1OYVA 2E2WA 5BWOA 3D5EA 5F1PA 3LUDA 1KY5A 4FVTA 1Y5RA 2ZB4A 1Z36A 3A28A 3T7SA 2J07A 2R79A 4N65A 4QXOA 4RK0A 3MJHA 5JJCA 4WJKB 4XPIA 4BQOA 1ZNXA 4WN3A 2A1TS 5CHYA 1FMFA 4D4IA 2NZXA 2XYQA 4LTNA 5G4KB 4DCGA 4CIYA 2FLWA 4MEAA 3UK7A 2GR9A 2NLOA 2MJLA 1AHPA 2C4VA 3FMFA 2P68A 4OD0A 1JA0A 1A1VA 2RGWA 1JNXX 4URYR 3TRJA 2B1JA 1S5PA 5EJ6A 4W5HA 3NP9A 3FPBA 4KBGA 3K9FC 2DQZA 1EVJA 1QHHB 1FB5A 1Z25A 3FDZB 1T3GA 5DMHA 2QL9A 4CMHA 2WU3A 3AG5A 4B7ZA 1YC5A 1YDEA 1EYZA 3FRJA 4MHOA 3BKXA 1L8OA 3B8EA 4MUMA 4A0QA 5JEEA 4NHEA 1RYNA 2GFHA 4UUPA 3RVDA 5HZKA 3ZGZA 1WKBA 4X62B 4HL6A 4I55A 2HA0A 2A0XA 2ZRNA 4Q66C 1PHPA 3AOEC 1A9YA 1YXMA 1TLLA 1II9A 2BZ1A 2ASVA 3IIMA 4UE6A 2YN4A 2F3PA 4OI4A 2XUHA 3ANLA 3IUMA 3GRFA 1TLTA 1UJBA 3F3KA 4R2JA 2B4QA 4MV3A 1CEXA 3TO5A 4UZSA 1M2OB 1N5JA 2OGUA 4C4ZA 3TFWA 1ZGHA 5IZ4A 1R0CA 1EUYA 1RSZA 4J7UA 5IBRA 2P79A 2IZOA 4N47A 3R75A 1FF9A 3ICVA 2IP2A 3IAEA 1SCBA 1R9NA 1X6VA 1UZLA 3NG1A 2V7XA 1RYMA 4TS1A 1RM4A 5B4TA 2I7TA 4H18A 2JJMA 4PLVA 4ZHSA 5KYVA 1KH1A 1DT3A 3U6BA 1E2NA 1LY1A 2LIPA 1Q21A 2KB0A 1QC5B 1AXRA 1UBKS 1FUIA 3ISVA 4CT0A 4YR9A 3IL2A 2V4MA 4DA9A 5HW0A 4JEMA 1J49A 1IMOA 1HYGA 1G63A 5HUQA 3K5PA 5IK2D 3RFVA 3DF9A 4UAUA 4WMLA 4GM1A 5AP9A 5LP6A 2CNBA 1NIJA 1GPUA 2HI0A 4DSOA 4EUEA 5AK6A 4A92A 1SZCA 2XDQB 1B8PA 5F77A 5B2EA 2X2OA 1R8QA 4G8DA 2XWSA 4HD8A 1WVGA 1SCUA 3DE0X 3F3SA 3MHPA 1O87A 5AVJA 2G09A 3GFTA 4NL4H 2D5IA 3FYUC 1YU9A 4RO0A 4DC9A 4D82A 2HADA 3G2IA 3HWRA 2ZYIA 4O1MA 3V7YA 4A7PA 1XKXA 4M22A 1YVDA 3O8QA 3OEHD 4FP9A 4CN8A 4OGKA 1HDOA 1ZESA 4NK5A 1F6WA 4CKBA 4KO3S 2P69A 3GUZA 2GVZC 1KEKA 4FFMA 2A7QA 2GI4A 2ZATA 1KRWA 4DNPA 5ICGA 3TLGB 3L7JA 3BUSA 4TQAA 1F48A 2VTEA 5HM8A 4QGBA 3K1AB 1ADBA 5KWJA 2ZT8A 2R1VB 3OTIA 1EXVA 2YYZA 1KS9A 2PWAA 2V5VA 1SXJD 1GAEO 2P9YA 2ZI4A 4OSEA 3RRNA 3R3XA 1I0LA 4DEYA 3BB4A 2ZT5A 4UEJA 1PSWA 4HADA 3TBFA 1OOEA 3WL3A 2H2HA 2ZUUA 1CUGA 3A9CA 5K3AA 3WZ2A 3H2BA 4NMMA 3SBOA 3VZPA 4C0WA 3RB8A 3BX1A 1N33B 3COVA 4Y2XA 5M34A 2ZBQA 2OGSA 4V1CI 1G4HA 3X1MA 1A9XB 1CNMA 3OZFA 3HSYA 4KRYA 3T9CA 1SOMA 3K09A 3ZHUA 4M6WB 1VI2A 2H59A 4ZMSA 1EFPB 1W2HA 3CLRC 5DISB 4CMCA 2QP4A 3VNUA 3GVHA 4H6XA 4HFNA 4Q3CA 1RLTA 4QBFA 4URWR 4RTMA 4MR9A 2HHJA 4YRMA 3IHKA 2YR0A 1F9EA 3K9NA 2RGUA 4A0HA 1R6XA 3RBXA 2YV2A 3B1VA 1PLJA 2PR7A 1WU8A 4MNTA 2JARA 3DZFA 3OY2A 4HMQA 5FO1A 5AUNB 4NYIQ 2WMDA 4ZXPA 2C96A 1OFGA 2J08A 1O6ZA 3L46A 4FWIB 4J3NA 1D09A 4NDNE 1VE7A 2QTHA 3TXAA 1U2GA 1I7PA 1VPVA 4RF5A 4YXWA 4TSFD 4E1VA 2WAAA 3KLOA 4P34A 4XFJA 3ZV6A 4C22A 4PVDA 4RK4A 5JH7B 5JSHA 1YQGA 1AY0A 1UJ2A 3G8CA 3SG0A 3TBHA 1HA3A 3H99A 3SQWA 3C70A 4XCQA 4A36A 3ZGOA 1JR3D 5JRJA 1J24A 4G84A 1BGXT 3GEDA 4J7XA 4IXTA 4YQFA 2HA7A 1UKBA 1XWFA 4PICA 3D8HA 3VGJA 1P45A 1NL3A 3HN6A 3TKLA 4TTTS 1CUZA 2MSNA 2RI1A 5AJXA 5AK0A 1IUNA 2X42A 3OURA 4M76B 4AB1A 1U4NA 4B7CA 1KAOA 3A2NA 3JXEA 1MEOA 3OBBA 4KAAA 5D87A 5AVWA 2FJPA 4IR7A 4AWXA 2DOKA 2YCBA 3I05A 4CHGA 2ZIUB 3I1FA 5IN4A 2GETA 3KQHA 4WBNB 1Z88A 3I6IA 4MQUA 4MULA 2XNHA 3RS0A 4TRRA 2YS6A 3OX2A 1Z8FA 3A6HA 4QQFA 2H48A 4DSNA 3UMYA 3IE0A 3WLRA 4OYYA 3G2MA 3V7WA 3KR0A 2G04A 2CHVA 2W37A 2CEKA 1M54A 4GEKA 4UULA 4XVRA 1OLSB 3C3KA 5A7FA 3L8MA 4K9DA 5F78A 2H18A 4LQ4A 1P0FA 4RTJA 2MIIA 1NBMD 3T3NA 1ZM7A 4A82A 3V4RA 5CA1F 1HSOA 3K4PA 1E69A 5ISMA 5BW5A 5EPUA 4KZPA 1K97A 1QG0A 4CU5A 3NORA 2QUAA 2ZUTA 1E0JA 1GGMA 2FPIB 6ABPA 2IF2A 2AMYA 4MYRA 2VH1A 2AJ8A 3UJ7A 4FE3A 2IEDA 4DS3A 4JR1A 3QXCA 4B3BA 2AJBA 3PNPA 3KE9A 3OT5A 1ZU5A 1E2QA 1C8VB 1N1EA 4RSRA 2NU9B 1FFXB 4KQGA 1SBTA 1SPBS 2AYXA 2FW1A 4JKIA 3U0VA 1E5VA 5LZ4A 1FVFA 4K3UA 2IU6A 3BM5A 4I5DA 4XTCS 3SZMA 3IT3A 4IHKA 4DM3A 4FMCB 4GL4A 4BP8A 2JVIA 2PANA 1WABA 2AK2A 2WA2A 4MYDA 1E1CA 2DBZA 3ZD7A 1CQIA 1GLNA 2QTMA 1ZI6A 4YMHA 4POOA 2ECKA 2R2GA 3W5DA 4G0UA 5GAJA 1W36C 2XCLA 4L5BA 2UVDA 3TNDA 4LV6A 1Z06A 3X44A 2HY7A 2NYAA 4G9GA 1A5BB 2C77A 3KXPA 4PHTA 4C30A 5JI2E 1ETUA 4G5QA 3U9LA 1U7OA 1SD2A 4F9GA 5C53B 2B8NA 3CVUA 3U4QA 3IGFA 2Q3DA 2CMKA 2XNSA 5LWQA 1NVTA 4L9WA 1P1CA 3UK6A 2C7OA 4D5EA 3S6JA 4DCMA 1OAOA 2NZ8A 3JALB 2VZ8A 5MN4A 2MYTA 3EA5A 1UL1X 3BZUA 1HT1E 4RIIA 5DHRA 1BOFA 4KB5A 4B6GA 3RO7A 1XTPA 2P4HX 3K1ZA 2AQHA 2CHUA 5D84A 3RUDA 1T5DX 2YIVX 3ZQ4A 3FROA 5EJEA 2ATXA 3KOZA 2EJTA 2XAAA 1M8JA 2BE7A 3BL5A 4C01A 2GDZA 1BTOA 3ZLBA 2WJPA 5ALQA 5EQDA 5C3UA 3GWGA 1WQ3A 5F9HA 3FPEA 5AVYA 3ZKAA 4YIKA 2AHRA 1NN1A 3ROEA 4UASA 1F2TB 2RG1A 1AKWA 4NECA 1A04A 3PG5A 5AT1A 1VG8A 1EB9A 5F2NA 4JU8A 4C0XA 2KQUA 4GVXA 4GX2A 2VPPA 3GG2A 3UB3A 4JFRA 1AZWA 1HEYA 2VJPA 4F5EA 1VG1A 5A4IS 1NP7A 3HUDA 1Y8RA 1ZAYA 5IAJA 3IFSA 3PTLA 3NV7A 4CQMD 4BFYA 4RX1A 5D3KA 5AW7A 3RQIA 4CR6A 1LS6A 1VP3A 3P2EA 1A7JA 5EVCA 2NT4A 5C7YA 1Z26A 5JO9A 3E8SA 3RJTA 4L3OA 4FFLA 4ZPXA 3R44A 3X1WA 1W93A 1DCFA 2H0RA 5EUMA 1OAKA 2I1QA 5GZ1A 2PKQP 2VNSA 2Y99A 2H3HA 3W8FA 5DW0A 4YUZA 3O2SB 1B93A 3Q8XB 2XTJA 5GIOE 2R8OA 2ZBVA 1RZVA 1DC3A 4AROA 4ZOQI 3B85A 4JYMA 3O4RA 1K7YA 2OZLB 4ZOLA 1MPTA 2VXOA 5E38A 2QTCA 5IG2A 1E8DA 2E4XA 5K4AA 3IMGA 3KJNA 2BR5A 4LAFA 4AZ0B 2QUKA 5KSPA 1CLUA 2WKQA 3OZXA 4I4TB 5L3SB 1KWGA 1HRKA 3R7LA 4DQVA 4L85A 5J5AA 1YDGA 3D8SA 3DVRX 4OP3A 4YT4A 4H9GA 5ERXA 2P1ZA 3E3OA 4ZZ1A 3PQ7A 4RY0A 2YHSA 3EA0A 3TQHA 4X45A 3SFTA 2CLHB 4BC0A 5DNYB 1VCMA 3MWEB 3H2YA 3VO8A 1NUHA 2OXFA 2W6ZA 1CYEA 1U2PA 1QIKA 3L6CA 2OQVA 4WNYA 3MS2A 5C5CA 1WVIA 1HL3A 4IUDS 2JLWA 2WNSA 3FYTA 1N6RA 2JB9A 1GLVA 4FC6A 5B1IA 1JEYB 2DT8A 2OV6A 3BD8A 2Y67A 3LPMA 4PLZA 3HFJA 1GCUA 2WZDA 3LXXA 3L92A 2E0IA 2GHIA 1A5AB 2VUIB 4B3CA 1Q19A 3FDIA 4GKVA 4IGFA 2BTEA 4QDOA 1DWQA 2YN2A 1E2PA 1JQ5A 1Y37A 2XDWA 1YE5A 3C6KA 4R8RA 5IH7A 2Y1DA 3R3JA 4B33A 3NIWA 2NVUA 2P4EA 5G2OA 3WKEA 3IKVA 5F51A 3HFRA 3F5FA 1OFTA 1MA3A 2R8ZA 4O2AF 3O1IC 1MGPA 1ZRHA 2G17A 1ID1A 1XMJA 2YWDA 3GHHA 2V1UA 4D7AA 1Y9JA 2V7WA 1KU0A 5ER6A 3NWJA 4CCYB 1DBRA 2VQEB 4U7WA 2WWXA 1WNFA 3OU6A 3R5SA 4FMDB 4C6SA 4XQEA 2VUUA 1N0UA 3IOEA 4PQFA 3KQNA 5TXGA 2CN1A 2QZJA 3D6MA 3UBTA 3TVTA 2YMPA 1M33A 3C5VA 1TT7A 1Z62A 4G01B 3ZLUA 1GDTA 5K05A 2JFUA 2ZU0C 1T9BA 3KZKA 1FRNA 4GS5A 5E9JA 4DQKA 1TAQA 2CUNA 3IR6A 4HAXA 4IVPA 4KO4S 4RL6A 4FDTA 4Y1EA 5CX1B 5KAMA 1DWPA 4FB5A 1PFVA 1SVSA 3BMCA 4NYMQ 1U9IA 5KO2A 1H2XA 2EGUA 3NBQA 1F0KA 4UMVA 4INZA 4MCIA 3JASA 1EWTA 2X1VA 4AX4A 4LYJA 2EG9A 3KJHA 4L16A 2G6BA 5ECWA 1FJHA 1NURA 3I8XA 4B6EA 4CIDA 4KLAA 4QGSA 2O7RA 3BXHA 1KYWA 4OIFA 1XDSA 1SCAA 4MKGA 2JGDB 2GT1A 5I7AA 3CZ9A 2NO6A 2W98A 2ZIVB 3RQSA 3C4VA 3U3XA 5MN6A 1UMDA 4TMWA 2OCBA 3I2FA 1F7VA 3NAQA 1U7HA 3I0MA 5TSDA 3L06A 1OCEA 2C3YA 3BWCA 4C05A 5I4CA 1GOTA 1GZHB 1B6GA 4L27A 4QDTA 5CGZA 3RVQA 2FRDA 4TYWA 4FYYA 4LDNA 1MEJA 4WFQA 1YZFA 1TMOA 1AKQA 2C20A 4LG1A 4TKMA 1POXA 4L4RA 4GH5A 3M82A 1P2DA 3DHEA 2XYGA 3U3OA 1GPYA 2MTBA 2ZAGA 3X1DA 2A86A 3DUFB 5BYBA 4R5HA 2B9VA 3FNEA 1T13A 2XCQA 2Y0EA 2Z2XA 4K2HA 1DCKA 2I66A 3JZDA 3B2QA 3B1JA 3MOGA 1N2CB 4HWKA 2I4TA 4CMEC 5IBCA 1PR2A 3KAKA 1BROA 4RY8A 1RRMA 3LIPA 4CV1A 1DUSA 1H5NA 2GRJA 2OP0A 4R9RA 1HYEA 4IDCA 4REMA 3W6NA 1T9DA 4YA6A 3AVXA 1WE2A 2VP9A 2ZIXB 1CR6A 1PR3A 1ZP6A 3L2OB 1AS2A 4TT8A 4D2IA 4Z7JA 4B79A 4OTZA 3WLJA 5IUJC 5ECYA 4DCTA 2GUWA 3OIGA 5ESRA 3FW1A 4EX6A 4W6QA 4EPVA 3DTNA 2X4DA 4UBMA 5ALJA 4W6ZA 3D5TA 4IH9A 5GV7A 4BCDA 1ELOA 4OAQA 3T4UA 5K3FB 2H5LA 2V59A 4TKVB 1RVDA 1OGJA 4AXBA 5C46F 2XE8A 1XCPA 3AONB 3IDSA 4UVDA 4WA8A 1WDKA 2D8AA 2E6UX 1T24A 5ALUA 4GVLA 4J7CA 3JQ6A 1KQFA 2ZUVA 3SYTA 1L4KA 4OP1A 5AHXA 1WMFA 1U3VA 4KXQA 4ARCA 2BEVA 1ACJA 2WSLA 1RXEA 4LSGA 5UKDA 3IDOA 4PYKA 3FSEA 2P6NA 5ALEA 5BSEA 1V11B 5LBUA 4O4HF 3QKIA 5BNZA 5KNBA 1YD7A 4BECA 4RF2A 2OGWA 4H0CA 3GLIA 3SXUA 4N03A 4N9QA 3UNXA 3CX8A 2P40A 3F1LA 1O77A 2OZKA 1EUDA 4MS3B 2FGJA 2C2XA 4X7BA 3B78A 3OZCA 2M32A 5E95A 3S2EA 4BO9A 4X5OA 1EGMB 1KYXA 3DE5X 3E1KA 1GHTA 3DZGA 2P3LA 2ZBRA 4IMIB 3ETNA 3UTDA 2MINB 2PPVA 3I3OA 1R10A 4QT0A 1KKUA 5K6RA 4NATA 3J7AC 4Z7QB 1KYYA 1D9ZA 2VA8A 3KWLA 4JQZA 2WDPA 4RJIA 2CLOB 4Y3UA 5DPMA 1A8SA 4NAUA 5CRIA 3WK9A 1LDYA 2JLRA 4M89A 3X1XA 4ZP1A 1T29A 2O5CA 2J31A 4ZU1X 4FIDA 1WDLA 3D3JA 4Z49A 5K0FA 5BOVA 2HOQA 3V3KA 5ALRA 4ZREA 4ZRNA 3CEAA 3CXUA 2A1UB 4TTJA 4EHLA 4ITUA 1CRQA 1W8DA 2HIMA 1HEIA 3C45A 5EJAA 4DA6A 2ZE6A 4D0GA 4CV0A 5KTRA 5MGNA 1GSHA 2HJ9A 1DELA 5IJWA 2X0NA 5I7EA 3WV4A 2UXDB 4RUKA 2ZDQA 3JATA 4GP9A 3HWWA 5EZYB 3B20A 2O14A 1N6LA 3D6JA 1U9YA 3DBIA 3IT1A 5DHPA 1RJ9A 4C6TA 5HBRA 4YAFA 3SSOA 3ONDA 1G6OA 1I51A 4E08A 4AYWA 4L78A 1FY2A 1PZMA 4CZ2A 3Q10A 4H6WA 4MUGA 1L2TA 5AUQA 2DJIA 3AVVA 1RYYA 4CDMA 3EPHA 2JAPA 2CLSA 3IBFA 4U2FA 5CH8A 2YNMA 2Q0XA 2QPAA 2IGTA 2EEPA 1YCHA 2WRZA 4HP8A 1ZWLA 5G4LA 3W34A 4I55B 3LT2A 3G1TA 4QU5A 1G17A 3BPSA 4OY3A 4C20A 4EVQA 5K3CA 3W2EA 4Q00A 3EZ6A 5ALXA 3RTGA 3QPBA 3AVUA 3KT3A 3ABQB 3OZSA 3WIEA 4B71A 4HO1X 3RSZA 3LM8A 4XFDA 4X8MA 4Z4HA 3C3AA 2QN9A 4ALKA 5K0GA 2UXCB 3WJ7A 1MDFA 1BXZA 3M83A 4HUTA 4I1SA 3SHOA 4PV7A 4G37A 2OZVA 3KB8A 4FFSA 4G25A 1A9ZA 3ADKA 3IQIX 3RAPR