3OLQA

The crystal structure of a universal stress protein e from proteus mirabilis hi4320
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
306
Chain Sequence
EKYQNLLVVIDPNQDDQPALRRAVYIVQRNGGRIKAFLPVYDLSYDMTTLLSPDERNAMRKGVINQKTAWIKQQARYYLEAGIQIDIKVIWHNRPYEAIIEEVITDKHDLLIKMAHQHLGSLIFTPLDWQLLRKCPAPVWMVKDKEWPEYGTIVVAANLSNEESYHDALNLKLIELTNDLSHRIQKDPDVHLLSAYPVAPINIAIELPDFDPNLYNNALRGQHLIAMKELRQKFSIPEEKTHVKEGLPEQVIPQVCEELNAGIVVLGILGRTGLSAAFLGNTAEQLIDHIKCDLLAIKPDGFTCPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Universal stress protein E
publication title The crystal structure of a universal stress protein E from Proteus mirabilis HI4320
rcsb
source organism Proteus mirabilis
molecule tags Structural genomics, unknown function
total genus 100
structure length 306
sequence length 308
ec nomenclature
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00582 Usp Universal stress protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3olqA00
3OLQA 4WY2A 3AB7A 4R2KA 3MT0A 3CISA 3AB8A 4R2JA 5CB0A
chains in the Genus database with same CATH superfamily
3GLGA 3HVHA 4MXDA 1L5ZA 3KKEA 3BF8A 3RTBA 1F60A 4B83A 3VGJA 1W4LA 4PAWA 2YMQA 1YZGA 1SVKA 3AQ4A 5HF6A 2RK6A 3WIUA 5BR7A 4Q4HB 4NYJQ 1YZQA 1GG2A 4G37A 4GX5A 3DPIA 4R41A 1DOHA 1QH0A 1Z37A 2YXNA 1ONNA 2DX7A 3ZJ5A 5KHOC 3ZQ6A 2MSNA 2K6GA 4D8WA 1UPBA 1TIBA 2DTDA 2G9QA 1GCUA 2QWXA 1QE0A 4IDDA 1XZEA 1U6IA 1AUQA 4G5SA 1LV8A 1YUMA 2QP3A 3WC4A 4DF3A 3GROA 3UPDA 3SDSA 4B6SA 2DUNA 4G5QA 1IMJA 3NFYA 3CEHA 4G0YA 1N2EA 2OVBA 3H83A 2BMAA 4PE5B 4XEUA 2JGAA 2R4UA 3HKDB 3WHIA 1KTIA 4DWWA 1H05A 4NCKA 4A0GA 4TVBA 1HL3A 4CGYA 3SHVA 1UXOA 3RVNA 1H94A 1FYEA 1E9FA 1NTRA 3F3KA 3LOQA 3O74A 2GHTA 3SJUA 4REQB 3TUJC 3RC8A 2JCGA 4MDYA 3VI4B 4CM8B 4PLYA 5DI3B 3DEYX 3PE6A 2HQSA 2KWIA 3LTNC 4K0RA 3NU1A 1W5AA 2BFNA 4D4KA 1XVUA 2VPTA 1LPAB 3ICOA 3P9XA 4LDNA 1CK4A 1MN6A 4JP2A 3IPCA 3UJNA 4FE4A 2H2IA 1HZJA 3LHKA 3UH1A 5B6IA 3GAMA 4LAFA 4MUNA 1WM1A 1EZ1A 3WNVA 3RUPA 5TGZA 3GRYA 4UU8A 1I7LA 2P2ZA 1AHPA 4X95A 4QASA 5D1NA 4Z54A 5E6SB 1XXLA 1ND5A 4AX8A 3L6UA 3DKKA 3QYAA 4F85A 4JU9A 3OPYI 3OPYA 3SQLA 1IATA 3ACCA 4BKPA 3AR6A 1ORRA 4ZARA 3PPXA 1YZKA 4TRMA 1MP0A 1B73A 2QE6A 1UMKA 4P92A 1GUDA 3P9PA 3OLWA 5FBRB 4NDAA 3D2AA 1NUHA 1C7RA 3GZJA 5AK0A 2WIKA 4AC9A 3PHCA 4D99A 3FROA 3NB0A 1OGYA 3PFWO 4M1QA 4U7FA 3JWEA 4AMGA 4I1SA 4S35A 3DYVA 4WKPA 3WP0A 5FOVA 2Z6AA 1LLCA 2MTBA 1ESMA 2PE5A 3Q88A 4WXPA 4MW6A 3TG2A 3FJOA 2CDAA 1G7TA 4MAAA 2VAXA 1D2HA 1LTQA 3WRXC 1E7SA 3WXBA 1BQ3A 4ZYTA 4YPVA 5FI3A 3VYWA 1N2HA 3DZKA 2OZKA 4ZRDA 1Q19A 1HYQA 1VL5A 1ZM7A 4WE3A 1U3VA 2W2NA 4FFBA 2R1ZA 1NVFA 1K0FA 1XTTA 1SVSA 1ZN7A 3HMKA 4I55B 2V74B 1JIVA 4IMRA 3TZKA 4BBPA 4BB9A 5AVQA 1JR2A 4IIJB 4UTRA 4K6HA 1I1QB 5JSYA 5I4KA 2UUCB 1A2BA 2Y1OA 1PZMA 2WSLA 3CUUA 4NZYA 3HKEB 4N41A 5AOCA 1IXRC 2WT8A 5D6NA 1G18A 1Y33E 4K8RB 4BWVA 1W29A 3C8ZA 1ZD3A 3FYCA 3EZYA 1IJEA 4X85A 3PRHA 3A1SA 3FBTA 2B9EA 3RLFA 4CW7A 4AG5A 3S2ZA 4EQZA 1DO2A 4ECEA 1XB2A 2R25B 1BD4A 5A1TA 3GZTB 1WBBA 2OCPA 1YS6A 2Q2WA 4HWPA 5H83A 5JDCC 3I1YA 3U13A 4DLYA 1R27A 4KBGA 3A6EA 4XWOA 2XUFA 5KKNB 1MW8X 5KOIA 3J80A 1XLTA 1PZEA 2FWRA 4F4IA 3A9VA 1HFWA 2RKOA 4KHZA 4PQYA 4X60A 2F1KA 3EGDB 3MLAA 1JG1A 4F4UA 1J0AA 3ZD8A 3LPLA 3FF1A 3OU6A 1VPTA 2AXNA 1KPIA 2XSZD 3QI2A 4KQKA 5C81A 1F7VA 5GPBA 1P6QA 2O7QA 2Q3HA 1W85A 5EVCA 2H08A 4G81A 3EF0A 3I42A 1UKVY 4UUNA 2HTEA 1IHUA 1XKLA 2QJRA 1ODSA 3FVWA 3IALA 3T9DA 2J07A 1D9XA 2Q6IA 4YNBA 4EJ0A 5JCZA 2XB6A 2H16A 4PSUA 1WMAA 4PFSA 1TK2A 4CE6A 4X91A 4G4SP 2B30A 3EBPA 3C1UA 4PLZA 2AYZA 3B1ZA 1CY2A 1I4OA 2YWJA 2ODBA 3TIXB 4DUYB 1EUYA 4BDSA 5AI5A 1JMKC 2BVNA 3HA5A 3EHEA 4RA9B 3LUAA 2F43B 3PGLA 2CE7A 2YFYA 3BRWA 3R5XA 4JQCA 4LE0A 4NPHA 3SE7A 3TB4A 1TTHA 5TGDA 4K9SA 4MV8A 1U7XA 3EGIA 2QOEA 2J0VA 3W6OA 3T1YB 1NKVA 2H2HA 3UJCA 4WNIA 1J1UA 3AB8A 1GYPA 3OPXA 4UUBA 1U2ZA 3GV0A 3GT0A 1E58A 3L6BA 3GDFA 3DBIA 3OFKA 3OZIA 3TGLA 2VPXA 1FYFA 5SY9A 3E9EA 1X77A 2ECKA 3KZXA 2B3DA 4FOTA 4GVXA 4NNPA 1Z7GA 1ZK3A 4OHUA 4WBXC 1G0OA 1BVYF 4ERXA 1IPHA 5KHAA 4CQLB 1JHOA 1TUIA 2ZYHA 4TSRA 3IKJA 4N3AA 1OI7A 1RZRD 2D5LA 1I4DD 2ONYA 2BZ1A 4L8VA 4OL0A 4GBGA 5AMXA 4DQ0A 3GJ6A 3GH1A 3DD1A 3OCZA 2C5HA 1XE3A 1T4GA 3G0GA 2A78A 1TM5E 2IHBA 2QM0A 1DQPA 3HWRA 4MS4A 3QELA 5JS2A 4AJ9A 4HLUA 4YWHA 5B7NA 4GW3A 2FHPA 1ABEA 3T94A 1EEHA 2ZJ4A 5LKRA 4Y1RA 2A3NA 3KZNA 5EXXA 4MVJG 1CFZA 4WK0B 1H3NA 1KDTA 1KSGA 2I2WA 3BD7A 4EMSA 3CH7A 1VPDA 2IYWA 4ZCPA 5A1JA 1R12A 2QX9A 5CJ2A 3PKIA 2PV0A 1VHDA 2PVCA 4BAZA 4ZP1A 3HVUA 2KQUA 4HRYA 1OX5A 3IO5A 4G09A 4MKXA 4MWEA 3CUWA 4OHPA 1UEXC 3NNDA 5AVTA 2ZI4A 3GJRA 3ON5A 4N6GA 5FULA 5EIHA 4CBVA 1DTWA 1P0QA 2N9UA 3LE8A 4FTWA 3NI2A 3WLIA 1Z0KA 3QQPA 4IHJF 2QAGC 3N2EA 2REQA 4CMGA 5KJ1A 4C7BA 3U37A 4LJYA 2Z0MA 4RORA 5JQGA 5CLLA 2IOQA 1CJKC 3TSYA 1BHJA 2OO5C 4XIJA 3H9QA 3Q85A 4CRWB 2X8JB 3AR4A 1P4GA 3M2TA 4QXOA 4AIIA 4PYLA 5KTPA 5H59A 3UAWA 1T3TA 2QPTA 3GLFE 3SF0A 3FXAA 3PUWA 4ZDKA 4GR4A 2EJVA 1P1IA 2FEKA 1QYWA 2KI5A 1P7ZA 1EX1A 2JAOA 4HDQB 1ONPA 3G0CA 1W88B 5SY6A 3EOBI 5A7GA 3KUKA 2B8NA 1Z6ZA 4F92B 3SU8A 4Q1EA 5K4HA 121PA 3NC1C 3ZE0B 1DQZA 2BH2A 4JI8B 2VAWA 1DO8A 1SM4A 3ZY3A 2VHTA 2X2FA 3WTCA 4IJUA 5GJBA 3CZPA 2ASEA 1DSSG 3TBHA 1TZKA 1ZK1A 1ZINA 2W4MA 5T6BA 3AGPA 4C04A 1JJIA 1I6WA 2A9PA 5ETJA 2W7TA 2ZOSA 3L1UA 4QDOA 3CVYA 2R7KA 2LIPA 4H7EA 3AK4A 1W35A 3C41J 1LK5A 4DQLA 4IJ5A 3AX6A 3SZGA 3SVLA 1GV0A 1S5PA 3INRA 4HSGA 1LV7A 3RIYA 4H59A 2PX5A 2D0PB 4TWAA 2HFJA 3FKSA 3KE8A 3NG1A 2PEYA 1LDMA 1G291 4HRAA 4RM2A 4XUEA 1KRXA 4RHTA 1C3EA 2FPPA 2AR7A 1FFDA 4S1WA 1A76A 3V4OA 1WOYA 4CQMB 3DDZX 5IAAA 1MHTA 2QK4A 3ESAA 3KCNA 2C2XA 3WG9A 3ZVLA 4A36A 2O7VA 4M9CA 3A6JA 3K0HA 4QOGA 2ZSAA 1EP3B 3RS0A 4JJ7A 3LKVA 2COEA 2W0SA 3RVDA 1AVTA 4EJFA 2HU2A 2E49A 4TKMA 4CI0B 4WERA 2RK4A 5CJJA 2ZE7A 1KTVA 4XWWA 5JJCA 4WV3A 2H2DA 3T1QA 1ZK4A 2E9SA 2GGSA 4JXKA 2JL1A 1FP6A 2Z9BA 5YASA 5LYJB 1DRWA 2GAFA 3HFJA 4LRTB 4KFCA 4YMWA 2Y27A 5CRIA 3OZEA 2FWPA 3QKSA 3VHXA 5KB3A 4A1FA 2PGDA 2XTJA 4XLLA 3UANA 4A2CA 2IDKA 3SOPA 2BFMA 1R6AA 2QXYA 2ZUDA 2QZZA 3N0WA 4EHHA 3W78A 4O4HF 2PBFA 2JK0A 1PJTA 1PGPA 3N2KA 4S24A 5A05A 3RVRA 1Z0FA 3HVJA 4RQUA 4TV9F 2PL3A 2BMDA 5HBRA 1VG8A 2QSZA 2PMWB 4UUQA 4LG1A 2MSEB 2WD7B 3H16A 3EPJA 1D7OA 4UVIA 4YAEA 3AVXA 3BRWD 1N78A 4YRJA 4X6XA 1N0VC 1Y3AA 1ZM2A 2VHXA 2VYVA 2NVUB 3ZJVA 4BJHB 4EUSA 3AEZA 5C1OA 3P2MA 5E8JA 1B8NA 1UK8A 1Z8FA 2BR3A 4C21A 2B37A 1ISIA 1QF9A 2PG3A 2ONCA 4X1IB 3W7AA 3WDKA 4B6QA 3S7ZA 3RAEC 3GCWA 4XVRA 3UATA 2OVFA 4JOBA 4E3WA 2P9FA 2QZPA 4OMCA 4MX8A 1Y7TA 5FFFA 4HAYA 2OZLA 4LMAA 4MVJM 1NNUA 4Z7QB 3W6PA 1KZ7B 1SXHA 1D2CA 5FL7D 2CT8A 4GO1A 4M8IA 4KVGA 4PFKA 3DEHA 5AJYA 5F2OA 2BGMA 1JG2A 3TLKA 3URMA 3T3PB 3CVWA 4P5EA 3HLYA 1RAAA 4F11A 3KTFA 4XIYA 4FOSA 1H2WA 2P4UA 4EEXA 2C5EA 2CVOA 2P1ZA 1B4DA 2NO9A 4KW7A 4JODA 3INTA 2I6TA 1L6RA 4Y3UA 2VPYA 1BE1A 2FK7A 3BK7A 3KYDB 2IWRA 3RGWS 4A82A 4B87A 1XU4A 1NUTA 3WAKA 4YAKA 1PVVA 2JLBA 4BBJA 3I6IA 3KZCA 3IXQA 3ULKA 3NEAA 5KAMA 4WGFA 3ILSA 3ZE8A 1QONA 1YD7A 2P0YA 2VCYA 2JHFA 3JAWA 4RYLA 1A2QA 2B61A 1F2VA 4ZCLA 1N77A 4K05A 4BMVA 4UZFA 3FPFA 3OFNA 4RZUA 3VPBA 1MGOA 3QMMA 4HDAA 3AFHA 4MTLA 2C84A 1OXSC 1QJCA 4P22A 1UZMA 4WAUA 3H19A 2AI2A 4I4TF 3O9VA 3VDMA 1W96A 3MTDA 1B16A 1XCGB 4O5OA 4TTAA 4R5HA 3JZMA 4JI3B 2XRYA 3NYQA 4QPZA 5HS4A 5KYWA 1OE0A 1TYDE 1RAGA 2MYNA 4Y2PA 4RTSA 4QREA 4KREA 1E2DA 1GLVA 3PXBA 5CTJA 1BHSA 4BWYA 2WRZA 3OT1B 3A2NA 3CGWA 4BYMA 2FN3A 4M76B 5AW8A 1ODKA 3VHLB 2YJZA 5K8CA 1RWKA 2OBYA 3S2IA 3MCVA 4YR9A 2I78A 3M70A 1YNOA 1YR6A 2W0MA 3QX8A 5B7QA 5CDFE 3A7EA 1US8B 1VHJA 3MPUA 4DNOA 2QY6A 2VNKA 3PUKA 4ZI5A 3GWZA 1KWKA 3AUXA 3R7DA 4H7HA 3MRSA 4WWHA 3TLMA 5CEJA 3ZHZA 1CLEA 1JVBA 2QUAA 4TKUA 2XB4A 1N1DA 3U39A 2ZLBA 3AY0A 4RTMA 3EX7C 3ZCSA 3C3WA 1ZICA 3JALA 1EHCA 1PNVA 1QHGA 2OA0A 1CHDA 1LFDB 1R8YA 4YAUA 1I0ZA 2DKFA 2ZRPA 5A62A 3FNRA 3MBIA 1RWPA 3K09C 2Z57A 3PD7A 2A1TS 2A0FA 5K05A 4FONA 4TKZA 1D07A 3H5TA 1O94C 5T4HA 4G07A 2FFAA 5B5SA 1W36D 2B1QA 1F1BA 1E2IA 3KLMX 4LZNA 1U9YA 4AKIA 3DFKA 4C06A 3SYNA 1SUWA 4RL4A 4BFYA 3G2IA 5I9IA 3Q10A 2GZDA 3KHTA 4CIWA 1RWVA 3EUFA 3CX7A 3QKRA 5LVAA 3FKSD 3JVUA 3WGOA 4NXNB 4B8ZA 3D8TA 1QQ5A 4IF6A 4KDFA 4Y6SA 3PD0A 4LWPA 2UDPA 3D1LA 2W6ZA 2O2GA 4HLQB 3AHDA 4JDPA 2WUWE 3OZRA 5EGSA 3T7EA 2R66A 5DNAA 2O8DB 5DX0A 4YT8A 1EWTA 1SH7A 2OBNA 3EFBA 3IR7A 1R00A 1C4OA 3OEYA 4OEHA 4K6MA 3FAZA 4E5MA 4L50A 5DCUA 3HY4A 2AFIE 4MYUA 3A14A 1J9ZA 1QK4A 1BG6A 1NC3A 2PGOA 3AYZB 4IFIA 2WICA 4OB8A 2FPKA 2Q8QA 3CLRD 1JT9A 3A1EA 3PC4A 1JAXA 3I04M 4XR4A 3I5XA 3SOZA 2JASA 4A8HA 3MD0A 1KFCB 1HG1A 3UTDA 3SIRA 1SBCA 3L3BA 2OESA 4RV5A 1PJQA 1WZUA 3PNLA 4ARVA 1O95C 3PC2A 1JVSA 4LHEA 4RPHA 1JEJA 3UMSA 4C0QC 2QQ0A 3E9RA 1SCBA 3BORA 4Q48A 2Z2KA 4EZEA 2GD1O 1QF6A 2E4AA 4IXMA 5CB6A 1G2QA 3QF7A 4I9GA 4CN8A 1II9A 2CW5A 4V03A 1C50A 1M67A 1THTA 2BEVA 4OG2A 4RF3A 1KBQA 2VDMB 2WB2A 4AY2A 2XDYA 2JZNA 3GARA 4RWZA 4TTJA 5GONF 4OH1A 4F6RB 2VYVD 3IT2A 1GUYA 1QGOA 3K2EA 4KDCA 4EI8A 1GQYA 4MEAA 1UWVA 5JD3A 5AKYA 1CY0A 3D31A 2CK3A 5AK6A 4Z8XA 4ENTA 3K8ZA 1TAQA 1LS1A 3NIGB 1QIMA 1MRSA 3A2LA 1Z7EA 2IH2A 4YASA 3OQNA 3EXEA 3OY2A 4R2IA 2H07A 2ODWA 4KFTA 4YI5A 4KPGA 2VWPA 3QPAA 2OG2A 2HPVA 3AHFA 1UBTS 4WNYA 1LS6A 2CHUA 1XDWA 1MENA 1WDTA 5BQFA 1R4NB 3FR7A 3KZ1E 3UK2A 5EHZA 3K32A 1GN9A 3PXEA 4X8OA 5CVUA 4DSTA 4BASA 4WOJA 2PL9A 3CLUD 4INZA 4MV6A 5WRFA 1A9QA 4NMHA 3H18A 5FI0B 4NQRA 5IT0A 3TOCA 1XRMA 1U3UA 2GEBA 1Y5LA 3ECCA 1GZDA 4ADSG 1N4AA 3AUYA 5KWEA 2ERXA 2P2DA 2PUEA 3VA7A 3F7TA 1JZTA 2BFDB 3C8MA 4BV2A 4Q7QA 4BVKA 5BPFA 2OBBA 1ATIA 1YVDA 2VL7A 4FGJA 4WSOA 2BTQA 5T41A 2CXXA 3TINA 3VSDA 1JQKA 1KZGB 2J0EA 3ESCA 3TW6A 5B37A 1HT0A 1MXHA 5EQJB 1KK1A 1CUJA 1QCDA 4J0QA 4ODIA 3WWEA 1QGED 3S55A 3GPBA 3PKJA 1Q2XA 3BQNB 1GAXA 3R7FA 4MKHA 1L4MA 1IHPA 4X9XA 2X0JA 1OC4A 2R6HA 3PNQA 1VG9B 3W7VA 2RGRA 4PNHA 4QARA 4ES6A 3HB9A 1MNQA 2XYGA 3CIFA 1GQOA 1TAUA 5DOZA 4N0EA 1T36B 3LA8A 3TGWA 1GADO 5EPUA 1FP4A 1MZVA 3B85A 3BX1A 5LB4A 3ZDAA 4R2XA 2VKQA 5AHRA 4TLBA 1VMAA 4ZZ3A 4MR7A 4LF4B 4NNJA 4J6EA 3ADPA 1XZJA 2VYFA 4Y2UA 3ZK9A 4EQ6A 3CJTA 3KUUA 2XE6A 2TYSB 2YVUA 2QEQA 4BNLA 1D6JA 1IK6A 1MX9A 4KGZA 1Z35A 1TCCA 3D4NA 3KOOA 5LZ8A 3SIPA 1OLXA 4AJ1A 2VZEA 1KJIA 4FCCA 4IUBS 4UFNA 1FSFA 2QN6A 2Q45A 2YIVX 4MUGA 3NOOA 4IUYA 1TX4B 2BFCA 2HQOA 4AS3A 2JAWA 1X94A 3QA9A 1C41A 1E8DA 3QTTA 4DLUA 2VPPA 2XGGA 4XCQA 1A5TA 3SICE 3DLIA 3K1TA 4Z99A 2F3QA 5GINE 2DPXA 1F20A 3A3YA 2BFAA 1L5OA 3BDAA 1FBTA 1PQWA 1E6LA 2ZIAA 4H17A 4OLBA 2JRCA 5CHYA 3WMRA 1BYUA 1PFGA 5U1PA 4KXMA 4B3BA 5DX8A 4UMDA 1DLJA 3N8GA 1A04A 4YRLA 3RS8A 4B7XA 4YRSA 2AGVA 1XL1A 3IQDB 4AZ0B 5JSFA 4M0EA 3DE4X 5DCLA 1J4AA 1GP2A 2C5BA 1XAIA 3HFSA 4IYRA 2MSLA 3SK0A 3SNKA 4ETWA 2PR7A 4ZGWA 5JVDA 3OP4A 3WWOA 1SUFA 1FFAA 1XDZA 4WEQA 2WHXA 1GTJ1 1KOFA 5CEFA 2H1FA 3MRVA 1KVTA 3DHYA 2OC4A 5I7UA 2PVPA 4CMIB 2EP5A 3G3EA 1Z47A 1Z6TA 1P60A 2GEFA 3M9XA 2AMJA 2A0WA 3NBMA 5AJTA 1TK9A 1Z5UA 3FPLA 2OCYC 3GELA 4ID3A 4R4JA 5GV7A 5H82A 1R8SA 1UBEA 2PJDA 2X41A 4KWIA 4PGHA 5CLFA 3QEKA 1JFFB 1TZBA 3CINA 3MTBA 3AM5A 5M34A 3ZV3A 4C5BA 3U31A 5FPHA 1DKOA 4Q05A 4PPNA 4HLDA 1T9GR 2C98A 4IZ6A 1ODCA 1QOZA 5FA8A 4AKEA 3NVDA 4L02A 4L72A 4U2KA 1JTFA 4YRZA 2AT1A 3KD3A 3TLGB 1XZGA 5C34B 4CETA 3IIJA 4A10A 2A5YB 1UBMS 3KQHA 3UWMA 1M2VA 3BTOA 2DULA 4JUAA 2V7QA 3IXMA 4HH3C 3LM8A 4YJGB 2QQ5A 3IBCA 3VJRA 3UPUA 4ZT6A 2ZP1A 1B14A 1C9JA 1KAOA 1KC3A 2C8VA 2F9LA 2OBXA 3AIIA 4DCNA 4BNHA 1UKAA 2WJ3A 2XGOA 5EERA 5FAKA 2R6FA 4CL8A 5K6AC 2AZXA 2HWXA 5E3HA 4CLDA 4PBRA 4Q9IA 4Q9KA 2AD5A 1RPZA 1P2GA 4HDKA 3DT8A 3U1VA 2A7QA 2GWRA 2P4SA 1ZITA 3BIFA 2BP7A 3L79A 4R6WA 4JLPA 1NVTA 1U8CB 4ALIA 2E7ZA 5L6MB 1KY3A 3GJQA 5I8WA 1C29B 2JZCA 2VZLA 3AESB 2CK3D 4JCOA 3HUTA 3L8MA 3AVYA 1YOVA 3KVVA 1L5VA 2IGTA 3PA8A 2K7ZA 1G3UA 2OMKA 4HN2A 5DE3A 4F71A 2FUG6 2W9XA 3MTIA 1DX9A 2AQ8A 2XVMA 2I7CA 5CLHA 3PLNA 1MLDA 2FE1A 1NVWQ 3O4HA 4KFRA 2GOYA 5DGHA 3CZRA 4UOEA 1AKMA 1GUBA 2DTEA 4Q3NA 3D4LA 1MT3A 4DMMA 1QH8A 3JYPA 4TLMB 3H4VA 2J9XB 3NHAA 3KAPA 3ORSA 3LP5A 3WLPA 5CA0A 4NDNE 1DPFA 1MAUA 2VHVA 3FI0A 1TKAA 2J7PA 3C6MA 2BLNA 2C3PA 2QJOA 1UMBA 1UMDB 1SCDA 1CDZA 3C97A 4YUXA 5FOTA 2YYZA 1W30A 3S3TA 3VJKA 1OV6A 3KT0A 3HYCA 4OGGA 4TS3A 5KQLA 5JTUA 2JFXA 3W5SA 3GP8A 1QQ6A 1O2DA 4QKQA 3ANMA 4OH7A 2VBGA 4YJ3A 2Z2XA 1KDYA 3UMJA 1CS0A 3WBJA 1N9ZA 1DWUA 3ZCTA 3IJPA 1RC0A 4OCZA 2G7MC 5IM5A 3ED5A 3RABA 2EATA 5LR6A 1Y9JA 2IUUA 2BMEA 2XNSA 4Q19A 3FNIA 4MCIA 5KU1A 1P1KA 2DU8A 2J3EA 2ZPAA 1NWCA 2NV6A 4M86A 4K2AA 2A9RA 3FVTA 3LIPA 3BD9A 3S2FA 1PJ4A 4CKEB 3EODA 4TTPA 5FDFA 1QVWA 3PQFA 4O4LA 2QRLA 3NVKI 1U0JA 2EKLA 1GHTA 3I61A 2Q8NA 5KO2A 1W6UA 1IY0A 2H5LA 3D5QA 1QTNA 3VTKA 5D3ZA 1ZMTA 1QYVA 3FUVA 3SSMA 1JKMA 4G84A 4O63O 1KJJA 1W59A 2YMLA 3X1WA 1P1HA 1RE0A 3AI7A 6NULA 1IJFA 1DIOB 3RKRA 3OE7A 3L82B 3MILA 1U3TA 3WLJA 1NNLA 2WJ4A 1ISSA 2GHIA 3C5WP 3GO4A 3U3XA 4G85A 3HLKA 2UVPA 3D1JA 4XB2A 1XN1A 3QSGA 5AYVA 3TIVA 4YRKA 4KO3S 2MYTA 2C1EA 1ZJ5A 5LP6F 1CU1A 1M74A 3OUUA 1JEYB 2QL9A 4DIMA 3A4YA 1YC2A 2FAXA 1FTQA 1R6TA 2DOKA 1FP7A 3AW9A 3DVSX 4L4YA 3U7IA 3GDOA 4S2UA 3VH2A 4CV3A 3ZJTA 1W0CA 5AICA 2VQSA 5FWYB 4ZVOA 5H9VA 3RYFB 4E31A 3D0RA 5KMGA 2I03A 2CV2A 4PZAA 1VMKA 3JU3A 3IXLA 4RE6A 4P3KA 4QRDA 4WFIA 3ZS9A 1U8ZA 2VTBB 4CKYA 5D87A 2FX2A 3EYAA 5AOAA 5IT9A 3EASA 1OLOA 1EFPA 4DMKA 3L4KA 1AKWA 2GZSA 1GPKA 3T35A 3T38A 2G9ZA 4X1KB 3RUAA 3VO8A 4CG2A 4V2UA 3CW2A 3UW1A 4LZOA 2PTHA 4OXRA 4Q3OA 1P1BA 1THZA 3DXZA 4Q39A 5EMMA 4II7A 2IBTA 2C3YA 5C8DA 1KI9A 1HNNA 4O0LA 4Y98A 2QG4A 2BI4A 3B7WA 4FYVA 3SS9X 1RMQA 1E60A 4HDNA 2P9CA 3I01M 4UKDA 4UHDA 4M88A 4Q1FA 3AEUB 3OBBA 4G89A 1K3UB 5JC1A 2R7AA 5E6RA 4F96A 5EWJA 3OHPA 4OAOA 3IT0A 4F6CA 3EIOA 1JLSA 1AS3A 3ORFA 4NCIA 4LXTA 3EDCA 1V5GA 2JFGA 2QN1A 1NXWA 4UQOA 3ROZA 1YB1A 3DULA 4EKGA 1J2RA 5HM8A 1LD3A 1JQBA 2P9TA 2LZ0A 1JNYA 2WYUA 4EY3A 2R8RA 1RLTA 4HNGA 4BCCA 1IXSB 1W5TA 3I2YX 4RIHA 1VE7A 1A72A 4QOHA 2IVFA 2V7QD 5JZSA 3HSYA 4OJYA 5BMVF 1SZDA 1AK9A 3PVCA 2PPLA 1AQLA 2FMIA 2HWWA 1T5OA 3UEOA 3FTEA 1JQDA 5JD5A 1T6ZA 4OLHA 1UMCB 5I47A 3BQMB 3IP8A 3L2OB 1DFHA 4FI3F 1U7TA 3AP2A 4H08A 3WGNA 4HDSA 1E0DA 1O08A 2G4VA 5FP0A 1H3EA 3SX0A 2G5GX 3H3FA 4MWGA 3IQFA 2I62A 1UINA 2O0HA 4UREA 1DXOA 5KTOA 1M2NA 2VRNA 2LTAA 5AUPB 5AW7A 5DNEA 3KXDA 1NC1A 2RGNC 5HVNA 4MVCA 3MSCA 5ESWA 2XBLA 4AJLA 3T7TA 2CZGA 1JEQB 2Z9CA 3UXMA 1PE0A 3COSA 1RXUA 4H1WA 2M32A 7YASA 5JYCA 1O9BA 3GP5A 1TJ4A 3L1JA 4INJA 4HFMA 1C7ZA 4UPDA 3EEBA 1G9SA 2CHVA 5TQVA 4FFDA 2E3JA 1U2GC 4PIVA 3CIOA 3CWCA 2WKQA 1K97A 2HK6A 1KMMA 1E3WB 3DC7A 5FBLB 2GN9A 3G02A 1UPAA 4J1NA 4OQPA 3JZDA 2EV9A 4J16C 2J7PD 4YCJA 1JWLA 2QSJA 3GEBA 3HBJA 1NZJA 1KYQA 1EX6A 1Y7IA 1P9NA 2A9KA 4GPIB 4HEJA 3C85A 4HX5A 2YS7A 4BX0A 4JI7B 2YASA 1ISRA 3OEHD 4Q9HA 1IUKA 1PWZA 1E1CB 3NHRA 4C0HA 1Y5IA 4PWZA 8ADHA 4GPTA 1KI4A 3HDVA 4EJMA 4X20B 1ZRMA 4B4UA 1JILA 3A06A 3TI9A 1P45A 2IHZA 3UAYA 4BQPA 3T4EA 1W52X 2IXAA 3ZWYA 3LOPA 1PFQA 1GTMA 4GL4A 1NONA 3VJMA 1SKBA 3C8UA 3UJ8A 1MX5A 2D1YA 2OV8A 2TMDA 4KV7A 5FORA 5GMOA 3M3DA 5C4IA 1WQ4A 5LM3A 4UAVA 5E8RA 3TL6A 4A8JB 1R5JA 1ZC4A 4XD2A 3K4QA 1RJ9B 2CXRA 1JKIA 2QP9X 1DXHA 1IG3A 4TL9A 1WDWB 1E1NA 1U0RA 2W8BA 3VQTA 4N18A 2H29A 1PAUA 5L95A 1EWVA 3JQCA 4Y0VA 4WFJA 3C45A 2BMJA 3MGGA 2YW9A 4CTNA 4C0AC 4ZI7B 3LUDA 3OE7D 5AKIA 4HWGA 4ZT2A 1D8AA 3R8CA 1HC7A 1JBQA 4X8MA 1JAYA 1DQNA 1VLLA 3BCHA 4OMDA 1KO8A 4ZRNA 4II2A 1VL6A 2O23A 2ZJAA 4GZ5A 2GAJA 3V34A 2GKOA 5BOSA 1ODTC 2VHCA 2DBZA 2AR0A 3KZVA 1LC3A 2F9MA 3E58A 1ADCA 3NHZA 4GOND 4O4IA 1V3VA 1QH9A 3MB5A 1DBSA 3DV2A 1GL9B 5EIBC 1NGSA 3WLRA 1LNSA 3IAS1 5D3KA 1ULSA 2J32A 2WOJA 3PSAA 5HFJA 4LRWA 1E5DA 4ZVTA 2AA3A 4OBBA 2XMBA 4MOWA 1BS1A 2VNSA 3PEUA 2PIAA 4H0NA 4Q1BA 3CX8A 16PKA 4QOJA 4JI5B 3VPXA 5A6VA 5FLEX 1VI5A 3ROKA 4NBKA 2P9HA 1KRWA 4BEBA 4DCPA 4KWCA 3JQQA 1DUSA 3ND5A 4FW9A 5DVZA 2WA1A 3GLFA 1C3JA 1JJFA 3BWBA 3SHTA 3L8ZA 2V3CC 4RZIA 8ATCA 1CFJA 1GKUB 4JVMA 4PAQA 1AIPA 1SURA 4V0NA 5FPYA 3ZIUA 4L5YA 1OXBB 2CFRA 3W3AH 1RXIA 1Q91A 2D5CA 3HU5A 4O5AA 5A3QA 3CLVA 4QDTA 4DA8A 1JAIA 1U3FA 4BNFA 1PW5A 2HA7A 2HJGA 2W6QA 3A1VA 2AZMA 1UKEA 2GXUA 4I66A 1JIKA 3KVRA 4JEMA 2Y1CA 4E1AA 4W1RA 3RNLA 4YP7A 3V1TC 3MJVA 1ZWKA 3QPDA 4KMMA 3CE9A 1AZTA 4WDRA 5JY1A 3H2KA 5BNFA 2V3VA 3A4IA 1NRWA 4OM7A 3IERA 1YC5A 2J67A 4DS3A 4N5DA 1Q5PA 3CEJA 1WF6A 3O9ZA 4KC0A 5FWXA 4DUPA 4E94A 3EVGA 2O8NA 1WXHA 5C1IA 2AZDA 1BH2A 2KM1A 3AEKA 3KJQA 3U7JA 4KQ9A 3VX4A 1NJ8A 3CG0A 3WRWA 4C7VA 4GIBA 1TADA 1Z34A 4URWR 3TZQA 3K1AB 3CTPA 3OWHA 3SZLA 4CQJA 1DCMA 2DETA 2I1LA 1LQTA 1NVKA 1NKSA 1TRKA 1UF9A 4DREA 3EWNA 3X2EA 2ERCA 4JVOA 5JAIA 1OZ0A 2P6PA 3BTUA 4XX0B 3N5CA 1IM5A 3NT5A 2XIQA 4H4EA 5AI8A 1TCAA 2JFZA 4X3PA 3VR4A 3OX1A 1H6AA 2HEGA 3ROPA 1CF2O 5DW3A 5LIPA 3EVEA 4WOCA 1QIIA 4BNMA 3DEJA 1WZCA 3VZSA 1FK8A 2X1HA 2H54A 1YSCA 2HLPA 1QHFA 2YX1A 3E7XA 3KPVA 3O3OB 4MEBA 1RRCA 3SEQA 1WW8A 2OPBA 3ADCA 3QBDA 2H17A 5FBHA 3T61A 1PZNA 3OIVA 5H02A 5HJ7A 1E7QA 1XZQA 3G6WA 4JJFA 3GGOA 4A92A 4R2WA 5B4TA 1G9TA 4Y2SA 2RGGA 5FR1A 1M8GA 3CLSD 1NY6A 2JIOA 4XJSA 1NFRA 2C82A 4QFMA 1KEWA 2NU7B 2L42A 3PQ2A 4G0XA 4M7WA 3WR5A 2OLKA 3WSWA 2QX6A 4ZODA 1QIKA 3CUYA 1IEVA 2SNIE 1SD2A 2HXGA 1P4JA 2Q0HA 3F9CA 2O06A 3L0IB 3M4JA 5JH7B 3EF3A 1RBQA 3R3WA 3W7BA 2VHJA 5P8WA 1ZHHA 1WOMA 4KQWA 2WD8A 3VZQA 2FDXA 4FSXA 1WO8A 4QZVA 4TTIA 4G5GA 2P1DA 3ZI7A 1CUGA 1KMIY 1IWOA 1X42A 1Z0UA 3IIIA 3DKVA 3DO5A 3L7IA 4C1BA 1ZNXA 2VHUA 1O87A 3GVPA 2ZBPA 3VBCA 4QVKA 4TSKA 4C20A 4DDMA 1NW8A 3HK2A 1KI8A 2X4DA 3I52A 1A9XA 3DLBA 5CFMA 1SHLA 1UANA 2DEUA 2GZHA 3ZX4A 1KEKA 1K7EB 1QO7A 1MABA 4H15A 4QXPA 3OF5A 4EH1A 5B6PA 3QFFA 1UT8A 3W8EA 3Q4GA 2W2XA 4G0OA 4ZDJA 4FM9A 3PDIB 4KU4A 5IF3A 1U2TA 3KZOA 2ONJA 2VKTA 2ZS8A 2X42A 1X7YB 4NDZA 4HJXA 1PNTA 2RGEA 2H4XA 1WUIS 3DQZA 1RYFA 1SVMA 1AE1A 2CYBA 3EIEA 3PG5A 5CYGA 1I2DA 2AWNA 1PF7E 1UDRA 2RHRA 5JXGA 1NMSA 2I80A 1NVVR 2Q5FA 1R6XA 3PPWA 3PZRA 4FYKA 5FWAA 4DL9A 2QORA 2WLTA 3N87A 4E5YA 3HTXA 2R4TA 4MUMA 5EZYB 3Q0TA 2VT3A 4QFBA 2I34A 5FUBA 4B7ZA 1FJ2A 2VZ0A 1COZA 4PLVA 5EWLB 1YH3A 1QZZA 1DCFA 5D00A 2IH5A 5F9MA 1X7GA 3FMGA 1L1FA 3DWFA 3PC6A 2EX1A 3BKXA 3LUBA 2VP6A 3RNOA 4BL5A 1YQEA 4D3XA 3ZJUA 1Z2NX 4L8WB 4EHAA 1T35A 3EVAA 3ZWKA 3GH3A 4GSKA 1QR6A 1NP7A 3G8BA 4JNKA 5LDHA 2BSQA 3ZLUA 4IQFA 1XPRA 2H1HA 2GM3A 3QU2A 3L7LA 2Y4NA 4ENWA 1S2NA 1YIDA 4OQYA 1NRJB 3EGXA 4NAHA 2FPRA 5LNK1 4R1LA 5EE9A 5E1BA 5J58A 1FX0B 2GPBA 3F46A 1RW4A 3T3EA 3PLRA 2Y2UA 1WZIA 2ORIA 4D1YA 4E13A 4DY6A 1MO3A 2FPGA 2HK7A 1Y37A 1G8AA 3JRWA 4AJKA 1YZNA 1UT6A 4UARA 1MUUA 3HU2A 4E1BA 3AKZA 2H3EA 2OCXA 3F6EX 3JQPA 4KX5A 5J2UF 1T34A 3P9KA 4BX9A 4TMFA 5DEOA 4OP1A 3FFTA 3K05A 5HIAA 2LBPA 4E4RA 4B82A 1RLJA 3G1TA 2F2TA 3E4DA 3W5BA 1WHTA 5BRNA 4QLOA 3VH1A 4DGQA 3CEAA 3KETA 1DAKA 4WACA 2J9GA 1LPBB 3DMHA 1JXMA 4K9LA 1KFBB 4UDXX 1C30A 4UPVA 1ECBA 1LQ2A 2Q07A 3K9LA 4TLAA 5JFGA 2CXQA 4KN6A 1U90A 3VSAA 4C7MA 3BIOA 3IYLW 1CQIB 4EGAA 1LWOA 2OV4A 2W42A 2BKVA 4KNVA 5ELXA 2DQSA 1P5HA 1X1RA 3AHEA 4E1VA 1GPNA 2HDHA 2XD4A 3GBVA 3N53A 3GFBA 4LSGA 3WKCA 3VKGA 1I3CA 2VQ6A 3MG9A 5DLEA 1VBFA 2E5LB 4A8PA 2M9MA 5IAGA 3USCS 1Z7BA 1A9YA 1DELA 3PNYA 5KQSA 3U7EB 1R0WA 5KVCA 3DYBA 4JP8A 2RIPA 3SIXA 4CEJB 3AXTA 1BMFD 3VR4D 1U0BB 3KE9A 3FTCA 2AMYA 3F47A 3HUUA 3PT9A 3FPSA 3QLUC 1A77A 5EAIA 1D0IA 1E4VA 3EH2A 3L4BA 3GPDG 3CE6A 2O4UX 3QYJA 1FA9A 1GDHA 4GMDA 3SQWA 1IM2A 2AFIA 1S8NA 2PZAA 1JSRA 1H1DA 1NBEA 3F7MA 5AOVA 5BQ5A 5EUBA 4AMYA 1Y1TA 1CIVA 3C7AA 4DAOA 4NNOA 1U2RA 2XIJA 1AOXA 3EK2A 4P3OA 4DLXA 4JR2A 2FPMA 2PWAA 1A9SA 3Q2KA 3RRFA 1JF8A 1U2EA 3S4YA 2WUVA 4RIIA 1PS0A 5F9FA 1A9ZA 1YKFA 1ZUD1 2D54A 3UAOA 4CYMA 2XKAA 2FPSA 4IIVA 4ZQCB 4YGXB 3ZI0A 3TLCA 3BM5A 3CNNA 5E9JA 1ZLYA 1Y6ZA 5FNVB 3QNMA 2NP7A 3W5HA 1N0UA 2FWJA 4OA5A 2QUZA 4FE3A 5K09A 2IYEA 2B94A 4DV1B 3BG5A 4UNQA 1DKMA 3CRRA 1BZYA 3IE1A 3R0QA 1BCSB 3K16A 2ZDHA 1CDOA 4R1NA 4FC6A 1YZ3A 3ZTTA 4NPAA 2ZG6A 1RYYA 2IEGA 1UPCA 2IQIA 1XO1A 2J3QA 2HF9A 4Y2JA 3U3OA 4E7OA 3O8DA 1ZY2A 3JQFA 4GP7A 2A5FA 4M0UA 4NMWA 1W0JA 2EOAA 4JFAA 4GT1A 4BVJA 1VM6A 2ATIA 3IJ5A 1M2FA 1Y1QA 2YICA 3L0PA 5CIWA 4ZQGA 3PJGA 1IH8A 1POWA 3DF7A 1TVCA 3UHOA 1P9WA 4TMKA 1MH1A 3GBPA 3GRZA 4CF6A 2WWIA 4BGVA 3DKRA 1XK7A 1G5IA 3U4QA 4KE8A 5FR2A 1Z15A 2OR3A 1L8OA 1FXWA 2B21A 4F5DA 3PR1A 2OSBA 3SEZA 1A9TA 3I6QA 3W1EA 2FW8A 1T8SA 3AJ9A 2PU7A 4N3CA 4U9UA 4E5VA 3T9BA 1E66A 2J85A 1H2YA 4TZ0A 4F21A 2AW3A 3GCDA 5GM1A 5CX1B 5I7AA 1B8VA 4HQNA 1LSUA 1A5SB 1GVNB 2PKXA 3NP9A 2BDEA 4FYIA 1L5QA 3RYIA 3ZYCA 2NU9B 4CKXA 3RIEA 4ENPA 3EPHA 5AIAA 1BE6A 1KS9A 4B3CA 2OQVA 1YJQA 4F38A 4HEQA 5DXJA 1NLMA 1MOPA 3LRPA 1L9KA 2F3TA 3RUFA 4J0JA 5FO1A 3WLFA 2WJ6A 1HORA 2J5RA 1QDEA 2WK1A 2R65A 4FOLA 5M3BA 1CIPA 3CZ9A 1PLKA 4ZPXA 3AUKA 2P69A 4OPMA 1BKDR 1JHPA 2VDWB 2XEDA 4Q1DA 2NO5A 3H1AA 4ZV7A 1RI5A 3T7AA 1CC1S 1R10A 2LGJA 4N6NA 1J9GA 2G09A 3L84A 3ZHYA 2TECE 1OY1A 1EG7A 1ZUNB 3L7KA 3KG2A 1WD7A 1SNYA 1PJAA 1VXOA 5TT0A 3K70C 1EJ2A 4YI3A 5BWNA 1JP7A 4LZPA 1V39A 1YJXA 4KLCA 1LVHA 4ZYVA 5JJBA 4MQLA 3MCTA 3FVRA 3IPYA 3W2IA 1J8YF 1D5WA 3G2JA 5IUJC 1K4KA 5LWQA 5C8YB 1QRUA 5E0OA 2X1MA 1EUQA 3EHDA 1TLTA 4DR5B 3LQQA 4TT3A 2EJBA 5EFOA 2VXCA 1JEEA 4HS9A 3ZDXB 4RDHA 1Z2CA 1XRSB 2OT3B 5LB2A 5DBFA 2PKYX 2IEBA 4JSRA 5FYQA 2FEMA 1RWWA 5AT1A 3ONEA 2IYYA 1FBNA 3GZNA 5A9SB 1EXVA 1SFRA 3CLTC 3STYA 4CZ2A 5K7SA 3E2IA 4DR2B 5GZ3A 5FRDA 2EFYA 3WYCA 3R9WA 1H3FA 2VEDA 4AN4A 1GSOA 3VXKA 1IEWA 4ALNA 1UXKA 4I50A 3OLVA 4P1ZA 1NG1A 3SVZA 2BKAA 3D6FA 3H4MA 1NVEA 1SC3A 1TYBE 2CDBA 2EGUA 2V0GA 4K28A 4HGZA 1KFKB 3HKBB 1A7UA 1G8HA 1Z07A 5F7JA 3RI3A 1L5WA 4PZZA 3LQRA 2FR8A 2RHGB 1P77A 1DCKA 3UJDA 3KOXA 2QL7A 4CTJA 2OAP1 3QV2A 1Y4ZA 2E4VA 2Q5QA 2INGX 3QVKA 3ANXA 4BVFA 2Q3FA 1RR6A 1BE0A 3SM3A 2GBGA 4LDZA 4LCEA 4LXHA 4WL0A 4EKNB 3JQ9C 4INAA 4O2BA 3QVMA 3HBMA 2XRMA 2Y1FA 5C1PA 2CDRA 4FX5A 1JX6A 3EEIA 1RYDA 4HQOA 5FCDA 1U6JA 5IM4A 3U4MA 3M6MD 4UEQA 5IJXA 4PO1A 4D3SA 1UBNA 5I45A 1UP4A 3AVPA 2XZTA 4DLNA 1F5SA 3KOMA 3G7NA 3CBQA 1LFAA 1CUAA 4OHBA 3UK6A 4YPFA 3VPGA 3Q1KA 3ZDEA 4DCMA 3OZFA 5T5QA 4AWAA 4BNZA 1G4HA 1XLTC 4C88A 1E2GA 1DV2A 1KBOA 4DCGA 3JWJA 3AVVA 3EW9A 1P18A 4FGLA 4H1UA 4NBTA 2K5UA 3VDQA 4GBJA 4P7JA 5J4YA 2LKCA 1ATZA 2P8JA 3AY6A 3JYNA 5FIUA 2WM3A 3ONDA 5AD1A 4F91B 1L4YA 1LB1B 1TA9A 2PQ2A 1V6CA 2VZ9A 3J7TA 1T0JB 2M2IA 4NPCA 3CPSA 4YHHB 5JU6A 4I9FA 5TJ9A 4NCHA 1JIUA 1U94A 4US1R 4EG8A 3JATA 4GLBA 3THXA 4QGFA 4IFTA 5DISB 2F1IA 1KIAA 3DW3X 3P97A 1EFUA 5F3WB 1GDTA 5I51A 1DBPA 3GIDA 3ZN2A 3OJEA 5KYNA 1LLDA 4JVLA 3HCAA 4X90A 4RKRA 3ZW7A 2Q6KA 3ADBA 1X1SA 3HKDA 3C43A 3UT6A 1EE2A 3GI1A 3L0OA 1FQOA 4I8XA 2X0RA 1K5GA 4FR5A 4QPNA 2QMUA 3HWX1 3FOWA 3LBYA 1Q3TA 3Q7EA 4MW5A 1QZ3A 3DDUA 5EFZA 1TF5A 1PT5A 4NP6A 2KBFA 4Y18A 5BSTA 1L7PA 3D8RA 3G2HA 4JLBA 3R0XA 4H1HA 1GCIA 2ZJ1A 2NUAA 3DCJA 5BWLA 4JA2A 5KDOA 1UKYA 2JIRA 4I9UA 2NXWA 1WTAA 3GAFA 4E2YA 4GP6A 3DONA 3VDXA 3EE6A 3Q5DA 1YS9A 5JZ9A 1N5KA 2IQ5A 1C14A 5ADHA 1K2VN 1Z45A 2W2VA 3GLRA 3IP3A 3NR2A 4P4SB 1N8NA 3STVA 1N36B 4FZJA 4Q6BA 4NJEA 4KRXA 3F6RA 4IVRA 5L3VA 3A32A 3GA0A 3LU1A 1SA0B 4FUQA 3RRYA 3PICA 3THWA 1JA1A 5HF8A 5EP2A 3UT5A 4UNRA 2P78A 4XDHA 4OBXA 3TNDA 1XTPA 1ZGHA 3ZGZA 1XFDA 2G72A 4OFWA 3EBLA 4Y6RA 3IUSA 2XOXA 4MQ4A 4C76A 2BHRA 1DHTA 1FE8A 3NHMA 4JH0A 4LY6A 3SX4A 5BT8A 2VF5X 3HABA 2SKDA 3O94A 3PPYA 1W7AA 3LC7O 4UNPA 3D4PA 3U1TA 2JFUA 2CLFB 3LQYA 4MQUA 3I34X 3JVIA 3OZAA 4G01B 4L8FA 2P6UA 2Z08A 3OOHA 2IV3A 2A1TR 3I6YA 2WYVA 4X63A 5DM0A 1Y98A 2BFFA 2FYTA 4G0MA 4B33A 3BAZA 3OLXA 3NO4A 1GQRA 3LJKA 3OU2A 3FMIA 1R5BA 1IZZA 3JQAB 2DBRA 3OZSA 4I8DA 3TVYA 5B36A 3SJZA 2X3YA 3JVVA 1U7OA 4C05A 4W5OA 3MJEA 1FRNA 4XZ3A 5CW2A 2XT9A 1XGKA 3GJTA 3LP8A 4YO7A 5JSZB 3OQHA 2O3QA 1ADFA 3ND9A 5ADWA 1TLLA 2E82A 2ZBDA 2YYAA 3VTAA 2DWOA 2P4HX 5HUJA 2AIRA 4Z4CA 1AK1A 1SD5A 2P27A 3KEMA 4FWBA 4IIJA 2O2EA 1FVOA 3E3MA 4TT3D 3VH3A 1QRAA 4KEAA 3ZQ4A 2H1OA 4KVFA 1GUFA 1ESCA 3I39X 4MROA 4HYEA 4YJHA 5BSEA 5DW0A 1RYMA 1LH0A 1PZFA 3PDJA 4RPLA 4HPXB 2HF8A 2QR5A 3P9SA 4FMCB 5ARCA 4FINA 4M37A 1G21E 2AN5A 4A2QA 2VSOA 3WKEA 2XWSA 4M9ZA 5G0VA 3KB2A 4EARA 5HQTA 1BKSB 1K5HA 3G2LA 4K9OA 4GZ6A 2FETA 2XY4A 3GLKA 3NPAA 3GLHE 4GXQA 2VPQA 4GKBA 1QQ7A 3AH8A 3S0JA 3SXPA 3RK4A 2QV7A 4O2RA 3AINA 3B20A 4PR0A 4HPJB 3LY5A 3OWXA 1WKBA 1MJ5A 2GCOA 4U6NA 2NUPB 1UBCA 3SHFA 1E3QA 3EPPA 4V0RA 1ZM3A 1HDCA 1RKBA 1V8FA 2X7HA 4AUKA 2Y1EA 1AS0A 2FLVA 1HQCA 4J6FA 3MQ2A 2D2VA 2W4QA 3BWXA 4YDQA 3AR5A 3DMRA 4LPKA 4EHBA 4CKWA 2CHEA 3HEBA 3OAAA 3QVXA 5AXCA 4PC3A 3K9GA 1E79A 3JYHA 1NM5A 1U5BA 1M1YB 3LPNA 5KZMB 1QYCA 1E6MA 1OI3A 3MIIA 4AQYB 1UWLA 2JB9A 3BCRA 5A3RA 4CLRA 4CIXA 4ZOEA 4B35A 1VHWA 3IP1A 2P79A 1EWQA 8OHMA 3O7WA 4RA9A 1AGYA 3JARB 2EFJA 3UAXA 1BW9B 4TWJA 1DJLA 5AJUA 4A8TA 1JYSA 1EKXA 1ZOPA 3KT6A 1P4RA 5FPQA 4CKCA 1LQUA 4CF7A 4PO3X 5LOVB 5FPKA 4QBIA 2YQZA 3RK1A 4JJIA 1R16A 3Q2IA 3BFVA 4TT8A 3TVTA 2UXBB 1WP4A 2VSNA 4KXLA 4ENSA 1GKLA 1GNQA 3INYA 3VC7A 4K8OA 5ALYA 3I0ZA 3S29A 2D8AA 4GLJA 1P5ZB 4EPXA 2JVJA 4Q4JB 1A71A 5HW0A 2A0UA 4CT5A 4N7MA 2HLDD 3U60B 4EHLA 1AU9A 5EP1A 3F8WA 2PJUA 3IEVA 3SEAA 2GN0A 4HNTA 2LW7A 2XZPA 2Q3MA 1AKTA 1BCRB 3N8HA 2PEZA 1CUXA 3FFAA 3OZCA 2NO0A 3PWSA 4ICIA 4PONA 2O20A 3LDGA 1Z08A 2Z8ZA 4U0KA 2QSYA 3FDZA 4HLNA 4Q3CA 4D0GA 2C9BA 2XMCA 1BXRA 2W83A 2XHZA 4FT4A 1HX7A 2Q46A 1EE1A 1SCUB 2HU8A 3B2NA 3CT6A 3FNQA 1YBVA 4NMLA 2Z9DA 5AP9A 4Z86A 4QE3A 2G80A 4ZCRA 1C8BA 1T0HB 1F0NA 1ZEJA 2J6CA 5ECGC 5BVGB 13PKA 1Y9EA 3ENWA 4GM1A 4IEFB 1E1KA 4ZJZA 3W2FA 3RHTA 4EO9A 2X6RA 2FJUA 5HIIA 4Z1MA 4TMXA 5K6TA 3C6QA 4P2BA 1G5RA 5HMMA 4LOKA 4PZUA 2YWDA 4AJ2A 4FHZA 3DJYA 3PXAA 3U19A 4OUKX 2GK3A 2IYXA 3MJTA 2R2AA 2J09A 4OA8A 1DG9A 3JQ7A 2ZROA 3LFHA 4E5NA 1ZWLA 3B5JA 3VU0A 3MM4A 5EYPA 2IODA 5B3AA 2HXYA 3TL2A 4ZHQB 4MHTA 3ZDRA 1OWLA 1L5HA 1QLJA 3UAGA 2XEXA 3KVNA 3WWCA 3LUHA 4CVNA 2GBFA 4OHYA 1IY1A 1NXPA 4MRVA 5TV2A 3S2SA 1DQRA 4ZU6X 2QD2A 4FYJA 3ZHBA 5B30A 5JDIA 5KJEA 1QS0A 1G5TA 4O08A 1IQPA 5GVSA 1ZRHA 2CJWA 1AZLA 1CT9A 5AVXA 1W88A 3IAHA 3PNSA 4CM1A 1VBMA 4XR9A 2OCGA 2X8BA 1T1IA 1MIOB 4UATA 1OFGA 1UXIA 2F9FA 3GRVA 4HP8A 2DECA 1B3RA 1YB7A 2V0NA 1THMA 5DSXA 1RCTE 5H4HA 4EY6A 3OZVA 2ZSIA 3BWEA 4YCDA 2Q4TA 4RLQA 4CF4A 4FQ7A 3CMMA 3R3HA 1H2ZA 4WESB 1XRNA 4BQNA 1JFTA 1QVVA 1Q0LA 2JRLA 2DE0X 3BHNA 4LDRA 2IUTA 5AVWA 3TTWA 4BY9E 1G3RA 4KUHA 1VGVA 4DZZA 5GJWC 1TA0A 4R83A 4IV8A 4PZLA 3PITA 2B5OA 1N7GA 1YBFA 2E87A 5HKBA 1FZQA 1MJGM 1U1EA 3RF6A 3RG2A 2PYDA 4CM4B 3QF4B 4JNCA 5JYEA 2QJWA 1SWVA 1ZL0A 3VVCA 3TZCA 2O8VA 1RWBA 4ML3A 3RIXA 3WDSA 1ORVA 4BO3A 1KBZA 2EZ4A 1N8KA 4BLSA 2R11A 4DTCA 3EB9A 5IVKA 1NFFA 2IZ7A 3RBXA 1XLWA 4ER5A 2V6FA 5J3JA 4FQ5A 3NKFA 4EYSA 4YV2A 3K6RA 5F21A 2VT7A 5BSRA 1HT1E 3FYHA 3RR2A 5JISA 2E5FA 3HLTA 3MTAA 3S27A 3RAFC 4Q7LA 1VFPA 1NI4B 2I9PA 2QJFA 4I1YA 3F67A 4LC9A 4MVJH 4AZ3A 1KJ8A 1DQSA 4ZYZA 1X7ZA 4MUIA 5C1BA 5C37A 4GR9A 4RFVA 5JQGF 1T6XA 1SVIA 1ZD4A 5JAUA 4CM7A 3OAAD 2BKXA 3CO5A 3P1JA 5CB4F 4KBYA 3ZDYB 3ZEIA 1SOUA 4KG7A 3HFGA 3V8MA 2WHYA 1XTIA 4IDGA 4KP7A 4US2R 2HH9A 1OI2A 3SF8B 1QGZA 3TSAA 3Q8XB 2O3RA 3F3YA 1L9XA 4F45A 2VUUA 1OTHA 1P73A 2X1VA 4K46A 2JFBA 2WI8A 5DP2A 1QO0A 1PL0A 4QUBA 1W4AA 2BM1A 1PQUA 5KI6A 2FFQA 2V97A 4AB1A 1G7RA 4NZPA 1ZIOA 3O92A 2ESRA 5LC1A 4KI7A 4DSNA 3WLHA 1YI8A 4HN9A 3N6VA 3RKUA 1U3GA 3P0RA 1BA2A 4BOYA 2ZUEA 3G9XA 5DM4A 2G6TA 3AR7A 1MDBA 1XCLA 5GM2A 2XF2A 3T06B 4DDTA 5U4XA 4MW2A 4O2LA 4DYDA 5GY7A 3G2KA 3AZPA 1MB3A 3A6GA 3N8DA 3U3JA 1IVSA 5IDYA 3A9WA 4RH0A 4G9GA 1FLNA 3I6ZA 5JNTA 4IHQA 3V5NA 1WBJB 1D3AA 4PZEA 4MW9A 2ZYDA 3CS3A 3HV2A 1RKVA 1DRVA 1UDXA 1GA4A 2CHGA 5FPPA 3PFKA 1GQ2A 2FPIB 4AZSA 4L9SA 4XOUA 1F2UA 2G9UA 1YKGA 3CNBA 3GHYA 1ZXLA 2YS6A 5JNRA 3KCQA 1OYVA 1ML3A 1CG6A 5G4KA 3Q7QA 3OCXA 5MGBA 1LWNA 1FFGA 1R3DA 3GAZA 1GGNA 4FZ3A 1SK8A 1NE2A 3BRSA 5JYDA 1L5YA 3CISA 3W2EA 1HL7A 5KSYA 2RDMA 2XWQA 3VC1A 5JRJA 4YJ2A 4L73A 1R6VA 3DG9A 1AUOA 4YMGA 3DOJA 5BR4A 4TN1A 4ZVPA 1RXVA 4A5OA 2VPIA 3G6KA 4DANA 1HEUA 2XT6A 3BD6A 4R1MA 2AOTA 1PWYE 3VNQA 3DCNA 4ID9A 3WQBA 3E6AA 4NAUA 2WHEA 3A1UA 3NETA 2FKAA 1HY3A 2JARA 2KYRA 4HG2A 4LHYA 4MQFA 2ZRLA 1J7KA 2C07A 2HIMA 1DO0A 2JCSA 4FIZA 1VGQA 3R7AA 3WP1B 2R8YA 1UBOS 3M89A 5JS7A 3T95A 3EULA 2YVQA 4LQ4A 4XAQA 1RC8A 1NAIA 1WQ3A 2VOJA 3ZWWA 1IFXA 3FOAA 1LLFA 3WNZA 3E7WA 3TFOA 2P5YA 1KYWA 4KAXA 4QYXA 5CVVA 3WV5A 1NPYA 2J9FB 3G85A 4K6GA 4FBLA 1JSCA 4Z7JA 1JTEA 2IUYA 3MYYA 4Q1VA 3SYMA 3W4KA 3QOXA 2VVTA 3NTQA 1YCHA 5EXEA 1F6DA 1HE3A 3NFRA 4NE7A 3RU9A 1XR3A 4FMPA 2WJIA 2WV7A 4UE2A 2XUAA 5F5NA 3B3FA 4RLHA 2YN4A 1IN1A 1SQGA 1EXNA 1A82A 2PH5A 2RHBA 1PJZA 2BCGY 3BZUA 3UBTA 5I4BA 2QLLA 1D2GA 4Y0NA 3X1ZA 5F98A 2ZBQA 1RM5A 1RWOA 5C8VA 4D0LB 3DS8A 4JJ4A 1RVV1 4HQFA 3RS2A 4AJPA 3K8YA 3A58B 1Y6RA 2H2FA 3ND8A 1M3SA 1WDKA 5FJJA 1TW3A 4KR7A 1EUDB 2NO1A 3C7KA 3IDFA 3MUOA 4NK4A 1H2AS 4MSUA 3HFRA 1Y3IA 1ESDA 2P2CA 3NLLA 2CVPA 2VF7A 2H1LA 5HILA 1OGIA 3C6YA 3ZHTA 5HE8A 2O8EB 1JGTA 4IH4A 3TEJA 5B7GA 2C4HA 3DV9A 3VM6A 1ARZA 2QM3A 3R9XA 1X7WA 3LO8A 2A9QA 4HDRB 3BWMA 4K9KA 5IDWA 4BFZA 2RH8A 3ONNA 4DSOA 3SQMA 5JASA 3L7AA 2WF8A 3FRHA 4RM3A 1E4EA 4AY4A 5CLJA 5LMZA 2AF3C 1XZKA 3B9RA 1MRZA 4XRRA 3LQ1A 2P7IA 5HMLA 3FRIA 1A88A 1T9CA 1ZN9A 4YRFA 1KAMA 2PA0A 2QT9A 1LDBA 3C4JA 3H6GA 2OB1A 2JGIA 4D44A 4H18A 3JQBA 1XD9A 4HNHA 3TLJA 5B1IA 4Y9UA 1DAPA 1ECGA 1UC4B 3FTDA 1VCMA 2DSNA 1WR8A 3C1OA 4ZQIA 2RHTA 5IVDA 4A6XA 4BP3A 5HSGA 2LUOA 2YWEA 4GNKA 4EJSB 2I4TA 1F1JA 1XWWA 1CV2A 4PNZA 2A86A 2P65A 2VDVE 4TL8A 3OBIA 3ZWCA 4PG8A 2ERYA 1QO9A 5DSTA 4WKNA 3U81A 5BSKA 2QJTA 3OQOA 1H2FA 3VJLA 2AS0A 1CXZA 4KLAA 3A0UA 2XB2A 2P4EA 4ZC1A 4RJTA 3B9BA 1C1HA 2QRHA 4HAOA 3O73A 2AYYA 2JGEA 1VE1A 4DRXA 4TLEA 2JIPA 4F4FA 2R1TA 1E59A 2V55B 1KHTA 5SZHB 3DOEA 3H1TA 4E21A 3PTAA 3WHLA 1NUUA 3WOHA 4HQLA 1MMFB 4W63A 4YMHA 1K9SA 2OFWA 1XRJA 4RD4A 1CY4A 1JQJC 2ADFA 3IEIA 4MRSA 4JZYA 4XCXA 1OIXA 1C0LA 1H66A 2B9VA 1K88A 5TMBA 3RT9A 1QO0D 2SBTA 4P9NA 1FTYA 4C3UA 3PNMA 4HS4A 4NATA 4JY7A 1T1EA 1XZPA 3H9JA 2CKMA 1PUIA 2WG0A 3K0CC 4KXQA 3KTAB 3KSZO 4BE4A 4BWFB 3T0IA 4C0WA 4ZV9A 4W8HA 4UFPA 5DPMA 1UWCA 4LY9A 1AGPA 4BRWA 1M2EA 4X1YB 4KIWA 1MJHA 3EZXA 4E4YA 2I65A 3EMBA 3COPA 3EWSA 3L0YA 3ZGNA 5J4LA 3L07A 4N0PA 2AMLA 5H81A 3KFVA 3T34A 1ZR2A 1JLLA 1ZK2A 2ACKA 4CUZA 5B58C 4TWIA 1Q74A 1Y48E 2R8XA 3A6LA 4HB3A 1QOQB 2XWPA 1QHHA 3CPEA 3I2JA 4EI2A 1R0KA 3B6IA 2JBAB 2QVCA 3GVIA 3NZEA 4U63A 1DIHA 1KPGA 4QNNA 1PVDA 1XZFA 1E2EA 5CUQA 2WUEA 3PC8A 3IP6A 2V9PA 3HB7A 4XD7A 5ULLA 1W2HA 2E4WA 3TTSA 2VF4X 4RACA 5HKKA 4RFSA 4UNSA 3RFXA 2QNBA 2ZYVX 3BIXA 4NJMB 3I9FA 2GTIA 3WYNA 4BEJA 5JYBA 2YHIB 3EA0A 4RZQA 4FWTA 1T9AA 3F7OA 2GZRA 1LBSA 2HF7A 3QLEA 4DR3B 1MEOA 1P29A 2V7XA 5AJWA 2JLVA 1YXMA 1ZGAA 4R1UA 2BFDA 3HCFA 1YULA 4EA6A 1S1MA 1X13A 2ZIUB 1SVNA 1FQWA 2OCKA 5EJIA 3PEVA 3T5CA 1UC9A 1PWXA 1J07A 3ZWAA 5IVHA 5SICE 4HAXA 4KX3A 5ELMA 5HJ5A 2Y0CA 5B64A 3O8OB 5HOEA 3DF9A 2WJZB 5DF1A 1H6DA 1OXMA 1R0CA 2ETXA 2XZDA 4BN4A 2ZEJA 2XQKA 2ZR9A 2HCTA 4I1PA 1ITZA 1B41A 1T3LA 1Y4AE 1ZCFA 2AHRA 3OESA 4WXRA 4TTRA 3RYCA 4OYLA 4ZVRA 4EYKA 4Z6KA 4ZVNA 3JASB 3ZLVA 2ODPA 2PWYA 4TOIA 1WNFA 1VKHA 1DEXA 4DV2B 3GVHA 2BEUB 2B8WA 1NRIA 3KD2A 4PRZA 1DNPA 2ZAMA 3KAJA 4R01A 2YV4A 1U8YA 2H65A 2W58A 4Q0MA 2X2OA 2EHJA 3RBVA 3U40A 2HN9A 2ZRHA 4K1LA 3AR9A 1MGPA 4B44A 3LQKA 2XMZA 4MS3B 1H9AA 1E61A 2WF5A 1YWGO 4MRNA 2CB0A 2MR5A 3I58A 4HAZA 3EG5A 2VJBA 3KRTA 4QHTA 2W4IA 4HT3B 1VP9A 1YJ5A 2N75A 4X8HA 4R9VA 4ZVQA 2B1JA 3TPCA 1B74A 2JHPA 1I3NA 1ZSNA 1PV1A 1SQSA 4P54A 3QE4A 4RTOA 1U5AA 2ZVPX 1LPSA 2XKKA 4B3FX 5I9MA 4LSWA 3M3HA 5TXGA 3TMYA 4C3ZA 1CUIA 5IU6A 5C7YA 1ENZA 3HB5X 4KVZA 3AY7A 3FWHA 1W4RA 3EPKA 1LU9A 1B1CA 3F6PA 1Q7CA 2QNIA 4QRIA 2NT4A 1BTOA 5JG7A 1G42A 2GERA 3AVOA 4G0ZA 3FUWA 2QQFA 4XDYA 4EITA 3EUEA 3LLVA 2EFDB 2GPWA 1WJGA 2V45A 4J94A 5BN5B 3GG2A 1S9HA 1YR3A 1VJTA 1RKQA 4MZDA 4RD3A 1JV2B 4U2EA 3FPEA 4OFXA 4J75A 1VMEA 2NZYA 3MAJA 1IG0A 3N6XA 1JRLA 1JFRA 5G3YA 5HG0A 1QQAA 1EFKA 5HIKA 4QJ3A 4MPDA 4G23A 5EUCA 8GPBA 3PIDA 4AXBA 4G56A 1MEEA 3R23A 1H1LB 1W8DA 3LY9A 1HT3A 3LUGA 4AN0A 1L5SA 3NM4A 4CLHA 3I2FA 4KR9A 1G41A 3EFHA 3NORA 8MHTA 1Q2UA 4IBOA 2YIMA 4C6SA 1HZZC 1KI6A 2YWFA 5DCYA 3JD0A 3O2JA 4TS4A 2QD3A 1XMPA 4Y1GA 5EXDA 3IEXA 3ZWPA 4UTVA 2I7DA 1GPYA 4F3YA 4L22A 1YASA 2CWWA 3D8HA 1SUCA 3QKIA 4FVTA 5GGXA 3SAJA 1GTL1 3TOVA 3I2KA 1QIEA 3J7AC 1NSFA 5KREA 4B3SB 1DKRA 2C2WA 3ZDBA 3LW8A 2H1WA 1VSVA 5KSZA 2O5VA 2AUMA 1U1IA 5C46F 5JWRA 4DIUA 3LK6A 2JI7A 3Q8LA 3VAYA 1NQAO 1TW2A 2JAPA 3D3WA 4TYNA 5HWSA 5TVKA 2VDLB 4LBZA 4NV3A 2E85A 1QVRA 4W9NC 3ZD6A 5LIRA 4MB6A 4HZUA 1VJ1A 4W8GA 3JWIA 1KE2A 1N2IA 1TO2E 1J90A 1OOEA 2P9ZA 2AFHE 2W6CX 3MNFA 3N2LA 3RFUA 2JNWA 2WZDA 1Z0SA 1B0UA 3QLVC 2ILTA 2F3RA 3MWLA 5LQKA 1K68A 1M2OA 1W44A 2WW8A 1RI3A 1STOA 2ENWA 3IP5A 4IHJB 4LJSA 4O2AA 5T57A 4F0JA 5IKOA 1TPZA 3TM4A 4UHFA 5I5EA 2PL5A 5EJ7A 3QFRA 3DEAA 4J91A 4HWRA 2NADA 3L1KA 3U56A 1KI2A 1JBEA 3Q3IA 1M2JA 1DJPA 2Y9MB 2JC3A 4M54A 4MPTA 4KITB 3OTHA 4M0LA 2IPLA 1GKIA 4G1UC 2J0UB 3TQRA 5FQNA 1L7BA 4HUJA 3L05A 3LUPA 4YONB 1F06A 2P75A 1X9HA 2P0EA 1QRTA 2Q2OA 2YQ5A 1JALA 2F55A 4IOKA 1UJ5A 3BVPA 3L5OA 4NYMQ 4X24A 4DJEC 4EKEA 7REQA 4IIFA 3ILYA 3LWBA 3CZ4A 1G3IA 3HJAA 2ZWVA 1L4KA 3F6BX 3DZ8A 1TT5B 5KYXA 1T2AA 2AMFA 3RS9A 4PHHA 1OU4A 1YGPA 1ORHA 3CLSC 1KYIA 1L4BA 3INGA 3EZFA 4D5EA 1Q16A 3JVEA 4DLWA 2YVKA 1R8XA 1KGSA 2IYPA 3FZNA 3DWIA 3B6KA 2W2TA 3K1JA 4KQXA 1V11A 4G1MB 1CIJA 2HO4A 3TUZC 4R0VA 3K73O 3QEAZ 4ZYYA 5JATA 3EFOA 2PUCA 2A9VA 1T6BY 2WB4A 4P3XA 2R8PA 2ZETA 5IP5A 3J81k 3PX2A 5BW8A 1YR2A 1C3LA 1O8BA 2SICE 3D6MA 5BSUA 1ABBA 2NYVA 1D4ZA 4DLPA 2PO5A 1K9VF 3D7RA 4DSZA 3RU7A 2ZWOA 2Z2YA 3LAWA 3RRJA 4D4LA 3K1ZA 4NZNA 4YDHB 4PSAA 3N9IA 3R3VA 3BJIC 5TC4A 1QV9A 5A3SA 3O90A 4MW7A 3E22A 1U2DA 4D9BA 1XD2A 3VR2D 3GUCA 1A1SA 3V8QA 3VR6D 3WGTA 1TK3A 1OLUB 3VYRB 1AF7A 1EDEA 1A8PA 3N8NA 1GN8A 1OHHA 3W9BA 1R5NA 4HKTA 3JVDA 2OAEA 4C4SA 2DPYA 3C7CB 2IVZA 2JFQA 3TRDA 4M9XA 2VQDA 3OECA 4HHEA 3WFZA 3HHPA 4R8MA 5CA0F 1PX2A 2HBQA 4O4HB 2D2IA 3OCJA 4TV9B 5TARA 2PGXA 5JZVA 3D02A 5T3YA 3ZXSA 3L6DA 2IX3A 4MJLA 3BERA 2OV1A 2GVDC 1U9ZA 1O97C 2AL7A 1TD9A 2ZTSA 3M6WA 3MERA 3TXXA 1Z4KA 4YJ3F 2ZTUA 4Q4AB 3UUGA 3CKMA 4CEHB 1RRVA 3DE3X 4U3JB 1I24A 3Q2OA 2FSUA 1ORIA 4WZZA 1A4UA 3MWEA 1SHZA 2ZJYA 3QVWA 3NDIA 2BFEA 4N0QA 1YA8A 4YRNA 3MJSA 3RWOA 1VMDA 3E8XA 2DHQA 2X0IA 4KR6A 1FDSA 4O4LF 1VC2A 4UU7A 4EGQA 1SCQA 1UK9A 4RTPA 1RPNA 1J49A 1A27A 1FDTA 5A6SB 2OC9A 2IXBA 2CNKA 3U09A 3G0HA 4BLWA 4KHPB 1MRNA 1X2EA 2GEKA 1KU6A 1Q1ZA 3SZUA 5HM6A 521PA 4MP8A 5AI6A 1WXFA 4B48A 1SIUA 3CZ5A 5CX4A 2BHSA 4M4SA 4RJLA 1CR2A 2EDAA 2C7OA 4N7RA 5J43A 1GY8A 4L9AA 3E3LA 3M6XA 4OJMX 4JC8A 1Z8DA 3EN0A 3HJHA 4GOJA 5GWXA 3REOA 3WQHA 1WE2A 1DAMA 4QUAA 2JVIA 3GLHA 5E1DA 3SC2B 4GKKB 4QTUB 1K6JA 1YA6A 2JJ1A 4QGAA 1EAMA 2OLJA 3OJWA 4JMPA 4PLWA 3X1YA 2SHKA 4R7TA 4Y2XA 1OPXA 3DEZA 3FHCB 3DDOA 4KOEC 3EGCA 4QBGB 4IVPA 4NE9A 4IQGA 3L8EA 5HE9A 3H2SA 3E03A 1E64A 1ZG3A 5MF6A 4IJWA 3EAQA 2NQ8A 3B89A 3NBAA 4MRMB 5I7EA 2X3FA 4YJFA 4P7GA 2FWNA 1MAHA 3DZIA 3C87A 1PSWA 2QD1A 2YWHA 3KEGA 1WSWA 1O9HA 4I4TB 4OI4A 5IBQA 5JR3A 2AF4C 4JIGA 4P7BA 3RUEA 2JKZA 1JEQA 1WL8A 2EKPA 4M1KA 4RK4A 1JHDA 3ZY6A 2A33A 1UBUS 3VSEA 1XEXA 2Z83A 4LWQA 3UWOA 2AWOA 1FNDA 3EXIB 4UVHA 5K3CA 1KU0A 1OX4B 5IXYA 2IW3A 5ICSA 2YBDA 4X44A 1NURA 4KZKA 1AG9A 1JZQA 1ZA1A 1ZGBA 2QI9F 3MWDB 1PG5A 3OOJA 4BFTA 4R68A 1LI5A 3D3KA 2QTLA 3ZGOA 5M7EA 3KQNA 4EEZA 1Y3BE 2EVWX 3ZXIA 2HO5A 2Z8YA 4DZRA 1NXSA 3DOCA 2YKGA 3EIQA 4DXAA 2LR0A 5JUWA 3I9NA 2C0PA 4PWYA 3WJAA 4B5LA 3H6HA 2ABWA 5HKKD 2ZUBA 1XAHA 4C4PA 3BFKA 4M7OA 1ICEA 5EWMB 1CR4A 2ZI6A 2Q29A 3EARA 2XTMA 4O1IA 4B4VA 3M2PA 1AY0A 3KYCA 5EHNA 3QTLA 5HGJA 3CNEA 4XSVA 2ZATA 4PO8A 4WZBE 4PHTA 2DM6A 2H00A 4XEHA 5I7HA 2O14A 1E1QA 3R7WA 1M34E 1C4XA 2QAGB 2PD3A 2G63A 1FOEB 3FWYA 4A8JA 4GUDA 1XJ0A 1UQTA 2WWFA 1FFBA 3AR8A 1VDMA 1TGYA 3B9QA 3GFSA 3BSSA 1V95A 3KB8A 3SZ3A 3DXYA 4E32A 1ACLA 1QF7A 1TVKA 2UAGA 2I5PO 1KSFX 4MJ7A 4KQJA 3PXUA 3NJRA 2M1XA 2YDYA 5CIQA 5JJ5A 5LLTA 3H99A 2P9JA 2AG0A 4EUFA 3ZXXA 1GAQA 3F0TA 3ZNOA 2C9ZA 4QX6A 2XVYA 4J3NA 3A2KA 2I1QA 1YKSA 2SCUB 3E1KA 4HX9A 3F4LA 1U0TA 1ZGCA 4IJ6A 4E0BA 3CQ9A 2CSXA 1JQ5A 3QENA 4BLPA 3I83A 3AY3A 3DKIA 3R0JA 3ILXA 2YMPA 4FHCA 4OUDB 4AIRA 1IUOA 4MWSA 3GC6A 3KUXA 1OHHD 1FP1D 3FYUA 3WZLA 1YUBA 3UW3A 3VZCA 1V5IA 3DNFA 3OPMA 1PI3A 2AJ8A 3IURA 4OLJA 2ZXUA 4D9NA 4K9RA 3WRYA 3ENZA 3LG2A 4DQVA 3DC2A 1TYZA 4F6LA 5DXFA 2AK3A 3CPHA 3OF2A 4GDMA 4QDZA 3A6FA 1UJNA 3CYFA 4XVQA 3MYRA 2RHLA 5LQRA 2B1GA 2VP3A 5FX2A 2ZE5A 4UD2A 2V96A 2JGLA 3OKAA 2QMEA 4U0JA 2JFNA 1B6GA 2GCGA 2NYUA 3UB3A 1QANA 2PRSA 3LLUA 2H2WA 4IJQA 2CVHA 5DKFA 2XCRB 1JHYA 4G8DA 5KNLA 1EQAA 4BVEA 1XZMA 4ZO7A 3I4LA 3A1WA 4KSYA 3S81A 3U61B 2QTWB 4JYAB 1W76A 1MORA 4WCVA 5E9QA 5GONB 4C30A 2ACWA 4TUYA 2OO7A 5BN4A 2QRVA 2VF8A 4OIFA 5K0BA 1SXQA 3BMCB 5JNSA 3OQIA 1RHJA 4GKVA 5J1SB 3DEFA 1MT0A 3PEEA 5K0LA 1SZPA 5AW5A 2QPAA 3BIWA 3FDFA 1XQXA 4H60A 1WTCA 3ZHCA 5JQWA 4AL4A 3NBUA 3TD2A 5L51A 2RE8A 3DOHA 4FFMA 1X1DA 3HJGA 5I8ZA 4ZYLA 2CHFA 3R8XA 4BWGA 1OYWA 1QP8A 1KH2A 2YXLA 4S0ZA 5FV7A 5IEJA 4K9MA 3L4JA 1EK6A 3QYFA 2CLIB 3IAM1 4N5MA 3ZNNA 5C2JB 1HYGA 2G82A 4UCWA 2CNBA 3Q5EA 5D3MB 1EPUA 4ARZA 4Z4EA 2FG6C 4H6VA 4BMSA 5F1OA 5ERGB 5F2EA 1ZNWA 4XX0A 4NU5A 4A7PA 1VA5A 3HN6A 3KJFA 2OG1A 2NX2A 1KS2A 3L0DA 3X3HA 2BT4A 2X86A 3ES9A 3FFWA 3W34A 2IEYA 4AF6A 3O31A 5EJ8A 3UJ3X 2POQX 3R0IA 3P9CA 3KR1A 1SG0A 3GQVA 4ERNA 4O33A 3HDQA 5EXPA 2I91A 2C7GA 4M6WA 4O4IF 4BNUA 4FIDA 1YVRA 3B6MA 3U4IA 1F0KA 4B85A 1EINA 4BN0A 1DKUA 1OKKA 3U17A 1KH3A 4GLLA 1QFJA 4QC2A 3ZV4A 5B1EA 2LCFA 4IGAA 4B17A 5MN4A 5JJIA 2PKQO 4Q1AA 4MVJI 5HK9A 2IBMA 3QU9A 4MUYA 5KNCA 4ME6A 3X1DA 1TO1E 5IVIA 3P7MA 4LISA 4L78A 5K3SA 3SIWA 5EGNA 5AVZA 2GR9A 1M6NA 3BE4A 2NU7A 1G20E 2QZ9A 2VTKA 1I7NA 4LZLA 1YB5A 1TM2A 4ZTZB 4F9TA 2VP2A 1Y6QA 3RSLA 1RTKA 4JXZA 4JI0B 4K2HA 4MDHA 5LZ7A 3QOWA 2CMDA 3SSAA 3STWA 1BDIA 3V7FA 2YTZA 3NXSA 4EB6B 2HA6A 3C4QA 3AEQB 1QGYA 4UFOA 3E48A 5DXAA 3TTVA 1O0CA 4A1OA 1HKHA 4IKOA 1HRDA 3BKWA 4INOA 4WN9A 5JWHA 6YASA 3HADA 1VE9A 1LW6E 4RTLA 3I2HA 2V5UA 1J06A 3LCJA 4F1WA 4JSYA 2DTXA 4MGHA 1IXZA 3ZDFA 4I6EA 3VOBA 1X8XA 3V6LA 4BKMA 2GFHA 4EA7A 1HFEL 4G0QA 4GI5A 4LYEA 3NRJA 3QVVA 2NPOA 1DUVG 1YQQA 2G1KA 4Q9JA 4IV0A 1DWQA 1QAQA 5FUMA 2ZT8A 5K2OA 3BA1A 2VS1A 2XF8A 3AOEA 5A4JA 4MINA 1WCIB 3DAFA 3KDPA 4RVNA 1RJDA 1I2CA 1E1QD 2QTFA 4TVSA 1VKNA 3U7GA 3HN7A 4LNUB 2VTVA 2QRNA 3AFOA 4MPJA 2DPGA 2OTCA 2PSJA 5KYGA 4GZ3A 2XKBA 1U02A 4CWAA 5TPWA 1DJMA 4QRHA 3KU4A 1BFKA 1NAHA 3H5WA 3NWOA 3LI2A 4EY4A 4G8JA 1QK5A 1U2PA 2X6TA 3BH0A 1BS9A 3WS7A 2CB9A 2PZKA 1XG5A 2XUOA 1GL6A 4AM8A 1NT2A 2PNFA 5JEDA 2PSEA 3FB4A 5EWLA 3I8OA 2V58A 3QPWA 1RQRA 1R9NA 3LGXA 1KHHA 1KP9A 1AKNA 3ODPA 1M1UA 4HFJA 4OXKA 5IKEA 4BPBA 5ERYA 5JECA 2HRQA 4IX1A 2VH2A 4XVUA 2F8SA 2JFYA 2W5UA 3VO1A 5K3FA 5K0TA 3ZHUA 4DV0B 1SOAA 2ZCUA 5ITZB 3O8QA 4WUTA 4O4JA 2GBLA 1WUTA 1DBQA 3EQ7A 4R2HA 4CMEA 3DXXA 3QA3E 1TUBB 4FXPA 4QQNA 4BQOA 1JVNA 5SZIA 4P82A 5KTYA 2Z4SA 4LOJA 5CVCA 4D43A 1Q92A 5KWJA 5E7JA 1Z2AA 1YZYA 4DNFA 4QHYA 2QQEA 3R1IA 4FFNA 1N2GA 3RJ5A 4PEVA 4UJ3A 4V1CA 3SHQA 4Q3DA 5F64A 2GM4A 3TDMA 1E3JA 1EFVA 2FPWA 3EQZA 4WQMA 2CUNA 3U5TA 2IGBA 3LPCA 3PQDA 1ULUA 3VFDA 4L0QA 1K7FB 1YDHA 4XWAA 2I67A 4FHEA 3VKFA 4HYQA 1W87A 3M83A 1IBSA 2B8EA 1H4VB 3KQOA 4RETA 5G0UA 3BPSA 1UK6A 3UK7A 1OJLA 5I9TA 1KYTA 1R6DA 3QKUA 1HDRA 1JG7A 4G9EA 1U6KA 4L0CA 2GVNA 4MHSA 2PY6A 4TXMA 5F7ZA 2IKQA 4W7HA 4EAAA 4U5XA 5AQ1A 4YHBA 3SWWA 1T5HX 3GLIB 1X87A 3RCBA 3D6TB 5C35A 3KOUA 4H35A 3SBEA 3ORQA 1SXJE 4OTZA 3N75A 4YN3A 1QV6A 1EFCA 4G3XA 1G5PA 1Z9BA 3OSUA 1TM4E 1BN6A 2WU8A 2XHEA 4KYVA 1DBVO 3DWEX 3BGVA 4L8GA 5KDDA 3VO2A 4KXNA 3ABIA 4N3GA 2ZBUA 3RC7A 3FWNA 4L2IA 1K7CA 3V8RA 2ZQ5A 1QV7A 4XJXA 1XPUA 3V4PB 3DEKA 5ALHA 4ZCSA 4H3SA 1IN5A 5ERXA 1ZUHA 2IITA 3MMXA 4RVCA 4HR7A 2FLKA 1MB2A 1J8QA 1UDAA 4MO9A 4QNRA 5AKEA 4RX1A 4FFRA 4HB0A 1OW3B 3M34A 2ID4A 1RCFA 4WZAB 1E5QA 3TW8B 1Y8RA 2BC9A 2V7UA 2XCUA 3T9EA 4GUAA 5KOHA 3LF1A 4XB1A 1T5BA 5BN1A 5CNKA 4GXRA 3RFFA 1M73E 4CM3A 3U1BA 1KZ6A 3IQGX 3HCPA 1RIIA 3O1IC 1T43A 4NMXB 4PGFA 1H4QA 3VNVA 3N76A 1FDVA 5ALJA 3RTAA 3WLSA 3GFGA 1LPOA 3MWJA 4J7AA 4Q01A 1G55A 4HATA 2WOOA 5KNCD 1YFLA 1F8GA 2FKNA 2C9OA 2IY8A 1EGHA 3HY6A 4LOHA 4OQMA 4B6OA 2MCFA 2GYYA 1NBIA 3KLNA 1J1ZA 2E48A 3ZWNA 2Q9CA 5TQ2B 2Q8PA 4KAJA 2EU8A 2XUGA 1JKJA 2WFAA 3LLCA 3WICA 1NXXA 2R6GA 1R3UA 1Z16A 1PEDA 3Q0IA 5ABPA 3U7QA 4DUGD 1UC8A 2BCJQ 2ONZA 2BEJA 2I54A 1XVVA 2WDPA 4MMXB 2BGWA 2BFBA 1PGQA 4PV7A 3S8MA 4L4SA 2J33A 1XRQA 3KKOA 3P94A 2J45A 4ESHA 1USIA 4UEJA 3HP1A 4RXMA 4XM2A 2VJMA 4M8LA 4HGRA 3CT4A 4LXUA 3HDYA 3BREA 3OETA 4S12A 3TKAA 4L57A 4AD8A 5KKCA 5HF9A 1U1GA 3W5AA 2CXUA 1EZ4A 3VR1A 1YZLA 2QENA 3A4LA 5FTWA 5CVDA 4MUHA 4ALJA 1P2VA 1OXTA 1TT7A 3ORHA 5CYFA 1PT9A 4LSZA 4QEZA 1WV0A 1GL7A 2N0SA 2XI4A 4GYJA 5EQDA 2G9NA 3H0CA 4F4HA 5LN1A 3IBGA 1H65A 1BX1A 2G17A 2X5JO 3A37A 4R3UC 5H68A 4IIGA 2OORA 2FOLA 3R41A 2MHCA 2I55A 4WXMA 6PFKA 1UQRA 2BEWB 2XUHA 3NC0C 4R6XA 5DLQC 4GNRA 1W6RA 3WK7A 4DARA 4DJDC 5BSGA 5BN3B 5CB8A 5AW0A 5IANA 1APBA 4TGLA 2ZPUA 4D98A 4RO0A 2GYVA 1ULZA 3N86A 1DBRA 1JJBA 2IZ5A 1CQJB 2NTJA 2WA2A 1N1MA 3R3SA 1OXKB 3K6SA 2V6BA 4QNMA 4W7SA 1TJ3A 1J5PA 2WT9A 3K5IA 3E61A 1M5UA 4HZGA 3OE1A 3CVOA 4YRCA 1CLUA 2G0AA 4C07A 4PYJA 2A9JA 3FYSA 2DFPA 3GQBB 4CLOA 1BXGA 1ZUNA 3A27A 3OQJA 1USUA 4ISCA 1S2OA 3WA6A 5C32A 2IT1A 3DVRX 1V1RA 5A04A 2G67A 2ST1A 1XTUA