3OLQA

The crystal structure of a universal stress protein e from proteus mirabilis hi4320
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
306
Chain Sequence
b'EKYQNLLVVIDPNQDDQPALRRAVYIVQRNGGRIKAFLPVYDLSYDMTTLLSPDERNAMRKGVINQKTAWIKQQARYYLEAGIQIDIKVIWHNRPYEAIIEEVITDKHDLLIKMAHQHLGSLIFTPLDWQLLRKCPAPVWMVKDKEWPEYGTIVVAANLSNEESYHDALNLKLIELTNDLSHRIQKDPDVHLLSAYPVAPINIAIELPDFDPNLYNNALRGQHLIAMKELRQKFSIPEEKTHVKEGLPEQVIPQVCEELNAGIVVLGILGRTGLSAAFLGNTAEQLIDHIKCDLLAIKPDGFTCPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Universal stress protein E
molecule tags Structural genomics, unknown function
source organism Proteus mirabilis
publication title The crystal structure of a universal stress protein E from Proteus mirabilis HI4320
rcsb
total genus 100
structure length 306
sequence length 308
ec nomenclature
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00582 Usp Universal stress protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3olqA00
4WY2A 3AB7A 5CB0A 3OLQA 3CISA 3AB8A 4R2JA 4R2KA 3MT0A
chains in the Genus database with same CATH superfamily
6ABPA 4QSHA 2DERA 1GGEA 3OEED 3MD9A 4W8HA 2OESA 4NMXB 1W581 4ID9A 5H1YA 1J2UA 1RQPA 3EDRA 1CCWA 2KSQA 4H4EA 3RYIB 4F5DA 4LFAB 2C4KA 3ZLJA 4P7BA 2POQX 2J7KA 3IMCA 4QL3A 3MUNA 1RM4A 2QSUA 3ICOA 3VVMA 4AZ0B 4BNFA 4JQYA 1V11B 3FOWA 1SHZA 3NYWA 1WY5A 2VUIB 1G8YA 6ADHA 3D3WB 1KNXA 1LRJA 1ZVQA 1R7RA 1YS2X 2WILA 4PRKA 5ALTA 1XXHB 4PLHA 1VJGA 2FZLA 3FMGA 1Z6GA 3PFBA 1ISIA 2X8AA 1ZJYA 3QVTA 4IKOA 3U2QA 2PGNA 1GN8A 1NRXA 1Z16A 2WU0A 3FSJX 1Q84A 3MA0A 1QFYA 3O93A 4WKCA 1ORDA 4Z9BA 4AUKA 1ONNA 3UOAB 5IT5A 1CJMA 5JC8A 2GN8A 1JF8A 5KBYA 1CQIB 3F49S 5C5CA 1QVWA 4N6NA 2GAOA 3AR6A 2D6FA 2Q2QA 4BRUA 5H8WA 3K9CA 3K4QA 4U7PB 2JZCA 1UBUS 3T3IA 2OP0A 4RPCA 1X1CA 3S2IA 3J81k 3N76A 1S1MA 1MENA 1U8EA 3T5BA 1VBNA 4ZDWA 4PLYA 2CT8A 2IYTA 2ORWA 3X2FA 1QQBA 2ACEA 1UMDA 2UYOA 4KWIA 1RXYA 2Z2KA 4Q03A 1Z0DA 2Y77A 1L9XA 1WCWA 1XYYA 1XQ1A 2FOLA 2XTJA 3CKKA 3LF2A 2AOUA 3K2BA 3Q2KA 2A5LA 2UU9B 1MC8A 1WU8A 2QYTA 1KEVA 2Z5VA 3PTLA 2IOQA 1TJYA 2V96A 4IZ6A 3IDFA 4ML3A 4ZI2A 1R0XA 1UANA 4M83A 1FSSA 4LC1A 4ROSA 1TEHA 3LK7A 4XCXA 4DCUA 4C7BA 4PX5A 1C2TA 3K1AA 1RD4A 1BXZA 5GY7A 2EFEB 1FRVA 1JG7A 1CB7A 3MWDA 2HEIA 4PLGA 3BGDA 2QPLA 1RJEA 4YV1A 3VR5A 2ZE8A 1JE0A 1T9DA 3HXTA 4OBEA 3RIYA 2E3JA 1JG2A 4X7BA 4L5JA 2UZAA 2VHXA 2A6PA 3AW8A 1TT5A 3PUJA 4OXRA 3WRYC 5IAGA 3O95A 4KWEA 3H9UA 4D3DA 5JRJA 3HYRA 1NN5A 4LI3X 4JQZA 3T9AA 3WYGA 5C8VA 4OHVA 1WVIA 1Z0FA 4NCJA 2A9JA 4M4SA 2GM4A 2Q3FA 3HXPA 3OTQA 1QANA 3GB9A 2EW8A 2NUTB 4Q0MA 4O1MA 4MEJA 1WABA 3ZG6A 5CCXA 1E79D 1KJJA 2IKSA 4OTZA 4F56A 4GOLD 4KFCA 1CZKA 1Y5MA 2DLDA 2WF6A 2EFGA 3H3JA 1EFPB 3OI7A 2PZGA 4ZDJA 1YA4A 1SPXA 4L3VA 1E3WA 4JLOA 2IX3A 1D6NA 4RV4A 2MSWA 5EXTA 4N8EA 4BO6A 4DWWA 1UEXC 1KYWA 3JQEA 3T1YB 1H93A 1PF7E 2H9YA 1W48A 2NX2A 3QUAA 4IRXA 4OHCA 4WPGA 4KAXA 2QRPA 2P9EA 4ISCA 3PQEA 1JR3D 5JD4A 4I66A 3ERCA 4NP6A 4Z51A 1RQGA 2HF9A 1EZZA 1XZBA 5JW6A 2X0RA 1HF3A 5BUSA 1OYWA 1U9IA 1A4UA 4JBYA 4OAQA 4UBNA 4V3BA 3SQWA 1VA4A 2EYUA 3IULA 4UPDA 3KOUA 2ZT7A 1IJEA 3E05A 5IJAA 2FV8A 1ETHA 2PUFA 4C3UA 2C92A 2L0XA 3OG9A 3QUBA 2C7GA 1RWMA 1UOEA 2OOSA 3UW1A 3H87A 4JUBA 3FZEA 2A58A 2WWXA 2NO7A 4MGYR 2AEEA 1CSEE 1RMQA 4DLNA 2PS0A 1WETA 2FQXA 3ITDA 5KYXA 4OQFA 1YI8A 4ZMRA 1UBNA 1LBIA 4PZCA 2C83A 3A2LA 3BB4A 5KC8A 1UAAA 1K88A 2R6HA 1SOWA 3AXTA 5HHTA 4QTYA 1TM2A 2YBDA 1UIRA 4JOBA 5DCLA 1AH2A 3VC2A 1MABB 3PJGA 1NQOA 4L74A 4DR5B 3O3MB 3O8OA 3R7WB 3NJ8A 1EAYA 1QC5A 3FNGA 1KK1A 1T15A 1Y9ZA 3C7CB 3P26A 1C8VB 4RS4A 1ZD3A 1W87A 5FWXB 1C2YA 3TE6A 3VR6D 4GZLA 2UVPB 3O4RA 4Q3NA 3I6YA 3UBTA 3Q3CA 2W2OA 3KB2A 1TW3A 3ZY3A 3PRHA 3ZLTA 1Y1QA 4CDMA 1LPBB 5ADWA 2ZQYA 2JCSA 2AI2A 2Q3CA 1ZCAA 3MJSA 4BMNA 4DZRA 4RV9A 4BNIA 5JAOA 4CG0A 1EGAA 5GONB 5CLIA 3AR7A 3ORQA 2IXAA 4IMRA 4LDZA 1VLZA 3Q7SA 1IY1A 3EMDA 3NZEA 1LPSA 1H2HA 4RHTA 1WSDA 4XVHA 1QH1A 3H5VA 4A9AA 2J0QA 4HEHA 4MV0A 4XGIA 5FIUA 1B23P 1SWVA 2VA9A 4KU4A 4YJGA 1GFSA 1L7AA 2VDMB 2BCJQ 5CB0A 4GR5A 7ADHA 3OD5A 1MQ8B 5FLXA 1LS1A 2OUIA 2FRVA 3LZCA 3MG9A 1GDTA 2QMEA 4BAGA 1DUSA 4E5NA 3PGXA 2BJWA 1EWRA 1GAWA 1UOQA 1DT3A 3E5HA 2DH5A 3OM8A 1SULA 2BC9A 4ME6A 1NFRA 4WGGA 5B53A 2EL7A 2VTVA 2X0KA 2XEDA 4IXWA 1EEHA 1JIXA 1JIJA 1P1JA 2GILA 1F8GA 3FYUA 1LZLA 1SUSA 2FWPA 1FUKA 4GPIB 1XTJA 1T1EA 4PNZA 4BX0A 2XKKA 1JWLA 4W9MC 4TLBA 4QOIA 2J4CA 4WZBE 1X2EA 4U2KA 2QQEA 3QU5A 3VU0A 3WICA 1B43A 1UFKA 3U3DA 2CKDA 2GXUA 5JFGA 1YD7A 3VKVA 2F3UA 2VDJA 4UE6A 4KJZA 1RHMA 4JSTA 5AOVA 4DMMA 2AS0A 2SHKA 3VBCA 4O4LA 3OBIA 1MQ9A 4M0EA 5J3JA 1R4ZA 3ZDFA 1Z4OA 3C43A 1LK5A 4ND2A 1FXWF 4RY9A 2VWQA 3HJRA 5IDYA 3ORYA 5FPSA 1D6MA 1PZEA 3I9JA 1H0RA 1MJNA 1T8YA 3PUHA 4KYIB 4W9NC 5E4FA 2VDRB 3SLRA 3L6UA 4NV3A 1YZLA 2VP9A 3PQ7A 3Q15C 4XQEA 3MERA 3ML1A 1MO6A 2CNKA 3C6MA 3RRNA 4Z1OA 4PXYA 5F1YA 2NO4A 3TLAA 1XKQA 2PT5A 4V0NA 3UXEA 3SHOA 1ICEA 1R8YA 2VHCA 4IGIA 1MDBA 4MV1A 3RJTA 1E3JA 4DV6B 3RG2A 4RVGA 2A59A 1WP9A 3FLMA 3K0HA 4EJSA 4MCHA 3PJFA 3RQSA 3HU3A 3KNZA 3NYIA 3CA8A 3II6X 3PSHA 3GPCA 4JY7A 2GEUA 2I0FA 1TMOA 1TLTA 3FMVA 4X84A 1D0SA 4AFNA 3ONDA 1C7QA 2PBZA 3RFCA 4CNBA 5CFNA 3HVIA 3L7LA 4M9CA 2DBVO 4AT1A 1E98A 1XX6A 2FSVA 4Y2JA 3ANTA 4A3SA 1T9CA 1ISJA 2C5LA 1SCQA 2Q6OA 1QYIA 2KBFA 4TQUS 2JI8A 1I3LA 1SBCA 4K81B 4RORA 3CG0A 3TZQA 4I4IA 2P68A 3NTUA 3O1IC 4J2HA 3RFTA 2F1RA 2YW2A 4GS5A 3AZQA 4ZYUA 5HNKA 1PD0A 3TRDA 5KTSA 2YWBA 1IOLA 3LT0A 4QFBA 3W2IA 2WVJA 4U5QA 3P0JA 1P0IA 2B21A 3L7OA 3BMQA 3PICA 2GA9A 2JBAB 1V8PA 1DELA 4KQ2A 1E7RA 4FDMA 4LHWA 1GRCA 4GLLA 5EVJA 4L4XA 3ZCTA 5ELLA 5K8CA 5LQJA 1QV6A 3AVTA 3CRRA 1L4YA 1GN9A 2AYXA 4KCGA 4NH4A 1A82A 1MIOA 2P6OA 3LBNA 2AIRA 2O4CA 3PGLA 2F3SA 2PYDA 4ARCA 2VI5A 5LQDA 3REQB 1HRKA 4AYTA 1FZTA 4Q47A 3E70C 3IJEB 5KNBD 4PLZA 5DW0A 3T5PA 2P11A 4TL7A 1TF2A 1XCMA 3ER6A 4J49A 4WOJA 3RT9A 3SZ3A 5BW5A 3CW8X 3VNRA 2W42A 3ICQB 4M99A 3O1JC 1KWKA 2OHGA 1T0PA 2QMZA 3QK7A 5M2QA 4XDZA 3STXA 1IN6A 4I1UA 3FVRA 1RIIA 1V45E 3I6BA 5BRNA 4NABA 3WQBA 3A3PA 2WJGA 5FO0A 5JDIC 3D8HA 2A3RA 5F1KA 1AMUA 4ZFNA 1HZZC 4RZXA 4IVNA 1T9KA 4K6GA 2YHAA 3B9RA 1ECPA 1QK3A 1YS4A 3QLVC 1DQNA 5AI9A 2XCIA 3ZGYA 1FFYA 3B6MA 4IIDA 2XQJA 1GL9B 2R25B 5JASA 4PTZA 3W05A 1TVEA 5JEDA 1BDIA 2QTWB 4LAFA 1F1BA 3K3PA 5LMCA 1UEIA 5KINB 4RQTA 1YHYA 2VDQB 3LPNA 4KQIA 1ORRA 2KLBA 3OIDA 4JVMA 1QIIA 4Q00A 3SJAA 2C7QA 1QPZA 1XE3A 4DS3A 3C3DA 1FRQA 4IDHA 4BMDA 1BGWA 1HO3A 2RHGB 1PDOA 3DCNA 4MW7A 4OM8A 2IP4A 1TM5E 4JSYA 4DABA 4L08A 1XNGA 2ZTMA 1G2IA 1ZSVA 4XB6B 2QSJA 4YACA 2WAOA 1X1EA 5BN4A 2G9UA 1C3LA 3HUEA 2WAMA 4UUBA 2JDID 3AFNA 4HLCA 2G0NA 3EMBA 4X54A 4HDMA 4F1JA 1E9EA 5ILGA 4P36A 5U1PA 1GNRA 5FHQA 1Q7TA 1GNTA 1J8DA 2LR0A 3GZTB 4GSYA 4UOZA 3MTAA 2EX4A 3HP1A 1QYCA 4BO4A 4WLEA 3F0TA 4Z0NA 1P0FA 4YO8A 5K6TA 1IBSA 2P5SA 3IO3A 3KT8A 5B7QA 3C87A 5JZBA 2Z3WA 2RK4A 1R12A 1S2MA 4LMBA 1ZH4A 1EE2A 1EM6A 1NT2A 4KRYA 4B81A 1KEWA 3IDSA 4AJIA 1D2AA 1ENPA 1FTQA 2P2DA 4PSVA 5CT5A 3SDSA 2Q6VA 3WNVA 4EQZA 1AE1A 1RQRA 2JFFA 4OJNA 2BGUA 2VG8A 2YIVX 2IYVA 2WJIA 4RVDA 4TN1A 4Y1RA 5DLYA 2IFTA 3ZWNA 5BQXA 1SA0B 3ZK7A 1DINA 4MQFA 2JFGA 1F2TA 4MKXA 1QE3A 1WZNA 2GD1O 3BWCA 1F9AA 4KXQA 4TXJA 4JR2A 5LXTF 2ATEA 4L4RA 3LT5A 2B1RA 5EQTA 5JJKA 1NOJA 2XNDD 1HETA 1BJTA 1QHGA 3QHQA 4M9SA 2OD7A 4IIHA 5BNTA 3TXAA 1E9DA 4D9KA 2BP7B 1N8TA 1ULZA 2JFUA 2NACA 4OXQA 4ZAWA 1GITA 3ND6A 2WBLC 3E9YA 5A04A 2OE2A 3DOIA 4BVJA 4UTVA 2XPCA 5E2BA 4Z53A 2XBMA 4MVWA 1GA1A 3DE5X 5BN1A 2BZ0A 1OIXA 2W2KB 5BV8A 2PZBA 5KOJB 1KDTA 3WQQA 2FCAA 3CB4A 1M9NA 3EAQA 3GGPA 3IEKA 1YACA 1YE3A 4PLCA 1X13A 3QLTA 3PE6A 5AOCA 4DR3B 1Q5PA 1Z8FA 4BLVA 3RUIA 2FYTA 4R1TA 3VZQA 3QX3A 4PW0A 3LUCA 3JWPA 4UCFA 3D1LA 4RHYA 5LD2B 1CRLA 4BTEA 2GYUA 1F1JA 4FR2A 2EFHB 4K3UA 4G65A 1FDUA 5E0KB 3TPFA 4FS8A 2YUTA 5EYPB 2IOFK 5ALYA 3EWSA 1JECA 1TJNA 3AHEA 3M4XA 1Z3CA 1ZX1A 3GT3A 4GBMA 5EJ9A 4YP0A 1FS5A 2XEXA 2XXBA 4OH1A 5HUJA 1U2QA 3WL5A 2PT7A 3VKUA 4DJJA 2ZTUA 3EEQA 2AVNA 4LCBA 1T36A 2AJLI 2QX4A 3KKLA 4MJLA 4QOEA 1FJHA 4UM7A 3V34A 1YAJA 4D9CA 3RSCA 5AUOB 1EX6A 3KB1A 5HKLA 4J8PA 4Q24A 4FQ7A 1XA4A 5GM1A 3RAEC 1JH8A 3GLSA 1P2TA 3CH5A 4AO7A 4MUHA 1EHCA 4CM8A 1A76A 1WXEA 4G5HA 5DNCA 1V3UA 1AKNA 1DC3A 3J80A 2BYTA 3CH7A 3DT8A 3RVNA 3WQSB 1IDN1 4FUQA 1SK9A 3N75A 3HU1A 3QF4A 3ZDYB 2GRUA 5F9MA 4B8ZA 5AI0A 5BQ3A 1YVDA 3H9QA 4UVEA 4S0XA 4J29A 5TT0A 1KNQA 1OFIA 3OPYA 1RAHA 5TDHA 3RGGA 1PWZA 3ONFA 2E5FA 2ESRA 4R1QA 2NVOA 2Y4NA 1E2FA 1MA0A 4NOLA 3V9AA 3DP7A 1AKVA 3K30A 2Y1KA 1LKZA 4QE3A 3EZ6A 5CTAA 1SXHA 4Q12A 3R41A 1OE0A 3CJRA 4FI3C 4MB0A 2B92A 1CERA 3IGFA 4OHWA 4WCVA 4CZ2A 1KBZA 2DFVA 2QTAA 3D9QX 1ENOA 3G5TA 2FPXA 1QO0D 3DOUA 5JXJA 3VR5H 1NWCA 1EBFA 4NE2A 2QMUA 4QARA 1XJ5A 4ZQFA 5FEUA 4RZQA 3N8NA 2P7HA 5JSKA 2WWGA 4J0GA 3CV3A 4EIWA 3FNFA 2WLTA 4BVHA 5B2FA 1GOTA 1LBTA 4RTSA 2C77A 2O5CA 2J9RA 4TV9B 1I9CA 4R16A 3ZGXA 3VHLB 3RC3A 1U02A 3O8DA 2H17A 1I2ZA 4N8SA 4G5XA 2XR1A 3I6MA 1J8QA 2RH4A 2WHQA 4HDCA 4KHZA 4OL0A 1YHZA 2G3YA 2Q29A 2R68A 5CX1B 1PR3A 3U6KA 3QF4B 1ACJA 4D0GA 2ZUUA 3L6CA 4RTLA 1F0NA 5IKPA 5HRAA 4NAVA 4QYIA 1BX0A 5LP6C 4R1OA 1BROA 5C3UA 1H0HA 1W29A 4LNAA 4G0XA 1IQUA 1E3SA 1NUPA 1OZAA 1A3CA 1WXGA 1W52X 3KYDA 4G2TA 3NM6B 2AB0A 1GPLA 3E81A 3L8FA 1K92A 3R24A 4MINA 3RGWS 1X8LA 2ZI9A 4DJEC 2ZPTX 5TVGA 2IXGA 4LHEA 4XM0A 2A7QA 5EY5B 5LNK1 3NS7A 3VR6A 2C04A 3JVUA 1W94A 1A72A 3E9EA 1T8RA 1TQ2A 2BGLA 3U1BA 2QAJA 3L1VA 5A2QA 5JVDB 1YHNA 1CUJA 2OFPA 1P3DA 3DO8A 4RETA 1B26A 1DEAA 4UVGA 3EF1A 1SAYA 2HU8A 3DAGA 4ILEA 5M5BA 1T1GA 2IEIA 5LM3A 3G1UA 4MGKR 3S29A 3QBEA 4YTEA 3VJRA 2Z4RA 8ADHA 1OH7A 4B47A 4IYJA 5HYVA 1NWHA 3IAAA 3LT4A 1T5SA 2IHVA 2SCUB 2DBRA 3KPYA 2J09A 2P77A 3I6ZA 4U4AA 4XM2A 3KOYA 4XXHA 1YQXA 3LY8A 4O2AB 3DEFA 2FW1A 4UTXA 4BNJA 3IAUA 2EP8A 4HPWA 2NAPA 1QZ3A 2V4MA 1DEOA 2AK2A 1PT5A 3OFSA 4X6XA 2XMCA 3VNBA 1CIVA 2WWIA 3DG9A 5C4GB 4ZJYA 5HK9A 2UYCA 1WJGA 4S24A 4NDAA 3TLKA 4F2PA 1JILA 1KC3A 3BFXA 1ZEJA 5L40A 4DG9A 3V1TC 3WB2A 1A8UA 2QT0A 4BNHA 3GUCA 3QLUC 4RQUA 4XRGA 3K9FC 4P53A 3KSBC 3D1JA 2WI8A 1E8NA 4YMLA 4QM7A 5IBPA 1SZPA 3DR3A 3EVDA 4FGJA 3O7WA 1E9BA 4GR4A 3VSAA 4EI2A 5I3CA 2QBYA 4ZGGA 2KPOA 2RGEA 4Q66C 4O2BF 3OFNA 3OQBA 2HWWA 1WX1A 5E6UB 1SG6A 1N25A 2JZOA 5FFMA 1Z07A 4CM9A 5KYTA 5BSFA 1P18A 2GCEA 2I1VB 3T7KA 1E2NA 2PD6A 1VJCA 3I2YX 4B4DA 1OQAA 2FSIA 2ZDHA 3B1KA 1OASA 4NOKA 1L4HA 4Q9NA 5CVEA 3NUZA 4R8MA 3KJZA 1SELA 1JEEA 4NK4A 3UCEA 2V7XA 4J6FA 4N40A 5CYPA 3AM4A 4BQFA 4FINA 2D1TA 3WOHA 4RA9A 5A5VA 4FHGA 2BMWA 2GTIA 1Z4QA 2GDJA 2QL6A 1TJ4A 3R44A 3R74A 4NU8X 1QG0A 2NV6A 3BZWA 1NFFA 2G67A 2QF7A 1S2GA 4BLWA 1KY2A 2ZANA 3AP2A 4FFOA 2RJ3A 3DPUA 4B09A 2ZUBA 2CF6A 1NR5A 2P62A 1UDRA 3BCRA 4G9GA 2G08A 4NLLA 2TYSB 2FY8A 3LQKA 1D0IA 2XADA 1ZN7A 4Y2PA 4PG8A 4HADA 5FUVA 1PLKA 3PDCA 5L4SA 3EBOA 2E9SA 3C8HA 5KDDA 1RYFA 5GAJA 5KTKA 1T6XA 5L8VA 2X14A 3B2EA 1RLTA 2C99A 1TAQA 4M0PA 1AB5A 4MWEA 1FNDA 1KR2A 5AOBA 5INTA 1WBDA 1JDZA 2W0MA 4PR3A 4BDTA 1Z5PA 1ZQ1A 4HNAB 4IXDA 4J1TA 2QTCA 3CZ5A 3EIUA 4KN6A 3U3ZA 3V1MA 2QJOA 2PJZA 3GAZA 3O4HA 1XU9A 1M2VA 2YICA 5CEFA 3SZUA 4A2QA 4LRQA 4HEA6 4TTVA 1AGRA 2Y1CA 2H1HA 1DTEA 4UBJA 5T64A 4BWYA 4EVQA 4G0OA 1M1NA 2DULA 2HDOA 3FYDA 2Q2VA 1XRNA 3W1WA 4E09A 3S8MA 4CMBA 2VTEA 1U7PA 3PVSA 1B8PA 2VP6A 4KGVA 1WPGA 2OBFA 4MUBA 4RLFA 4ARVA 4LZOA 1YQEA 3A37A 3UHPA 2A5YB 2WMNB 4COKA 1UBGA 2GAIA 1UP7A 1LK0A 2EWMA 4OUDA 4YAJA 1FLVA 3OFJA 3JD3A 1ZXLA 1AN0A 4YQYA 4GMHA 3VXKA 1D2MA 4C22A 1IXSB 1VC2A 4NZ9A 4C3ZA 4YT2A 4Y18A 1T35A 1TZCA 4GECA 3DO5A 4MSUA 4HQFA 3DOOA 4O4HA 3U4QB 1HSOA 2I5PO 4GX2A 3I37X 1FMTA 2RHMA 2IV2X 5HPYB 4B40A 3H1BA 4PC2A 2FSUA 2GHRA 4FWTA 2H1SA 3NRJA 4DGQA 3AONB 3FCUB 3TZBA 2F1OA 5JCPA 3EFOA 3W5DA 2JI6A 4BY9E 1EGVB 1N0IA 1SQSA 1O0SA 2XKJE 3T38A 4BLRA 1O8BA 3LJKA 3VSCA 2PDAA 3M9WA 5JI2E 4J0HA 1XVIA 3VYSB 3CMCO 3ZV3A 3QV1A 4ND5A 1YOVB 3BRCA 4XEHA 2HZ7A 3O3NB 1MKYA 4N82A 1QTIA 1TUBB 3T3NA 3QIAA 5DOZA 2ODWA 1UM9B 3JQ7B 4FBGA 1H6CA 1KOFA 1LX7A 3FAZA 1JALA 4OQMA 2HIGA 4LYAA 1Q1NA 1C4OA 2O7NA 2YYAA 4KQ9A 3TNLA 3VO9A 4AB1A 3D8SA 3I5XA 4NBNA 3ZVNA 1SQ0A 2NUBA 3E3MA 2PKWA 3LY5A 1JPNA 2DJIA 4INAA 5BUZA 1HEIA 1PR6A 2OO3A 1EVIA 1YZUA 4B3XA 3VR2D 5T8KC 4RMGA 5EG5A 5HFAA 4LTNA 1FFAA 4H35A 2D2IA 4F2GA 1AOXA 1YL7A 3CZPA 3GQBB 4XPZA 2R8RA 4KN9S 2VHYA 4LC0A 4CG3A 5K4HA 1ZMOA 3LM8A 1GG5A 1T2VA 1KYYA 4OX9Y 1XZDA 4FE7A 4C7OA 3E2IA 4OHYA 3ZGVA 3YASA 1FQOA 1DQYA 4H7EA 3SJCA 3LHFA 3MQFA 4JJ7A 4WZAB 3VOSA 5HSGA 3PJRA 2F3QA 3VTZA 2C7PA 3TIIA 4CWAA 1B00A 1K2WA 5JAPA 4M89A 3GDFA 2C2YA 3MCWA 4GZMA 2R751 1YOVA 2CNOA 5REQB 1E7QA 3D4IA 3N6VA 3A1WA 4FR0A 1MT3A 4GRAA 1N4AA 2HHAA 2UYQA 4JB3A 1RM3A 1ZHOA 3H0EA 3MINA 5HM6A 2IHTA 4NDZA 5AW1A 1WOYA 4EHKA 4P22A 3BD6A 2HLPA 4DV7B 1XDUA 2GS9A 1JSZA 1LNSA 3T1NA 2FW7A 3E22B 4QYTA 3ZHYA 3R5SA 5H9VA 5D00A 4TVSA 1Q17A 3LO8A 4F9GA 1GYQA 2P7IA 4W6ZA 4ABTA 1F6DA 2R00A 3U31A 4ICIA 1PFVA 5CDSA 3N2GA 1KGSA 4Z1MA 2GRJA 3D4OA 4RKQA 5FBHA 3PE3A 5JNRA 4DCSA 3PUKA 1HDYA 3W79A 2B35A 3CE6A 4ZODA 4V24A 4RVSA 4FK8A 2ETXA 1TDJA 2I99A 4ONEA 1NJ2A 3HV2A 1DAKA 2FWNA 1M6YA 3K53A 3H8VA 3LQYA 5D3QA 3D7LA 1E3LA 1S1CA 2XTAA 4KUEA 4BPRA 1RAEA 2ASVA 2C8KA 4TXHA 1K63A 2VS1A 1Y4UA 4IHQA 4LKOA 3VUFA 4BP1A 2JAUA 2XF2A 4G1BA 3VYVA 1QYDA 1OYOA 1YRWA 4OLHA 2AOXA 3OM9A 4JLJA 3S2FA 1A4XA 2O59A 4UNNA 4RPGA 3T7IA 3DB2A 3ULKA 5T3YA 2FAXA 2VUHB 2BRUC 2GZSA 5J1SB 4H3HB 5JT1A 4Q18A 5AXCA 3ZWXA 3U80A 1Z45A 1TVKB 1TTPB 1ZW1A 2EVWX 2RGWA 2I2AA 3CU5A 3IV9A 3LCCA 4G8DA 5L3RA 3R7WA 3HEMA 4OU4A 1MF7A 1FPMA 3WY9A 3F67A 4JL8A 4URFA 1UJBA 3N2KA 1TGVA 4W8OA 3ZHSA 2CF5A 4WIAA 5AM5A 2OGSA 4LCEA 3HGTA 1QFXA 4AWXA 3JQDA 3RYHB 2NTNA 4F38A 2ZJ7A 4GE0A 2XA2A 1IPEA 2L82A 3DTTA 3NDPA 4GNRA 4ZCSA 5LQKA 4FDAA 3UFXB 2WUDA 4NC9A 1LLCA 4GM1A 3KV3O 5F5XA 3QTLA 3L0PA 2XLCA 4XQCA 4DANA 5BR8B 1W6RA 3ZBTA 2Z1MA 1RM0A 2MJLA 1HSZA 1KU0A 4MV6A 4REMA 2P4SA 4WDQA 5AI6A 1O57A 3UMSA 3V48A 1XTUA 4E22A 3HVUA 3FTPA 4C4PA 1WUTA 1CUWA 3UK6A 4YJGB 2P27A 4M46A 3SQMA 3GJ0A 1CYDA 3H4MA 3P20A 1YB5A 4I55F 2ID9A 2XE4A 2V7GA 2QRVA 4ZRNA 2XGOA 4LBVA 3BOSA 3F73A 3EQ8A 4RK4A 4QXAA 3IKMB 2JCGA 3PR2B 4XWWA 1DKRA 1FFDA 1N0VC 2XHZA 2PUJA 3A9RA 3IILA 4FMCF 4BKQA 1EQUA 5LMNB 2W48A 4NEGA 2XH8A 2PNJA 4F3TA 3ZOKA 1N1EA 3TTTA 4PZYA 5ADVA 1W25A 3HKEA 3OOWA 4QUGA 4E2WA 3K6SB 1WEHA 2GJ9A 1VBKA 3DZFA 4PFJA 1V5FA 2HT6A 1AQIA 1EP3B 4ZEXA 3K9WA 3ETDA 3B6JA 2RHJA 2C5HA 3KJEA 5TT1A 1R6AA 2PWYA 1JHMA 4FOSA 4EG3A 3MCZA 3BTUA 4F8YA 4LF7B 4L85A 3M3DA 3ZC3A 1ECLA 5I7RA 3QJGA 2YWJA 1ULHA 4FSHA 3EVEA 2FVYA 1RRFA 2XB4A 4D2IA 2A86A 1IN7A 4WNCA 5F5LA 2JGRA 3O94A 3L7MA 1GTSA 1IU9A 2GARA 3ECCA 3SZLA 4CHGA 3MGKA 4BQEA 2XUHA 5AVQA 3V7YA 4BWVA 1AUPA 5AVVA 4Q4JB 3UK0A 3WVNA 2WSMA 3TZHA 2W2PA 4P3NA 4X0EA 4LUCA 3GPDG 3PIIA 3PC8C 1IATA 2YKGA 1S7GA 2HREA 3NGMA 5HMMA 5CA0A 1MO2A 3BH7A 3FPSA 2K5UA 3F6BX 2Q28A 3LUBA 4AQDA 1QU3A 1XNHA 4MV4A 3RAJA 4YJFA 3SXJA 5C53B 1O87A 4D3ZA 1NLFA 2RHHA 2VZ8A 5C9ZA 1MX3A 3E3OA 3PLNA 4IQ8A 4Q4LA 4MV3A 1QH9A 3F4BA 2XYPA 1WMAA 3D4PA 1DB3A 1N0UA 1OHHD 1WDTA 3DBRA 2O2YA 1RWBA 3H9CA 2BF7A 3MM4A 3OC0A 1DAEA 3UANA 1BEUB 3UC9A 3E27A 5HFJA 3KG2A 4DDKA 4DLWA 4HLDA 2WVGA 2NYRA 4P33A 2I33A 4MVJF 2ZRFA 1X7DA 5HTKA 3ZDEA 2IUEA 3G17A 4WZZA 2OPHA 4BBAA 2O8FB 1I3CA 1OXKB 4XQ9A 3K72B 4U8HA 3TR5A 5KIAA 2YRWA 4YK7A 3R9IA 2P6UA 4R8VA 4R9RA 5ICSA 2JLUA 4BLTA 2YQ5A 3NWJA 3A36A 4DIMA 1CJSA 5AKYA 2WHXA 3KD3A 1V8OA 1GT6A 2ZROA 4BNVA 3ZBQA 5CT4A 4NJMA 4A0FA 1XJ0A 3IURA 1AGPA 2CXPA 3LWZA 2G80A 4AJOA 1CF9A 3L04A 2CL5A 3GVCA 3M9XA 1P9RA 2J7PD 4KZPA 1NG9A 2RKWA 4G4GA 1L5WA 2MYUA 4YJFB 5TV2A 5TMEA 2IPNA 2GN0A 4PLWA 3MD0A 3N07A 4DFDA 1NU6A 2VUUA 3A26A 3Q3VA 2BE7A 2CCJA 2FTKE 2OYSA 4XJTA 1ZKDA 1LTKA 5I7WA 4MZDA 3GUZA 1HK7A 3RWBA 3IPRA 4BFXA 1NVUQ 3KOMA 4IIGA 3T3OA 1JKMA 1L5QA 2PWZA 2V5UA 4W7IA 5CT9A 3NT2A 4CLEA 7REQA 2Y6VA 3DFMA 3HK2A 1H2ZA 1WSBA 4HGPA 4J0JA 4N1AA 3HWSA 1UZLA 3LX8A 3K1ZA 4FT2A 4OOFA 2I6GA 4JYAB 2YN2A 3FVWA 5CAEA 2A5FA 5HDBB 1ZI9A 4CQMA 2V5VA 1IQRA 4IEEA 1QTNA 2OYCA 4A0QA 5C32A 3KQNA 4L9WA 4RULA 2GD6A 1XFAA 3DO6A 5FP0A 1ELOA 2EKDA 4DR1B 1UH5A 1GG9A 1NVWQ 2SKEA 5LQAA 4K1LA 5ED4A 1C1DA 4W8GA 2JATA 3GLUA 4C0LA 1OGJA 1YDWA 4GI3A 4ZZ0A 5LKAA 1JQJC 3CSSA 1DUIA 2I7DA 1C50A 2XBLA 4P31A 4KDEA 1SXJE 5BN4B 5ES4B 4DCOA 5KNDD 5MDHA 1HMYA 1O95D 3UJPA 4AAYA 1QK4A 4TL6A 1D8TA 4EHNA 3WL4A 2ZWPA 1QYRA 3AIOA 1A9XB 1Z12A 4LIPD 4ZVLA 2VJDA 1HI9A 3G5MA 4REOA 3KQKA 2OB2A 3WI7A 4TYNA 3KCQA 5FTLA 1D4AA 4QBKA 3OLXA 4M1QA 1EVEA 1R5JA 2IP1A 1P7CA 4OI1A 4PO9A 1T5TA 10MHA 2FWMX 1XVUA 2I7TA 1QTRA 2X58A 5F2KA 3Q2IA 3OWOA 2CLKB 1MNQA 4HV4A 1CZUA 4XIGS 4OLFA 4AW9A 1FP6A 3TTXA 3GJ4A 5M7EA 3G7UA 2NZYA 3OQVA 3MTBA 1YDHA 4Y1RB 3U61B 2C3OA 4ZQEA 4NZPA 3ANSA 4GPEA 1VG1A 5K03A 3SNHA 1T5OA 2AD1A 2VF2A 1C81A 3KRTA 1WHSB 4YMWA 3R7NA 4D3XA 3QWFA 2CCGA 3CRNA 3HCAA 2VJAA 3MWGA 4LZZA 4R1NA 5E1BA 4AYXA 1C1DB 3P32A 1HLGA 3JR7A 1YR2A 2CL6X 4P4SA 2HRBA 2J4DA 4RVNA 3N70A 3FTFA 3F46A 3JYHA 3CEMA 1CQJB 1SIBE 2AH5A 5B1SA 1DVRA 5LB2A 2VEDA 3JX9A 1Z8DA 2V65A 2QRUA 4AZWA 1EDBA 4TVOA 1XRSB 3D6HA 2X2EA 5ENZA 4BVFA 4BN0A 4G63A 4DNQA 5G40A 3KVOA 1A9XA 2Q45A 1YFZA 1D2NA 4US2R 4WWHA 1DL5A 1EZ1A 3HPRA 3P2EA 4G3XA 4I5DA 5IJ9B 4E4RA 4M21A 2WV9A 4CVNA 2ZS8A 4HEJA 3MWJA 4DV4B 3NJRA 1CC1S 1N3LA 3U4CA 3B1VA 4P3PA 1E3MA 3QPWA 2V6GA 4LJ6A 3EGXA 4N18A 2NPIA 5LLTA 2C7RA 2O8DA 4M8KA 2DT8A 3ESBA 1DWUA 4POAA 4BNXA 3PGKA 1YC5A 3IDAA 1BU5A 3EYWA 2R8XA 1T36B 3CZ4A 2YBEA 3K2QA 4JJEA 3RUDA 1DUVG 3TRKA 1QVRA 5FBRB 4OMCA 3W78A 5EMHA 4MW1A 3UF0A 4WBNA 4ZEWA 5A7FA 2PCJA 3NIDB 1M75A 4XSVA 4JP3A 3KYCA 5BWBA 2I4IA 3FCCA 1MPTA 2W11A 3CX8A 3IH5A 4OQEA 1I5RA 4XVUA 5KVQA 3ZD8A 2PJDA 2VHUA 3CZCA 3WB9A 1YMVA 2BFDA 3OP1A 1U5BA 3NP9A 1QSGA 1SR8A 4GI5A 4ZQGA 3SQLA 3WG9A 3TSZA 2VSQA 4UU7A 4Y2QA 4KR3A 2QPOA 2HIMA 2VJQA 1JEOA 1WULS 6LDHA 3HU5A 1O54A 4QVKA 2E89A 4ZZ1A 3EWIA 2FN7A 3P9RA 1ISGA 1JKIA 2F3RA 4QUHA 1MH9A 1W5TA 5BQOA 3I2HA 4HN9A 4L5BA 4CMCA 1XZKA 4LDJA 1F2UA 2JGNA 2BLLA 4X63A 4PWYA 4UBLA 2HA6A 3KTDA 1KI2A 1R9JA 3NOVA 3OEHA 1GFZA 1XDGA 3R2JA 5CA1A 4Q7JB 3TZCA 4C4YA 4K9RA 1AF4A 1T0UA 1V39A 1IQPA 2FJPA 2ZIZA 3B8EA 5AW0A 1LTHR 2F64A 3ZU2A 3O03A 1X7YA 1DRJA 1YSCA 3JPWA 4MQMA 4QLBA 2X7JA 2IIQA 1I3KA 3MHPA 1J20A 4P7KA 5CNKA 5LZ5A 4CEIB 1AXEA 2IA5A 5E2IA 1BVRA 1P4AA 4TSFA 4GNKA 5FOTA 4CDNA 4FGKA 2IUTA 3GYGA 1CLEA 3FWZA 3LUFA 3LXRA 4HHEA 3Q7RA 4QRIA 3EPKA 5I7SA 1JDBC 4MKFA 3B3QA 3UJ6A 2HSWA 2IBSA 4HTFA 4L8WB 4DSNA 4E15A 4BMPB 3OJFA 3Q6NA 4YWHA 1E2UA 1QFZA 4IPTA 4MR7A 5K0LA 3HCCA 3OECA 1GQFA 5MF6A 5K3BA 5DYGA 4DRXB 1TCAA 2GNOA 2Z5GA 4G1CA 1LJ8A 1KYVA 3HZHA 1VTKA 1S3FA 2NXWA 2FPGB 4JQOA 1K6JA 4EVSA 4AZ0A 4MQLA 3BXHA 1LXCA 4KPYA 4I6GA 3OCCA 3OJWA 1JLLB 3L1HA 4BTVA 4CQMD 3O84A 3CF4A 3EGEA 5A2GA 1XKXA 2J45A 2RC5A 2YY7A 1EP2B 2BONA 1QIEA 2Y27A 4G25A 3AFMA 3B60A 3QY0A 1O77A 4J16A 1DDOA 4NONA 3R5KA 1OPRA 5EXEA 5G1NA 2P2SA 1G6OA 1H65A 1L7BA 1CJBA 4RD0A 3SBOA 3ZUPA 1TU0A 2RGNC 2HA0A 1ZISA 4ZOAA 4KXXA 3A1DA 5ALMA 1OREA 1XZIA 1KKMA 2OCXA 2YV1A 2QUIA 3EDMA 3GXOA 3R6DA 2NO9A 1DV1A 2Z2XA 3I3OA 3QELB 1DO2A 3AWDA 1GCOA 4JBXA 4OQYA 2Q1TA 2Q3DA 1X1QA 2WD7B 3QWBA 1JGTA 3BX1A 1LI5A 3F3YA 3R0XA 1EK5A 3GFVA 1CY6A 3O8QB 3Q6MA 5AJXA 1L7DA 2GR9A 4CMEA 2JA2A 5T3UA 2NQ2C 3TM5A 2WKRA 2ZAGA 2QYHA 3OCUA 1L8LA 3R5JA 3ZDCA 2WZCA 4IXNA 1XZLA 4JI6B 4GG1A 1XAJA 5H68A 1WXWA 1XXHA 3H2KA 1JR3A 4WBSA 1OFGA 2J46A 2GEFA 2X2OA 4U39A 3B6IA 3X1XA 4LX8A 1PN3A 4V0QA 3B38A 1HDOA 2O8VA 4R3UC 1FDOA 3QEMB 4MGZR 4XVRA 5CFLA 1JH9A 3JU3A 3G82C 4LXGA 1OZHA 3O1HB 1R6TA 3ZWVA 1QP8A 1B16A 5E6UA 4CTNA 2OFXA 2JIZD 4RADA 1VIYA 2ONKA 3GIDA 4WLFA 4ZI7F 4I9UA 5P21A 2QD3A 3GD5A 4MUAA 3RV3A 4DY6A 3ZY5A 4MUXA 1CYEA 1U7ZA 1BAPA 1CY4A 3IMEA 3M70A 4KFSA 3H5RA 1ZCBA 1Z2EA 3WKAA 4JA0A 3U9SA 1AKTA 4AG5A 3PLAE 3PD0A 4LRUA 3AP3A 5BSMA 1ECJA 2JASA 5E7MA 3UK7A 4DNXA 3KOXA 1ZK3A 1DBVO 2RGUA 2HF8A 2C9YA 1YAHA 4M49A 3C8MA 2X0DA 4RJKA 3H8WA 3PS9A 5KNCA 2V59A 3Q0IA 5EXDA 2JFOA 3THOA 1IZ0A 2AOTA 2FDRA 2P6MA 3G7NA 3I1IA 4Q15A 2G5GX 1V1RB 2P69A 3OO0A 1IHOA 3PR3A 2BMFA 5EUBA 4DMGA 4PC1A 3QI2A 2R6R1 3NRCA 4NG4A 3WISA 2XUOA 4JMPA 4QXQA 4YH1A 4OHMA 1TUEA 1ZH2A 2YNMC 3ISTA 2LRHA 2WKPA 5AVOA 3COJA 5L7WA 2WC1A 4PQEA 2VDKB 2D59A 4MR8A 1KJ8A 1K7CA 4LZLA 5DKFA 3SYLA 1TRHA 5H4GA 1YO6A 2PQ2A 5KEIA 1M2OB 4G4IA 5DT2A 5MN4A 1Z13A 2Q1UA 1BQ3A 2Z5LA 4BZPA 3UWPA 2BGKA 1USWA 3FROA 1PNQA 4JDUA 4IJUA 1S2LA 4YAIA 1MTZA 1RQXA 1W2HA 2BISA 3G9XA 5FUWA 3ILHA 3D43A 1HOTA 5E8RA 5K01A 4TM7A 5LZ7A 3CX6A 3QX7A 5CVDA 5IVIA 1JQ3A 2YVKA 4CF7A 5KNDA 1ZOPA 3CLHA 4DLBA 2VDWB 1T43A 5GM2A 3IOMA 2IZ7A 4Y7CA 2WOJA 1OILA 2YC2C 3CZQA 3ZZ1A 2RGBA 3M6WA 1GDDA 3I8OA 5TQ0A 1CW2B 3NORA 4QVIA 3TRIA 1CUXA 1HT1E 1GPBA 1HWYA 1O95C 2YWXA 4XR9A 5EQFA 3TTUA 1WV1A 2QN6A 4EHBA 3JYNA 1FVFA 3MMZA 5EMNA 1JTVA 5FH9A 2HPAA 1GFIA 1WD7A 2F00A 5J5CA 1RHRA 4GDFA 2W6JD 4NZYA 4R7ZA 4FMPA 4R5HA 5A0VA 1RCUA 5TLSA 4YCMA 1MOPA 1VA5A 4L9RA 4Q7EA 3G2KA 2WF9A 5F4BA 5H9WA 3U3JA 1NVDA 4S04A 1Z7EA 4B6EA 1JA9A 2IRWA 3U7QA 1GQ2A 1CK4A 1Z6PA 4MW4A 5FUYA 3WOVA 2HMTA 1W0CA 2GBPA 4AICA 1DAFA 1UAYA 2HWKA 1YKFA 1XDZA 3SBDA 4YIHA 3G2JA 4N5MA 3RRJA 4I4TB 1CG6A 1J2JA 4PZUA 1L2TA 3K94A 3AI3A 2FFHA 2BEUA 1E6LA 1JG3A 3CGWA 3CPSA 4IDAA 3A4NA 3IQIX 4PCUA 4ZO9A 4QOFA 3QKTA 3TQOA 5EJGA 2R7NA 5FADA 3AOGA 1M2EA 2FZ5A 3MGCA 4EB6A 1MZPA 3FCEA 4PG5A 1CEYA 2MSLA 3FJYA 3BWDD 4EPYA 2NPOA 4Q4AB 5HTOA 1XCGB 2CXHA 1UKBA 4L4UA 2XNHA 4YRMA 1V6SA 3LSYA 2CLSA 3HBFA 1U8UA 1WMBA 1DDIA 4YCJA 5TQ0B 4HVCA 3A9TA 1K3UB 3OLCX 3QPVA 3ROFA 3O0DA 2OLKA 3W8FA 5HVNA 4ALMA 1V5GA 1T9BA 1XEXA 4YP7A 3TB6A 3WGZA 3NVDA 3OY7A 1ISFA 3PYMA 2BFEB 1XP8A 2GJKA 1XA3A 2OORA 4N39A 3TLXA 5C2JB 2IYZA 5L45A 5LQUA 3Q8LA 4S1WA 4MI9A 3U0VA 1SWWA 4X6LA 4MAFA 1Q1AA 3A6ZA 3UOWA 3HBNA 1YFLA 1W19A 1U2DA 2YN0A 4QTXA 1USIA 4GLJA 3PD1A 1ZJ4A 5ECDA 3EXHC 2BGGA 2FP4B 3HABA 4HGNA 4HWOA 4Q3BA 1JHPA 2R79A 3KLPX 4CEJA 3CLKA 3KYJB 2ECQA 4E2ZA 4NSNA 5JHGB 3N58A 2GN2A 5BVGB 5JRDS 2XGGA 4TS9A 4I4LA 2DUNA 3NOQA 4CKCB 4NK5A 4DREA 3JZAA 2HCBA 1AY0A 2H0AA 1N77A 2IIVA 4LDPA 2JFHA 3K71B 1A7JA 2PA3A 1YVUA 1NX9A 2F1HA 3HNPA 3Q1LA 4L0MA 4NENB 3B1JA 1W0JD 4HAXA 3T4EA 3NHBA 2JIMA 1X39A 5A9SB 5ALGA 5EWMA 5KNCD 4MW2A 4YR9A 1QGDA 4Q4AA 3QSGA 1D6SA 4PAOA 1E0AA 2VNSA 4DLAA 3R6TA 2IZOA 1W30A 2YV3A 3DQZA 4Y7DA 4E1AA 1K6XA 1DQPA 3JWEA 3F3SA 5DJ5A 2AC4A 1LX6A 5F2NA 3BWXA 1I4EB 1N7GA 4CV1A 3U5ZB 3FX2A 1BSVA 4ZAZA 4XM1A 1BTOA 4O4LB 2REQB 1BDJA 1SXIA 2FSGA 2RDMA 3DNPA 3IQZA 3B7WA 4KTVE 3RD5A 4AMZA 4E3WA 1KEEA 3GEPA 1NKTA 1TD1A 5DV9A 4C6HA 3EDYA 4FVTA 5AICA 4BQSA 5AVRA 3OQNA 1WDLA 1NRWA 5EKUA 4P6VF 4B7ZA 1GA4A 1WZCA 2EKPA 2O20A 3BK1A 5K1ZA 3AKYA 1NW8A 2B4KA 1YQQA 2AD5A 2QP9X 3RSHA 1KDZA 1JQBA 2I6SA 4P93A 2WJ3A 1XLVA 2OMKA 5LR6A 3NTQA 5HF5A 1I1OA 3LYAA 4Q7MB 5I8WA 1USVA 1D1QA 3ND5A 1D04A 1NBAA 4M7WA 2IYWA 1E4EB 1K7EB 1ZIXA 1P2BA 5FAXA 1SVIA 1QAMA 2IEZA 3CLTD 2VWHA 2XWJI 4M6WB 2VT7A 1EKXA 1WUYA 4ZT6A 4QM6A 4OYLA 4WADA 5J1TB 3NWOA 3T5TA 3GWGA 1KYZA 4NENA 3DPIA 4ENQA 2WYHA 1Y8AA 3PXXA 1P5JA 2QN3A 4I46A 3SJUA 2G1PA 1VJ0A 5EKXA 4UJ3A 1KVSA 4HSEA 1I7SB 3OE7D 5LP6A 1NW4A 1FLDA 1GTJ1 5LDHA 4M8NE 1TTTA 5DI3B 4DCNA 1T9ZA 3VV3A 4EFLA 4FFMA 4YQEA 1TKBA 4AS2A 1FS6A 3VSDA 5HR5A 3C8ZA 3GJ3A 4MUFA 4Y0AA 4TLMB 3TOXA 3WHLA 2QAGC 3TCXB 2HGZA 2Q9BA 4GE3A 1EP1B 2I8AA 1LBSA 1ZZEA 1C7JA 2VZ0A 2HSZA 5EMKA 4B85A 1JLHA 4GOJA 4BL5A 1WBBA 3CW9A 1E8MA 1E4OA 1F5SA 3N6XA 4MWBA 2V7BA 3CKLA 4QULA 3B48A 4TMYA 5AESA 2X2PA 1NMQA 2KS6A 1PT7A 2CJYA 3RSLA 3GMSA 2Q8NA 5K7SA 4RZIA 1R0BA 2NQTA 3H1GA 1CFJA 1FFEA 1DQSA 1CNEA 1ISRA 3HRIA 4I4CA 5HBGA 3T5DA 5L3QB 1ESDA 5C35A 3M5PA 3NHKA 4RQBA 2GI4A 1ZK0A 2X0IA 5TQVA 4KFTA 2BUCA 3FUCA 5ERYA 3URMA 4B76A 1PKEA 1E1RA 2EKZA 1O6FA 4GX1A 1T4CB 3CPEA 2WJZB 1GZ4A 3HNOA 3QU4A 2UZ1B 4DA0A 1Z4MA 4QWMA 3VC7A 4BMOB 5A9SA 2VAVA 1IRIA 2EYQA 2P40A 4ZMBA 3FUUA 3E0QA 1UL1X 4GC5A 2G0TA 1UFRA 4BV2A 5MFPA 1AQJA 1TJ5A 3R4CA 1VRCA 2IHNA 3WGOA 1Q15A 1HURA 4WZ6A 5HJ5A 1KH3A 3GL9A 1FTSA 4FFRA 4Q9IA 1E3EA 1BRMA 1BX3A 1DRVA 4BNYA 1HL7A 2AR0A 4ZGWA 2R60A 2X5KO 4WDRA 5CK4A 4HSGA 1ML4A 2OHIA 3BPSA 1IWBB 1OWNA 3UB4A 4HNTA 2W9XA 5ICGA 2P91A 3FPLA 1J24A 1ZITA 2KWIA 3AX6A 1FIUA 1FF9A 4MQFB 2PPVA 1BN7A 4M60A 1X8JA 2EL9A 4IEIA 1S2DA 4M87A 4PCVA 4EMBA 1D9XA 1YJCA 3R9XA 1I7PA 1UZUA 1FY2A 1N6HA 2NZ8A 5K6AC 4YCNA 1M5TA 1DDGA 4S12A 3K6KA 4RSHA 4HH1A 3LG2A 4CUKA 4QXOA 3P0HA 3F3MA 4KO4S 4PG4A 2XVAA 1L5NA 4DJDC 721PA 1ZUNB 4K9OA 3M3HA 1VJRA 4GSLA 2WNHA 2I2CA 5AHWA 4ZVUA 2WQ7A 1KH1A 3R8FA 3DEYX 5CBKA 3LYUA 2HNAA 3NBQA 4KQHA 2C29D 2NTVA 3GDOA 4MKIA 3DBRB 1D09A 2NZVG 4AJNA 1O94A 3BRWA 3D2LA 5AFSA 3NDIA 4V39A 1KFBB 4H7PA 3B7GA 4K9MA 5IC5A 1SG9A 5K6AA 4PHFA 2VHZA 1Z17A 3CNHA 1FUYB 3CH4B 5T4HA 1BDBA 3HB7A 4NIMA 4O33A 4CL0A 4LZAA 1CEQA 2AZMA 2IEDA 2QIPA 3PNSA 4UEKA 3TD9A 2IOFA 2P6NA 2JJ2A 5JROA 1KI3A 3AU8A 4KIWA 2G5CA 2HK9A 3CF6R 1OA0A 3GMIA 5L95A 5FV7A 4IDEA 1KI6A 2PJUA 3DCJA 3M1IA 3K5HA 1KVTA 2QSZA 3PBKA 1NBMD 1K75A 2EJCA 4BO5A 4TZTA 3ZZMA 4E1VA 4CMKA 1J5XA 1OUMA 1TYZA 2YV5A 4V0ME 5DM0A 4C21A 1HYQA 3IBSA 4EECA 1M83A 2QL9A 2RJOA 3W77A 3TLJA 5DPMA 2VP4A 1XKTA 2GLTA 4GX0A 1G21A 3NH9A 4KVAA 4ZT7A 4UTOA 1MX9A 3KUDA 5DEOA 4NHEA 1ZUNA 3E9NA 2JI9A 4CV2A 4BFVA 4XLZA 3I1JA 4IWYA 3E03A 3OPYB 1I24A 2FX2A 1A7UA 2JJ8A 1JJFA 4YJ2F 1LLDA 3C4VA 4FFWA 3MOIA 2Z56A 4IILA 3GRFA 3FSGA 1XDBA 2V9PA 4G6ZA 1V8DA 4M0LA 3MHTA 1VL0A 1DRUA 3LX4A 2EG9A 2A8YA 2GUGA 1QG4A 3E2MA 4FI3F 3E9CA 1M34A 5FPHA 4G23A 3S1SA 1HNWB 3LFHA 2PXAA 4PSUA 4P7GA 1PL7A 1TQ4A 4YCLA 5IJZA 5I7FA 5LYJF 2AEFA 5AJZA 1MT0A 3QPUA 1F6WA 1M8GA 1G8KA 3WP1B 4XOIA 3CCCA 1NXSA 3CZMA 3UK2A 3WYEA 3WJ2A 2R6ZA 4EY6A 2FMIA 4OB7A 2P78A 5B3KA 2HCTA 3RUFA 1H8HA 4EPTA 3H19A 4PPYA 1QQ5A 3LCJA 3E8SA 5D84A 3UUGA 1CY7A 3USZA 2BR3A 1BQ4A 2CZCA 4BECA 3AL2A 5HF9A 2VYNA 1P4HA 3VU3A 3PUZA 5GV7A 2JLRA 4X97A 4EYSA 2F67A 3HJFA 1U0JA 3I4FA 3AUUA 3BKWA 3I61A 1EUDA 3LOPA 4L7VA 1PSWA 2CXSA 4JI0B 4U5XA 5TNXA 2WIAA 4Q3EA 1NC3A 1QLWA 3KVYA 3B6EA 4AN1A 3H9GA 2G4CA 4E7PA 1LI4A 1ZGBA 4KWHA 3QV2A 3AZOA 4JX8A 4E11A 1QAOA 1I01A 1QXSA 4XFKA 1SHKA 2H51A 3T1QA 4BNGA 1GTRA 4AJLA 1NTOA 3UM9A 2QN7A 4MDYA 1M6EX 2GPYA 4JUIA 5JY6A 1XIVA 4P2GA 3CLRC 4UVHA 1IN8A 2G71A 4Z5XA 1HC7A 4MIEA 1EFUA 1KIMA 1RWNA 2O2XA 1QMPA 1YDGA 2JIZA 2VKQA 2ZRNA 1FXWA 3COSA 3UAGA 1NAIA 2C3PA 4D43A 4BIIA 4JXKA 3PDIA 4LYEA 3NBAA 5H16A 5K99A 3C5WP 3ZDXB 3EBLA 2GEDA 3EVBA 3VDQA 1Z15A 1WSAA 2AYZA 4N3CA 2WKWA 1J8VA 1Z22A 3PEVA 3LXMA 4GPBA 3P2KA 3V1YA 1GKIA 2GPWA 3VH2A 3UB2A 3L93A 2QR5A 1Q3TA 4KO3S 5CX1A 4ZOEA 4Q19A 4QODA 3A70A 5AM1A 1Z2DA 3NW9A 3SC4A 1VHWA 1ZN9A 4RLHA 3EPHA 3ANXA 1T9HA 2MYTA 4NTZA 1JDSA 1OWPA 2FMXA 2IY9A 3DYVA 4AC9A 1J2RA 3FTNA 3UKJA 2MR5A 3W3ZB 3WJ1A 4EPXA 3RSZA 2V3CC 2WM3A 1DJOA 3FGNA 1JNYA 1IEWA 2Y3IA 1B0ZA 3N7AA 4JIGA 2NZWA 4JUCA 2C9MA 3GJ5A 3SYKA 4UM5A 4KXFB 5EI5A 3W2FA 5DE3A 1E77A 2Q3BA 3B5IA 3V7WA 2D0OB 4ZKDA 1F48A 1RI2A 4AWBA 1YJAA 3TTVA 3GGSA 3WADA 1VP9A 5L3VA 1W36C 1D4OA 1YONA 621PA 2VCYA 5GWXA 4ZYVA 4NHOA 3CNLA 1YL6A 5FWDA 5JVDA 3EIWA 2COKA 2XYGA 2RKOA 4TTRA 1OWMA 1RHJA 2QVGA 3BDVA 4NYJQ 1ENZA 1GU1A 4JX9A 3WLFA 2L19A 4EVRA 4ZIRB 3EIEA 5AKEA 1M0TA 2I4OA 4HUTA 4MH0R 2VQEB 1S96A 5KCMA 3V3TA 3I3SR 1QNFA 3BIXA 4FILA 4J3JA 3R0IA 1JJIA 4DM7A 3E7XA 4ZARA 1X0XA 4L3WA 4NZNA 2ZIAA 4KXLA 1Z5GA 4HF7A 4IHJB 3CO0S 1TAGA 5K8LA 2DETA 3H5WA 1YS6A 3TJZA 3GJSA 2BFDB 2G09A 1KJWA 1UBJS 3P27A 4NFSA 2VDVE 4XUGB 3X1DA 3GEDA 4HO1X 2W6ID 2QR3A 1P7PA 5D87A 2IU3A 1XCLA 3VTAA 1YB4A 1EK6A 2PLNA 2PWAA 4UHCA 1KZ4A 4B3CA 4W5OA 1TO1E 2GCNA 2Y0PA 3QFSA 4NNJA 4HDRA 1DEHA 3VR5D 1D1SA 1NJ5A 4ZWNA 4MXDA 1X14A 3MTQA 4DVJA 1PSDA 3GYBA 4MYDA 3VPDA 1N3IA 1ZKMA 4U0JA 2QTNA 3VBEA 1O08A 1REQA 3U1VA 2YC4C 3JALB 4AP6A 3SN6A 5K0GA 4B3RB 1C30A 5IHXA 4NS4A 3TKAA 1JXQA 2REBA 4G0UA 1X7YB 4KQMA 3P5SA 1EXDA 3VPBA 1DZIA 3UJCA 1T5BA 3CNOA 3VR1A 2XODA 4JBNA 1RPNA 1YCGA 2AOVA 2GZMA 3HA3A 5EC8A 1OBHA 4I3FA 4EKIA 2BL4A 2FEWB 3A25A 2CDRA 3IBFA 3G9ZA 1P6XA 1Z0UA 5ALFA 3C6ZA 2H5EA 5K0ZA 5CG1A 3QMMA 1YV9A 3U39A 3PXCX 4PTLA 3OJCA 4FZJA 1B2LA 1L5KA 4CF6A 5DULA 2JFYA 1VI2A 3I52A 1OBVA 4CMIA 3PEYA 1CY8A 3W4KA 5DM2A 1DHTA 4IIYA 2Q46A 1V7ZA 3W1EA 2XOEA 4RF3A 4JVLA 2UXBB 2BY4A 2QTMA 3HCNA 3MUOA 2DLNA 2HJSA 3LBHA 3NASA 1PTJC 4K3VA 3IT0A 4E12A 1GGJA 4YUZA 2C3UA 1XROA 4N01A 2FOIA 2AE1A 3N3AC 1YFJA 4DC0A 1Q7RA 3K2IA 3QPCA 4PPGA 4US0R 4WNAA 2AG6A 1X7WB 2A84A 3O2JA 2X23A 2JJYA 1N0WA 5JCXA 3GJRA 1ZGCA 3INNA 4M38A 3KPVA 4G1UC 4IJQA 4KWTA 4XD7D 1NLZA 1RJ9A 3SEAA 4KNYA 3KJQA 1PFKA 4DIOA 4DXHA 3NHJA 3NBFA 3PG5A 4QREA 4UDOA 4PIVA 3KSUA 3WNDA 4BKMA 4D8VA 3D7RA 4OUDB 1VGRA 3MVEA 2G28A 1KORA 3KTFA 3QYJA 3FPHA 2ZR8A 3AKCA 2QLJA 2G07A 1XRQA 3GWZA 4I9HA 2H08A 2ZVJA 4FMDF 4JVNA 1Q0HA 2I1LA 3Q7QA 3RREA 3TI9A 1SC3A 4GZ3A 3PI6A 4PYMA 4MJ3A 3GVIA 2RHOA 3IHLA 5KNLA 5C3MA 2CNBA 4Y98A 4BAZA 2I76A 4X1YB 4ALJA 5CYGA 5JFOA 5JWRA 3HS3A 4LXUA 3T15A 3PNBA 2P2LA 2RK6A 5KSZA 2HBZA 3ITEA 3OZUA 5EZYB 2XQKA 3HJNA 3ZU4A 2B7LA 4XWOA 1IY2A 2WHYA 5A5FA 1TF5A 3FCYA 4MCAA 3IPCA 5ICEA 1NNSA 1RQ7A 2WJ6A 3BTVA 3K73O 4N0PA 4XQGA 2XOXA 3EH1A 4TV8F 2I2DA 4D7AA 3ROKA 4CI9A 3KKZA 3LPLA 5K8UA 4ARAA 3LRXA 5B4TA 4E2YA 1F2DA 3O83A 5DYYA 2WYUA 4Q3KA 2JFWA 3OQ1A 3T8YA 4YAGA 5CB4F 1N78A 1Q0ZA 5LB4A 2DPXA 1JDBB 3P1JA 5K8TA 4CCAA 1PNVA 1A2KC 1NYRA 1WXHA 2CHUA 2YRXA 5CDFA 2ISSD 3FCSB 4MUIA 3LOQA 1POWA 1SFRA 3CF0A 4PRYA 4FQ8A 1VLLA 4GP6A 4L5IA 5DBHX 3SZMA 2RONA 3KKOA 3NNDA 1SRQA 2QXYA 3FJOA 4IIVA 3ECSA 1D2EA 3QEJA 4KQ1A 3RB8A 3RUPA 1F0KA 2BM9A 3USES 5KWIA 3CEHA 3AEQA 2XDQB 1M33A 3RYIA 4HVTA 3WIBA 1O95A 1JDVA 4Z3DA 1V26A 3L6EA 1DP4A 1R15A 2O2ZA 2ZRPA 3FDZB 3WWYA 4C0HA 3TVTA 3DXYA 4CQLA 1ECCA 4URWR 4INZA 2ZRAA 4XUDA 1V11A 4PNPA 3U5TA 4KMRA 2ZREA 3VPHA 1XPJA 4MVXA 1IG3A 1HT3A 2DSNA 1PDVA 2F62A 3BAZA 2PKQO 3EULA 4K6MA 4OFXA 1UM8A 3URKA 4QEKA 4IZHA 3JQ8A 2DAPA 1Y7LA 3HR7A 5KSYA 2YZMA 3R7FA 1E0JA 2J07A 4J9VA 4TRMA 5CH3A 1P73A 3SF8B 4B6OA 1W46A 4XIYA 4MLDA 4WINA 4LCJA 2PKQP 4EG0A 2ISQA 3ESQA 4RXUA 5CCEA 4HPJB 1RCTE 4M37A 1O6CA 4IJVA 4DLXA 3T5MA 2V98A 2Y71A 4FLEA 4QGAA 4JVSB 1DIRA 1U3CA 2IVFA 2IQIA 4H1WA 3S2UA 1XZHA 4EJ6A 1BHJA 1SU7A 1U2PA 3P2OA 1A5SB 3KE8A 5ESRA 3AVXA 2AFVA 5BP7A 3AF1A 3DE2X 1SXJB 5E4TA 1RT9A 3RM3A 1JAZA 1KVQA 3UJ3X 2WT4A 4PY2A 4CYMA 3C6XA 1MVLA 2Z6VA 4ZGBA 1WHTB 3JQAD 4HL6A 2E4UA 1MXHA 4BMYA 2GYWA 5IANA 1NYTA 2F4NA 3HBLA 2ODBA 4X6UA 2H6EA 1VL8A 3A9VA 1KPIA 4F9EA 4EF5A 2ZIXA 2PXXA 1KRHA 3ZGOA 2PH7A 3FVVA 4CTKA 1LV7A 4TTQA 3WDLA 2HPHA 4CQLB 3NEPX 3QVLA 4RUKA 3L8DA 3T0IA 3DAOA 2EGGA 3EZ9A 4LRXA 2OT3B 2IUYA 1UAGA 2H06A 4A0SA 3I34X 1ISMA 1PL6A 4KAAA 3ZH9B 4WXHA 4JU9A 5HZMA 3T4XA 2F8MA 1A0OA 2P3LA 4BQOA 1CPYA 2PT9A 1RWVA 4Y9SA 5EWLB 5CFRA 1NBWB 2BEUB 1MMFB 2QTGA 1KY4A 1RSZA 4IS3A 1L4KA 1CUIA 1FP7A 2HY7A 2O6HA 5G02A 5LJIA 2ZJ3A 2FPLA 4JWKA 1C5KA 1L8QA 1OV6A 2FCRA 3SHTA 3ZNNA 4QFCA 4DQVA 2FE4A 2Q5HA 3AHFA 4RL6A 1A5ZA 3EQ2A 2PUWA 2C2GA 5EJ4A 4FZ5A 3HM9A 2W6CX 3I04A 3N8HA 1SCJA 2MDTA 3V8BA 5IZCA 2F1JA 3EG9A 3LQRA 3ZW7A 3HKEB 3KD2A 3RLIA 1IH8A 2Z08A 3PU6A 1UPXA 3FBGA 1MJGA 3N2ZB 4R8RA 4W4TA 1CR0A 3BH0A 4Y67A 5D51S 3NB0A 4U2BA 3SYRA 4QRHA 3UQYS 1DAMA 1QYVA 2Y0DA 4YDSA 1AO3A 4ZHSA 2D8AA 1WAMA 1JEQB 1HLPA 3G59A 1UBEA 1CE8A 4I3GA 2G1UA 1PFQA 4LI0A 5E6RB 5J9FA 5TEWA 3UA4A 4CUZA 3BMNB 3FNHA 3K70B 1O6GA 1B0UA 2QYOA 4UFPA 3ECAA 4EHHA 2VJMA 4TL9A 4ACBA 3IEUA 3PC6A 1SM4A 3M34A 4LXXA 3K0BA 1HMPA 2BM0A 3P9ZA 1DAPA 1QGUB 1Z9BA 4FGLA 4JOCA 4Z8XA 4D41A 1WQ3A 1TO6A 4BV9A 3SPXA 1IHPA 2A5DA 5I9IA 3WGYA 4RW0A 1DNPA 3V4LA 4UHEA 5JD5A 5IT0A 1CUAA 2POCA 8MHTA 5TX7A 1YDFA 4E08A 3W9UA 1WF6A 1N5OX 3I0NA 3LDFA 4BFCA 2ACKA 4H3VA 1KJNA 4RAQA 1NHGA 4CM4B 5BXYA 1HDCA 4W9RA 2O1WA 4JCOA 3I9MA 3OWHA 5IPFA 3PHBE 3S5JA 5KTMA 2H48A 2RAFA 3BWMA 4I8XA 4K5QA 2W2NA 5C51B 5HZHA 4DUGD 3UAYA 1J9GA 4RKWA 4DXAA 2CLDX 2JCXA 3B36A 5AW4A 1PV4A 2JHPA 2AUMA 2RBKA 3EXIA 3CWZA 3O8RA 4QIHA 5FPTA 3DUFB 1FU7A 4RD6A 3WGUA 3VR4D 3W7VA 1SHTX 1JHDA 3AJ9A 5GONA 1WXQA 4M1SA 3ICPA 1KRXA 3WB1A 4QDZA 1BEEA 1OFVA 2V1UA 3P2JA 2QRHA 4HGQA 2AFHB 2ZYIA 4WA8A 3THYA 2VPIA 2Y99A 3EIHA 1XMIA 5HJEA 4ETMA 1EE1A 2RH9B 4LFBB 2ZUFA 2C7OA 2P67A 3LK6A 4MA0A 1PL8A 3A9WA 1BG6A 3V4VB 1OKKA 1JFFB 1QGUA 2ECPA 3CCBA 5J4LA 2PXCA 3WV5A 5JYEA 2A35A 2Y1FA 3G0DA 4PYIA 1WPRA 4ZAGA 4N0DA 3IUQA 3ABOB 5I9SA 4B82A 3I4CA 3T34A 4EW6A 1JPVA 2EERA 4GLOA 4L8YA 5CGZA 1H6DA 3HJCA 4I6JA 2VHWA 1WOMA 1JEYA 3FRHA 1KI1A 2XMPA 4ERNA 3I62A 4HYYA 4GXNA 3ZXUB 5KNCH 4EY7A 4YRTA 1E5LA 1O4VA 4YN3A 2VJBA 2AGVA 3ZHUA 4P2BA 4K40A 1V6CA 2BGIA 2ZRLA 3PHGA 1D3AA 1UDCA 3JVIA 4FGSA 4K9KA 3F8WA 4OEHA 1BMFA 1GPUA 1XLTA 1Z08A 2XXAA 5JQGF 1J0BA 4BRSA 3NEJA 4IDPA 3G8CA 4ARBA 1POXA 1X38A 2EX0A 2GHQA 1YR6A 4YRIA 1JFSA 4PSDA 1Q16A 2QM3A 3F6RA 5F5NA 3EPLA 4ZT5A 3AY0A 4R31A 5AVSA 4UBOA 3BIJA 2AKAB 4WTOA 3D6JA 4OB8A 3RAPR 1NP6A 2OZPA 4BNTA 4EW3A 5KX5A 1EVJA 2Q5IA 3OX3A 4B9EA 4ZIRA 2DCMA 3OEYA 4XA8A 4GKKB 1U0FA 1XVVA 3Q3JB 3OVMA 3H6GA 9ABPA 3VA7A 2CMDA 5BSKA 1M7HA 3DF7A 2B94A 2GHIA 1WEKA 1H1TA 2GJAA 2K87A 3ZPXA 4AZ3A 4EUSA 3IAM6 4HUQA 1R0WA 2WM8A 3OM1A 5BWLA 1UBTS 3OQPA 1CD5A 1VIVA 1JFFA 3IEXA 1WRBA 3ZHOA 2HHJA 2HO4A 1QGAA 1PHRA 3UXHA 4O08A 4U7DA 4JR1A 1V95A 3EGCA 5CB4B 3ILSA 2G5PA 2BUBA 1D1TA 3TZ6A 1Z33A 1MU0A 3MFYA 2IVZA 3CUWA 2O0HA 3O8LA 1JBEA 1M1XB 1P2UA 2BTOA 4ZOBA 3V4FA 2H31A 2ATVA 4P4LA 3WLHA 4AN4A 4C5CA 1S3IA 1SD2A 3CVYA 3AKZA 2JHGA 1QHSA 1FDRA 1TX4B 1XBTA 1YQWA 1ZRSA 4KFUA 4KW7A 1XGKA 2YRFA 4KKXB 4BC0A 1LSSA 5GOZA 4HNQA 5KQMA 2X7XA 1MCZA 2HI0A 2EG5A 4RFLA 3AT1A 5E7QA 3EVTA 4OM7A 4UZSA 3RANA 1BXGB 3H16A 4V0SA 2BEVA 2C57A 4LWQA 3FDJA 5E3HA 4AF7A 1W4BA 2QT1A 2EARA 3K1YA 2ZRKA 2O7RA 4O2BA 4S2EA 3SHVA 3UWSA 4BNDB 2FWAA 2JIOA 4O8CA 4D6XA 3IESA 3DEAA 4DLTA 3R9XB 3F74A 3W5AA 1E8DA 4PU0A 3VR0A 4DIUA 1BCRB 4A8HA 2VNHA 5JJBA 2NU6B 1J8YF 3RW9A 2AHOA 3AVYA 4F2HA 1PCXA 1Y80A 3IUPA 4R6WA 2GXAA 2X8LA 4F84A 4YUAA 2O7VA 3QKUA 4OOEA 5IDVA 1NJ8A 4RAOA 3V8MA 4MDEA 4CR6A 3B1YA 1AKUA 3V2HA 4L6IA 3DAPA 4XFDA 4YRAA 3RTDA 1SOAA 1ZJ6A 3D6MA 3R0ZA 1ZL0A 3HXKA 4ITUA 3TD2A 3PQ3A 4TSRA 3WA6A 4EZEA 5ALUA 4YVFA 4EAQA 1E1YA 2NZ2A 2GZDA 1UKEA 4LSGA 4ZCPA 2PAFA 1RMYA 2HFKA 1YGPA 3NR2A 2CHQA 3DTVD 1EFRA 4PFKA 5LLSA 4IDDA 2JI4A 1V47A 3FNEA 4DEYA 3AF6A 1ZN8A 2BBWA 4JC0A 3QOWA 3ROGA 1GKUB 2DJ5A 2XTMA 1SIOA 2Y1EA 3CXUA 5G41A 5B12A 1FYEA 1RRMA 1CR1A 1I4DD 2PZLA 2ZE5A 3CCFA 2JFPA 3TAHA 5LZ9A 1P62B 2BFBA 4RPIA 4RE5A 1EFHA 2QZSA 3S81A 4EKDA 4XH9B 5CM2Z 4DMLA 3R09A 1U04A 3EZXA 3C97A 2QG6A 1ODFA 1K8RA 3MOSA 3R3WA 2Q4RA 4QZVA 1VGQA 3ABQB 1CQXA 4CUJA 5IYZB 4MJ7A 1NLMA 3DF9A 1ZZGA 3QHAA 1E4VA 3G89A 3MMXA 2CY0A 5E38A 2QRGA 5B1DA 4QG7A 4DILA 2ZLBA 3KOWA 5A4AA 3NANA 1TPYA 3A3OA 2Z1DA 5EMLA 3KXPA 3GP5A 4KIJA 4NL4H 4X8HA 3KZXA 1T2NA 2I9PA 1CBUA 1NIPA 2AI1A 2C42A 3NHLA 1XD8A 4KLAA 4RA6A 5LQMA 5THQA 3IAXA 5EMMA 1VYVA 3RT1A 3STVA 4CIWA 3G68A 3IP5A 3SNKA 4NDNE 3GRZA 3WGLA 2C98A 4JJFA 4YXWD 4O4HF 2A5JA 5DI9A 4KQJA 4CPDA 3RRFA 1DC6A 1M34B 1EVZA 1XU7A 2QHXA 2M98A 4B6QA 3ZJ4A 1SA0A 3DWIA 4PLTA 1NMEA 1R10A 1E94E 1OAKA 4HUJA 4UDNA 3EYAA 4C4TA 4ERXA 1N3BA 1U0SY 5CA1B 2ERCA 2ZSBA 4E31A 5CR9A 5JSFA 1E9SA 3EVZA 2GSDA 4IDFA 3RLFA 3BS4A 4X3CA 4LHVA 4MQ4A 4B43A 5A5DA 3I58A 2QL7A 4NJOA 5KNDH 1YIDA 1OJLA 2BR5A 3QP9A 1RWPA 2DX7A 4H15A 4MVJI 2H1FA 3NHRA 3THSA 5A3RA 4KITB 1N33B 3PRYA 1FE8A 2G8NA 4Y6GB 3FXAA 1IXZA 1IN5A 2O05A 2ZYTX 4IDGA 4N7MA 5D5PA 1ODIA 5DCYA 2PKCA 4B84A 1EXNA 1S01A 2JHFA 1WKBA 1P19A 1T3TA 3B13B 3T95A 2ST1A 1X6VA 2G25A 2AK3A 3IVRA 3DPSA 3IJRA 1U7WA 3NHSA 4LOKA 1X74A 1Z4LA 3I92A 2DYKA 3ZNOA 3M6MD 4IGEA 4BNZA 4RTNA 4MR7B 2Q5JA 1JIIA 4LE0A 1AUVA 1BNCA 3IB3A 1DT5A 1VKRA 4MIOA 4Q9HA 5EIHA 1GU0A 3EBPA 3QPAA 1UF9A 3AI7A 4A92A 2G6TA 4C78A 1XQWA 5EYPA 4F97A 1TNDA 4CM5A 2VRCA 1W4LA 1G3IA 2ZJ0A 3PXBA 2I65A 4GKAA 4NMWA 2VQ6A 4MI3A 3RU2A 2PV0A 2VNIA 1B76A 3ZDZB 1SKYB 2QSYA 5C1OA 2H4YA 2BMAA 5FQOA 4LV6A 2PN1A 3EXG1 4JWTA 3V7UA 2LVBA 5CBPB 2W2LD 3IOCA 4O3FA 5DGCA 4ETIA 2XD4A 1XZEA 4JENA 1U99A 5DHSA 4A16A 1H0KA 3I28A 3NTVA 4P83A 1TKCA 1VIMA 3AG6A 5I8PA 4NXMB 2AMVA 4LXIA 2R5FA 3DLCA 5HIMA 4Z9FA 2Q41A 3EPPA 3PWKA 3ELUA 4X41A 5IFKA 1EIWA 4BB0A 1YIAA 5TC4A 1RWQA 2O3QA 2EKLA 3DOCA 3TW0A 1Y6GA 1R4NB 4AMVA 4HNVA 3NV7A 1YT5A 3S5UA 4DR7B 4CV3A 3QELA 3FA2A 3K0FA 3P94A 2HK8A 4UTZA 3PDHA 1AT1A 3FPCA 3O8QA 1AKEA 4NNPA 2XAUA 4YS6A 4OXNA 1PJZA 3TW4A 4OJQA 4F86A 2ZI7A 4TYYA 3VKGA 2IS6A 2IODA 2IYYA 1CRPA 4DC1A 1CZRA 3UUFA 1KJQA 3D7NA 3IIKA 2H2HA 3NM5A 3VPAA 4BBJA 4UJ5A 3MMSA 1QRUA 4NCKA 3W1VA 2Q3EA 5HKOA 3EDQA 3IPXA 3ZQ6A 5JQGB 3LDGA 4ZI7A 3NLLA 4CIVA 4J7UA 1RIFA 1L4LA 3PHHA 2YHUA 3CRMA 2OXCA 2PU5A 2VPZA 2GK3A 4CU2A 2I7CA 3OZTA 3I5UA 4EG5A 2EWWA 2J3DA 2WF8A 1DC8A 1IRXA 3DVAB 2YZ7A 1KK3A 1UBLS 3N3BC 4IDOA 5G4KB 4ECAA 1Z28A 3E5RA 1X7XB 4TV9A 4LWOA 3TQFA 3INRA 2YWEA 3KDSE 2FRXA 4KQKA 2Y05A 4LVNA 2PSEA 1IZ9A 4IZOA 3INYA 4AG6A 2GGSA 3A28A 1QRTA 1DXOA 3O75A 3R5FA 5GGXA 3RAGA 4PYJA 4EMSA 5MN6A 1DIOB 1OIVA 2WHEA 3ITKA 4FGWA 1H23A 5FPYA 3GRUA 1Z83A 2C3YA 2J5KA 4AZVA 2HLHA 4Y9DA 2LTAA 1CR4A 1NY5A 4PCAA 3DV2A 5LUBA 3CNEA 2JAQA 3TZLA 3B1FA 3WNQA 3LSTA 2AOTB 1AMNA 1MFZA 1LPMA 2W6PA 1O0CA 3AVPA 1J97A 1V1RA 2QNRA 1B1CA 3P19A 4UAUA 4YHBA 1SG0A 4P7JA 3OUUA 5K0FA 1KETA 2WTUA 2P9GA 1NRIA 1DBSA 1IBRA 4GF5A 2DTEA 1WQ4A 2GKSA 2XUIA 3GLQA 2QTRA 1S8NA 4K8OA 2YQZA 3MWFA 3U56A 1CEXA 4ZYYA 3EZGA 2DM6A 1GP2A 1L7VC 1H9AA 4LJ5A 2JAPA 1QP0A 4P0QB 2PQ6A 4TWIA 3TINA 3BTOA 1W76A 1Z2PX 2VPQA 1TZBA 3FOBA 4GC9A 1F7VA 3OF5A 3DL0A 1ZU4A 2PSJA 3GEGA 1RVV1 1UBHS 3PVZA 4MRAA 1TADA 4OK3A 3Q5DA 4US1R 4ZJZA 1VJ1A 1IULA 3OFKA 3DVAA 4E03A 3FUXA 1G5QA 3ZGLA 3RKRA 2HQ1A 3GU3A 4BNUA 4CFYA 2IH5A 4XI9A 1N1MA 3A2MA 3CLVA 3FDIA 4HN2A 4QGGA 3AERB 5IW8A 4Q1DA 1GEGA 3IPLA 3MTJA 2XVZA 4RF4A 3MB8A 1YZTA 5EIOA 1FMJA 5B7GA 1KQFA 1RFLA 2FZKA 2MSEB 4O2AA 3LOUA 4LOIA 5BSEA 1GV1A 1RYYA 3GRVA 3K8OE 4E4YA 1I3MA 4PBSA 3PPWA 4PFSA 3RHFA 2XMBA 2Z0MA 1NQWA 4P32A 4U2GA 5SV2A 4F5EA 5I4KA 1AQNA 3MC1A 1DG3A 1D2GA 1D5CA 3X1WA 1IWOA 3N7TA 3UAWA 2OTCA 4K9DA 3CEPB 4KUGA 4WECA 1ZUIA 3CQ9A 3PYLA 1P5RA 1ZUHA 3EXHB 1T1JA 1NHWA 2PBFA 1WMEA 1CJKC 1QCYA 2PSDA 3DMGA 3ZYCA 2XSZD 2N3ZA 3C14C 1T8PA 1UDBA 3L8MA 3LUKA 1XD9A 5FNVA 2IOYA 2HU7A 2XIJA 4C6RA 1U4OA 2ZWVA 1UOOA 4JYBA 1R16A 3IJPA 3QXHA 1RU3A 1FUIA 1RPJA 1N6RA 2YJ5A 4KTTE 1GNLA 2Q4DA 4NZMA 1VPLA 1WG8A 4AZTA 1G2QA 4NCNA 2O3RA 4EJ0A 1J90A 3EGDB 4JIMA 1KSJA 4MHSA 3RARA 5JNTA 1CUCA 4UZFA 9ATCA 2BT4A 1YBHA 1M3SA 1G6KA 1G42A 3G3EA 2YTZA 2BMEA 1N6IA 5AM0A 3GLGB 5IK2D 3AERA 4DDHA 3AL3A 3OZXA 5A4JA 4ARIA 4H7IA 2JBWA 1EFPA 2CHVA 5JQWA 4L02A 2ODEA 1OLOA 5BSWA 1VKJA 2IHZA 2YXBA 3M4NA 1FTNA 2ZZMA 1A8QA 4JR0A 2QW0X 3A6FA 1WUHS 4YYZA 5FLKA 1S0UA 2DP4E 3HADA 4IUBS 4JA2A 3U4DA 3ZQ4A 3OTOB 4MVJA 1ZM4A 3R6GA 1MAAA 1EYZA 2P5TB 2QE7A 3HJUA 2XMGA 5FF9A 1FFXA 1DIAA 3R76A 3PQ5A 3COPA 3H97A 1I1HA 2CXNA 5GQSA 3ZDAA 4JLBA 1VMKA 1FP2A 1GQOA 5HWSA 3KKKA 2KHZA 3GGDA 1G16A 3F78A 1RLMA 4P3XA 3HDGA 4I50A 5HOEA 4HB0A 3NC4A 3G9UA 4KLNA 2YXNA 3ZTWA 5L4LA 4BGVA 1G8AA 4RK0A 1EGMB 1NQXA 3DZ8A 1L5LA 2XRMA 3SXUA 3AJEA 5CXUA 1VFNA 3RPEA 1SXPA 3B3FA 1BE0A 4HLUC 4AY4A 1G3QA 2H0RA 1FU8A 4Q4DA 4MUGA 4IH1A 2H2FA 3PQDA 1R0RE 2CFSA 3KSRA 4URZR 4ZRDA 2XCRB 1MBZA 4ZAFA 1P1CA 2R8PA 3DT9A 2J9GA 4YDRA 5FOUA 1TM7E 3GG9A 3C7DB 3PA6A 3V1UA 2ON6A 4MHTA 1MHTA 2EW1A 1OC4A 1U2EA 2R86A 1Z2NX 4D9FA 1QC5B 1BFKA 4D57A 1V48A 5I9MA 3IAHA 4MV8A 4QDXA 1UK8A 3AEQB 1TCVA 4YJ3F 4JAVC 5LBUA 2L17A 4NR0A 1CQPA 1H4VB 1JJAA 3CJTA 4YXWA 3P52A 4M9RA 3TL2A 4BJ1A 3I05A 4KGDA 1J1UA 1MAUA 4TTAA 1OTHA 3VDMA 1RZ3A 3FSGD 4H16A 1P31A 1GZ6A 3GRKA 4L95C 3QKWA 2CLOB 3JARA 4R41A 1RM5A 3JQ8B 1UP4A 1RRVA 1VCHA 2A9RA 1EUZA 4P58A 4R1LA 3RF6A 3AVVA 4H7KA 3G2MA 4NECA 6NULA 5JMWA 1MEEA 5DRTA 3TDNA 3X3HA 3OZGA 5BUCA 3S2YA 2YFQA 1G2OA 4DQUA 3N0RA 2XQVA 1F17A 3FKSA 1TC1A 1Y1PA 4DDUA 2NO1A 1V4NA 1Q2XA 1C0PA 1V35A 2RGAA 5JYBA 2P0AA 1PT9A 2NXEA 5FR1A 3LQFA 3KZOA 1SD1A 2BI7A 2VYVD 3M9LA 3HO8A 1BMQA 1G5TA 4RM3A 2AMFA 1WUIS 1XRRA 2J3MA 3PRJA 4X20A 4B44A 3A6KA 3L4BC 4UC0A 3C7KA 4N3AA 3UH1A 2ZSUA 3KVNA 2HDNB 4HH0A 5TJHA 3S8YA 3KQYA 1ZI8A 1Z18A 2ILVA 3D6VA 3LXUX 4R54A 1RJDA 3IR5A 3E1GA 4QGSA 4QEDA 2JJ1D 3K6JA 3NVKI 4HRYA 2ZIXB 1G6HA 3TEMA 3QVSA 2LDBA 2O8BA 4WXEA 4Y6SA 3K96A 7ABPA 3FPEA 2HDHA 1NXTA 2PWBA 3SX0A 2CNDA 2RHBA 3LHSA 3B20A 3CUTA 4YROA 5GTDA 1VIDA 5HM8A 1U3WA 1P5ZB 1PL0A 4QDTA 1SK8A 4Q9AA 1IOWA 3JCZA 2YJ3A 1M2KA 1PV1A 3L07A 1KYQA 3LUJA 2B82A 4P3OA 3S55A 3JARB 4UATA 4BNKA 2V7TA 1DEKA 2A67A 4C3VA 5ALVA 1OH6A 1SHUX 1YVRA 2ZJYA 5K05A 1EUYA 4H08A 3T7TA 1U2RA 1RHQA 4Q3CA 1CZOA 2B4RO 5BYJA 1IXKA 1E5XA 2ZYGA 1TFUA 2GETA 3EFBA 1QM5A 3OCVA 4KNWA 4M6WA 4OBWA 4W7HA 2FUNB 1E99A 2HA4A 5DHUA 1KZYC 4BNLA 2HRQA 3W4JA 4CTJA 4GSKA 1LNQA 3EEBA 2F48A 3OIFA 1ZI6A 4DSOA 1EEXB 2WTXA 3IX7A 4KVFA 5LUAA 1RW4A 1OI7A 3DLTA 4YECA 1NV8A 3A6PC 3DE6X 2IH4A 3EG9B 5DI3A 1LLFA 1KWGA 2DF8A 1US8A 3TOSA 2QD2A 2XQGA 4OATA 4M55A 2OBMA 4NG5A 1SBIA 7YASA 5JY1A 1P3Y1 1U4SA 3K0EA 1CKEA 3L4BA 3N2GB 4I7EA 1E5VA 3E61A 2P1RA 1CE8B 4LK2A 4C89A 5DIFA 2CLHB 5J4KA 5CM8B 4Z6KA 1YQDA 1CIJA 1KO8A 2ZBGA 1BH2A 3B1XA 4C6TB 3V8EA 3ELDA 3H05A 1DIGA 1L4MA 3M3PA 4OHRA 1XG5A 3RNLA 4ZEVA 2I29A 3L0CA 2WDPA 4B3FX 2FZ4A 4RZSA 4Z54A 3RC7A 4YASA 3B9QA 2P79A 3GFSA 4Q37A 3UMBA 4D0RA 4JLUA 1SUEA 3RSSA 4ESVA 3UJNA 4EJMA 3WIEA 4Y1FA 1R4AA 5GIPE 1MIOB 3ENNA 3PFHA 3NFRA 3ESCA 4MV5A 4EDHA 4MW5A 1FJXA 1KIAA 1U0NA 3PFIA 1EWKA 4M36A 1U0GA 5G1OA 5HGJA 5SY9A 3ZHTA 5IASA 3GJXC 3R3XA 3L79A 4H3SA 2J0EA 4CLRA 5HIKA