3OLQA

The crystal structure of a universal stress protein e from proteus mirabilis hi4320
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
306
Chain Sequence
EKYQNLLVVIDPNQDDQPALRRAVYIVQRNGGRIKAFLPVYDLSYDMTTLLSPDERNAMRKGVINQKTAWIKQQARYYLEAGIQIDIKVIWHNRPYEAIIEEVITDKHDLLIKMAHQHLGSLIFTPLDWQLLRKCPAPVWMVKDKEWPEYGTIVVAANLSNEESYHDALNLKLIELTNDLSHRIQKDPDVHLLSAYPVAPINIAIELPDFDPNLYNNALRGQHLIAMKELRQKFSIPEEKTHVKEGLPEQVIPQVCEELNAGIVVLGILGRTGLSAAFLGNTAEQLIDHIKCDLLAIKPDGFTCPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a universal stress protein E from Proteus mirabilis HI4320
rcsb
molecule keywords Universal stress protein E
source organism Proteus mirabilis
molecule tags Structural genomics, unknown function
total genus 100
structure length 306
sequence length 308
ec nomenclature
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00582 Usp Universal stress protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3olqA00
3OLQA 3MT0A 4R2KA 4R2JA 3CISA 5CB0A 3AB7A 3AB8A 4WY2A
chains in the Genus database with same CATH superfamily
2J0VA 3LPLA 3FFAA 3ROZA 1W4RA 2BEVA 2MTBA 2X1LA 3AHDA 4MKZA 4EW1A 2C4WA 1ESDA 3E2PA 4CXMA 3RT7A 5TQ0B 5DBHX 3TO5A 1QU3A 2VOJA 1CY1A 1E3LA 2GD2A 4B85A 5A05A 4WSOA 4YJHB 4I14A 2G40A 4QAQA 3NATA 3VYSB 4ATNA 2ET6A 3K7EA 3I05A 1JDVA 1D2MA 4N0DA 1A9ZA 1DQRA 4EDHA 2AS0A 3U4QA 3GEMA 5AUNB 2G9ZA 2FOXA 2YDYA 2HLHA 3U7JA 3WIDA 1B41A 4HEQA 4BFVA 5FWYA 1DX4A 2I78A 1O9HA 3M5CA 3V3KA 3VTFA 4F9EA 5AW1A 2WP0A 1I3OA 4MB6A 5JC1A 1PTJC 1OX4A 3O0DA 3PVSA 4GVPA 5UKDA 4KZKA 1GAQA 3TINA 2E82A 3WGVA 1U3DA 1XVUA 3LO5A 2Q5IA 4LN1A 4CIDA 3DBOB 4OFXA 1G21A 4OGWA 3MMNA 4RTQA 5K5EA 1E1QD 3RANA 3E9ZA 4B79A 3L79A 3NWEA 2WWRA 1A8PA 5G3ZA 1E6EA 1KO1A 4YDSA 1GCOA 2AXPA 1XELA 4NNPA 5JH7B 4YJ2B 1JI3A 4FS8A 4KMSA 1XLTC 1O96B 2HHHB 1J8MF 1SCKA 1WZIA 4Q21A 3S8EA 4DBLC 2Q1UA 2XDAA 3S1SA 2OZKA 2P9GA 1GVHA 3KJNA 3RK0A 4MV6A 1W46A 3IVCA 4PLCA 1T0JB 2OBLA 2VTBA 3TSYA 2W8BA 2XBLA 4BCCA 3IQDB 4ZYZA 1GDHA 5GJVC 4ABTA 4IMJB 2ZT7A 4OJYA 5HXAA 3RBZA 2FOLA 4P36A 4EHHA 2PRZA 3EVAA 4B33A 5AKGA 2EWVA 4WW0A 4D9CA 4TYQA 1SQGA 1QANA 1JXOA 2IUFA 4HTFA 2XADA 1I0IA 4U7FA 2GERA 5TXGA 3U80A 1GYRA 2N75A 3AERB 3IT2A 2W0SA 3KR1A 4YXWA 1XHEA 1KORA 3RIMA 1GTJ1 5BSGA 4TT3D 3TNDA 1KSGA 1MO2A 5J1SB 4XFDA 1S1CA 13PKA 1XN1A 3NHSA 4H1TA 3T4EA 3PYMA 1I7LA 2WFZA 3R3JA 5DYTA 4WK0B 4WOKA 4TVKA 2AEMA 4LXQA 3DHYA 3HXMA 2YY5A 1W9HA 1X7HA 3HN6A 1E3WB 1T10A 1YD7A 2ZJBA 4C05A 3VJRA 4KQHA 4LOJA 4XGIA 1UMBB 3AUJB 2C57A 3DDZX 4P08A 4HL6A 1E0DA 1ACLA 3IAS6 1Q0HA 4BNXA 5HFJA 3F7TA 1T4MA 2DRIA 3JQEA 3LZDA 4EYSA 2GJ8A 3EPKA 4K8OA 4J0CA 1SU4A 4C08A 1B8VA 3BD7A 3F6BX 4I5IA 4M1OA 4MR8A 1SIUA 4MUJA 4NECA 1XPUA 1JSCA 1HM5A 1VHQA 2D4AA 2ZE5A 1QVRA 3JRNA 1Z6XA 4TMZA 2X7JA 2OV8A 3FVRA 4YH1A 3I9V1 2G9RA 1OXVA 2FSSA 4BQSA 4EX7A 3LHIA 3FZYA 1MAWA 3MCVA 4BY9E 3DOUA 2O5CA 2H5EA 2VP2A 3W5CA 2F67A 1LU9A 3AONB 1GG9A 2RGAA 3U9SA 2XGOA 3HP7A 4E5NA 1ZVKA 1N3YA 4BKUA 1BWSA 1Z8FA 2C8KA 2HPHA 1TQDA 1NSYA 3RF6A 3VGJA 5JCZA 1DKUA 1OGYA 2HADA 3ELYA 4E4TA 4O59O 4TXLA 2C7OA 4JSTA 1D0IA 5D3KA 4F11A 2X5KO 5AI4A 4TS4A 1IOWA 1NUTA 1KC1A 4INOA 4LW8A 2JJ2A 2BHTA 4JJZA 4QUKA 3TAHA 2AL7A 1KFCB 2BPOA 3LDUA 4CLXA 2PXAA 3DMDA 4EITA 2X7HA 2YFKA 3ZHRA 2GS9A 4YCNA 4YJGB 2I2AA 1ZUNA 2XNCA 4BLSA 1KJJA 5CVDA 4JVOA 3JARA 4RHXA 1GA4A 1WTCA 1YZVA 3CLKA 4KFUA 3EZ6A 2MWMA 1RIFA 2RH9B 4MYTA 3GPLA 4ZEMA 4GMDA 4D6XA 1BU8A 2AFHB 2ZWMA 5F78A 4YNBA 2ZYWX 1A9XA 2YZ7A 4IH1A 1K6EA 3ZZNA 2WNIA 4NYJR 4H0FA 1X1EA 3D31A 1DC6A 3EY4A 3REGA 1Q7TA 5JRJA 1F2UB 1Z47A 2YXEA 4R2LA 5E0OA 5U4XA 2GKGA 2ZYUX 4WFQA 1M2VB 3B1YA 1PJZA 2PM8A 3L8MA 4PRZA 1TTPB 3AKYA 3HBNA 4X7BA 2XMRA 3A4LA 4QBFA 3GELA 1QC5A 5JJBA 4EB3A 2XKJE 4OQDA 5AJYA 1LVUA 3CT4A 4OXKA 4OEHA 1Y0BA 4DA9A 2EZ9A 3CLRC 4HRVA 4P83A 4DV4B 5JBIA 3IT1A 3NM4A 3SHVA 5TT0A 3BMNB 1ISFA 2HLDA 2YS7A 2ZRMA 3GFOA 4IJMA 4DIEA 5JPDA 5IVKA 4ZQGA 3WXBA 3VU9A 1G20A 5D1HA 1FX0B 3P2JA 2OHFA 3FGOA 3SIRA 3HVRA 1D8TA 1QLHA 3CLSD 2NO1A 1AXGA 2GMWA 2VZ9A 5T4HA 3T0FA 1JHZA 3L8HA 1UDAA 2CYBA 2VH1A 1CQJB 3BWDD 2ECPA 3Q3GE 1KJWA 3ZHSA 1I2ZA 2FWBA 1LI7A 3LYLA 1XTPA 2Q8PA 3U2QA 2JJQA 4RXMA 2IHKA 5AQ1A 1ISGA 2H1IA 3LQ1A 4X9XA 1L7QA 1J0BA 2Z3ZA 4YCDA 3RT1A 3W3AD 4FMPA 1E1KA 4LE0A 1P2SA 2YIDA 1JAIA 5D87A 4YI5A 2W5UA 3K9CA 3SX0A 3OO0A 2NO5A 2AQKA 4QGBA 2WPDA 1E2FA 3GI1A 5FTMA 1SK9A 3C7KA 2QQFA 1XZIA 5DPMA 5GOZA 3V6MA 4CL0A 3PITA 4OYYA 4BBAA 5MN4A 1HWYA 3G1TA 4GZLA 2V7VA 3U17A 5SZHB 2OPHA 2VYCA 1FU4A 3W90A 5B2ZA 3VU3A 1B1AA 4DHEA 5LZ8A 2AYXA 1C9MA 3NG1A 5J4KA 4F3RA 2JAQA 3SR3A 4UTNA 1NU8A 1W87A 3FNFA 3ZCRA 2BFMA 2D5CA 1KY4A 2UKDA 2C7RA 3CJQA 3OZTA 4TQUS 2XRZA 1SXQA 3ELBA 2LXNA 3QY9A 4KL8S 4C03A 5KVSA 1F7UA 2GNAA 2XY4A 4LXTA 4O4JB 4W7SA 3RUCA 3TE6A 4M83A 1ZGZA 4RE5A 1OXUA 2JFFA 4LXYA 4M7WA 2C99A 1X7YB 4MVJD 2NW6A 4MWDA 5JBNA 4D5EA 4G84A 4D79A 4I55F 5DK6A 1M6VB 3DGEC 1M2GA 3I6MA 4U6SA 4EJSC 1M1NA 3JQ7B 3V7UA 1D2HA 1W6RA 3D7SA 1RBMA 2IOFK 5EE9A 4CLHA 2VQSA 2DT5A 4ZV4A 3P9YA 2GPAA 4ILEA 3GJ7A 3HY4A 1H5NA 3JQRA 2O9JA 4KC0A 2GFIA 2RARA 3ML1A 4B46A 4ZYYA 5C7YA 3A0UA 3O2NA 4QXRA 1NUUA 2RBGA 1FYDA 1PVOA 1QGOA 4HDSB 3HXOA 1QJCA 2XHEA 1NYRA 5SV2A 3B78A 2JKZA 1KOJA 3EEQA 4WOPA 2IW1A 3THXA 4HZGA 4NE2A 2X40A 1A69A 3A6PC 5CA0A 1L4MA 5J5CA 1PT7A 3T1VA 2I1LA 3GVIA 1G3IA 4AG3A 3KJXA 4BGVA 4HQNA 3UXMA 1Y48E 1SXGA 1HLFA 1GPBA 4L74A 3GLGE 3G0CA 3R5FA 3SJAA 1A1SA 3AR7A 4JUAA 4OK6A 2Z83A 2ZM5A 2Q3FA 4X7MA 3JD2A 3CNHA 4ESVA 4DAEA 4OJKA 3WYCA 4ROSA 2I22A 1GPLA 3QPBA 1E64A 1U9YA 2ODTX 1L8QA 1VC2A 5CPBA 1XZNA 4A5SA 3QPUA 3GOHA 4HQ0A 3FCOA 1SB8A 1UZMA 4N6OA 4U6NA 3GJ3A 1SQFA 3BL5A 2HQSA 5HE9A 2FFBA 4RULA 1PJ2A 3KJZA 1IDN1 3MBKA 4CM9D 5FL7A 2AKYA 2IKQA 3TE7A 4N54A 3E2IA 4HXGA 2YRWA 5CNKA 5GONB 2O1SA 3AR2A 4BVKA 2WHXA 1Z88A 1U28A 2JVJA 2JK1A 2C2WA 3UKJA 4IFTA 4IM7A 2EFEB 2H07A 3NUQA 4F2HA 1OLUB 1JDSA 4LVUA 2K7FA 3RRMA 2CXTA 1YVRA 4XSGA 4CKEB 3K2QA 2NU8B 4J0EA 4IGIA 1WDKA 1US8B 2NZ2A 1Y6GA 4EGAA 3SHFA 3LTNC 3GGSA 1NJFA 1P3JA 4HO1X 5TIIA 3HBLA 1T25A 3F78A 3FTDA 1J0EA 1QRRA 2O8NA 4WXPA 1NBHA 3KDPA 3OP4A 4F93B 2HW8A 4OREX 4ZTBA 2H3EA 4WZZA 1W0JD 2A5FA 4NJEB 1JR3A 2X15A 4D02A 3BH6A 3MUNA 3E7DA 4TVBA 1AV7A 2Y1DA 1DG1G 5SZIA 1WBBA 1L7EA 5DP1A 1LSOA 4UFOA 2JFHA 1KDYA 3JZMA 3EAFA 1YK1A 3DB2A 4GWKA 4KXFB 2FP4B 3OPMA 5I9MA 1PL7A 3WVNA 1M9NA 2H4YA 1Z68A 4NBRA 2D1SA 3AQIA 2H54A 4W1PA 3DR5A 4FYVA 1E61A 3V1NA 5CXXA 4WN9B 5FPSA 3H0CA 5KJCA 5KYTA 4YP1A 1A76A 1EP9A 1VGQA 1GKKA 2QG4A 2QYSA 3IUBA 3L0CA 1QE5A 4I6GA 2Q5JA 1KEPA 3EIXA 4RVNA 4UD2A 2H4ZA 4XQCA 1JEYA 4CGZA 2Y71A 2OZLA 1K8QA 2AI1A 2PKXA 2W0MA 3AKDA 3GB9A 3P27A 3QVXA 4CKCA 1PGOA 5F1YA 3R8CA 4LRQA 3S7ZA 3W2FA 1NF2A 2BDEA 3C8DA 2GBGA 5HHTA 3KVVA 5CTJA 1Q3HA 3D6AA 2WT8A 4FCVA 5I8WA 3BXEA 1VYHA 2CB9A 3KWJA 1YB6A 1U0SY 1BMFD 1LWNA 2V3WA 1LBIA 1H9BA 2XUPA 4HGNA 2XV1A 5HJEA 3ET4A 1RI3A 1BCSB 4K6OA 2H1LA 2D7JA 3HNRA 1L1EA 3OPVA 4ZCQA 3ROMA 3WWDA 4EKIA 4QOGA 4D99A 3GEHA 2D06A 4IVRA 4MUHA 1TL7C 2YZNA 1PT6A 3JATB 5H68A 1LV7A 4U7PB 4X91A 1E20A 4LY6A 2H2IA 2QSYA 3GEGA 2YY7A 3OZFA 3VO8A 3ZBQA 5BVGA 2C94A 1WCWA 2EERA 2E5FA 3LXMA 4TGLA 4JGIA 4WCFC 1ECJA 1OBCA 2D1TA 3FN4A 4J29A 2ODAA 9ABPA 4OJTA 3GFQA 1IN4A 3HUEA 4K1LA 5TS3A 3T5CA 3EZ9A 3WA6A 5K8JB 5CA1A 1I6LA 1YR1A 5KNCD 1HXHA 5GV8A 2C2GA 4Z86A 5I9SA 2RGYA 3SKYA 5L8VA 2C82A 8AT1A 5J3JA 3OFVA 4IKOA 2CY0A 1KEUA 1KMIY 4UHJA 3TTUA 3LGAA 3OLVA 4BO8A 1QIGA 3FIJA 4KO3S 1FP1D 1TMKA 3FMIA 2OAP1 4JEUA 4BEBA 5K3AA 3FUUA 1QTRA 1ACMA 1C1HA 1XZCA 1HT3A 2GK4A 2I8AA 2XGMA 3O8BA 4MWGA 5HOEA 2PY6A 5ILGA 3H1GA 2JFYA 2FPWA 1P2VA 4RZHA 3AEYA 3IP7A 1GCAA 2VCEA 4QOJA 1SKUA 5IT5A 3NGXA 3FY4A 4RFSB 3I1YA 1X70A 4XB1A 1YMVA 4MMZB 2ZM6B 2R25B 1SBQA 4Z3OA 3TMYA 4CQJA 3QU5A 4F1WA 2P3LA 3OE7A 4HC4A 5KX5B 3E5NA 4RKFA 4KUHA 4HDCA 4W9NC 3X0DA 1RFLA 4MSUA 4CR7A 2ZUUA 2C1XA 3A1UA 2HWWA 1HE2A 2A86A 1CIJA 1CYDA 1G2IA 4D8WA 2Q2NA 5FLEX 3X1WA 1WWKA 2AOTA 3GLUA 3VR2A 1MJGA 3WKEA 1DC3A 2PVCA 2LGJA 3GT0A 5EJGA 4OD0A 1R6TA 2PVSA 1VPEA 1XWFA 5BSMA 4B3SB 4XARA 2PZJA 3QFCA 4N5HX 5T67A 2DWCA 3PDIA 2REQB 1CJVC 1MC1A 3VR5A 4TPKA 3LKVA 1YBVA 2XOKA 3KAPA 3ETEA 1KMCA 2MYPA 4ZOLA 2GZ2A 1I4LD 1MMFB 1WQ3A 1DEHA 1V5WA 1O8CA 1QGDA 4YRMA 3JALA 4RTSA 3A9WA 4F7DA 1EP3B 4QNRA 5JCOC 1SAYA 1JDZA 5JMTA 3WSVA 1L5WA 3AVUA 2X0KA 3BD6A 1OWLA 3R8XA 3SOZA 4E0BA 4MPTA 1S1MA 3IMFA 3NONA 4N3NA 2HEGA 1RZRA 4D7AA 8LDHA 3L0ZA 1MTZA 2QL6A 4PGMA 1K08A 1DAFA 3IB3A 1NOIA 1EGAA 1PV2A 2GJKA 3G5MA 4TV8B 2I76A 4GVLA 4C5CA 1S2MA 3I5YA 3G9XA 1NR7A 3E9EA 3DL7A 2JI8A 1C2TA 2YHUA 4Z7JA 2UYCA 4HBZA 4FZVA 1XQ9A 4JDPA 4FEEA 4WDQA 5DMXA 1C5KA 1PL6A 3I5MA 3E1GA 2F9LA 3I73A 3CX3A 4MGIR 2PS1A 1TTQB 2XCUA 1G7TA 3EZXA 5DEOA 4GH5A 4GT1A 5LB4A 2A9KA 3LWBA 3X2EA 5J40A 1VL5A 3A6FA 3VM6A 5JH7F 2IP4A 3IQGX 1OI4A 4LCJA 2RB5A 3M33A 4YJ2F 4UUNA 4OJQA 5DGTA 5D1NA 5K99A 1JX6A 4CT5A 3RYCA 5JFTA 2XYHA 3CEAA 3U7QB 4CL8A 1QOPB 1YCFA 3CTMA 1SULA 4L0CA 3TGLA 3GC6A 3DHNA 1I1HA 4L6AA 3HCRA 5EUQB 1XYVA 3TQOA 4AJKA 4B3DA 1E1CB 1PVDA 2W6JD 4PWZA 4RPIA 4PF1A 5EJFA 3L06A 4KPEC 3AHFA 4KR7A 1XPJA 2P30A 4RHCA 1REQB 2C3MA 1RI2A 2Z2XA 1P9RA 3K9NA 3N2LA 1N2CA 2VL7A 2AQHA 1CP3A 2V4ZA 2JVKA 2P7HA 3D6NB 4J1NA 3RAJA 3KP1A 4FE3A 2NVUA 4OB8A 4EL0A 2BW0A 3OTHA 1P5ZB 4NJMB 4FOTA 1V8DA 3UFBA 1Y81A 1NMEA 5DCUA 2ATIA 3ZK9A 2OLJA 1X8LA 2AJLI 3ON5A 3N0RA 1OAOC 2PRYA 3ZX4A 4BFLA 5IM4F 3AHJA 2EJVA 1X39A 2JAXA 3MOGA 2XF8A 1P1RA 1F14A 2MOKA 3ODGA 1H2ZA 3EGWA 3N8GA 2XKBA 4HLDA 1PLKA 1T34A 2HRBA 2JD2A 4RIEA 4UU1A 1AH2A 1R2QA 4R41A 4WIAA 2XT9A 4RDCA 1SCUA 4L8YA 1GGMA 4M6WA 3DCYA 4WZAE 2XMPA 1ZRMA 5DTJA 1KMNA 3ABOB 5I5GA 4CNBA 3LX5A 1RKQA 5BW6B 4EM6A 4Q1EA 3LBNA 2XMBA 1QVVA 1KJYA 3NHMA 2YJ3A 3JAMA 4H4EA 3WX0A 4ZEXA 4DN6A 4GKVA 1E6LA 2QAGC 1MORA 1YMQA 1CUBA 3EUWA 3N2GA 1OXSC 3H2IA 2EDAA 2P0AA 4I5GA 4N7JA 4HEA1 2XUJA 4FW9A 5B3JA 2BH2A 9MHTA 1IWBB 3TI9A 4KE8A 3UMRA 4B4DA 4LI3X 1ATZA 2D2VA 2GD1O 4PBSA 4IXWA 2HB6A 5TNXA 2IPXA 1BG6A 1HEIA 1P0CA 4UTOA 1RQ7A 1OWOA 2VZEA 3K0BA 4ZCSA 2FR0A 3TRFA 4EBFA 4YN3A 2Y77A 2PKEA 2WTAA 1VHDA 3W4JA 2X86A 1U5CA 1UOPA 2WMNB 5TB5A 5EYPA 1Z5PA 3OP1A 4XIJA 1XRSB 2R60A 1D6NA 1EG7A 3L8EA 2PH7A 3O38A 3A9UA 5HF9A 4MHOA 1WQ1R 5KKAA 4DBLE 4D3ZA 2P2ZA 1ENYA 3S2GA 3T4PA 4FBLA 2W22A 4H7PA 3GCXA 3AEQA 3PXCX 2O3RA 2WBLC 1QYXA 3PK0A 4FN4A 5DIZA 4EKDA 1KP9A 1PQUA 4YQZA 4F5YA 2RHWA 4FSXA 1XVVA 3VUEA 2B8WA 1PWHA 2FDCA 3S3TA 1W0KD 3TLGA 4HDRB 4MW0A 1GZDA 2ON6A 2B5WA 3QE3A 1ZSNA 1WM1A 3LO8A 1CU1A 2Q1XA 3KQOA 1UJCA 2QWXA 3H04A 5BOSB 3OJOA 3ORSA 3X1XA 2JVIA 2XF2A 1JNYA 4ZIRA 1OFUX 1KVTA 4R98A 5K4AA 1NULA 2IL1A 5PGMA 3IBYA 1A04A 4CF4A 4XVUA 5BSEA 3IUNA 1S7CA 2NSHA 3V8MA 4BO2A 5KNDA 2ODQA 4PXYA 3B1WA 5J4VA 1O95C 5EWMB 3RODA 1UJBA 1XCLA 4OXYA 3HXQA 1QYRA 2BBTA 3L5KA 1YZKA 2YICA 2Z2ZA 3AO0B 1JE1A 2H0QA 3KHUA 2NSYA 4GYYA 4KQCA 4BGDA 2Q3JA 2WDPA 3D2AA 5CLJA 2DEUA 2EL7A 2QE7A 3B51X 1KQ3A 4HQKA 4NBUA 4JVNA 5K8IA 3VPBA 1RTTA 1KDRA 5ESRA 2XQIA 4MPJA 2V45A 1TIBA 1ZBDA 1ZNQO 3JPWA 4NZYA 2AOXA 5DM0A 1MIHA 1NUHA 1OASA 3A26A 4NZZA 2YBDA 4KQXA 3V97A 5B30A 5MF6A 4ARZB 1KI4A 3DQZA 2Q2VA 5DCLA 1JHYA 4LXUA 5GAJA 5TQVA 2CEAA 5KKNB 2J0SA 1X2EA 4Y2YA 2EU8A 3LJKA 3MTBA 3P9KA 1V8BA 3GFRA 3K20A 3A31A 4JL8A 4OI0A 4AZ3B 3H2BA 4LJ4A 1R50A 3OC6A 3ABQB 1P8JA 1LSJA 4M36A 1H2HA 4TQAA 3SQMA 3X44A 5JZMA 1NDUA 2NNLD 4FFBA 3SQLA 2ZXEA 2DF8A 2V98A 4PZUA 5T8KC 4PG5A 4L78A 3M3HA 5E8RA 3WLNA 2FW7A 1B3BA 4H6VA 5KDDA 4AKHA 2ZE6A 3ZDCA 3GDGA 3ZHQA 1KHHA 2CNWA 3KL2A 1TE2A 3T9FA 1ZIOA 2DETA 2HDNB 2Z09A 1QH1B 1GA1A 3QVGA 2OXRA 4BO3A 2YZKA 3OT4A 2VHQA 4MH0R 5AVYA 2Y2UA 5C8XA 4K46A 3WQSB 5TF0A 1NQ5A 2B5OA 5TSDA 4FYYA 4DQVA 2VDVE 4KPGA 1OLXA 3S7TA 2VDLB 5SY9A 2GCOA 4BYGA 1OBVA 3ZK7A 2NXWA 4RK7A 1MT0A 1JWAB 3EG9B 3K9HA 5CEJA 2WD8A 3L8YA 5KQSA 1JG4A 3QVSA 1BGWA 3ZCPA 2RKBA 2VPWA 5CK4A 3DMGA 2Z8ZA 4JI7B 1MC8A 2J5KA 2GN1A 2Q6IA 4ZARA 5DOVA 3HWWA 2CNOA 3FDIA 5DTMA 2NU9A 1IEQA 2C2YA 1QS0A 3P52A 4ZEVA 1RWBA 1WY5A 5AO9A 4PR0A 1N1EA 2F7SA 3TTTA 4C0KA 2EBWA 3EDCA 1LJLA 3GT7A 1NPDA 1XL0A 3EXFA 2QL9A 4MITA 2ORED 3ZD8A 5G1OA 3BAFA 3PKJA 3X2FA 4AFNA 2Y1XA 1RWNA 2VUTA 3FZQA 3VU0A 1OJLA 1RWMA 1ZO8A 2DBZA 1XDWA 2W71A 3UY4A 1MO3A 4QRHA 2E37A 4UCXA 4FGZA 3VQTA 2GR9A 5F2EA 1E7SA 1WMFA 2LTAA 5FAXA 1N2JA 1Y8RB 1S9HA 2B98A 1O4WA 3BTOA 3HKBB 4RGBA 3TZKA 3NC4A 4YRKA 5CVTA 2HLPA 2XLBA 3A1WA 3E9RA 4NFHA 2V65A 1W4AA 3BIWA 5BNFA 2QSZA 4KVFA 621PA 3F6SA 2OD9A 4FNOA 3TLKA 4CF7A 1IY2A 3VH2A 5L4LA 4XFJA 4DBVO 1L4FA 2IU4A 1HUQA 1D2RA 2CVPA 3PB3A 2HJSA 4F5DA 3W6UA 4ARIA 4IICA 3B2QA 1F48A 4LJSA 3AF5A 3E3NA 1TZJA 5CDFE 4HDMB 5JZ9A 4FT2A 5KREA 4K3UA 1X3SA 4PINA 1CJUC 5EXXA 3W6OA 2B4KA 3I72A 5IFLA 1JZTA 1G1MA 4F71A 1MR3F 2WSIA 5B6IA 4AKGA 4RZIA 2Y1EA 4MUNA 2GCGA 3SLKA 3DTVA 1UJ6A 3DVSX 3FHTA 1V3TA 1BIFA 1HYQA 1Q0LA 1G5IA 1WHTA 2OOKA 4MPRA 4RD4A 4B3JA 2G67A 1WLSA 3EVEA 1ZX1A 2H7VA 3G2JA 2FFHA 2R7KA 4RY9A 5AVVA 3ZWQA 4I9HA 4FSDA 1NVKA 4F2GA 4LMRA 1EDEA 4KDRA 2JGAA 3ITKA 4Z9XA 3UJDA 4EFKA 1TYEB 1UKVY 2ZRJA 1MDBA 3AL2A 1CFJA 2INGX 3K9WA 4XKJA 4IFEA 3WGQA 4BNYA 3FPSA 4PLVA 2XMQA 1BKSB 2A9RA 3NWOA 4FFLA 2CUKA 4HN2A 2ID7A 5FXMA 5BMVA 2EV9A 1D2CA 2AKEA 3BWBA 4GLOA 3PYLA 4S0ZA 1MZPA 2WSSD 4FN5A 4RVSA 2DLCX 2BN4A 3TM5A 5FBLB 3JQAB 3OQPA 1WRBA 3F49S 3L7BA 1L1QA 2L0XA 3QKRB 1UT8A 4E3WA 4QYXA 1QYVA 1RYHA 4GRDA 4GX5A 4J1SA 5AP9A 3RSOA 3UJBA 1PFUA 3DW1X 3ES9A 2FG7C 3RHFA 1YF3A 4YJ3A 1SR8A 4PYOA 3UT0A 3GRYA 1XTTA 5CW2A 2RAFA 3UK2A 4BCDA 2A94A 2PBZA 1SVUA 2CUNA 2JJ1A 3T5GA 1MA3A 5IFKA 1DXHA 5G0UA 4GAEA 1E92A 2B6NA 2Q45A 2QM8A 3IH5A 3PSAA 4BX3A 1RXEA 4J3JA 1NLZA 4B40A 1Z7EA 4Y9RA 4R1LA 4Q39A 3BXHA 3DBHB 4RS4A 5F77A 4HDKB 4ZO7A 4MHTA 2DFDA 4NOKA 2GESA 4IFIA 4YRIA 5IXJA 2QB5A 1T0HB 2WWWA 4G5SA 3HK2A 3GNTA 3TOVA 5JOQA 4MWTA 2CDRA 3Q72A 1ADBA 2BCGY 3HWRA 1L8LA 4JLBA 5DM1A 1ZUD1 3V7WA 8OHMA 3NCHA 1KK3A 1Z2AA 3OZDA 2QY6A 7REQA 1QO0A 2BFAA 1SBCA 3Q2IA 2CVZA 4GI2A 3TTSA 3LQ4A 3KXDA 4P0TA 1GILA 4U02A 3OTOB 1S0UA 3QLEA 1YBMA 1SKBA 4DL9A 2RGEA 3ROPA 4LYHA 3GJZA 2NGRA 3VYRB 3ZJVA 1U7ZA 3OIDA 1F8GA 5AJUA 2DUNA 3IMGA 1ISSA 1FP2A 2PZBA 2CJXA 3A32A 1AO3A 3E5MA 3M5WA 3ZH2A 5HUQA 1SWWA 1AB6A 1LJ8A 1RJEA 3ELUA 3ISTA 3N2NA 1LK0A 2ZJ5A 1WXEA 4HR7A 2AR0A 4PICA 4GBGA 1T3LA 2H92A 5KTTA 1DC8A 2HMTA 2HT6A 2JAOA 2JI7A 3PHJA 4MINA 4YGYA 5DNWA 3OUTA 2NLOA 3HDJA 3QHAA 3GEDA 3O2QB 5A3VA 2HF2A 3OIVA 1INLA 4N8DA 4P4SB 3W78A 1ZGAA 3KYCA 2P78A 1TU0A 2X13A 2QVCA 4OK5A 4QXOA 4UUPA 1P2FA 3TOZA 2GUWA 3BH7A 5ITZB 4M99A 1NJ5A 1VMAA 2FV8A 4Q9DA 5EJ6A 1NBMA 3C16C 3I9MA 3MT9A 3GMIA 1FTQA 1OA0A 3D7LA 3A7EA 5A0FA 3W5UA 1JDBC 3CUTA 4TMTA 3JQBC 2EFHB 1VCHA 4E4RA 2XXAB 1T3SA 3L92A 5WRFA 3VVCA 3TF5A 4RVFA 3S2IA 4A3SA 4EPYA 4MDYA 2FRDA 4O6VA 3NTOA 2IY7A 1GTMA 4AECA 5JD6A 3A4IA 3FYUB 4DEYA 1J0XO 1YFZA 3M34A 3L05A 1MV5A 3EZYA 4JC8A 1QCYA 2QROA 2C92A 1C7IA 1Z8HA 3DOOA 4QYIB 3TNLA 5KX5F 2YVAA 4L9SA 1ZCBA 1M2HA 4BKRA 4TX1A 4YIHA 2R96A 2VYFA 2YC2C 5JD3A 4NXNB 3AVXA 2PFSA 2XR1A 2HJ9A 4J4TA 5LMUB 3NYWA 4FHCA 4H7KA 3N7AA 3TVDA 1W5EA 1EUDA 2ZSKA 3KL4A 4C30A 3THWB 4QEDA 5KAPA 4ECAA 3D8UA 4PX9A 3PUVA 5BPFA 1QP0A 4JI5B 3K71B 2GASA 4XPIB 2AXNA 1TM3E 3GEIA 2C2HA 3JSAA 4J0GA 2IYNA 3REQB 3ZY5A 5LP6F 1T0UA 5I4IA 3BA6A 2E7ZA 4G5GA 1NFRA 4YRSA 2IY8A 2D6FA 2VBFA 1UMDA 1LX7A 2WIDA 2RKWA 3IUEA 3IOMA 4RHYA 4XVCA 3FNIA 1VJ1A 5BN4B 3QMMA 4BNNA 3PXDA 4S1WA 4N01A 1GQOA 1Q21A 3B3QA 3ZHCA 1X1SA 4C0HA 5M2QA 4TYYA 3KEGA 1QHXA 4Y9TA 3OCZA 1RM4A 3E23A 3GJ6A 5JYDA 4LYYA 1OC2A 3HQ4O 4LV8B 3O8OB 4OV6B 5K09A 4F5WA 2GN2A 2NTNA 4R2IA 3VVBA 4C7VA 3SXUB 2IS1A 2P9QA 2HOQA 3WB2A 1J33A 1B0PA 2PZEA 3OG9A 2OXTA 2VHZA 4JLWA 3U3MA 3EVTA 3H97A 2I3DA 4GRAA 5A5DA 5JI3E 1D7AA 2YXLA 2ZYIA 4RETA 1V71A 1AZLA 5ED4A 4WAUA 4HFNA 3DM5A 1A98A 1P3Y1 4BKOA 4EJFA 2C4KA 3BCSA 2QD1A 1Y1SA 1IQUA 3WRWA 4C4TA 1TW2A 4KE7A 2GXSA 3LP8A 1PVVA 2FR8C 4M7RA 4UNQA 3GRKA 2ZB7A 3MMZA 1HT2E 1OV4A 1WDTA 1ZH8A 4A5OA 1AKYA 2VDOB 5ULLA 4OHKA 3NALA 5I9BA 2PVPA 2C61A 4WN3A 1XDZA 4Q1BA 1E3QA 3K9BA 1AUOA 5PNTA 1UBSB 2V7BA 3KYBA 4ZGWA 3M6FA 4EFNA 2NO6A 5REQB 3OEHA 5LR6A 2ZE8A 3P7MA 5K0TA 4DT1B 1R9NA 2Q29A 1FRNA 1GPDG 2J0UA 3NQ41 4P5EA 4MJXA 1AUQA 4OUKX 5C52B 2WHRA 3PGXA 1WO8A 1Y4SA 5E3HA 3NS7A 3VZPA 5GADl 1FBNA 4K81B 5B7PA 2ES4A 3STHA 1HH4A 4QXQA 1P7YA 3M4JA 4D3DA 1WQ4A 3I8XA 3NIWA 2J07A 3KO8A 1PRYA 3S1LA 1F9AA 4CMHA 2XE8A 2IYZA 3CN7A 1CUZA 2TRSB 4W1QA 5E2AA 2DFKB 4HEJA 2QM7A 2DXIA 5ICFA 3DT8A 2DQSA 1WIWA 4UDXX 2YFQA 3G8AA 1CY4A 1RCFA 1LDNA 1SQ0A 2AN3A 2X9LA 4EBBA 1X92A 5LUAA 1XEXA 4F06A 3H16A 4C6TA 3V4SA 3ZE8A 1OF1A 1QX3A 2X5XA 3C3CA 3G9TA 1WDMA 4J07A 4MP8A 5E7QA 5EIBD 3H75A 1IL0A 2Y9MB 3VU8A 5LXTA 5EJMA 3EFHA 9ATCA 4G0UA 3FSRA 1NIJA 3ZDAA 3E81A 1DPFA 4R2XA 4M9RA 4MWOA 1DIGA 3ED5A 4G25A 3FCXA 3TK1A 3ZZTA 4XD7A 2FCAA 1SK8A 2QQ0A 4BNKA 3R2JA 4S3MA 1NHWA 2OHVA 1O1YA 1Z15A 2QMYA 5IT9A 4E5UA 2V7TA 3U19A 2F1KA 2FSHA 2OAEA 3DVRX 3DOIA 3A3YA 5JNVA 1I30A 5C8YF 2PKQP 1GZ5A 3MCAA 1WW3A 3OPYB 1XXHB 1A71A 2Q62A 4IMRA 4PZZA 1D09A 3Q2OA 4BV3A 1PSWA 1J1ZA 1MX9A 3CEHA 3H17A 3DWGA 3PKZA 3RRBA 1F8YA 3EY9A 2J0QA 3ZYCA 1KRWA 2CKDA 1TO2E 1L1RA 2OOSA 3L4BA 2ZB3A 4PXAA 4OXRA 4W7IA 3GJ0A 2R1TB 3NBKA 4DANA 3WFIA 1QRTA 3JXEA 4PHFA 3TL2A 2G7ZA 4BO9A 5IXYA 4QASA 4E21A 5H9WA 4U7GA 5SICE 2F48A 3EF0A 4CV2A 4V1CI 1UAGA 1G9SA 2XQGA 3ZTWA 2OCPA 1IH8A 1XD2B 3EDOA 5A3SA 3U1TA 2MR5A 3WDLA 1Q6YA 3ESDA 3ESZA 3IFSA 5DNDA 2D1RA 5ENVA 3ANSA 4M9QA 4TRMA 5TGZA 3SQOA 1EKXA 1X77A 4W63A 2H5LA 5BURA 4R31A 3H5RA 4XWAA 3PJRA 4HUQB 3WLFA 3VNRA 2R47A 3DR3A 2W93A 1TJ4A 2GJ9A 1FUEA 4K03A 4R16A 4YCSA 2WB4A 1F9EA 3Q3VA 2F3UA 3WRYA 4LHVA 4Q00A 5CM9C 4Y2TA 3EVZA 1J25A 4AXBA 4L76A 2X0EA 3CFYA 1O03A 1ZJJA 3PHLA 4Q01A 5EHZA 1NVDA 2JCBA 5HDQA 4CETA 3GLHA 3HR8A 2HZBA 3CXRA 3JQDA 1PG0A 2HHLA 2ZYSA 3NASA 2R6R1 3WOVA 3QNMA 1J20A 5CFZA 2HU7A 1NRXA 2AOUB 1R4NB 3GG2A 1ULZA 4DLUA 3H1TA 4ALLA 5HGXA 3EGEA 1Z45A 4L4RA 1Z06A 2VDUE 5F52A 5FBWB 4RD2A 3M5PA 2XBUA 3M6VA 3RU7A 3WHPA 4W6ZA 2LKDA 3B38A 4RA6B 2ZB4A 2ZRHA 3NBUA 4K6FA 3CLHA 4KTVE 1U4OA 1KYWA 3A4NA 4CV0A 5A4AA 3Q6NA 2AN5A 5KPJA 3AL0C 1SHUX 2RGCA 5ER9A 4EPXA 3RAGA 3SC6A 1E6MA 1U9CA 1C3OA 1G8PA 1I4DD 2BP7B 1RE0A 3B9RA 4GMXA 4L8LA 1P4GA 1LPNA 4PLHA 3R7LA 5JNSA 4FHZA 4B6QA 1KDTA 3CLVA 3FJOA 3A9RA 1JMYA 3CZ4A 5CX1A 1LF5A 4V0NA 3VR4H 2PKRA 3R3YA 4JQCA 4US2R 1SC1A 2O3TA 2QJTA 3MCWA 3V4ZA 1VFNA 5FOTA 4RD1A 2VPXA 1A5BB 1C0KA 2XAUA 2XWBF 4KOEC 3G2PA 4ER5A 1U0FA 1IC6A 2QZJA 4FI3C 4IWNA 5I47A 2H6EA 1ZK0A 2QP3A 3P9ZA 3T1NA 3T7CA 4DSZA 4CCYA 3SQWA 1RPZA 2BKAA 4YV7A 4HDNB 4CM4A 4N3CA 4XDZA 1KU6A 3C1AA 3GL9A 3O9VA 1J49A 4Q4JB 2BGKA 2AMVA 4XJSA 3U3OA 3R6WA 4HV4A 2NUPB 4BJ5A 1T2DA 4Y6QA 2QBYB 3DEIA 5THXA 3R9IA 1RAGA 4LSWA 3ZCTA 1Y1KE 3FCCA 3STYA 1NBEA 3BSSA 4FFOA 2H4HA 4V0LA 3V4VB 5BWCA 4HPWA 2HWKA 2PO7A 2WSSA 2PH3A 3PHIA 3EVBA 2GVDC 3OLWA 5C4IA 1C9DB 3NUGA 3F9RA 3T94A 4ZVTA 1XQVA 3LYAA 4G4SO 1I4OA 1IFXA 5FWAA 5KHAA 5C3UA 3W3ZB 4D9BA 1XP8A 4HQLA 3SI7A 2HV9A 1MX1A 1IUKA 2I80A 3KYDB 4AJ2A 4C20A 2EFGA 2I4MA 3UMYA 5A2GA 3AXSA 3TKAA 3RYIA 2WUVA 2SCUA 2W42A 4RTRA 3CSUA 4MLPA 1U2GA 3QBJA 5FP0A 4BZZA 1QZTA 1AIPA 1NW9B 3EGOA 4R5MA 2QXYA 4J7AA 4P4GA 1FFGA 1XVAA 3ZI4A 4X20B 3ND9A 1A77A 2IIVA 2O0LA 4DG9A 4E08A 1TO6A 4Q7JB 2Y1WA 2IXFA 3R5XA 3P1JA 1U2DA 3WKBA 4E2XA 3C7DB 3Q9UA 4CQLB 4YAIA 3HV2A 3FDJA 2M6LA 4CTNA 5KSWB 5L95A 5E2BA 4MS3A 2ORWA 3LGXA 4WK6A 1IBLB 2QNRA 2DCUA 4D4LA 2I6UA 4Q4AB 1Y6ZA 2H31A 1T15A 5JNLA 1YJCA 4C0JA 4D5GA 1NW4A 4MDFA 2OV3A 4FDTA 3RIEA 1ZGJA 2FF5A 4OHCA 4JLUA 3EQ7A 2G0TA 1N57A 3U9TA 5DBGA 1M34B 5KOYA 1U1FA 2C59A 4JSRA 1R6VA 4YV0A 3C98A 3ZV7A 1QHFA 4JBGA 1NF9A 2XKAA 4I5EA 4FW8A 1G55A 3LF2A 3T7EA 4DRZA 3TMKA 3UT5A 1PFGA 2QV7A 5J9FA 3SYRA 2WV9A 1EK1A 3H2JA 4LC9A 2V8BA 2FPGA 2JLRA 1EFVA 1Z6ZA 2Z5GA 3RUEA 3CF6R 4RELA 2WHPA 3JQGA 4YAOA 1KNQA 2ZFUA 1JKMA 3IUYA 3OX1A 3ZN2A 5HIAA 2GHIA 3GPIA 4KN5A 5TE9A 4I3HA 3ZOZA 4C1BA 5A4IS 1RXUA 3S8MA 1Z26A 1S96A 3ZI7A 2JDIA 1J99A 1AKEA 4CUZA 4A10A 3MWYW 2Q6VA 1GL7A 1KMHB 5C8VA 5BYJA 1P1KA 5AHOA 1XK7A 2FN7A 3LDHA 1NVEA 3UPDA 1KYYA 1WHSB 4BB9A 3IXMA 1L5VA 4LQ4A 4QEZA 1QIKA 3IPRA 3RSHA 3WK9A 1NI3A 1XZDA 1KF0A 4PY2A 4R1PA 5DWQA 4QECA 1OT5A 4CTKA 2UU9B 1HG0A 1K7XB 3SX2A 1FFEA 2WJHA 3LY5A 1RC1A 3DE4X 4NFSA 3IAXA 5DOZA 2O8EB 1UM9B 3V4FA 3ETLA 1ZKDA 1MN6A 1V8PA 2VBCA 4GP7A 1WS6A 5AKXA 4DIKA 4KWTA 3PQ2A 4LSZA 4NENB 3R1IA 3KX2A 4QSHA 1UDCA 4ND4A 1FTWA 1HDRA 1RAHA 3EXG1 4IQGA 2E85A 2ZS7A 4TYMA 4CIXA 2ZBRA 4G5YA 4TQGA 5I8ZA 4P3YA 4BPBA 4DF3A 3FNBA 1BHO1 3JVDA 3NDJA 3O90A 1IEVA 1MQ8B 3ESYA 2JLAA 5LZ7A 5B55A 3GXOA 3SC3A 2P62A 3P9QA 4UNPA 3EWSA 1L2TA 2X42A 4XW2A 1JTEA 4IJQA 4ARAA 2PQ6A 3FUWA 2CK3D 4ARUA 4R3NA 4RIIA 3QJYA 1MDFA 1JTFA 1KAHA 1SU6A 3ZDXB 1YQGA 5SY4A 4EGCB 1LQTA 2HJHA 4P7BA 4YV2A 2OCGA 4J0DA 1IXZA 2PBFA 3F7OA 4ZEOA 3RNLA 2I55A 2JPDA 4NCIA 1X8KA 2HGZA 2YINC 5AYVA 4E5DA 4LXIA 1C3VA 1EFLA 1QHEA 3CB4A 1Z4LA 1N75A 4B9EA 4WJLA 6REQA 2BFBB 2R6AA 4IF6A 4BZPA 3G0HA 2XWSA 1I1NA 3DDUA 3RIXA 3SHQA 2Y2VA 3DV0A 4G41A 3K09C 1SCIA 1BVUA 2IOQA 2VBGA 5JSYA 4B83A 1CEXA 3WLRA 1AUPA 1H69A 2YY6A 4I4CA 4R8KA 5I9IA 2JFXA 1I3LA 2Y27A 1DJPA 1QVAA 1FNSA 2LIVA 2OK8A 1N8KA 2J3KA 3NKFA 3LL4A 3GV0A 4PRKA 1G60A 1JR4A 1VXOA 4QSMA 4Y2RA 4B82A 3V1LA 1YJ5A 1IZ7A 1JQAA 1S89A 1IJBA 4YA6A 3UOGA 4BBPA 2C9YA 4AP9A 1OH6A 1NQTA 4LWOA 4EOGA 4DMHA 1BJTA 1KH3A 4ITRC 4BP9A 2UVPB 2O4CA 4LKOA 1DHTA 1PEYA 4ZVUA 1ZEJA 2GPTA 2FLKA 5IJWA 4PW0A 5HIIA 4BV9A 2YKGA 1T91A 8MHTA 3IP8A 2BMVA 3IEUA 2RC5A 2HEIA 2OD2A 3L7NA 3E5HA 3O4HA 4BQNA 4D46A 5A5GA 4ITVA 4I50B 1XJ5A 4CMIB 2H16A 3AF6A 2VYQA 4TV9A 5AHRA 4DQKA 5BO5A 4RK5A 1LCIA 2YJ5A 3LCJA 3SC2B 4UM9D 5K05A 2IE0A 4N3GA 3ID6C 4C0AC 5IYZA 1P7ZA 1JEEA 4DV7B 4ZMSA 1J24A 3NHPA 2F1OA 3FB4A 4WLEA 4NP6A 3I53A 3VR6D 3B6IA 5LIPA 3QE9Y 3UFXB 1HL3A 3SAJA 2WUWE 1ZD4A 5EJIA 3AUXA 3ZPXA 4CMEC 3KSBC 5E9JA 3GT4A 1NJ6A 1VHWA 2NTJA 3OY7A 4HHEA 3VSDA 4JU9A 1VHJA 1Z0ZA 2Q0XA 5KB3A 2B9EA 3DXXA 4HNAA 5A9RA 1A2KC 1CUAA 1K4YA 1BHJA 2P2DA 3RABA 1O4VA 4QFBA 2XMDA 3IDZA 5DX0A 3E8MA 3RCBA 1AKMA 1OZFA 3IKMB 3CRMA 4X1YA 2LDXA 1FF9A 2H57A 3URKA 1F4VA 5CT4A 4ZKDA 2ZATA 1FMCA 1XEWY 2BHRA 3UOWA 3ENWA 2O8VA 3EIOA 3N6RA 1U8ZA 3ROQA 4B17A 3IPLA 2E3JA 4L1KA 4EY8A 2ZEJA 3FM9A 1JPJA 2RK6A 2EZ8A 1J9GA 2FWIA 2HL6A 4MQMA 4BX8A 4EGFA 3MXOA 4Y98A 1GUFA 3HJCA 4JUBA 3JAKB 4ZI5A 1QQ6A 3EXHC 2HNAA 5DTEA 4CFYA 1KTIA 2JLSA 4BNIA 4NBTA 1BDBA 2VO1A 4U9IS 3A1EA 2W43A 3ME5A 5KNBD 1B14A 3PX2A 1C4XA 2CFRA 3FYCA 4GX2A 3ER9A 4J2TA 2WIBA 2NZVG 1QORA 2PGJA 3JAWB 1Y6FA 5DM4A 4NSNA 4CFZA 1EDOA 4M0KA 5HKAA 1CWUA 2H1RA 1G0NA 2HX1A 2P75A 1SPXA 1H3FA 1RXYA 2VDJA 2YQ5A 5EAIA 3KQVA 4AZWA 1IDOA 1X7WB 3ZCVA 3H0KA 1ETUA 2W6PA 2W2LD 5HZMA 5CURA 5G0TA 4EHIA 2QW0X 2JLBA 2X0FA 2VT6A 2H9IA 2YVLA 3CJRA 3LC2O 1DADA 1SZCA 1U80A 2XZLA 5EP2A 4EQ6B 2ODWA 2ZBVA 1E8MA 5AKHA 4GBMA 2EFDB 2JHGA 2G4VA 4JT4A 1L5ZA 2NZWA 3H1EA 3ZVNA 1G2QA 1Z22A 4O3FA 1XKXA 1IN8A 1U63A 3C5HA 2AMJA 5K2MA 4LOIA 4WY8A 3BJEA 2RH5A 3LT5A 3EEFA 4ENSA 4O4IB 2VI5A 1ZIDA 2GZMA 2CHEA 1X19A 4FZRA 3F98A 4RK1A 3T35A 2ID8A 2W00A 4QFMA 4DLZA 3FPJA 4Y1FA 4EQZA 3CVWA 3L6CA 1I9CA 1K7SN 4RVUA 1ZUHA 1CZNA 1FVOA 1S3IA 2Q99A 1J90A 2O7VA 4D9JA 1OXTA 1ODJA 3R6GA 4HNVA 4AJ1A 3PJEA 3E58A 1YXMA 1G5HA 4EGQA 5ALNA 1CUUA 4N0EA 4C7OA 1FTNA 3G6WA 1H4TA 3FKSA 3PUXA 4KACA 1H2YA 1XZPA 1G4UR 3TBKA 2J41A 2QTVB 2C9ZA 2OBMA 2YVQA 1A8HA 1II9A 1SHTX 4AB1A 2RHOA 1P9LA 3FRJA 2R7AA 4CLOB 5I51A 3KT3A 1D4FA 2DHRA 1IVNA 1MVNA 3UJPA 4XM2A 1JW9B 3B2EA 3UQZA 3H6KA 1SXJA 2O0JA 3IIEA 2RGRA 2OORA 3H2YA 2RGUA 2O59A 3S81A 4FCWA 4DYVA 4MRMB 2R1VA 3HHEA 1R0SA 3RTAA 4O8ZA 3I39X 3I2IA 2P11A 4YBRA 5BYAA 5CDTA 2WYHA 4TTSA 3JZFA 1XROA 8ADHA 3DE1X 1TZKA 1FMTA 2CJWA 3NTRA 3IBGA 5IBQA 1WDWB 2C07A 1WMSA 2NWQA 2E2WA 2JAWA 2X1HA 5LJLA 3CVOA 3EMVA 1KGSA 4JC5A 1YU6A 4R2MA 1BROA 4D4HA 3U7FB 4HAUA 4ZC1A 1BEZA 4G5XA 3U1VA 5JCXA 1V6AA 4MYHA 3MWEA 4DNFA 2EQ5A 2V7WA 2C77A 4HLUC 5A7FA 3HKCB 4BQOA 4DA7A 4F96A 3KLOA 1O5TA 4U4AA 3T95A 1ZJZA 2PJDA 1ZAYA 1QQ7A 2AJCA 4TKMA 2IXGA 5IH7A 2VDWB 3FOEC 2PT9A 5G40A 4LBVA 1ESEA 1FP7A 1PEKE 1P4HA 1VHLA 1N2XA 2WP8J 2CKMA 1U9ZA 1UWLA 2C4UA 4X54A 5DYWA 4KOAA 5KYUA 1H8ED 2JH8A 4MA5A 3R40A 3GCDA 4XFKA 4EG8A 5B1SA 1I7QB 1NN5A 3IOBA 5J1TB 4AF8A 2QDKA 3O0TA 4UU7A 1V5FA 1LC3A 1QK3A 2BMJA 4KQIA 5KCMA 1ULHA 3LSTA 3VPXA 1YDWA 1PO7A 2JHCA 1Z3IX 2I7DA 4ZU6X 4TKUA 4HAOA 2FI1A 5EY5B 3U3XA 1TJ3A 4KMMA 3C5WP 1P2UA 3ESCA 4HWOA 4E1AA 1UP4A 3EPJA 2OO3A 1MHTA 1ORVA 4A92A 1CRPA 3ULKA 3ZXXA 1FUKA 1M7BA 2W4QA 3NJ8A 3FPHA 3PVCA 4B74A 3IELA 1TVKB 2AEFA 2PWBA 3B20A 3HR7A 2YXDA 3MJ4A 3FAKA 2DPLA 2QK4A 2O48X 3M0EA 3R44A 4FYXA 5TPZD 2B61A 2BJVA 1AF4A 3D64A 3V55A 5JYCA 2JFOA 4G4GA 4GOMD 1SPBS 1V5EA 2YMQA 3GK3A 3MGCA 4G3XA 2B6HA 2D54A 2UVQA 1F8FA 1XMXA 2FHSA 2VNKA 4MP3A 1PT8A 1JSRA 2ZT5A 4QDOA 4DJAA 3AKCA 2IZZA 1U6IA 2ETVA 2LCFA 4FD3A 4RH1A 3T5BA 3SICE 4DY4A 4E7OA 3IIIA 2HNBA 5LXTB 1WEKA 1WOYA 4M0DA 1L1FA 3RU3A 1OKKA 4CKWB 3CM0A 1Y4AE 1SY7A 1O2DA 1R1DA 2GVZC 4K2HA 5EOVA 2XDWA 5AKLA 3WMEA 2GTHA 2I9PA 3NYIA 2VRNA 4ALIA 4RVOA 4C6HA 3RHTA 2PSDA 4GQBA 3ZVLA 2QN3A 3WNVA 2H1WA 5EJ4A 1UL1X 4NAUA 4GPD1 4ASUD 5M04A 2FWNA 3JPYA 5HR5A 4TKLA 4H3HB 3PR1A 3U16A 4EA8A 4A2CA 2R2AA 1TM4E 4COOA 3ZHOA 2PGAA 2AFIE 3ICPA 3JQ6A 3UWSA 4F56A 4LHZA 1Z6PA 5LZ4A 2WB2A 1L0BA 1Z0UA 2CHGA 1CJTC 4PCUA 1QFSA 2C1ZA 3ONDA 4XA8A 5TPWA 2XCLA 3SFZA 3F3MA 2AQ8A 1QFJA 1SOVA 4LWQA 1FUIA 2D5BA 3NXSA 4IF4A 4M9UA 4TMKA 1ZS9A 2DQYA 2WJJA 3C4VA 4Q1CA 1QIMA 5L3ZA 3K70B 3AETB 3B6MA 3KYJB 1OZHA 4BB0A 4CTJA 4G2NA 1MFZA 2PMKA 1M6YA 1PZNA 1Z2NX 3C43A 4WESB 4FZ5A 2WRZA 4NDZA 4RJKA 3OKAA 1M2WA 1WXGA 2WM3A 4OOFA 5ELXA 3PP8A 1QLJA 3IODA 3OCCA 4K86A 5AKEA 4HNHA 4LBZA 4NYMQ 4LECA 3EUAA 2J4DA 4CM3A 2UZ1A 5B36A 3ROKA 4ZN6A 1VIVA 2IQ5A 3DDHA 1MB2A 5FO1A 1MG0A 1U02A 3JTMA 2EFYA 2DFTA 1L4BA 5IDQA 2R00A 4AMUA 5FWYB 3DT9A 2IPOA 5FOUA 1Y4UA 2DFPA 1PHPA 2Y9PB 2ONCA 3N8KA 4WERA 3LSYA 3OM1A 2E5WA 4OHPA 1T4GA 2P5TB 2GGSA 4DJFC 4Y1RB 3KSDO 3G9QA 1XVIA 3RVSA 3U0VA 4BFTA 3BMOB 1RJ9A 1UPXA 3COSA 1OX5A 2XYQA 1GUYA 3FDZB 1W5FA 2QJFA 3WGKA 3O4RA 4YCCA 2GCNA 1XCMA 5EMLA 3LUDA 4NOJA 1XMVA 5JTUA 3PNOA 4BVLA 1UZUA 1NX9A 2HSZA 3EQ6A 4OFWA 1ZCFA 5DTIA 4M1YA 5LLSA 3ZS9A 1TK3A 3ITNA 4YREA 1ODLA 2H2WA 1RPTA 1IN5A 4FUTA 3DOHA 3KKNA 4JHXA 1H8HA 2C4VA 2WAYA 3CLSC 4PYIA 5TMEA 1JI0A 1Y6RA 2Q3CA 1JJIA 1U1IA 3OLXA 3SNKA 4ZAXA 4QVGA 3DKKA 3O1IC 4F8JA 2OV4A 1JQ5A 2J9GA 1EEHA 3FHCB 3OMXA 2VTBB 2W8BB 1CQPA 1OAKA 1LI4A 2GAOA 1MZVA 2YX1A 3HC7A 1UKEA 3HFRA 4DNQA 3QEJA 1GNLA 4KYVA 4TMXA 1I14A 2ZREA 3NVAA 4IUDS 3B9QA 4B3XA 5F76A 4ZT7A 2CLMB 3UK0A 4JBWA 2JATA 3T54A 4C3ZA 2X19A 3TECE 2ZITA 5FUQA 1U98A 3HGTA 4J76A 1T43A 1JHAA 4X44A 5AXBA 2MR6A 3FGZA 3F4KA 3VR0A 5CFPA 5JNRA 4RTMA 1NKSA 3K15A 4KSYA 1FS6A 1YCGA 4G2TA 4O08A 1JHRA 3DEAA 3KRTA 4LMPA 4MVJG 4G5QA 1GEEA 2PZMA 3C85A 3U4MA 1N9GA 3HCCA 4FB4A 3B48A 4WDRA 1B23P 3AM1A 1NHGA 1IBCA 2HUNA 4FC7A 3I28A 2ACWA 1YQXA 1PJ3A 3DB1A 1XTUA 1V16B 4NR0A 5IEBA 2W9XA 3BGDA 5EWLA 3U56A 4AS1A 3NC1C 4AS3A 4P4NA 4L5BA 2WMDA 5K0LA 3AVVA 1BQEA 1LW7A 3HUFA 1UPCA 1PW5A 4L5YA 5CLFA 1VIAA 1GNPA 3ZW8A 2IODA 2R4UA 1CULC 4UDNA 1A8QA 4IXTA 1I80A 5HM6A 2AN1A 5IJ0A 1JH9A 1RS0A 4TTVA 2VTDA 3TUJC 1Y9ZA 5AM0A 5GOTA 2AT1A 1T6YA 4EB8A 4RACA 2NNWB 4MR8B 2XDQA 3CW9A 2QUIA 3OU6A 4RH3A 3DSRA 4AY5A 4WGFA 4P7KA 3RGWS 1J39A 3ZTYA 3FTEA 1U3FA 2SKEA 2A7XA 1P4SA 1LLDA 1YZYA 2RGNA 1R0YA 2W2NA 2WVGA 2ZTVA 1D1TA 3QU4A 3R3UA 4JBLA 4Y6GB 5CLHA 3KQKA 5F23A 2X9VA 5HUJA 1GRVA 4WKOA 5EJ5A 3ITDA 2R5NA 4RZXA 1XALA 4D4IA 1E6UA 1FJHA 2QW8A 3HZHA 5TQ0A 4ZYTA 2CT8A 3QMPA 4I1VA 3U62A 3VZSA 4PCVA 3CHYA 1HZZC 1J00A 5ESXA 4J0KA 5BSRA 1USUA 4PX5A 3RSSA 3V1YA 4HYQA 4UM8B 2VJLA 2TMDA 3H6GA 1DX6A 4JP5A 4S04A 4KJZA 5KMGA 1FS5A 3GQVA 2A58A 1J8QA 2AZXA 3OWHA 3FOAA 5CB8A 4GBED 2B2NA 2DR0A 1AS3A 1UPBA 5IABA 3MINA 4K0KB 3P96A 1SXHA 4JAVC 4UBOA 5AUOB 1KETA 1CZKA 1PLLA 3QXXA 1ZUNB 1G6OA 2ZTSA 3L8ZA 4QOSA 3W06A 3Q5EA 4LISA 3BFJA 1A8IA 3JARB 3UMVA 4D9NA 1OLSA 1UC5B 5AOVA 4C3VA 4BYMA 3VSAA 3ZE0B 1WSAA 3AF0A 2V55B 2XYPA 2ID9A 2J9RA 1H2EA 1N92A 1A9XB 4K6HA 3NDIA 4AU1A 3EIEA 2IU3A 4RGYA 3LNTA 5FQNA 1EWVA 1TJPB 1XRRA 2Y1LA 4KAJA 3DWFA 4K05A 1W49A 4BAUA 1P5HA 1QQ5A 4D9GA 5B2EA 2Q4EA 2VYVD 3AMVA 3BGWA 3KZVA 2NVBA 3O1HB 5ICMA 4CN9A 3VVMA 2H9YA 2W2LA 2TS1A 3DBRA 4JXXA 3PQDA 4IIJA 3GLFE 4D2IA 4QDJA 3EXIB 1FU7A 4AS2A 4BVEA 1L4YA 1SNYA 3K8QA 3OESA 5EJEA 4TWJA 1QC5B 2BMAA 3MNFA 2IGBA 4JDUA 4RXTA 5LZ9A 4EHJA 5EE0A 1BAPA 1RRCA 2CMFA 3ANTA 2Q3HA 5H83A 3IAFA 2VZLA 4K6MA 3ZWXA 2UZ4A 1FFDA 5JAHA 1UC8A 5D5PA 4AMGA 4QHYA 1QPZA 5KHOC 2CCJA 1CX9B 3PT9A 3VU9B 5LVAA 1TQ2A 3GBPA 2EBUA 3RUPA 3T06B 3WMGA 5DCWA 3U09A 3G49A 1HORA 3AEUB 5AXDA 2FQ1A 1SHZA 3FPCA 3PDCA 1ZNYA 2L69A 1Z0IA 2ZQYA 2GHRA 3MJTA 1RQGA 1ZOSA 2NZUG 2OZEA 1NGSA 2A1TS 2ZJ2A 3KBBA 1DCKA 2BGUA 4N5NA 3R3HA 3KV3O 3PJGA 4LFCB 3RROA 1KJNA 4OKSA 2JHFA 5CBKA 3M4ZA 5EUCA 1F20A 1RAIA 3I6IA 4OGGA 1E79D 1Z2PX 2ZYTX 2AG0A 3DJYA 3HYRA 4IP0A 3FHLA 5CIQA 3RVLA 1F6BA 1XAIA 4FR2A 4GXTA 4U0JA 5A3QA 1CS4C 3AJDA 1E5QA 2PD6A 3F5MA 4RJ2A 2POCA 4RE6A 1PD0A 1C2YA 4M89A 4RHEA 2E18A 3WC4A 5J2UF 4B3RB 3FPGA 3MJRA 3H87A 4RANA 2CLSA 1N7HA 1DTEA 2QLBA 5IZCA 1JBEA 1HMYA 2FEOA 3HSYA 4L08A 5ALRA 2UXBB 4FCCA 3G7UA 1Y7LA 3OM8A 4HDOB 3SBXA 3HM9A 4R2KA 1E1MA 2O7RA 1SUPA 2X6TA 5IT0A 5JY6A 3CKMA 5D5HA 1AKWA 3J80A 3ITEA 4WZAB 3ND8A 1IHUA 3QM1A 3RC9A 1RSZA 1TF2A 4BZWA 3FYTA 5LJIA 3BWMA 4DTCA 1QVZA 1V4NA 1ZYUA 1ESMA 2RKOA 3N0XA 3UW1A 2GXQA 1I36A 4QDZA 4F46A 2GRUA 4CPDA 3FPBA 1M1NB 3I62A 1Y1QA 3ICOA 1K3FA 5HK9A 3QWAA 1XT6A 4QOHA 3DKVA 3UJ3X 2V6FA 4Y30A 4YMWA 4FK8A 1A9TA 2PH5A 3EVNA 4RQAA 1ZMTA 3OEWA 4G6ZA 4N0MA 2ZJ7A 4RWZA 2QZ4A 4RY0A 5A5VA 3THXB 2FZEA 1Z0SA 5CEFA 2FWJA 1GRCA 3ZDYB 2QOEA 2DR3A 2C42A 3KHSA 4D81A 1YS9A 2ZIWB 3NU1A 5KINB 4BVGA 2EJUA 4D8UA 3ADCA 2OBNA 1ZVQA 1T5SA 2G5CA 2AFHA 4O2BF 2VUUA 1Q1GA 5L7WA 2G82A 1BVYF 3VDMA 5BQOA 3P2OA 3RAFC 1CD5A 5EWJB 4WZBE 4OQFA 5JLJA 2JEYA 1B8NA 1T4DA 3NHJA 2HC9A 4TSKA 1QZ3A 2FPUA 1QHGA 1M2VA 1U8EA 3CNNA 2A35A 2AMFA 1JB1A 4H16A 1Z5WA 2V9ZA 3HXPA 3BRWD 3Q8XB 4MVJM 4O1IA 4TLMB 4MW1A 4D0RA 5ALJA 3H1PA 1E4YA 5AJZA 1J8YF 1CNEA 2FQYA 2WYOA 5JFGA 2PMFA 2MYNA 2V4UA 5NULA 4H3KB 3F8SA 5FULA 2XMSA 4UHHA 2NSLA 3HE3A 3UAZA 2EEZA 1IY1A 1I3NA 2EW8A 1TGYA 2H9AA 1GPYA 1RHRA 2OKCA 2QR3A 4J9VA 3OTIA 5DVZA 5F35A 2Y6VA 3QI2A 4EG4A 1FX0A 1JG6A 1OYYA 4BQFA 4CIYA 1JU9A 2AXEA 2RHDA 2ZS8A 5IP5A 3ZDQA 4BO6A 2NXNA 2Z58A 2JIZD 4X3PA 3NHRA 2Q6OA 1RYEA 1EK5A 2CCGA 1NVBA 1XDDA 3CUUA 4OYHA 4HN9A 3QTBA 3O92A 1YVEI 3OAAD 2HMWA 2GYYA 4PQEA 3UVEA 3LX8A 4V0KA 4K9PA 2A33A 1NTOA 2OWDA 1M75A 1R15A 2CBXA 4HB3A 1DS6A 3KALA 3DO6A 4ASUA 1S8AA 1J21A 3DAHA 3HVUA 3ZCQA 3BWYA 4FU0A 3TUIC 2PUCA 2QR2A 2Q7OE 5AW8A 2H1VA 3NH9A 3GROA 1WB6A 3SYLA 2FRXA 2IUTA 2IYYA 3DMHA 4EVQA 2OFOA 3IDFA 2A2ZA 4LSMA 3O9MA 5EQDA 1T2EA 3OZXA 4NABA 5LBTA 1I3KA 1USGA 4P2GA 1ZLXA 1FDTA 4JQSA 4L4ZA 3OTWA 4RY2A 2ZTHA 1GO2A 2PGDA 4QLBA 4TRRA 1OCEA 1M0EA 2AUTA 2GBPA 3DD1A 4PCLA 4W9MC 3MHPA 1YRAA 1W19A 1QP8A 3HPRA 4Q3EA 4O4JA 5LA6B 5LOVF 3QWBA 4AKSA 1PAUA 3IAM6 3PUHA 3I9NA 1N8TA 2MYTA 2WIKA 2H65A 2OZLB 4YWHA 4CKCB 1KSJA 1M6VA 3OEED 3DAPA 2JGJA 2COKA 3LWDA 3QVOA 5DTRA 4TLLB 4LJAA 1IHOA 3F67A 5JPCA 4YLYA 5BWBA 3SE7A 5BV7A 1F2VA 3NWPA 3PPXA 3NFRA 1NPYA 3M8KA 4R8MA 5H16A 1HKUA 3ZXUB 3R0JA 4K9SA 1H94A 2PEZA 3L4JA 2J7KA 3MSCA 4MLCA 2QN6A 1W88A 2YV1A 1YJAA 1W5TA 3PRJA 3GD7A 4HGYA 3U7RA 2YV5A 3S70A 2WMOB 1P80A 3CXUA 2JIQA 3V8QA 4CRWB 5BVGB 4GW3A 2G5PA 2L18A 5DH9A 4EUEA 3VH4A 1JGTA 3ST7A 4B73A 4XZ3A 1LI5A 4BU0A 5A62A 5IAOA 1IXYA 4IEIA 5AKIA 4ZRNA 1T6NA 1YR3A 1TYCA 1YH3A 1KEZA 2VTEA 4Y7CA 5I7SA 4BE9A 4UM7A 1MB4A 4QDTA 5F1OA 2QTWB 4GXNA 5EPOA 3KOZA 4OCZA 2YNMD 1DJNA 2VUHB 3E22A 2PGIA 5LXTF 5CBPA 1TU4A 3KZOA 4DXDA 4MWCA 1V11A 3IIJA 3K9GA 5JDCA 3SHWA 2Z8YA 3G2KA 3G5UA 3AEZA 4LWZA 1D5WA 4KO4S 3HFGA 3GJTA 3VVLA 1YQQA 3AR4A 3V1KA 3R5HA 4BOYA 2ZI4A 1WG8A 4QT0A 1EHCA 1VL6A 1GKIA 2P9TA 1NXPA 1DELA 3MUOA 3MGKA 5GONA 1LEHA 2ZI3A 3CN9A 4GZ6A 1OR8A 3W04A 1XUOA 3SKXA 2HWUA 4BL5A 4YY3B 4UJ3A 4EGJA 1YWGO 3PR2B 4L4XA 1E0JA 1N6HA 2C5FA 2ZSEA 3LVBA 2YASA 3NHLA 3PT5A 1T8YA 2VEDA 3UHPA 4UATA 1I7PA 3L7KA 7AT1A 1G2OA 4JQZA 4KN8A 4CKEA 4D6YA 2NU8A 3CQ9A 1ITZA 1EZ1A 2AOTB 1C81A 2NG1A 2ACKA 4JLKA 4LE1A 1ODCA 4Z3DA 1GV0A 5P21A 4INJA 1WP9A 3OY2A 4RFLA 1CDOA 1NKTA 1DWOA 1RZUA 4MIOA 1C7QA 3WB1A 3CGWA 4NK5A 5C8ZA 4X24A 4N3AA 1D1QA 4DILA 2R6JA 2Q21A 2ZYAA 5FIUA 4ZOLB 4QTXA 3U6BA 4UBNA 2ZVQX 1KYVA 3JALB 2GEBA 3NANA 5BY2A 5EE5B 3RVJA 2IF0A 3BMQB 3EMKA 5CMLA 5LQCA 1GG8A 5KYXB 2BEKA 3GUCA 4B4WA 1F6DA 4RS3A 4E5MA 1KRXA 3P19A 3U5TA 1P17A 3W8DA 1O94D 1JAZA 4QO7A 3SR0A 1TK2A 2PSEA 3M7IA 4JLJA 1UBEA 1G5TA 5EVCA 5DULA 4AO8A 3GRZA 4EJSB 1HFKA 2K5UA 4N40A 3Q11A 1P61B 1R8SA 4E2YA 1SVKA 3UJNA 2PKWA 1ZESA 2B8EA 4ND8B 2DTDA 1ZCJA 4LPSA 2M6KA 3C1UA 3Q4GA 1Q77A 1E5XA 4DPKA 4L72A 2DTEA 1G8MA 2XCOA 2ZQ5A 4GO1A 1X3LA 5DV9A 1KI2A 1V35A 2J6HA 2QM0A 3B5EA 1W96A 3BHMA 4EY7A 4A6EA 3ZKAA 1DARA 2VNJA 4EUHA 1UP7A 1W6UA 3TLEA 1JYFA 3I34X 3NRBA 1P4RA 5CNMA 3C3JA 3LLMA 3G8DA 3PGKA 4CQMD 3B7GA 1E5TA 3PEYA 3TZHA 2I4TA 2OFPA 1IXKA 3J7AC 3STTA 3AQ4A 1N1MA 4PVDA 3DMNA 2XNJA 3K73O 4N9QA 3LMKA 2Q49A 1TO1E 1XZFA 1JIXA 1KXZA 1YI1A 2LZ0A 3KQYA 3D8BA 2FDRA 3KBOA 3HJNA 4LY0A 4AUNA 1ECGA 4DDMA 3GW8A 3LBAA 1AGYA 1COWD 2ZCVA 4N8EA 4Z9AA 4H0CA 2AF3C 2JD0A 4BEJA 2AWNA 3COVA 5MFPA 3WI7A 1N2CB 2I2CA 2OV6A 3GJSA 4LQCA 4G67A 1BCRA 2CFOA 4V0RA 2GEKA 2NO7A 4RPLA 3RC2A 3S40A 2NVUB 1N6KA 1DBSA 3QXHA 2UYQA 2KB0A 5FB3A 3DEJA 2QU8A 1XTZA 2ZVPX 2QD3A 3WFZA 1R8QA 3DFZA 1WXQA 2GYUA 4ZZ0A 4DC9A 4HGOA 1WNTA 4FINA 2A6PA 1WY7A 4B35A 3CPJB 3ZDDA 3ILHA 4GKBA 2C58A 4X5OA 1TUGA 3C6YA 3HM2A 2PRIA 4DUGD 4EHBA 4BXOB 2GBLA 2XUFA 1SCUB 3K8OE 3WRXC 3AZPA 2O3SA 3QLVA 5TVKA 3U81A 1AV6A 4CG1A 1YS7A 2QTGA 2CLEB 2YZ2A 3OSZA 4ENPA 1U5BA 4ZAZA 4JT2A 3BD8A 1WSWA 1XMOB 2H0RA 4FDAA 4I2VA 4RL6A 1MD9A 1QG0A 3KE9A 2YJTD 2R11A 4RFSA 4BJ1A 2X5OA 2R62A 1XZKA 3L7LA 2QQ5A 4OHZA 2F3SA 1ZHOA 1E18A 1R0BA 2OHHA 4GI7A 1G9TA 4BJ6A 3B7PA 3HDQA 1X74A 2QGZA 4BX2A 3N39C 1XX6A 5JW6A 2A5DA 1FYFA 4LGMA 4UCQA 4Z5XA 4FWTA 2IC5A 3CF4G 4ZT4A 2IKSA 5CT6A 4KRXA 3CRRA 1CR1A 5HNKA 1YRWA 3OIGA 1HURA 3CMCO 4B5KA 4I81A 2F4NA 4PR3A 3K1JA 3NGLA 3K6SB 3EPHA 1JL3A 1VLZA 4L9WA 4M0FA 3F47A 3KELA 5CU7A 1NW7A 1THGA 1UBHS 2EW1A 2NADA 3DTTA 4OB7A 4TS3A 4ZAFA 1CY2A 1JR2A 2J3LA 1U1DA 3K2EA 3V8NA 4RKYA 1YQDA 3KCNA 3IV6A 2HAEA 1ZRNA 4P3OA 2DUJA 1O7JA 2ZUTA 3ZNNA 3F6YA 2IPNA 1BXRA 4PLZA 5DM60 5BW8A 5ILOA 1VYUA 4EJ0A 1CIPA 1W5BA 3WRVA 1EG2A 5EHQA 2FFQA 1R4ZA 2IP2A 3AEQB 4W82A 4YUWA 1ZH6A 2FH5B 3PWTA 3RSFA 4UOEA 3B60A 1YRHA 3BE5A 1C9JA 1YACA 1AB5A 3BDIA 3OOHA 1G8HA 3VZRA 3TG8A 4J16A 3MRTA 3HN2A 3C3MA 1HPLA 1TAHA 3TLGB 3ONWA 5ALLA 2QX6A 1L5QA 3FSEA 4XUGB 4TV8A 3RBAA 3IDOA 2FKAA 3TD6A 5HM8A 1DB3A 4EL5A 3FI9A 4Z1MA 4ZHQB 2PRJA 2PAAA 2Z57A 3UNXA 1JEJA 3GZJA 4RAQA 5IJ9A 1DI0A 5EZ5A 4ZIRB 2J3IA 4JVLA 2QSJA 2VK8A 2XJ4A 5ECDA 4MP6A 1OHHD 4OL0A 3PRHA 1VLVA 3RK1A 1P7WA 1VA4A 4NDAA 5CB6A 1QP7A 5IDWA 4QTYA 3H11A 4XJVA 1C8BA 3H05A 3W2IA 1AT1A 2WWTA 4W99A 1FFBA 5H80A 4XCVA 4MVJE 2DZDA 1E2UA 1N6PA 3TXXA 3FYSA 4D0SA 2CLCX 4UBIA 2CV2A 1VPDA 1E1CA 3EGCA 2Q4BA 1UDWA 1Q3KA 1YNSA 1VYVA 1YZFA 2QQGA 2WG2A 2X0JA 5A7HA 2D1QA 4N8SA 2DFLA 2ZAIA 3RS3A 1ZIYA 2C20A 3LQRA 2FUCA 3BXPA 2QY9A 2XX3A 4JJFA 2JH9A 1Y1TA 5DI9A 5ALOA 3UGQA 1XZJA 1TXGA 1R4MA 2P40A 5AJWA 3E9NA 1X8XA 1PG5A 4GEKA 4BRZA 4N5DA 4D74A 2RCYA 4GU5A 5KVCA 4LF7B 4ANFA 2WJAA 1ORHA 4PQGA 4RUKA 1N25A 1PGQA 4YO8A 3GJQA 4ITUA 5HS6A 1Q83A 3PWSA 3D2LA 5K4HA 1JILA 3PC8C 1EWQA 4X8MA 1FMLA 3A2KA 2B20A 2W2QA 4FFBB 3RS4A 4U1RA 1O6GA 1QMGA 2PTHA 3A05A 3LBYA 5ILQA 5DYGA 5JEEA 1V9CA 1F6WA 6GPBA 5BUQA 2YRXA 4Y0VA 1NMSA 3DYBA 1L4KA 1SUAA 2NV6A 2VPIA 2WU4A 3LCVB 2W98A 4CG0A 2QA5A 3HJAA 5BUCA 3BGIA 3PQ4A 5SZKB 3VH1A 1NV8A 3QVGB 3WBKA 2OGTA 1D2EA 1HF3A 1MJNA 5JBQA 4O4LA 3RSGA 4PE5B 2C96A 3ZOKA 4GPEA 3ZHZA 3SHTA 4EZBA 1OLXB 1WCYA 2HF9A 4EABA 3BUSA 5F2NA 2GCOB 5TMDA 3LL7A 4UQOA 1QHIA 4DLKA 1EFRA 4LF8B 4LZAA 1M1YE 4QA9A 1AQNA 1ST2A 4CHGA 4ER3A 2IJGX 4PN7A 1CLUA 5AIBA 2Q46A 4JLNA 4V24A 3AUUA 3S8YA 3RVDA 7MDHA 3CKYA 5FBQB 1UBJS 3WYFA 1KIAA 5GJBA 4D3SA 5L53A 3GVHA 2I6QA 1E2HA 2FX5A 2IZ7A 4N3BA 4EG7A 2NU9B 1G6Q1 3B36A 1GLGA 2PYIA 2VJPA 2OV1A 4AJLA 3ZGXA 3STUA 3WBJA 2ODBA 3LUKA 1U0TA 4D3YA 2EGUA 4ZCLA 3JASA 2H18A 1E94E 3WK7A 2JGEA 3EXFB 3NI2A 2QI9C 4WFKA 3FOCA 1M8KA 4QUBA 1JUDA 4H1WA 3TRJA 1OFGA 3NBZC 1VBFA 3K1ZA 1T2NA 5K45A 1LLFA 1A2QA 3PNVA 3QVJA 4NNJA 5F73A 3KNZA 1UBRS 5HG0A 2R48A 2W6ZA 3E1SA 2OO5A 4RDXA 3OT5A 1L5NA 2HR1A 5BNTA 1NQWA 2AB0A 5A3JA 1NVWQ 2E9SA 2PSSA 2HK7A 4RFVA 4URXR 3QE2A 1Q91A 3QVWA 2ZTUA 3JQFC 3DGFC 1GU7A 8ATCA 1QIEA 3TZ6A 5IK2A 2OFFA 3HU1A 2VPPA 5C9ZA 1BH6A 2ZJFA 4CIVA 3WXMA 2JA1A 4C2AA 3PFWO 3UGTA 2HJGA 4EJMA 3V4RA 3K0CA 1Q84A 2YV2A 4PXSA 2HXSA 4QOIA 4RYLA 3RTEA 1HY3A 1YE5A 2R1UA 4MW7A 4ZJUA 4WI1A 4BASA 1IHPA 3B70A 1IRIA 1BS9A 4AJEA 1HNNA 1I10A 5JD5A 3BE6A 2QRNA 4TWZA 3BMCA 3G8BA 3SVLA 3CISA 1E8NA 4WA8A 2R751 4C0BA 3BHJA 3DTVB 6Q21A 5IWAB 2W6IA 1OY1A 4MUBA 3WY9A 3I76A 5H4HA 1XMIA 1RRPA 2XNHA 3FROA 1WW2A 1NNUA 4YIKA 3CRW1 3HY6A 1MQSA 4HQRA 1CVLA 3F8WA 1TCCA 4RHFA 1KOLA 4L0MA 3O5AA 1N3IA 2BWJA 3L6DA 5KWEA 5JG7A 5KTSA 4L5CA 1QRDA 1MT3A 1P0QA 2C03A 4W5TA 3E6AA 3WGYA 4EYGA 5P8WA 1M66A 4U5XA 3FWHA 1C3JA 2HO4A 3EWIA 4AZ3A 3NVDA 4ZXFA 4OQMA 3IUPA 2H2HA 4BWVA 3Q5DA 1X1AA 4M0MA 5BMVB 2XRYA 4PIPA 4G0QA 3SY8A 3TZEA 4YP0A 1KKUA 4GPZA 3R0VA 4NU0A 4Q6BA 2PMEA 3RVMA 3PGLA 2UYOA 3M1YA 4EPWA 5EIEA 4LDZA 1K92A 1WULS 2XT0A 3WHIA 5EESA 1Y6QA 1WXIA 2J3QA 3OCXA 2H3HA 1OSNA 2ZETA 1GUAA 1U8YA 1MENA 2QUBA 4KO2S 2WIGA 5LUBA 2AI2A 3UO8B 3BFPA 1YAHA 3F4LA 3DDWA 3AUYA 2V6MA 4M38A 1B93A 4QNNA 4CIAA 2I1WA 1N6OA 1XE3A 3M89A 5CDYA 1WXXA 3DMPA 1BO6A 4PTYA 2HFKA 3BJZA 3EG9A 4W1SA 3A1CA 3L02A 4GQIA 1LUAA 2BL4A 3FPEA 3ZE7A 2YIVX 3SZGA 3Q12A 2CDCA 4BMCA 5K0GA 1ZW1A 1I5OA 3L7DA 5FTWA 2WLTA 4A0GA 3ETJA 3FAZA 4OQ4A 5DT2A 3Q5GA 2IVZA 2B7CA 4M2LA 4RK0A 5K03A 4ZODA 3AFMA 4YMTA 2YWGA 1YU9A 2IDKA 1E3MA 5LA6F 1ZN2A 3H5AA 3F6RA 4KFCA 1BKDR 2BKVA 3KYIB 4NBSA 4YALA 1P75A 1HYEA 2E6UX 2P4HX 2OQIA 3NT5A 5HQJA 3AHIA 2CV1A 3VNVA 1VG0B 4GC5A 1OH8A 3Q8LA 3IE0A 4MJLA 1Z8DA 4JMPA 2ETXA 1KXJA 4BE7B 4H27A 3ADKA 1DAPA 1T5BA 2HWYA 1OBHA 1ZW6A 2IZOA 1ISJA 3TQRA 4YUXA 2ZIZA 2YFYA 1BGVA 3S0JA 2EX4A 2OCYC 3R3XA 2Z4TA 3GOQA 2BJHA 3PD7A 3WLLA 1XNGA 3CE9A 5HMLA 4GVXA 3AFNA 5J2TA 5GV7A 3U3KA 4HPXB 5E1OA 1UC4B 3UC5A 1PFVA 1L7PA 3ORYA 3T0GA 2BMEA 3OOSA 1HEUA 1I2MA 4KI7A 4ZOAA 5HCNA 1K63A 1LNZA 4UXIA 1GAXA 1ZD2P 2QZPA 3A14A 3GDFA 3U31A 2SHKA 4FC6A 4BPRA 2O52A 2ZKIA 4UARA 4KQ9A 5A04A 3HB1A 4Y67A 3CIFA 4H59A 4NQZA 3BE8A 1JAHA 1Z8NA 3QELA 4OU4A 3NT4A 5EIBC 4N4AA 3QVVA 2KWIA 4F5ZA 1WW8A 5CA1F 4QM7A 3H5IA 2R8PA 2QN1A 4DWWA 1G4AE 1ECFA 2NP6A 4V1CA 2JJMA 1H5QA 1PN3A 5CVEA 1S3GA 4DIUA 3NOVA 1ATIA 3A28A 5FPTA 3M9WA 4BWFB 2CBZA 2GF0A 3LUFA 1ZZGA 3EC7A 5H82A 2P5UA 3CUVA 5DF1A 4LAFA 4BLOA 3ZZUA 1P77A 1M2OA 1OGIA 1KGDA 1RXIA 4ZYXA 1NXWA 3TQTA 3WLHA 2XZOA 1TLFA 1NW3A 1F51E 1GDDA 1CTQA 1E77A 2QD2A 3AV3A 3H9CA 5ALEA 4F85A 3FNGA 1GGVA 2NYRA 1SN7A 3GPCA 3IO3A 5DM2A 4YT8A 3V2UA 1JYEA 4DRYA 5ITSA 5SYMA 1W2GA 4UHKA 5E3IA 1UWVA 4RESA 4HH4A 2CZQA 1VOTA 5JAOA 1QR2A 3UUFA 1P5FA 1FEZA 3CX7A 2P5YA 3F3KA 4IGKA 3IP5A 3G7NA 1EUDB 1THMA 5C1BA 2J32A 2QX7A 3H3XA 4QLOA 4FMBB 4Z8XA 1TQ8A 3FHJA 3IXLA 3DFMA 4MW2A 4R6WA 1KEKA 5E7JA 3AR3A 4XRGA 2IHYA 3JQAA 2BM8A 2Q41A 3NMUF 1A97A 1B76A 1ZOIA 4I66A 4ZOLF 3T99A 1E1YA 4OM7A 4TLBA 3OBBA 1KZ4A 4C2TA 4YS6A 3ND7A 2VRBA 1XZBA 2IYLD 1Z5VA 4BNFA 2NXEA 3GLKA 4MX8A 1M7GA 4Q1DA 5C31A 4JUCA 4QXAA 4TZ6A 4GZMA 1QG4A 1QAQA 4BLTA 4YPVA 5B1YA 3KEOA 1UCFA 1HTBA 5GJCA 1EXDA 4Z4GA 4R54A 3TAXA 3W5HA 5K8CA 1MO5A 3W7VA 2MJLA 1NWCA 4AX4A 1XK6A 2CF5A 2H1FA 5GVRA 5LYJA 5TX7A 3RTCA 1ZIXA 3UBMA 2HHAA 2PWAA 5D7BA 2F4VB 2Z2YA 1PKXA 1TCUA 1JLRA 2JGDA 2XW6A 4BMNA 2I91A 1W85A 2Z6QA 1EVQA 2PS0A 4LHEA 5DI3A 4K6GA 2ACEA 4GYKA 2ZDHA 4P1ZA 2OWEA 3DBHA 3O4GA 1VP9A 3VBCA 2K87A 2N9UA 3D7RA 4UJ5A 2IPMA 2HHJA 4LF5B 5AJHA 2WHYA 4BKQA 3DLBA 1ZIPA 1I5EA 3DKIA 4FYMA 3EGXA 1YFLA 4ZVVA 4ZXPA 1GUZA 3LLSA 4B81A 4XAQA 1HE1C 1PJAA 1VBNA 1RRFA 1BD3A 4LUCA 3MFQA 2NT3A 1QV6A 1SOMA 1ZMXA 4CF5A 3A70A 5JO0A 3B1FA 4OYRA 1T5OA 1TA9A 2IEYA 2P3OA 4JBIA 4P58A 1TAUA 1A9SA 2Y3IA 1UBOS 1JFTA 1U2SA 2CWDA 1MVLA 4PQRA 1AX9A 1VP3A 4GM4A 1PFQA 2JIOA 2O7SA 1PU2A 4ISBA 2JGLA 3RW9A 4XDHA 3NHZA 4URWR 2CV0A 2WJWA 1CR6A 4B71A 4OFZA 2EHJA 4CEIA 2J0UB 2ZJOA 4AJOA 3JQ8B 4MGEA 3VR4A 4D9HA 2ZRDA 3F97A 2ZUDA 3C6MA 5FCDA 5A1JA 2CNBA 5AI5A 5HILA 3I2JA 2FZWA 1OFVA 1KZ1A 4ZI7A 4Q6WA 5I7VA 2CL7X 1DO2A 3NB0A 1F12A 1S4QA 5FUBA 4FGLA 1A7UA 1TM7E 3F5DA 3NIGB 4W9RA 2KLHA 2OC9A 5G4KB 3PYXA 3EEOA 1BWRA 2FGKA 2WZQA 3G2HA 1D2AA 1DAOA 1QBGA 4IXMA 4O0LA 3ET5A 3M83A 4J6FA 4UAJA 4XJTA 1E7MA 2MU1A 5JRZA 2IZ6A 4IIXA 4CM6A 3AH8A 4YDHB 3QI7A 1UADA 1SXPA 3TIGA 3WLKX 1K75A 2HD4A 5JMWA 4L75A 1RXWA 3KC2A 1Y3BE 3OE4A 4OQXA 4AYTA 3M3PA 5FH9A 3AJRA 4H6XA 3GJ8A 1DOHA 3NKVA 1VFPA 2Z2IA 1HDOA 3FD8A 1SVWA 2VAWA 1CHDA 3CRZA 1FXSA 2B8TA 2BDTA 4C6TB 3FYUA 4LBWA 1RPNA 1U31A 2G36A 3I2FA 3KR2A 3R23A 2BZ1A 1MEOA 3DL0A 3G9UA 1VB3A 2DBVO 4QYIA 4OSOA 4F6RB 3ANYB 3JD4A 3X1DA 3SG0A 4DADA 5DYYA 1JSXA 2ZRLA 3DE5X 1Q0SA 4V0SA 6CHYA 5J23A 1PJRA 3KZCA 3BFVA 5AMXA 2WTEA 1N8NA 2H4JA 1PGPA 3VR3D 4BV8A 2X8WA 4TS1A 1R74A 4MA4A 1BDJA 2Y66A 2DSTA 5IULC 1DC5A 1X1BA 3VZCA