3OLXA

Structural and functional effects of substitution at position t+1 in chey: cheya88s-bef3-mn complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTSEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Variable Active Site Residue Influences the Kinetics of Response Regulator Phosphorylation and Dephosphorylation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Chemotaxis protein CheY
total genus 44
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3olxA00
3BBLA 3LUGA 2B4AA 1FFGA 3FGZA 2QR3A 5TQ0A 3QX8A 5JNVA 4RY9A 4LZLA 3KTOA 3QLTA 3KJXA 2R47A 4HNQA 4RK1A 3HDVA 2PUBA 4WXEA 2OENG 1GCAA 1ZDMA 1S8NA 3NNSA 4QPJC 4RXTA 3GA5A 3HVRA 2PUFA 3QLVA 1ZHHA 2FW0A 4Z4CA 4Z9BA 1D2AA 3O2JA 4KK4A 4MR8B 1ZAYA 3SQNA 1ZN2A 4PYRA 3TMYA 5DTEA 3OLVA 4IGAA 3EJWA 3BREA 4N03A 3T8YA 4YV7A 3GRCA 3LUCA 2ID7A 4WXMA 1YVUA 3H5IA 1MAVA 3Q41A 4H3HB 2NT3A 1YK1A 1DP4A 4H3KB 5ED4A 2BGGA 2MYTA 5JNUA 2IPMA 2V0NA 4MLCA 3E61A 1YTUA 3H5VA 3LFTA 3MF4A 3NHMA 3P9YA 4ZPJA 3EDCA 4OBBA 5IX8A 1TJYA 3D8UA 5KWSA 4HYEA 1JYEA 4NCAA 1Z26A 3M9WA 3RVNA 3VNBA 4JB2A 7ABPA 3FFXA 1BDIA 3ROTA 1EHCA 3I45A 1JDPA 1VPWA 4E7OA 1DC7A 3RVJA 5CNKA 3S99A 1YMVA 3SNKA 2JBAA 1NXOA 1MB0A 2QSJA 3IP5A 4RY8A 4W5OA 4PZ0A 2FN8A 5FBKA 3CKMA 1E2BA 3MIZA 2VYCA 4IILA 3NBMA 4TMYA 2JCGA 2RGYA 2FSPA 4LRQA 4WT7A 1DCKA 5BRAA 3RVLA 3QLUC 4W5NA 1UDRA 1K66A 1LJLA 2MSLA 1VLZA 4CBVA 2FKAA 5ABPA 3K9CA 3RVOA 3H6GA 5GOTA 3ILHA 1IIBA 1USKA 4IF4A 4MS1B 3KG2A 3F6PA 5EWJA 3CG0A 4ETIA 3OO1A 4ZMSA 4RKQA 2FMIA 4G0MA 5CNMA 3O1JC 4EUKA 1BDJA 2JRLA 3LTEA 3O1HB 4LE1A 4G0XA 4O5AA 3H5TA 4D6XA 3MYYA 3TB6A 2CHEA 4EVQA 6CHYA 4MYRA 5KQPA 3OMXA 2A9RA 3MQ4A 1D4ZA 5B3JC 2MYPA 4RK6A 3N6VA 1JFVA 4JP1A 4O1IA 3BRQA 3RVMA 2H3HA 5JNSA 1PNRA 1FFSA 4IMJB 5GQSA 2JVKA 5C5EA 4KK3A 3H6HA 2NZVG 5IC5A 2IPLA 1XHFA 2FLKA 5TPWA 2XDYA 3KYIB 2HJ9A 3HDGA 4P98A 2GWRA 4ML3A 4EYOA 3UUGA 3N0WA 2MYUA 4EVSA 3H5OA 1QP0A 2H0AA 4MS3A 4E7PA 5BQ3A 5JNRA 2IDMA 1CHNA 1A0OA 3CZ5A 1TM2A 3ROFA 1ABEA 4G0OA 1ISSA 3Q9SA 1OXBB 4ZMRA 4RV5A 1FFWA 4MQEB 2FMHA 2QVCA 4RK5A 1ZGGA 5IULC 4W5QA 1RZRD 2E4YA 3E3MA 3H75A 3CHYA 4MQFA 1BVHA 5TQ0B 2PMCA 2E4VA 1U2PA 9ABPA 3SAJA 4ETMA 1NXWA 3KSMA 4W5RA 3LKBA 1E6LA 1RXEA 4QYMA 3BRSA 4IRXA 3JTEA 4XARA 3F73A 3Q7TA 3L49A 3HXMA 3CFYA 1ZESA 2FMFA 1Y1LA 4OLBA 2WMYA 1E6MA 3LKVA 4M88A 1SXIA 3UKJA 3KHTA 2A9OA 2IPAB 3HUTA 3QELA 3GYBA 3GWGA 3A10A 2QXYA 4PICA 4L4UA 3TO5A 4NICA 4JB0A 3GBVA 1JF8A 3HCWA 5EWLA 1ZH4A 2A9PA 3QEMA 5CNIA 3C3WA 3OLXA 1NXVA 1XWWA 5T3YA 1JBEA 1QO0D 3EODA 2PL9A 3KS9A 3VNAA 5FWXA 1PEYA 5FWXB 2P9HA 2E4WA 3CLKA 4EYGA 4QICA 1LJUA 2QU7A 4RU1A 3G1WA 2HQRA 4Z4FA 5BRJA 5E3JA 2FN9A 3TD9A 5IEBA 1USGA 3EGCA 4XASA 3SM9A 4TN5A 3IP9A 3QLVC 2RJOA 1KGSA 3A0UA 2CHFA 3UK0A 1QQBA 1W9HA 1P2FA 2PLNA 3CNBA 3OQNA 2PUAA 1EWKA 3HK2A 3L6UA 4Z9AA 2JBAB 1EWTA 3IPAA 3LOPA 4LDZA 4N47A 1JYFA 3OQMA 4OLAA 1M2FA 2WRZA 2QV0A 1Z13A 3OM0A 4F11A 5KQGA 4XXHA 2PL1A 4Y9TA 4D74A 4EVRA 4EYQA 4KMRA 5C5CA 4KFCA 4TLLB 3RQIA 1B00A 4YGXB 1DBWA 4PEVA 1DCMA 3JVDA 1NATA 3G85A 4S04A 4Z4GA 4FE7A 1R8JA 3LUKA 1E6KA 2X7XA 3GV0A 3CG4A 4MGEA 1FQWA 3GBPA 4L85A 2GI4A 3JPWA 4F06A 4RK4A 1QPZA 4OG2A 1M5UA 3N75A 1YK0A 1DG9A 2ZWMA 2HSGA 4LE0A 1YS7A 1ZVVA 3A3KA 4IMIB 4RY0A 1U04A 3RVKA 1D5WA 3FFTA 3QEKA 2DRIA 2GX6A 4TLMB 3KLNA 3H5WA 4JAVC 1ISRA 3HV2A 1PHRA 4KQ9A 3CTPA 1RZRA 4KRFA 1ZGZA 1DC8A 2L17A 2E4XA 3DZDA 4PE5B 2L18A 4B09A 1BAPA 3DGFC 1JDNA 2VK2A 3H1FA 1MB3A 4EGSA 3M6MD 1QP4A 4P1ZA 5D2CA 1W25A 1NXPA 4RKRA 4WWHA 1QP7A 2FLWA 1Z2EA 1A2OA 4G0PA 3RVQA 1F51E 5TQJA 1HEYA 1Z16A 2IYNA 3FFWA 4G0YA 4KZKA 4MAAA 5JS1A 2A9QA 3H5LA 4YO7A 1YS6A 5EWMB 1MVOA 5JNWA 4MRMB 1P8AA 2PUCA 4RK0A 1YMUA 4Q6BA 2MYNA 3HS3A 2L19A 3DGEC 2ID9A 6ABPA 1OXKB 1DBQA 1L5YA 3FMVA 1XHEA 1BDHA 3MMNA 1RXIA 2HQOA 3QELB 2AYXA 3N0RA 3RVPA 4O1HA 1QQAA 2E4ZA 3MA0A 1P6UA 3C3MA 2JB9A 5FWYB 2OQRA 3F6CA 5HSGA 1I3CA 5IBQA 1RPJA 2O20A 3IDOA 4OTZA 5FWYA 5BR1A 4FB4A 3BILA 3O2QB 4G0ZA 1QMPA 2MSKA 3JY6A 2PE5A 2JK1A 4G86A 3N8IA 4GNRA 1T34A 4LX8A 1QKKA 2GKGA 3T38A 3CS3A 5KQLA 5F64A 3HZHA 4FE4A 3D02A 3H1GA 4MQFB 1LK0A 3DLHA 3OQOA 1MIHA 2M98A 3I42A 4RS3A 5IUNC 3GT7A 1QO0A 3O2SB 3QEMB 2CD7A 4H60A 2FTKE 4MS4B 4YWHA 2RDMA 3KKEA 1TMYA 1URPA 4ETNA 4YR7A 2LUOA 3CU5A 3N0XA 4NCBA 4JASB 1U0SY 1DBPA 1NXXA 1GLGA 2PUDA 4UHJA 3OLYA 1D1QA 3Q15C 3I09A 5DGCA 4Z99A 1L5ZA 4XLTA 1JFTA 4F3TA 2LIVA 3O1IC 1RNLA 3OLZA 1KRWA 3LUJA 1J56A 1AB5A 3RVRA 5TPWB 4YLEA 2FQYA 3T95A 4NQRA 2PKXA 5JS2A 3NNNA 5KI6A 2NUBA 4RXMA 1PEAA 1TVMA 5IEJA 4EYKA 1NY5A 1VKRA 2I6FA 3HUUA 2GBPA 2MSWA 4S05A 3OM1A 1SRRA 5HQJA 5B3JA 1QNLA 2NZUG 3EQZA 3O75A 1GUDA 4N41A 3CRNA 3JPYA 4ZJPA 2FXIA 1YIOA 3EAFA 3HJFA 2FEWB 4MQEA 1KMIY 2NT4A 4UHKA 1ABFA 1JWLA 5TE9A 4WUTA 2YHBA 5KC8A 4G97A 3HO1A 5DKFA 3IP6A 5I4CA 5TQ2A 2AYZA 4MR7A 4JOQA 2N9UA 4LE2A 1D1PA 2WJWA 3EULA 1M2EA 5KQMA 5DCLA 1Z12A 2R48A 4YRZA 3OLWA 4MS1A 5EWJB 2WWVD 4Z4EA 1ZITA 4F8JA 3QX9A 2KYRA 1U8TA 3A0RB 1LBHA 1CEYA 3C6QA 3RVSA 4KPYA 3NNDA 1KRXA 3N53A 1DCFA 3LUAA 4G0QA 2FEKA 2RJNA 3MM4A 4GPAA 4KVFA 1NXTA 5EWLB 5KC9A 1BA2A 2WY2D 5PNTA 5IUJC 4RXUA 4MPTA 1EAYA 3LMKA 4HNSA 4N76A 3QLUA 2WB4A 1TLFA 1Z2DA 3M9XA 3KYJB 5TPZA 3IPCA 1WETA 1JHZA 4Q6WA 3LUHA 2QVGA 2Q5CA 4KV7A 1JLKA 1GUBA 5TPZD 4Z4IA 2ZAYA 1ZH2A 2IOYA 1DRJA 2FMKA 3Q7SA 2IPNA 1U2QA 3C3KA 4MR7B 4W5TA 3HM9A 1JX6A 5JNTA 3CZCA 5DLEA 4RZSA 4Q7EA 1C0EA 3KLOA 4JA2A 5EWMA 3TX6A 4F12A 5HM6A 2LBPA 2VUIB 1PUXA 4N0QA 1CYEA 4WZZA 3KCNA 1H9CA 4RWEA 3HSYA 3URMA 1NXSA 1JL3A 2B1JA 3EQ2A 4EY3A 4DN6A 1JFSA 4DADA 3DBIA 1ZY2A 1SXGA 5FBHA 1Z15A 2LPMA 2M1ZA 3R0JA 5CHYA 1APBA 3F7NA 5IUKC 1A04A 2QW1A 3OO0A 4Z0NA 1JH9A 2HQBA 2HPHA 3IP7A 2PJUA 4RDCA 4MS3B 2JVIA 3B2NA 4KREA 2FVYA 3OMWA 1VRVA 4MR9A 3HEBA 2VUHB 1Z25A 2WJAA 4KQCA 4MR9B 2TMYA 3T6KA 2F8SA 3LUFA 4RK7A 4YS6A 5HKOA 4HNRA 1NTRA 5T7BA 1EWVA 4YP9A 3JS5A 4YCSA 2PUEA 1SXHA 2R4QA 3Q7RA 1Z17A 2LP4Y 4XAQA 4Z4HA 2W42A 2F8TA 3ILYA 4RSMA 3FDFA 1USIA 4MS4A 1P6QA 2FEPA 4ZYLA 4KNYA 4DQDA 3SY8A 2FQWA 3SG0A 2J48A 3JVIA 1EFAA 4N0PA 1GCGA 1LBIA 3O74A 5CNJA 3W9SA 2E4UA 1F4VA 4LDAA 3NHZA 1PNTA 4NV3A 3RH0A 3I5AA 2PAFA 2P4UA 2R25B 2QZJA 1DRKA 3H1EA 1AB6A 4MR8A 4XFKA 4D6YA 1C4WA 3DLBA 3K4HA 2JVJA 3C97A 3GL9A 8ABPA 2CWDA 4OATA 1DZ3A 5TQ2B 1DJMA 2L2QA 2YHAA 4QYWA 1SD5A 1M5TA 2PUGA 4MLDA 3LUDA 1FSPA 1Z18A 3QK7A 1K68A 3O21A 4MRMA 2IKSA 2FQXA
chains in the Genus database with same CATH superfamily
2AOXA 2V55B 1AM4D 1FFGA 3N87A 3PXBA 3U81A 3H13A 2B4TO 3D5QA 4PYMA 5GWXA 1NOIA 4CU2A 2IP1A 3KTOA 4O4HA 3GZ4A 1RYHA 4QXOA 5JXWA 3GRFA 3E3OA 2PR7A 1QK5A 5HQTA 3FI0A 2AN9A 2Y1KA 2C2KA 3KXIA 1GPNA 5CIYA 4WLEA 1GCAA 1PLLA 2FNAA 3LSYA 4IDPA 1N33B 2YWCA 3G8DA 3LA6A 3P9PA 3CUYA 3CW8X 4HNVA 1T10A 5JXIA 3LT1A 3QVGA 5TR9A 5EPUA 3UB3A 2OGSA 4F8YA 1ZN2A 5LZ5A 4IGAA 3CZRA 3P9QA 4C4AA 4DDWA 1U3TA 1OJLA 4ZAWA 4P2BA 4NMLA 4A2QA 4FHCA 4DR2B 2BMVA 2XYQA 1Y8AA 5G40A 1YK1A 3VXKA 2QI9C 1ZW1A 4RGYA 1IHUA 2Y76A 4QDJA 1R3UA 2HSEA 1P3JA 1H0HA 2YWDA 3MBIA 3SZRA 1IOZA 1V5WA 2W8BB 4JBGA 2G0AA 4MUJA 2GBIA 4I9UA 1K86A 2HJHA 3ETLA 5T57A 3RC7A 2IOQA 2PIDA 1ZK3A 3SSOA 4D02A 2XWQA 7ABPA 5E95A 2CE2X 5KINB 1ECFA 1EHCA 4QATA 1XI2A 8LDHA 1GT91 3F74A 1VC2A 3N76A 4IIJB 4UTXA 4Q5IA 1RLJA 4TL6A 2H59A 3GJSA 3L1VA 3DEHA 3CIFA 3FF4A 2RIPA 3AV0B 2HWXA 3IOCA 4KQXA 3IIEA 4AQYB 1ZL2A 1QRUA 2FFHA 4M9RA 4DR7B 3B7PA 5JCJD 4F56A 1RMYA 4GPIB 3MPOA 3SYTA 3KYBA 4RTLA 4GBMA 3G2LA 3FZNA 1LTKA 4TOIA 5JMWA 1P33A 4PSAA 1IAVA 1WPXA 4GOXA 4PZ0A 4C0LA 2AXPA 1DIBA 2JCGA 4RYLA 4XH9B 4M98A 3ZXYA 5IJZA 3EWAA 4MW9A 4UVIA 3EASA 1Z0KA 2LXNA 4MWDA 1TD9A 2NU9B 5IT4A 2BELA 1LJLA 3LCVB 4ES6A 3FOEC 4IIDA 2V74B 2RGXA 4PQFA 2AJ8A 2AFHA 2Z5GA 3TOVA 2H8GA 2I91A 5JAZA 4BWFB 1UIRA 3W7VA 5MN5A 1CB7A 4I50B 4W82A 1DKUA 1NW3A 1XZAA 2DG2A 3B52X 3TCKA 2DFLA 3CYFA 3DD5A 3THXA 1MDFA 2HREA 3SLKA 4BNHA 3H9GA 2B78A 3K2QA 2WG1A 4BLVA 4WE3A 1UKCA 4O33A 1YFZA 1IY0A 3LYLA 2VRCA 1AY0A 3LAWA 2MSDB 4ZODA 1H6BA 2DKFA 3TPZA 4B81A 4P58A 2BMFA 2W4QA 3NVMB 3WL8A 4EVQA 5JXJA 4J90A 4M21A 2WD8A 5E6UA 3NOOA 4YRGA 1QUEA 4K8OA 3ICPA 4D8TA 3PGJA 2XR1A 5B3JC 1RWKA 3LDFA 3VHLB 2WSMA 1TJNA 1SU7A 4U9HS 4JP1A 4OXIA 5A7GA 4CEHB 2VSNA 5K09A 1EWRA 1P75A 3UK6A 4GKJB 3U80A 1M8JA 4ZQBA 3LZDA 5H7XA 5M34A 1ML4A 2RJ3A 3VHXB 3EISA 3C6YA 5JSQA 5JV5A 2NV2B 4EPVA 1OXMA 3DEIA 3HDGA 1P19A 1OWPA 2CCGA 1KJZA 1U81A 2IYSA 1U0OC 4MHOA 3D8BA 1LDYA 3ZY3A 1Y6FA 1A82A 5DT9A 5FX2A 3AV3A 1IB0A 2FSSA 1V9CA 1V6SA 2QR5A 4KWTA 1TEZA 3EMBA 1Y5LA 2B1RA 4ZANA 2WUVA 4A8TA 2I1WA 4FW8A 4BP9A 2QL6A 1U8AA 4JYBA 3GFTA 5E4FA 1ZGGA 4W5QA 2QUBA 1ONSA 4Y6OA 5DWQA 5KCMA 4MCJA 4UOZA 3BH0A 1K7YA 3QENA 4IS2A 4OHVA 3SHTA 4FKZA 3JQ7B 3LKBA 4QRDA 1L2TA 4QYMA 3BRSA 4KR7A 4XGIA 1P1IA 3B6EA 4EHNA 4BC1A 4RW0A 2EW1A 1EFKA 1XZHA 1C8VB 2G1AA 2ROQA 1U5CA 4PZPA 2GO1A 1VQ1A 1YCGA 3AL0C 2X0IA 3NHAA 1XEWX 4IGIA 2WMYA 4G5FA 2D06A 1JVNA 1RXVA 4KXYA 2D6FA 1U94A 2BRUA 1MHTA 1K97A 1FXWF 4OSPA 1QSGA 3EG9A 4QUBA 3RK1A 3KQWA 4LECA 3UW3A 3W9UA 5GGXA 2IXTA 3R9XB 5JHGB 2FWBA 2RH5A 5B7GA 5F4BA 1CIJA 3OVMA 5JAMA 1RM0A 1XOIA 4I4TB 5E3HA 1BMFD 4L95C 4M53A 4V0SA 1JEEA 1OBOA 1GG2A 1H3NA 4ILKA 3WDMA 4ZOEA 3EODA 4CI9A 4DCUA 3GR6A 4DA0A 1CQJA 4BFXA 2P3LA 2PCLA 3AEQA 3UCEA 3OP1A 5E2AA 1I5OA 1LJUA 1U9YA 1QRAA 5BXQC 1BXGA 4L08A 1UJBA 2QW8A 2XMSA 3VJLA 1TTHA 4G4SO 1V2HE 5DHTA 1O94C 3IDFA 4PRKA 2G08A 2OCAA 3IAHA 4O4HF 3FPFA 4PQEA 3L4BC 3NHLA 4N8SA 2QZSA 4R3WA 5AVRA 2PVCA 4QSMA 1IWBB 1NHWA 2AG6A 3FMIA 4HHEA 4KXFB 1ZIDA 4URHA 5I3CA 3BDIA 4PLYA 4OF4A 2I2BA 1KNXA 1JA9A 2A3NA 2WIKA 3BE4A 5CCXA 2HLDA 3KSAC 3HYLA 1WVMA 3OQMA 3HH8A 4DV6B 2OAP1 2Q7XA 3M82A 1TUBA 3X1KA 4LSGA 5L3QA 2MT9A 3AY7A 3P5BA 4OKSA 2AFHE 2H92A 3I0ZA 5KQGA 2J0QA 4GICA 3TW6A 5C3MA 2A86A 3LBNA 4KMOA 4CMJA 4EYQA 4YJKA 1OA0A 1VA5A 4DIEA 4TQ9A 3SHWA 4G5OA 1Z5OA 2HAEA 3AONB 3ZUPA 2FMTA 1YI0A 3JR7A 1JDVA 4NARA 1DBWA 3M81A 4DNXA 1I01A 1PF7E 3SU8A 4FE7A 3MWFA 2X7XA 4LRSB 4A6DA 4MGEA 1Z8DA 2ZI5A 4G8DA 1MXHA 4NL4H 4N01A 3A9WA 2GI4A 3MOGA 2AC2A 1ZVJA 3QJYA 4ZOCA 4ZZ2A 5TDHA 1A5BB 3B85A 3GT4A 1D2NA 3HYSA 5AI5A 5GVSA 5HNKA 3GNSA 4LW8A 3CZAA 1OJ7A 2XDWA 1BWPA 4KPUB 3ILXA 4FYYA 1G8SA 4DMKA 2BH9A 4XSGA 5E7IA 2YJTD 1BU5A 4TMVA 3H5WA 3W5AA 1G0NA 3M70A 5FYQA 4K2AA 4TV8A 3VVCA 1CFJA 3RADC 4FWTA 1IXZA 4HB3A 3HR4A 4P93A 3NP9A 3ZWKA 4EI9A 1EQ2A 4P1ZA 1W25A 2FY8A 4F2WA 2WTBA 1J7JA 3HHPA 2FLWA 1U7PA 2H1RA 3TD2A 4A0HA 1A2OA 4CKBB 3AX6A 3BXOA 1WXDA 2N47A 5HF5A 1FMFA 3OTGA 1SG6A 3BA6A 4KGZA 3SFTA 4UTRA 5ADWA 3QV1A 2P68A 3AEUA 3RG2A 1BXRA 1UBMS 3VHQA 4ZAZA 2EX0A 2ZYIA 3MJVA 4NVRA 4NZPA 2HU7A 3X1DA 1K6IA 2HDWA 1FK8A 1ZRNA 1M10A 1VM6A 3JD0A 3MRXA 4YJHA 2ID8A 4OAOA 5ICCA 1WEHA 1W4RA 1DV2A 1O5TA 2FH5B 2RBKA 1G1AA 3R7FA 3JQ8B 1G42A 3IJ5A 2R68A 3ZNPA 3VH3A 2RHJA 2JB9A 3S68A 3CQ9A 5FWYA 2EP5A 2GM3A 2H4JA 2WK1A 4KIFA 1BXZA 2OWEA 5ER9A 5TGDA 4LDRA 1QMPA 1KH2A 4TQAA 3QEJA 2C2HA 3RIXA 3TAUA 3VI4B 3GP5A 1POXA 4XWOA 5HMLA 4GNRA 3UH0A 5EE1A 1B15A 1QZXA 2EF1A 2V7QA 1VHTA 3B1VA 3QNWA 4IYJA 4P36A 3LBFA 4QOGA 2Y6UA 3E53A 4MUBA 3HZHA 4GLOA 5K2OA 1W2GA 3X0DA 3RKUA 5JWRA 4LOIA 1LS6A 1PK9A 4GDMA 1JKJA 4TS3A 4YAJA 3GPLA 1D03A 2VYQA 2FGKA 2FXVA 5EKXA 2R1ZA 4OYYA 4KDFA 2B8NA 5A7FA 1E79D 1LLCA 2OBXA 4JP5A 4ZT4A 4H60A 4YV0A 1N9GA 2RDMA 3G88A 1URPA 1B74A 3DR5A 4L9SA 1PQ4A 1AGXA 2R6DA 4LQCA 3QF4B 2Q7OE 2C1XA 4XWKA 1K8XB 2VF4X 3RHSA 3HVJA 1XMPA 1HYQA 2GLUA 2JW5A 3FGOA 1UBRS 1JR2A 2XY4A 3R9KA 1ZUNB 4D8XA 4IKOA 2P2SA 1GGVA 2FZWA 2FHSA 3KEFA 4OAPA 4HWPA 2HK9A 1EA7A 1QG6A 3OHSX 4K6CA 4Z9XA 5G41A 2FQYA 3ZDYB 3VSAA 3OQ1A 5KI6A 2PO7A 3I34X 2M1XA 4RZ3A 2ZOSA 3KE8A 1N5RA 2NU8B 3OUZA 2OV1A 3GUCA 3IDAA 1FBNA 4NWIA 3R0IA 5DGIA 5K3FA 4ENWA 3L7OA 4S3MA 2C9DA 1SKYE 5B3JA 4URWR 4YJ3F 4AY2A 4P4SB 3AFHA 5K6TA 4XVHA 3BJIC 4R9NA 4HDRB 3BTOA 2Q27A 1MABB 2B6HA 2IPXA 5K4AA 1YR2A 2FFQA 3KTFA 1OX6A 4DJ5X 3U3OA 1FXUA 1P45A 1QZZA 3EXIA 2WJ6A 2O3QA 3OETA 4WUTA 3AVXA 2RAPA 4E5DA 5KC8A 4KN9S 1A4XA 3IQXA 1UEXC 5AOAA 4AJJA 4EG0A 1VSVA 2QN7A 3CBQA 1L5VA 1EVKA 3SDBA 5JD6A 3E0XA 1YRAA 2OCPA 1UMBA 5JCOA 1I80A 1ST2A 2CJPA 2HK8A 1NQXA 2IF0A 1K7SN 1KY4A 1DO8A 2II6A 3KSUA 4Y6SA 3RRXA 2WAOA 3ZCXA 3OJWA 2ZBGA 1CJSA 4L7VA 5DFAA 4M1EA 5KQMA 1RKBA 4ZI5A 1JIXA 4KWCA 2GEDA 4Z4EA 2HU2A 1A50B 1CUGA 4CQMD 6GPBA 2VH5R 3FDIA 3TJZA 3KIPA 4JBYA 1V8PA 1A71A 2ZXUA 1FXWA 3LUAA 3KP1A 4L22A 2P65A 1T3ZA 3MM4A 1LS1A 1B26A 4W63A 3MS2A 3L8YA 1NJGA 4HWOA 1Q7TA 2XTMA 4Q9JA 3QVXA 4EIWA 4MPPA 4LA4A 1KPHA 4MPTA 4OLJA 3ZDEA 1CTQA 1T2NA 3L1JA 4P82A 3LH5A 3OFKA 3FPLA 1QHEA 5KTRA 5BW6B 4UAJA 1E8DA 1M1NB 3EMVA 3DMTA 3OIYA 5FTNA 1SCJA 4KI0A 4PRZA 3P9ZA 5LP6F 5CDGA 1JLKA 1Q84A 2MDTA 1AKRA 3F6BX 4BLOA 4I2VA 3W6OA 3OTQA 2Q5OA 1ZONA 3ZHXA 4BNVA 4EQ6B 4JJZA 3IOYA 1X7YA 4KN5A 3B1ZA 3CRQA 4O4LA 4PHTA 5IC6A 1KBOA 2JJ8A 4D4LA 1A97A 3DVSX 2Q8NA 3FLEA 3LVQE 2AJCA 1INLA 1MHPA 4UHDA 3TLCA 2DECA 3C3JA 3N58A 2O8BB 3CW2A 5T67A 4B73A 4DADA 3CLHA 1NQVA 2RC5A 4PZCA 3ZIUA 1SEPA 4HG2A 1SCBA 3W9BA 4HGQA 2CL7X 4C88A 3JZAA 1ONBA 3KQSA 4LTNA 4C4TA 2DC1A 1YKGA 1J5PA 2WU4A 3FPKA 1BCRA 1HSOA 2OCIA 1VG1A 3IUPA 3IULA 4G5QA 3IP7A 4XQCA 1SVKA 1PVDA 2PJUA 1IEXA 1QK3A 1NSFA 3KYCB 1OAAA 3GHHA 1LRKA 3G2JA 2EKZA 1TMOA 1M8FA 4MR9A 4CDGA 2R6CA 3D0QA 4KQCA 5HZHA 3T6KA 5ADHA 4CHGA 3F6SA 1QMGA 3HCPA 3PJEA 2ZVDA 3B48A 1X7GA 4HVAA 4LHEA 3X43A 2FPGB 3ETDA 1M34A 3G2NA 5CT8A 1GZ7A 1J8VA 2LCFA 4BNNA 4P0TA 2JC3A 3QWFA 4KMSA 2XAAA 3GP3A 1NBHA 4HNHA 5HG0A 3D7MA 3ZWCA 3F7MA 2N42A 5ES3A 1DKMA 3I4CA 4FYHA 5AJZA 3FZGA 2DJ5A 1A9OA 1YCHA 3K94A 3GJ6A 3WMFA 5KO2A 4B44A 4BV2A 3KUXA 1L3IA 1TGYA 1TK2A 2P75A 2I3GA 2R60A 3A4VA 3AFMA 3QFCA 4NC9A 1E3TA 1GLNA 3SXUA 3W2FA 3FDXA 1Y8ZA 5EXSA 1FFAA 3IALA 4I4LA 4GLJA 3QBEA 5GTDA 1AK9A 1M7HA 3Q0EA 2LCQA 5C8YA 2GD0A 4LAFA 4WLFA 2JJ1D 3DD1A 1R6UA 3I30X 4M0PA 1HNNA 1EK0A 4R6WA 3TSCA 3EIEA 1DZ3A 5TQ2B 5B7PA 3I64A 4MWBA 1M5TA 1ORVA 3LUDA 2GO7A 3JQGB 3MUNA 4CKWB 4PR3A 1RYZA 3LDAA 5TRTA 2UU9B 1IBLB 2ES4A 4U02A 4Y2PA 3HA7A 1V7CA 3OPMA 4WY5A 3EA0A 3H86A 2PU5A 3LUGA 1IBKB 5BQPA 1G0OA 5GPBA 2QQ0A 4YAKA 5B2ZA 3UAGA 4ZV4A 5TQ0A 3V4VB 1I7DA 1J2JA 1NM5C 2D3TA 1AKMA 2YZNA 3DEFA 3H19A 1JLRA 1RTTA 4WK0B 3V8QA 2OP0A 5AVVA 1WY7A 4LXIA 4U2DA 4IDNA 2QMUA 4BRZA 3WGLA 5KDLA 2PUBA 4BX2A 1IPFA 3CXUA 3LQ2A 1N4DA 3CB2A 5IXJA 3Q8MA 1S8NA 1E1DA 1MNQA 4RXTA 4W9NC 5HE8A 4RTKA 3NEJA 4PTZA 2IU4A 4IUBS 2HMVA 4QQ8A 2V7GA 5DASA 3SZUA 4Z51A 1OAOC 1W0JD 4BMOB 1N92A 3U3JA 5JARA 3NTUA 3FCAA 4NBRA 3JQAA 1YB6A 1SVSA 1CCWA 3BCUA 5B1SA 3QVLA 2PGDA 1A8UA 2HRCA 4YRFA 1V4BA 4B4KA 4DOMA 4CLEA 1RRPA 3QU9A 2XCUA 5U9CA 3FIUA 5JANA 1E5TA 1G18A 1JDBC 1E96A 2BSAA 1O6FA 1CJMA 1PJ3A 1QGAA 1QTNA 2MYTA 4L2IB 1NYTA 2R6R1 5AXAA 2HCRA 1LQTA 2XXJA 3A9VA 3AW9A 5G4KA 5JMOA 4JOCA 2AQHA 1E0KA 5KYKA 1N5IA 1W73A 1UZAA 3HBAA 3QVUA 3ZH2A 5EIEA 2QDXA 1CJTC 1COWA 2QTFA 2JGDB 3QW4B 5KTMA 3RUIA 1S3SA 2IZOA 2K87A 2Y05A 1H22A 1F8GA 2GOYA 1KJIA 2V4ZA 3BZUA 1CQWA 3F47A 4JUBA 3IHWA 4QFBA 1YQGA 4JJEA 4RJ2A 5FUVA 5H3CA 3USCS 4P0PB 1OXXK 1TEXA 1QIEA 1GSAA 3DEAA 1EQUA 1P62B 4GPBA 4QUDA 1QU3A 3NB0A 3B7GA 3QEAZ 1I3KA 4LF6B 4COOA 4TSFA 2QRUA 3VA7A 4PAWA 3AETA 1D6MA 4ZAXA 5JJIA 1G8GA 3MK31 3IUMA 3JZFA 1TRKA 4V3CA 4ID9A 1J4AA 3IO3A 4EUSA 1DX4A 2FUKA 4G0VA 4ZT6A 2FJ0A 4O2BB 4EB0A 2QXUA 4XPIB 3UJDA 3COWA 4JKIA 2QJTA 4EPTA 1E9BA 1WDKA 1ZJ6A 3ZHYA 2I8CA 3STTA 2R1TA 1AO3A 4FIZA 5CTJA 1WKVA 4TV9B 1XUOA 3MNFA 5SYMA 1K5PA 3C45A 5B57C 3ZVRA 3PGXA 4QDOA 1PR3A 2OKCA 2O2JA 5BW5A 2OQIA 4I8XA 1G21A 1NWHA 2PUVA 3ON5A 5E2BA 2UYYA 3WMWA 1XXHA 3BZWA 4E51A 4FYWA 1FNDA 1ZMOA 4MS1B 1V7ZA 4YMGA 2CHUA 3W05A 4M9XA 1GG5A 2VH2A 3N3BC 4OGKA 1A8PA 5F52A 1KHHA 3IEIA 2QW0X 1DHTA 3WRVA 1HNZB 4C6TA 1HQKA 1XVLA 4KPUA 4U5QA 1CDDA 1XRRA 1G1MA 3I92A 4LE1A 1AKEA 1LI5A 2A3RA 2JLAA 2ZT8A 4R83A 3TLJA 5ALSA 3M2PA 3TZCA 3VC7A 1X8LA 5JAIA 1PJ4A 1KSFX 1LBTA 3ZCUA 3BDAA 2BGJA 3R2JA 4A1OA 1JW9B 4B6RA 2QPLA 2Y1FA 3T3DA 1KZ1A 3BFKA 4RD0A 7MDHA 3H1PA 4HAUA 1AMUA 1I7QB 3QZUA 4LXXA 3OF3A 4CKBA 3DZ8A 3MQ2A 3FBTA 1FFSA 2TMKA 1OROA 2WT9A 4G5YA 1T15A 5JDIA 4NEGA 4YV1A 4KK3A 5EZ5A 3UICA 3ZXSA 2XYRA 1IZYA 5JU6A 3OZUA 4XRGA 3ZUGA 1YVPA 4OREX 3WGHA 2J3KA 4LJSA 1W5SA 2BY4A 5AKEA 1KDTA 5F7XA 1KSJA 1KYVA 4R4JA 1R3DA 3TOZA 2NTYC 1G55A 1GTSA 2NVBA 1PQPA 2B2XA 3T7AA 3WHKA 2GJSA 2HJRA 4JGIA 2J85A 3VPAA 2L69A 4PRLA 1CHNA 3ND9A 1T29A 1XTIA 2QKYA 4MLZA 4DBZA 5D6NA 1XMVA 1T1JA 5AJVB 2CZGA 2QVCA 1HO3A 3UPDA 4NZZA 3T61A 2GEJA 4CF4A 2E4YA 3DZKA 3E3MA 4CMGA 2J32A 5BNWA 1KOJA 1JAHA 3EOZA 3D3EA 3QJ5A 1IWOA 3KSMA 1R9MA 3NUQA 4OHPA 4AJHA 2P6UA 5H5JA 1Z88A 5TX7A 1SC4A 2DFKB 2ZBUA 3FUCA 3JTEA 3I04A 2CLLB 4OK5A 3K5IA 2QAGB 4BO9A 3JQGA 2WJHA 1F8YA 4J1TC 3PFGA 4QBHA 1FJHA 1ZESA 2FMFA 4AO6A 3PHHA 5CLFA 3IL2A 1QANA 4FZVA 3A7DA 4AJ9A 1M2KA 1XPOA 4I5DA 4IINA 2W58A 1C4XA 3GMSA 1JDJA 2JA1A 3VHXA 1JR3A 1WMBA 4QTZA 3IYLW 4QXPA 4S0XA 1SHJA 1L5MA 2AXEA 2DM6A 3STWA 3T34A 4ESEA 5LVAA 4Y1RB 5EKSA 1UOOA 3LQYA 4DLYA 3CF2A 3FY4A 1JKJB 2PT7A 3HCWA 4W1PA 4YRBA 1PE0A 1R4MB 3SXUB 3RS4A 3KQNA 1NXVA 2D1RA 5AK0A 1KAQA 1WX1A 1XCOA 3TL3A 1QGED 2GZRA 3EZYA 5G2OA 1E2KA 3RYIA 1B23P 2TSYB 4R2XA 5HDBB 1T5TA 3H5AA 1GRQA 1VGVA 2R7NA 2VJLA 2JLRA 2ZJYA 1EHYA 4RZUA 2CLFB 3QOWA 1PSZA 3T54A 1F48A 4FE3A 1O58A 2FN9A 3TD9A 1Y8RB 3NBQA 4BYGA 4PLVA 5BSHA 4XA8A 1MO6A 1QR6A 1VMAA 1CSEE 1IULA 2OCYC 3A0UA 4WAUA 1BS2A 3N2KA 3B6ZA 3KX2A 5AW1A 1L5GB 1Y9DA 4BNJA 5K8TA 5CB0A 3UBMA 2DR0A 5JBNA 4UU1A 3TM4A 4D0GA 3FJ1A 2QTWB 1EJ0A 2HTFA 4E5PA 3IIJA 2DCUA 3NHWA 2YWEA 2J4CA 5F7OA 4K1LA 3PKZA 2WKQA 2VP5A 3NORA 1XAJA 2AI3A 4NDZA 1WB5A 1YS4A 4JX9A 3A6HA 4JNKA 1FE8A 1R0SA 4GOLD 1JSRA 2GEVA 1ZH8A 3DP9A 3TNDA 1N6NA 1XZJA 3B1FA 3CNQS 5JJCA 1JQAA 1KYXA 4YB8A 3GBPA 5E6UB 5I45A 1OKKD 3U61B 3PQ3A 1I33A 4GKBA 1S7GA 3VPBA 4YPOA 4Q03A 3VNSA 2XDQB 1N77A 4LE0A 1YS7A 2A4KA 3HYRA 1CW2B 1CETA 1UPCA 1KAOA 5C7IO 5KTTA 1REQA 2EERA 4KO8A 1RI3A 3WRXA 2YASA 3HV2A 3QVVA 4AG6A 1VHLA 1AZLA 2VEDA 3A27A 1EBUA 2P5SA 3IPLA 3P0FA 2MWMA 3OKPA 5IHPA 5LDDC 4KO3S 4ENRA 2OEPA 5F35A 2O0MA 4I1IA 4D1YA 3Q87B 4AZ3A 2GJ4A 3R0XA 3REQB 5D2CA 4INJA 4HTFA 2DFTA 2JFPA 1YE8A 3FAKA 3M6FA 4UNNA 3W0LB 1H0RA 5A1TA 4UTOA 4DFDA 1M7GA 4C0HA 1JQKA 1F51E 3ZWBA 4IMRA 1HEYA 1Z16A 3G23A 3B7WA 3VHRA 4OQMA 2W8BA 5IPFA 2OWDA 1CUWA 5AVSA 1F14A 4MRMB 8ATCA 2MHCA 3GDHA 3WLSA 2JZCA 2R96A 4Q6BA 3V7FA 2YJ5A 4PGAA 2WIAA 4CEJB 3E8SA 3ISVA 3OICA 3V4LA 1GYRA 4FIDA 1KZ9A 4O4LB 2EYUA 4FT4A 2NSLA 5EA2A 3RVPA 3GFQA 2J9GA 4X97A 3SJAA 2GD6A 2P5YA 4WJZA 2I2AA 3HCAA 4RL4A 5FWAA 3TQHA 4AN4A 2V5VA 4G4IA 3IDOA 4JXJA 4JH0A 3DXYA 3MG9A 2IXBA 3JVVA 1HDGO 4L4XA 4MQ4A 4O4JB 3VVMA 3GLIE 4UXHA 3A1CA 2H57A 4ZZ0A 4TWJA 4JJIA 2K7FA 3U7QA 2RHGB 1VLLA 3L7LA 1M1UA 4X90A 4BVGA 3PR2B 3QE2A 4KAXA 3SJBA 1M2VB 1RJDA 1Z2CA 2P30A 4TQGA 1I5RA 1NLYA 2HA7A 3IFSA 3GRYA 3HU2A 1GXSB 1OTYA 2RHHA 4IIXA 4XDGA 3I42A 5ALRA 1JPVA 4BFLA 4F85A 2Z4RA 2ZRLA 3H18A 1SC9A 4J1NA 5KPJA 3QEMB 1XIVA 3FPJA 1XJQA 2D1SA 1GITA 2FW1A 4DCSA 1XKXA 5IDQA 1W1UA 3KK0A 2BFDB 3HEAA 1DBPA 2RGCA 2RGEA 1THMA 1FLDA 4BATA 2QBYB 1N8TA 4CIAA 3GCDA 3FOFC 4IKEA 4IX1A 3V1KA 5DGCA 4Z99A 4LPSA 3O1IC 3OFNA 4BFWA 2V7BA 2JHPA 1FYEA 1W59A 1C0PA 1KI6A 1NGSA 2F43B 2ORIA 1E1CB 3Q3HA 4H35A 4KLZA 3FDZB 1UZLA 2CXNA 1UP7A 2AX3A 2PN1A 3JALA 4YQEA 1B2LA 1TYZA 2WTEA 4R41A 3EEIA 2ZM5A 3U7HB 2W71A 4O2RA 1XU7A 4KMMA 3WJ1A 1PVOA 2GRAA 1FF9A 4MGYR 1C30B 3OM1A 4LRYA 2I03A 3DPUA 2A9VA 3DE3X 1KF0A 1NJ1A 4YECA 3U17A 3FPSA 3KTAA 2CZCA 4GXNA 5LSAA 1LNSA 5AIAA 2ZQZA 3DDOA 4MUXA 2WJ3A 2R2AA 1KFEB 5KSYA 4JZKA 5ICMA 3PUIA 1WPQA 4YJ2B 1YONA 2TS1A 2ZWPA 4Q1EA 4A8JA 3HA5A 5GJBA 3Q3EA 2J0VA 3HL4A 1FLVA 1GU0A 4PGFA 5HA5A 1AQJA 2PZEA 4ZI7F 4Z53A 4LXTA 1LBSA 3IP6A 1AE1A 1W581 2YRWA 3UBTA 3KPVA 5FIUA 2L0XA 1GCOA 1HLDA 3SC3A 3T1HB 2JHCA 1Y7PA 4LE2A 4LOJA 4ZOAA 4F71A 1ICIA 3CN7A 3FWHA 4QPCA 3H5RA 4W6ZA 5BSVA 3HNRA 3G0IA 1VPEA 3SQMA 4DEVA 2G04A 3G9QA 1BTOA 2D2EA 1TKAA 4E09A 2FDRA 1Y3IA 3UMSA 2YVKA 4EZEA 4O4IB 3V48A 4NZYA 1Y37A 1WMFA 2YL2A 4ROTA 3PUYA 1LU9A 3NBAA 4Q4AA 5CA0B 4MO2A 1EI9A 1DNPA 4MK4A 4DLXA 5B6JA 3P27A 3RUPA 4X64B 2PLFA 1AGNA 3PC7A 4ER3A 1XRJA 4CKYA 3HSSA 4F6LA 3R7LA 1A9ZA 1IBRA 2P78A 1C3VA 1DEXA 2IYFA 2IHJA 4HNSA 4RHEA 2XNDD 5LMUB 2GN8A 3ND7A 3CVOA 5HRAA 5M29A 3PXAA 1JR6A 2RGNA 2ZRNA 1J9EA 4EPRA 4DNPA 3T4EA 2VTEA 2K4MA 4HBGA 3GLFB 3QKRA 5JSYA 3OZSA 4WA8A 5EPEA 3NBUA 1E63A 4LJLA 2H8KA 4M6WB 2A1IA 1IJBA 2DYKA 4CQMB 5BW8A 1N6LA 1H2WA 2LZ0A 4U8HA 1C0KA 5FPPA 4EJSA 4CUZA 1ZIYA 1V96A 2GUWA 2IHZA 5KYGA 5CBPB 2VDQB 3B1KA 3N2EA 2LBPA 2Y0CA 1BW9A 2X14A 2M2IA 1CR4A 2PX0A 4U7FA 5T8KC 5TEWA 2NVUB 1OBFO 3R74A 1Y6QA 2Z98A 4R69A 1II8A 3URMA 1X14A 3IODA 4AB1A 4X71A 4CKXA 2H63A 3M5DA 5FBHA 4DY6A 3O83A 3T4XA 5DBGA 1H85A 1SUSA 4XYGA 2PMBA 1MAWA 3TLEA 4QJ5A 2EATA 4C14A 3AHIA 3C5CA 3OEWA 4NE7A 2X6RA 2FFJA 3B3QA 2GPTA 2XITA 3FXAA 4X7BA 3H7AA 1KOLA 3CVYA 1IK6A 2WFLB 4M76B 4BO0A 2FSVC 4IHAA 1Z25A 2WJAA 3AM3A 4HDCA 1G2OA 1QAOA 1C29B 1W4ZA 1YRQA 2TMYA 2YQ5A 4IIHA 1SUFA 1C7ZA 1VL0A 4TYMA 1N2CE 3SZOA 4Z7JA 5A7HA 3F2IA 2QTCA 3AEZA 3IBFA 3OQJA 4YEDA 4HFRA 3T06B 4C89A 4V24A 2O3SA 1M2NA 2OBFA 3AM5A 5U1PA 3Q3VA 4X65B 4NHEA 1QX4A 1Z17A 3PPVA 4B3CA 1R5JA 2VI5A 2WT8A 1SO8A 1CY2A 1NTOA 3LK6A 1TJ5A 1G7RA 4TRJA 4CFSA 2WHPB 3P9IA 2A5YB 4ZV7A 1ZISA 3MSXA 4QUKA 2HU5A 3Q5DA 3WLQA 1K7EB 1NYQA 3QIAA 4BB5A 1EEHA 5BV1A 4QE3A 1F17A 1F4VA 3QVSA 1P60A 2C7QA 2ZRJA 4TTVA 1ISMA 1ZOSA 5EJ5A 2ZUWA 4EFLA 1XAGA 1NVUQ 2JLYA 5H70A 1PJQA 1JDTA 1NVVR 3ND8A 3UH1A 5FUWA 2BEJA 2FCAA 4L5CA 1QDUA 4GP9A 2QIPA 4A8HA 3LKDA 2A9JA 1Q0LA 4TKUB 1L4YA 1W93A 2AVNA 2H0QA 3BE8A 5GV7A 3CLTC 3GG9A 4WKOA 3TEJA 3G7NA 4UPVA 1SXJE 1O9GA 1T24A 4L3VA 5KJCA 1E2NA 5EJAA 4CNBA 3ZD6A 4E08A 2CUTA 1GPJA 4KWIA 3L9WA 3I72A 3KTDA 3PJFA 1W88B 3E1SA 2VDWA 4U2FA 1CEXA 3MUFA 4K9RA 4U1RA 4IRMA 4B45A 5B3KA 4MPRA 3I61A 2EGUA 2WYIA 1ULHA 4N4AA 1FRQA 1BXGB 4BJ3A 2C5AA 5LA6F 1A5ZA 1MH9A 4MDHA 3FUWA 2AEJA 2B4AA 2VZ8A 3IEKA 4RQBA 3UHOA 4BBPA 5KTKA 2QR3A 1KVTA 4PU0A 4HQOA 3MWKA 1U5BB 4TV9A 4ND8B 4OQLA 4ZTBA 2WWGA 4NU6A 4OQZA 5KNBA 2R47A 4PCVA 3IB3A 721PA 4M0MA 1AZWA 3UAYA 4ZYZA 1XLUA 5JRDS 3N5CA 3PEVA 2HJVA 4R1TA 4KHZA 4O02B 2OENG 1XTTA 1W4LA 1ZDMA 4OXQA 1G2IA 4M0DA 4CEIB 1TT5A 1RVDA 4RFSB 2VNSA 1N2CB 2V4MA 3C3DA 3JQEA 3O2JA 4ZO9A 4EOGA 3ETHA 3H11B 3HGQA 3T3HA 3KQOA 2V97A 3IJRA 4M1KA 2IFTA 2QOEA 3EJWA 1MO4A 2GBCA 3FBGA 1GD1O 2C3OA 2FETA 2QE7A 2QMZA 2WLTA 3RCBA 3T3MB 3T8YA 3VR3D 5EOVA 3VOBA 4CQNA 1YVUA 4B3BA 4H3HB 1X42A 2W2QA 2G9UA 4A8JB 1AHHA 5A06A 1LWOA 4Z7NB 1AUOA 4U4AA 1JG2A 4KO1S 1F6DA 1MFZA 3MCTA 3VGJA 1T2UA 3ZDDA 2MIIA 4JODA 3CX6A 3UHFA 4BL5A 1JPUA 3PVSA 1H6AA 4F7DA 3WK5A 1G7TA 3HJGA 3JARB 3NU1A 5EMKA 4IV8A 4OBBA 3UYLA 1KPIA 4M0LA 5AKKA 2IK8A 2JCYA 5A3JA 5K05A 3S1AB 1MAUA 5C8XA 3T9DA 4BJ6A 1BDIA 3ZY6A 3ROTA 1HYBA 6YASA 4RNDB 2GN1A 1JNYA 1DC7A 3QFTA 2AW5A 5DIFA 3BTVA 1G3RA 1OFUA 1RI1A 2NX2A 1UDXA 2WJPA 1DQSA 1DIGA 2CN1A 2WIGA 3ND6A 3AY0A 3WBJA 3T1NA 5C2JB 3DLAA 3K71B 4DCOA 1GPUA 2X4IA 3ZEAA 5I4KA 5FTWA 2I66A 4L1KA 2O06A 4ZI7A 1T35A 3UWMA 1NDHA 1R16A 4AO8A 2QRKA 3U4QB 3GRAA 4HQ0A 2BW0A 4DJTA 5C18A 2Q2OA 1RLTA 2NWQA 3LT4A 2IYUA 2ZWOA 3USES 4D56A 4KC0A 4JLUA 1B7GO 4ZOLF 5G0UA 4CEHA 2PAAA 4D79A 1YGPA 2DE0X 3WLEA 4BEJA 2W90A 1NUSA 1ZCFA 3I9V1 4GWGA 3MVEA 2WYVA 3IQFA 3EVTA 4QYIA 4ZK2A 4M8LA 4DSOA 4IVRA 5T4HA 3KE9A 4KQKA 1IEVA 1L5SA 1R0YA 4BGIA 1RJ9A 4Q4AB 5CA0A 1ADBA 4F04A 1AUVA 3HI6A 1MB2A 4JMLA 1SD1A 1K89A 5IHXA 4PQRA 4ZPXA 3LXUX 2KMLA 4ZCRA 4A6PA 4OX9Y 4WK6A 1J22A 5A3VA 2ZR0A 1J21A 4REMA 4F86A 3WSWA 3WIUA 2P1DA 1VPLA 1XTJA 3BB1A 2FR1A 1Z5UA 4D8UA 1NBMD 4RLFA 1U7UA 2M32A 3H5NA 3Q4GA 1PZGA 3E7FA 4OHZA 2CNKA 3RDPA 1FYWA 4AS3A 3WP1B 3H5TA 2GLXA 5DM1A 3U7RA 2Y0DA 4EFMA 3OKAA 2PSSA 1DXQA 1A9XA 3ZN2A 3ANNA 2JI6A 2F3SA 1T4BA 3DV9A 2QMYA 1IAQA 3OMXA 4NBUA 5CCDA 5LZ8A 5CYFA 1PTKA 4Q7KA 3BA1A 4MZDA 4UAUA 3F5FA 3R4CA 5DYNA 4U5XA 5DJ5A 3EBLA 2MYPA 1N7HA 4P0QB 4CQLB 2CJFA 2VK1A 2QV7A 1S2LA 4UBOA 1DGQA 1TECE 2R5FA 4UJ3A 4X1KB 4EF6A 2BZ0A 3TKYA 4B6JA 3BZBA 1Y42X 1E4OA 1U2DC 4EP1A 1A4RA 1T1IA 1JFLA 2OFOA 2VHZA 3C6ZA 1DUIA 4D3FA 4DEXA 3ROGA 1QK4A 4ML3A 1MV8A 4EYOA 4C03A 3HN7A 2PEYA 4ZDIA 2VSFA 2OY0A 3N0WA 1V11A 4YRQA 3U16A 5EINA 1YZNA 2MMCA 3PHCA 4NDAA 4W1SA 5L4LA 4DXHA 4JYZA 4LNHA 3VKHA 3IXLA 1RCFA 5CT4A 2MR6A 2C9OA 4EEZA 1NLZA 4EATA 3DUWA 1JVSA 4V2IA 5CH5A 2JEOA 2PX2A 5DB4A 1FW6A 1GLVA 3MMZA 3PQ8A 1L5NA 1USWA 2CLEB 2C3YA 1PR0A 1F0NA 2Z83A 3H75A 1WUJS 4WGGA 1AKWA 2VJMB 3R5KA 3BK1A 4L2IA 2AI2A 4LY0A 5U4QA 2AHOA 1JYSA 1FXSA 1NR7A 4E4RA 1AURA 3C14C 1AKVA 1N3LA 1XZQA 3HKCB 4EHJA 4I9NA 4DNFA 3T5AA 1PFUA 4JT8A 3MWEA 5FQOA 2VRNA 3OBIA 2V1XA 3WR5A 3Q7TA 3DOOA 3CNLA 1V1MA 3VVBA 3EXFA 3HLYA 1CY4A 1AT1A 1Z75A 1NUTA 5AWFC 2QZPA 5AHOA 5FO1A 4J16C 5CT5A 1E1KA 2KBEA 1WCIB 1U1DA 1N2XA 4BMDA 3ASUA 1NMYA 1YRHA 2BM9A 4DLKA 2C3PA 4ZTUB 1E62A 4EI2A 1CWUA 2P35A 4B5LA 4ZO4A 2PYDA 3UG6A 5JXGA 4QD3A 4KTVE 2FU5C 2PRYA 2VF5X 3OX4A 4MVJD 1JB9A 4BUJA 1DAFA 2XVMA 2C7BA 2HL6A 3BXFA 3KUUA 4H6VA 2ZRHA 3WB1A 3ZIAA 3V3TA 3OP4A 4QNNA 2H5IA 1FRVA 4XYLA 1FYDA 3MJSA 4GBGA 1F3OA 1KYIA 2WG0A 4CLOA 3BIJA 4PZYA 5H80A 1JBEA 4WSOA 1NSYA 1MORA 1P3DA 1XNJA 3GK3A 2PFGA 1RWBA 1JZSA 1FVFA 2C8KA 2V65A 3B3GA 3BKWA 4X20A 5KAPA 2PKQP 3HACA 2SKCA 2VYNA 4MW0A 3G6WA 5T4EA 2A2ZA 4TLBA 3SEAA 2EJUA 3FZEA 3B89A 2ZCJA 1Q1QA 4NSNA 5ECDA 5IW8A 3SM9A 1XRSB 3OU2A 2GXUA 1R8QA 3T15A 4F5ZA 3KZCA 4NFHA 1OBVA 2COKA 3OZRA 4W8HA 2VC2B 2WVHA 3R75A 4RLSA 2WZCA 1J06A 3TZQA 1U8EA 3NKVA 3L2OB 3O4IA 1OASA 3U9LA 1IZ7A 1MPXA 4Y9TA 4C5BA 5B4VA 3M83A 1MU0A 3NZEA 5PGMA 1IUNA 4EVRA 5L4NA 4OJTA 4KFCA 4TLLB 3TVDA 2GHIA 5BVHA 4CL8A 1OLUA 4AWAA 3Q8LA 5BYKA 5G1OA 3RYHA 3ZCQA 2BBOA 4B3XA 1QF9A 2HRBA 1XMOB 2BV3A 3LX4A 3ZZ1A 2QD5A 3NV7A 4JLDA 1UPFA 4JVLA 4MUMA 2C7RA 3WZ2A 3ORRA 4FGZA 3KJNA 1KC3A 1BHQ1 4YDQA 3G49A 4PFKA 3ZY5A 2AW3A 2PDAA 3RVKA 4DG9A 1DEKA 4OHCA 4RYDA 3GP8A 5LR6A 4RMGA 4G5XA 1Z4LA 4RE6A 2NVOA 1PHRA 3NRBA 2XBUA 2ZRQA 3OFJA 1PUIA 4LXQA 2FPPA 3CLSC 5HCUA 2QRLA 1KR5A 4CM7A 2XYGA 3S8MA 1J90A 2HYIC 4PSVA 5D3ZA 5LQSA 1W44A 2NZJA 3QOYA 1SUIA 2PRIA 4JKOA 3RVQA 1UPAA 1WOMA 4RH1A 4LXGA 2XADA 2EKDA 2AZMA 1Q95A 1Q7RA 5K4GA 2GYYA 1RKXA 1SOAA 3KQYA 2UVPA 4OQEA 1PRYA 1JDBB 1ZS9A 1WW8A 1I0LA 2IYXA 3T0IA 2MYNA 1QYWA 4OJMX 3OZEA 3WWZA 5MDHA 1O96B 1B3BA 1JJFA 1YR1A 4RPGA 4CM8B 1HX7A 1CP2A 1UMCA 1XHEA 3MAJA 3MMNA 3AM1A 5CM8B 4OHRA 4D0NA 5CA0F 2GDJA 5HSGA 3LNCA 5FWYB 1I4LD 2XLCA 3GGJA 1FUKA 3G2KA 4R9UC 4YDHB 3RTAA 3ZNOA 1MMFB 4F4HA 9LDBA 2H08A 3S4YA 2MSEB 2FE1A 2JCXA 3GFVA 1QDEA 4CMBA 1O5IA 1XXHB 2Q4RA 1NW5A 1QM5A 1XP5A 2MSCB 3NTRA 1H2FA 5KYUB 2NIPA 4MAFA 1T3SA 1YDFA 2HTEA 2WFMA 1QKKA 3AVQA 4FOLA 2X8JA 1BKYA 2BBSA 2PWAA 1SQGA 1JLMA 1V71A 3CNOA 2QM8A 3U3XA 3LHKA 4AUMA 1JEJA 1MIHA 4DG5A 1YULA 3JWJA 5DN6A 3AI7A 3OCCA 4EKDA 1Y48E 2ZIGA 3O2SB 2PZLA 3DFKA 1P2TA 3U4QA 4YWHA 1KDYA 3BIOA 4F4DA 1F6WA 3S2FA 5IC4A 3L7CA 4KDCA 4X61A 1RQ2A 4RSGA 2OFPA 5JSZA 2RONA 5L7YA 2UZ4A 2OAGA 1NDQA 1R6VA 2V54A 2J0UA 1R0LA 1D9XA 3HDTA 3IVGA 4Q3AA 1L5ZA 1V43A 3E03A 3D4OA 1T0UA 3PXGA 4D9KA 3PEWA 4DRYA 3G9XA 5DLQC 5DRYA 2VP2A 2JFOA 1E3JA 3K0CC 1Y4SA 4DANA 3O4RA 5E2IA 3ZU4A 4LHYA 5K8LA 1PK8A 3IHLA 4LS3A 4AYTA 1HEIA 4DIFA 1N6KA 5FAXA 1FTQA 1DX9A 1MG0A 3GEHA 4X95A 5L8VA 4K28A 4I4TF 3A31A 4HX5A 1AGPA 3UGQA 1GDTA 4EBBA 3MLAA 1QNLA 1PN3A 1QYCA 2VA9A 4L73A 3TMAA 3SOZA 3D7NA 2NGRA 4Z54A 3W34A 3EZXA 4J7AA 3BH7A 4KFSA 5ALVA 2FEWB 2YICA 3O6VA 4CIXA 4MMZB 4H1VA 1YC5A 2QENA 2PUHA 4J1SA 1ECBA 2O5EA 1HSZA 5K0JA 2A1TS 2IZ7A 2XBMA 3TN7A 4X8LA 1K2VN 2VJCA 1ZIOA 4G9BA 5I4CA 3QX3A 4MIOA 3EDQA 4JOQA 4C2AA 4N9QA 1WXFA 1G3QA 2NPIA 2V6GA 3VI3B 2P2YA 4ZDWA 3Q3CA 4B33A 1SBYA 3ECCA 3OHPA 4E88A 3VKVA 1IM2A 2BGUA 3R9WA 3MINB 2H0RA 3OLWA 4MS1A 3C48A 3DG9A 5I7VA 4NENA 4WZAA 4IJQA 2JK0A 2F48A 3BXEA 4PG6A 5B12A 4FFVA 4YIKA 3IESA 4HGNA 3RVSA 5JEEA 3AHEA 5FLYA 1K6EA 3SPXA 2IOHA 2RJNA 4IHKA 1AZSC 3PXEA 5J40A 3F4LA 2WYOA 3BRWA 3DF7A 3I37X 4MX8A 5T64A 2X77A 1M0WA 1BA2A 2ADOA 4DIUA 2Q62A 3LFHA 5GM1A 3G0DA 4NPHA 4BO1A 2QN1A 1EDEA 1YCDA 4IIJF 1SC6A 1TAQA 1YQEA 4N5MA 4OFXA 3GLQA 2RGNC 1G20A 2E6UX 3L8MA 4ENPA 1V4VA 3JD4A 4R1SA 3W7AA 3QFRA 4RMIA 4O29A 1TAGA 4YJHB 2IOYA 4XLLA 1S6YA 4UEJA 4ZXFA 1O6CA 3AI3A 2YWRA 5AUPB 4X41A 3MGKA 2H4HA 3H9UA 3EWNA 5FPTA 1JDUA 4IL5A 4HLDA 5FBWB 3L43A 4B3FX 3OQOA 2JCBA 1YQWA 3BWBA 4JA2A 2JBWA 1FU4A 4G1CA 1K27A 4G5GA 5D8DA 5DTJA 3LDGA 1PGPA 2BMAA 2C8VA 2Y71A 3M1YA 3O9ZA 5DBEX 1LK7A 1TQ8A 3K0FA 1XZLA 5EJEA 4MJ3A 4R8RA 3AEKA 3IE1A 3RSLA 1QF6A 4JI4B 2CXXA 4I6GA 1H2EA 1CF9A 4M0EA 5CM2Z 4X6XA 1D07A 3AUTA 4EL0A 5JYEA 3DBRB 4KX5A 3RYHB 1GA1A 3B8EA 1WNTA 3RR2A 5HIMA 5CVTA 3OEHA 1ONOA 2P0EA 1N2HA 1DI0A 1XC7A 3BFXA 3B9RA 2JVIA 4LMPA 1GSIA 4ZI7B 1QORA 4YT5A 4JT9A 2VDRB 1CK4A 1TYEB 1V25A 3HEBA 5HFAA 3W4IA 1K8YB 3ZE6A 1KBQA 2JLUA 1U63A 3KFXA 4ZJZA 5HKOA 1U2ZA 2ZPTX 4N18A 2HMWA 3ASYA 3TE7A 5AVQA 3IDZA 4O08A 3HFJA 1PWZA 4PINA 3VR6H 4B34A 5KX5A 4D2IA 4YQZA 4MJXA 4RHCA 2WDZA 1QF7A 3PUHA 1G8FA 2EVWX 1NJ8A 2BIFA 3KJEA 2NMVA 3FDFA 2FRVA 2MTBA 4ID3A 5FHQA 4ZXPA 4YO8A 1T6ZA 2FQWA 3L0PA 4KGXA 3WSTA 3GFFA 2KB0A 3LRXA 4TMFA 1LBIA 5F51A 3W9SA 3CSUA 2H9IA 4Y2QA 1B14A 2I4TA 3MXOA 2IYWA 1JQEA 3EXEA 2AOUA 2XTAA 2ZVQX 2XUGA 3I39X 3L8DA 4UHCA 4DGSA 2P91A 5K03A 4U6NA 3RKSA 4NOLA 2G5CA 2QYTA 1YZHA 1GKYA 5EIBC 3ZZUA 2ZBVA 3K4HA 2JVJA 3EOBI 3HBLA 1ZVMA 1Z0JA 4DDTA 1C7JA 3I2GA 4JB3A 5GONB 1OI4A 1YDGA 2VJAA 3JD1A 4MI1A 2BZ1A 3ESXA 4BZWA 2OCKA 2ZBEA 5BOVA 3W77A 3OC6A 2ZIVB 1TJ3A 2WSIA 4HH0A 3GN2A 3RSHA 3TE6A 1ZN8A 3LPDA 2YS6A 3F5MA 2X0FA 5KAMA 2Q7DA 3WKBA 5I8WA 3LDHA 3SWWA 3GLRA 1M6WA 1FTYA 2G9NA 3VZSA 1XZGA 4AKSA 2ECPA 1GTL1 1ZBDA 3QHPA 3QYAA 1T4GA 4JL5A 5ERYA 3VZPA 3VJRA 1KEPA 2OESA 4BQNA 5A3SA 5CA1B 4GQAA 4RCYA 3PX2A 4ARZA 4KNVA 4W9RA 3EWIA 4LFCB 5J2TF 1KZHA 4CLRB 2GR9A 1TB4A 4KR9A 3PJGA 1ZI6A 3IVCA 3SQXA 3OM8A 1VSBA 4PZAA 1FSFA 2PMKA 4HTFB 3LGAA 4C0JA 2OC9A 3IURA 2KPOA 3PT5A 4IXNA 1PZHA 1RACA 2GHRA 4JQYA 5ALPA 2E5WA 4XUEA 3AKCA 1XQWA 5HGJA 4BNDA 3G5TA 4OUKX 5DWDA 2I2CA 3K9NA 5FL7D 3MMSA 4YV7A 5AYVA 2O5RA 2ZGVA 4F2DA 3E18A 1FU8A 1T3HA 2OZPA 4H3VA 5EKTA 4TWIA 4JELA 2TYSB 2QROA 4P32A 3REGA 4CCYB 3FVWA 1IYZA 3PQ2A 4JP2A 5CB6A 3BC1A 4GBED 3UA4A 3EFOA 3L8FA 4HWGA 3S7ZA 1B8OA 2EZ4A 3U4HA 4HZUB 2OCDA 4QOFA 4W1QA 1E2FA 3BF8A 2CJWB 3I9OA 1ADCA 3M6AA 4ZPJA 3D4LA 3S2GA 4PGHA 1NVEA 2F9LA 3BXZA 4XGKA 2ZDHA 3GRVA 3D6MA 2ZM6B 1K3TA 5JJLA 4PHCA 2IU6A 3VNBA 2ASEA 4K3VA 2G40A 4QG3A 1Y1QA 2I62A 4ND3A 4HJRA 2CBGA 4AK9A 5IVHA 3H4VA 1HZZC 1KIAA 1NRJB 2ORVA 2XYVA 3HCDA 4GKAA 3RVJA 4DR1B 3CPJB 5CNKA 3D6VA 3S99A 1ZCAA 2I29A 4BN4A 3DAGA 4F6CA 2JBAA 2B37A 3ICWA 2C00A 4DCGA 2PBFA 2H9AA 2QSJA 1RI2A 2CY0A 3QYJA 1DFGA 1VCMA 1GUYA 1MKYA 1IOVA 2C8JA 2EP8A 1VCNA 4QJ3A 2N1MA 5AKJA 4INZA 5JS8A 2BFOA 3C41J 5BR7A 1VSUA 3U1VA 4HZIA 2YRFA 1M7BA 4JUDX 4D8VA 1P4SA 4TGLA 3FI9A 4RKEA 2F2TA 4AJ1A 2V7VA 4BXOA 1L5FA 1SVLA 2GH1A 3QE3A 4JD5A 4LVNA 3IQIX 4FXOA 4O4IA 3VR5D 1QPGA 3ITDA 1U7WA 4B17A 1ORWA 3FTEA 5FPQA 2WZQA 1J0AA 2B7BA 3LC1O 3B70A 1QWSA 1L5RA 3I53A 3SQWA 3RVOA 3PCTA 4M99A 4ZVMA 3R7SA 4F0JA 1ETUA 2XH8A 4F4UA 1UMDA 2AR7A 1RHMA 3MCAA 3WK8A 3OZWA 3ZQUA 3REFA 3ZQ4A 2ZZNA 1QTIA 3RK4A 4G0MA 2QVBA 2H5JA 4CMAA 1KOFA 1PHPA 4R40A 5EHNA 3EXAA 2N75A 1C0IA 3D59A 5BORA 5JJ5A 1L6IA 4YJ2A 3FB4A 2OVFA 4V0ME 3FUXA 4JENA 1GOTA 3TB6A 5KOHA 1Z0ZA 2HMTA 1NOJA 1HM5A 3HJBA 3NTXA 1L7BA 2CF6A 4PCUA 1QIJA 1U0TA 4OMDA 1E1QD 1TO1E 4GXTA 4E2YA 4B2IA 3BRQA 4BQRA 3FZQA 1DLIA 4JA0A 4P81A 5ALYA 5DSTA 3P9CA 4J0FA 5GQSA 5TGTA 1RI5A 2QPOA 2B1QA 2ZKLA 4OI4A 4XJSA 5JQGB 1DC5A 4F72A 3TQQA 3TZKA 2OQVA 4X8MA 5EHXA 2IYTA 4ZAVA 5I5GA 5JFOA 5K3BA 4HDKA 2BGNA 5FFFA 2ZJ4A 1J49A 2PGOA 2P2LA 3H5OA 4LBZA 3ZD8A 5CB4B 2AFIE 5LUAA 1ZZEA 2ZJ7A 4E5KA 3Q2KA 2BGLA 2J5BA 1VMDA 4XVRA 3OCYA 1JHVA 2O4UX 4EO4A 1VL5A 3CCBA 1P4HA 3K9WA 4O59O 3RPEA 3U4AA 2P27A 5FORA 1JPNA 4YH1A 5AW4A 3FE2A 2WYHA 2ZS9A 4ZVVA 3HHEA 3U13A 3CPEA 1EFRD 3GLGA 1WP4A 5ITWA 2W6CX 1SKYB 2JS7A 1I2CA 1U2PA 4N5LA 1IPHA 4NCNA 2YXBA 3O7MA 5G0TA 1VG0B 3N28A 4IRXA 3UENA 1T1EA 2P7IA 1HT1E 2Q1WA 4XARA 2RHRA 2YH2A 2ZT6A 4ZFNA 3G2PA 4D46A 4AY5A 2EAUA 3LT2A 1YGYA 4DYVA 5DP1A 1EXVA 4HZGA 3LKVA 3CUVA 1ZMBA 3DNMA 1Q0HA 4ZCSA 3WIOA 1HT3A 4CPDA 3R3XA 4QLAA 4JYCA 3V4RA 2Q07A 3RFCA 1H65A 3D7KA 3O4JA 3VJKA 2Q3LA 4TKUA 1BE1A 4BVFA 2VFAA 1Q12A 4CF3A 2C83A 1U98A 1X1SA 1ZXXA 1UC8A 1V8OA 2BCJQ 1M8PA 1V45E 1IJEA 4FFSA 4LYJA 3RHTA 1HURA 4Y67A 4L4ZA 1QO0D 3KPUA 1EVYA 4EJMA 3DS8A 5ALEA 3ZBTA 2OAQ1 3RC2A 1DX6A 4HWKA 2W2MA 3UQZA 4DS3A 1ZW6A 3ANSA 3P2JA 4PSDA 4UEWA 3A70A 2X8BA 4NG4A 5LYYA 4BNLA 4TKVB 1KQOA 2ZTLA 3OE1A 3QA3E 4ZC8A 2BEUB 3IP9A 3EG9B 1KGSA 2BFFA 3IERA 4D97A 5DCWA 2ZTMA 3FYCA 1FSSA 2FQ1A 4YRTA 2QE6A 1YIAA 2AXNA 4D80A 3KWLA 4I36A 4L4SA 3K4PA 1M2FA 3C39A 2PYZA 5CRIA 8MHTA 4BNFA 1JEOA 1T43A 5GZ1A 1EK5A 2BM8A 3OX2A 4ER0A 3G7SA 3QPBA 4ED9A 4L8LA 4XYEA 2APJA 4RHUA 1AG9A 4WCDA 5E6RA 3WSVA 3BIXA 3COYA 4Q3BA 4QLBA 4PEVA 5AUQA 4BKMA 2WIDA 2AD5A 3HLKA 3TRJA 3KPYA 2BUBA 1V8ZA 3NAGA 3OY2A 4C3OB 3CA8A 5SYAA 3JPWA 4LPKA 2OPBA 3VTZA 3HSKA 2ONCA 5F33A 3HGTA 4BX0A 1N25A 3ZK8A 1JQBA 2B0CA 3A3KA 3NM4A 3LXMA 2R8RA 3R3JA 4TVOA 3U3MA 3UK1A 3W5SA 3WL4A 5DGDA 5REQA 2CNNA 4EG1A 4B75A 2FA9A 3O9MA 4M0FA 1KY2A 1H6DA 3HYTA 3K16A 1SXJA 1CVRA 2YWHA 2XXAA 4FMBB 1DC8A 2BEUA 5ARBA 1ADJA 4GMDA 4I3GA 4PRYA 5NULA 2O3JA 4QAJA 2ZSBA 3J7TA 3FYUC 3UWDA 4R1LA 4KIWA 3M6MD 5BN1A 5C1DA 3WLNA 1RE1A 3KL2A 4FEAA 2QTBA 4WWHA 1A88A 5LPNA 4DJAA 3WNBA 4G1UC 2AR9A 1V8FA 3MMPA 4XUDA 2IYNA 3PGLA 2OG1A 2QNBA 2W00A 4AI6A 5K6RA 3FB1A 1P9LA 4AS1A 1CNFA 1YZKA 4H31A 2IVFA 2VHJA 4IHJF 2IA5A 2VT7A 3D3KA 3G5AA 5EWMB 4WXPA 1R0RE 2B3TA 5AI8A 2IW1A 2G76A 4HN9A 5E1OA 2FWJA 5LP6A 3HS3A 4IH4A 4DLVA 1TEVA 5LBUA 4I19A 1DBQA 4IR7A 1WSAA 3FMVA 1DKQA 3H42B 1PW5A 1JG3A 2NQ8A 1E2EA 2W2PA 4RF3A 4YMWA 1GQSA 3A6LA 3OU7A 3GA0A 2ZP1A 3VO9A 5K1ZA 2DFDA 3LX6A 2XUDA 4A6EA 1XZPA 2BL4A 2C58A 1CUUA 3AEXA 2PKYX 1I3CA 3O2NA 4B8WA 2O7RA 1C9JA 3IPXA 5BR1A 5FDFA 2Q1YA 3K8QA 4KAAA 1WCIA 3BILA 3M3PA 4D4JA 1EUCB 1UDCA 2BR4A 5BQXA 2JK1A 4BX8A 1K7XB 1DU4A 2Y66A 1MZVA 4IQ4A 1BXRB 1DJNA 3GPBA 3DKKA 3P96A 4YACA 1R15A 2O2CA 1CUAA 2AMVA 1RYYA 2JIMA 3BE5A 4TZTA 3LM8A 2PO5A 1VKNA 3A3PA 3WLRA 2OL4A 1NVDA 1QOZA 3T4PA 3WV5A 4C4ZA 4FP9A 2OXTA 2CB0A 2WFAA 1X8XA 2A0YA 3LHSA 4FGWA 5CDSA 3AHFA 1P2GA 2YYYA 1RHUA 1F8FA 1OWLA 1ST3A 2BSXA 4AT1A 1Z0IA 4FEEA 5DGXA 3REOA 1BDBA 4KVZA 4EJFA 3CLTD 4UDNA 1PX0A 3CCFA 1ZGHA 1NXXA 2WR8A 1MO2A 1PZMA 1JHYA 1KBZA 4RA6B 4XI9A 3CLUD 3FKQA 2HCJB 4JI0B 1Z28A 4P3KA 2QX7A 1QHHB 2KBFA 1O97D 4TV9F 2XCQA 4ODIA 4CM4A 4C06A 2IHKA 1OV4A 4YPVA 3EEOA 3PC3A 4RSRA 5D3KA 5FOXA 1RU3A 4CM6A 1HKUA 2BDEA 1TVMA 3BAFA 3EIFA 4B6FA 3DZFA 4UM8B 5FL3A 4BCDA 2YXNA 1VCOA 2CLOB 4I1UA 1XZNA 4ZCIA 3GEPA 5U4XA 2YY7A 3PIDA 3VPSA 4AZTA 4HYYA 2EW8A 1SUWA 3L18A 2EJVA 1SKBA 3EQZA 1ZBQA 1T2CA 1WHTA 3EGDA 4FZ5A 4TN1A 4FYVA 2BVNA 4PIVA 4YYZA 5IDWA 2I4OA 2WJJA 4YXWD 1YIOA 2V7QD 5CFZA 4EA7A 3GBSA 3QYPA 5FOSA 5T6BA 5A0VA 3MERA 4GC9A 4K9PA 1RMTA 1FDIA 4GT1A 2X58A 1I8TA 3KR1A 1Z62A 1WUIS 4KRXA 3ELYA 4M6WA 4URZR 1UBOS 3X1JA 1WCWA 2VJDA 2V7UA 4BYMA 2JFWA 3AHCA 3ZEIA 1A9YA 1PD0A 1CZOA 1P31A 2FEOA 5L40A 4X85A 1HOTA 4PCLA 1D1PA 2DGDA 2W4MA 1J6UA 1DBRA 1JZTA 4CTNA 3VPGA 5FTKA 2OO5C 1UT8A 3W8FA 3QX9A 4V0NA 3TEFA 4C2BA 4EGQA 1P1CA 4TWZA 5BUCA 4G25A 3WGGA 1TTQB 2YMPA 5KPDA 2BHLA 2GMWA 1DCFA 1J8MF 1NM5A 1GPWB 1W4CA 5HJ2A 1BKDR 3HJRA 4BVLA 4E3ZA 4GSYA 4Z1OA 1XGKA 2XB9A 4GPAA 4KIUA 5AJTA 5A0FA 1ECLA 4QFCA 2VH1A 1JE1A 3EYAA 3MTBA 4NV1A 1LGYA 2BUCA 5BUSA 4R8VA 4HLNA 2VRWA 3DDWA 1N2OA 3EHEA 1MR3F 4M7OA 2H2WA 3PFWO 2FRDC 5J2UB 1K63A 2E89A 1KJWA 2HQSA 1QO7A 3HN6A 3M3DA 1IHOA 2VDJA 3LUHA 3RUDA 3WA7A 2NZ2A 3KM0A 2EG9A 3D0KA 1JB1A 3FCEA 4X9XA 4EY8A 4YX9A 4NOKA 2R11A 2AJBA 3IR6A 3V3KA 3C7DB 3W7BA 3FDJA 3QPVA 4BEVA 2GZMA 1WABA 2W11A 1ZJZA 1HH4A 3ESZA 3EZ6A 3B60A 4RQUA 3JRXA 5DEIA 3K7EA 3JAKA 3AI1A 4RA9B 1WTAA 3E6AA 3R3ZA 1SOUA 2IHVA 4TLCA 4GSKA 1EMDA 3JU3A 3LC2O 3LECA 1XMSA 3NWPA 2M1ZA 4KITB 1THTA 3IUSA 4IOMA 1E64A 1BC5A 3R9IA 4LNUA 4QGSA 1YACA 2IIVA 4Y9DA 2PV0A 1YZQA 3U7EB 4XD2A 4JC8A 3ET5A 4C9BA 4MS3B 3VUFA 5CX4A 1QX3A 3ETCA 2AMLA 1XCLA 4HATA 2F1JA 3MTIA 3K1JA 2ZPUA 1NONA 4MR9B 2GZHA 3K72B 3OZTA 5DEOA 3WGMA 3EPHA 1MX5A 4BRWA 4JI6B 3P2OA 2QS9A 4M9ZA 1RCUA 1Q5PA 1NTRA 2HWUA 5BXYA 4GECA 5LYJF 4HDNA 3RGGA 1OC4A 4KNWA 4I81A 4DSUA 3HV0A 3T5TA 1UFQA 5CYOA 2PUEA 3K8OE 2ZAGA 5K4HA 1A9PA 3A9TA 1A96A 5H82A 4PYKA 3PEEA 5T5QA 3BMQB 1AV7A 3AG6A 2AGVA 4KQ1A 1ZU4A 1XD8A 3EQ7A 4UVGA 3OD5A 2ASVA 4ISCA 4TTSA 4UUOA 3RS8A 4LFAB 3C5WP 7AT1A 1AS3A 2FFAA 3JYOA 4LTDA 1OZHA 3DDHA 2FG7C 2PV7A 2HU8A 4IDGA 4LRUA 4RA9A 2VBGA 4CLOB 1UWCA 4AW9A 5ERXA 4UKDA 4QULA 1EK1A 3FM9A 1DRKA 4JUAA 1KEEA 1DARA 4R71A 2DUJA 3DHNA 4QTXA 3I8SA 2YOHA 2CKMA 3ZQ6A 3EPKA 1GGMA 2G83A 4E70A 1VXOA 1ZFNA 4PZLA 2Z2YA 4HYQA 1D6NA 2JFGA 5EQJB 3ZXUB 3IIKA 4HDQB 3HCNA 2X41A 3K1ZA 1FMLA 4M87A 3LSTA 3RU7A 1L4GA 1DRVA 2YHSA 3QE4A 5HF9A 2WTXA 2HBQA 1BS9A 4NEQA 5FFMA 1JG1A 2O8FB 4C7KA 1YB5A 2IZZA 2Q4TA 3AZOA 3E7WA 3OG9A 3ZVLA 4IIFA 4Y7DA 1KRHA 3IOEA 2ENUA 3TGLA 1EXDA 3EYWA 1D2CA 1WHTB 4K46A 4NY1A 3ROEA 4E5NA 3ABRB 1TD1A 1TA4A 2F55A 3KJXA 2ONKA 2HA4A 3KJQA 3NDJA 4DWJA 5HZMA 4EG5A 1Z2AA 3ZDRA 2XUAA 2GCNA 5D3QA 2QEQA 2IDJA 3C87A 3T41A 1TVKA 4F96A 4LBWA 3HKBB 2BAGA 1HFJA 4G4JA 4MARA 2DPGA 5EJ7A 1KP9A 2G80A 3PXCX 1YZ3A 4D43A 4RGVA 3DHVA 1Z4IA 1K8QA 5AVYA 1COZA 3HY6A 2ID7A 2M9MA 1KSHA 1T9KA 2V96A 3LUCA 1K9SA 5B64A 1NQTA 2EX4A 3PJDA 4H3KB 2R2GA 5I9NA 2REXB 5F2OA 4IO0A 3VM6A 1L7XA 2IW3A 4O4LF 4KQWA 2AQIA 5FCDA 4LYFA 2EJBA 2BKXA 5THQA 2OK8A 3UOGA 1DB3A 4Y2TA 3OKFA 3N8HA 3FPGA 2SICE 1XNGA 1V48A 3C15C 1ZM3A 3M9WA 3D6TB 4WNIA 2DP4E 1XRNA 3SX4A 2R44A 3D5TA 3P0IA 3TH5A 4C4XA 2A5DA 4P5DA 3CIOA 4FMCF 1S1CA 3LUBA 2PSJA 3DLPX 1LFAA 3BBPA 3PUWA 3VNQA 1UP6A 2GCOA 1WU7A 5FEUA 3D2AA 4MQ6A 4DC1A 1UFVA 2FGJA 4C4YA 3PC4A 4FCWA 1E7QA 2AE2A 3HXKA 4RY8A 3IAXA 3P0JA 3OU6A 2P5TB 1T4CB 3C98A 5ALJA 4B4WA 1MIOB 2YJ3A 3OOYA 1U9IC 3Q6MA 4KEAA 3UK7A 3WMRA 2E85A 3SE0A 4DMFA 2DLCX 1Y7LA 1E2BA 4LGCA 3USZA 2FZVA 2VYCA 2RFLA 1H6CA 3RSQA 3CGGA 1Y33E 1BOFA 4IOLA 4IZHA 1KEZA 1YU6A 4MVYA 4YJFA 3W04A 2EF0A 4HLUC 4MRNA 3QLUC 2H4FA 4K9KA 3RSFA 4IZ6A 1P29A 5GY7A 2WPDA 1TTPB 4Q12A 3DTYA 4NU0A 4QU5A 3FH0A 4LVUA 2UV8A 4HUJA 1W2WB 3N70A 4ZCTA 5JWOA 1BE0A 2WA1A 1IIBA 4Y8VA 1GP2A 1M2GA 5K9ZA 3DMNA 1IBMB 1I51A 1IG0A 3JQFC 4I4NA 2Z5FA 5FT9A 1ECCA 5JD4A 1RHQA 1EFRA 1NJ2A 3A1FA 2ALJA 3T7RA 4FDVA 3KO8A 1RRKA 4NF2A 2PGLA 3AJ9A 2GBGA 1EP2B 4FONA 3VMFA 2QN3A 4BEBA 4EJ0A 3K30A 4HMPA 1Q6ZA 3TNLA 5CPFA 4DMLA 5JZSA 3CKYA 3P4YA 2O6LA 4MVJE 1BD3A 1DELA 3PX7A 3D4BA 4KFUA 4D42A 2Q0XA 3ELUA 4AP5A 3LWZA 4ZEOA 2PU7A 4DV3B 3A2NA 3AGPA 3GWZA 3ZK7A 1PNRA 3A3OA 2JLWA 2IXFA 1XB2A 1VL2A 4IMJB 4DSTA 4RDIA 1TOAA 3IAUA 5BPHA 1JG4A 1PK7A 3EIQA 3WL6A 1GAXA 3RRJA 3H9CA 5IJWA 2ADFA 4GMGA 2HJ9A 2GWRA 2C88A 1QTQA 2J5RA 3PNKA 3L6EA 4B2PA 4ECEA 5L3SA 1C4KA 3P9KA 2C98A 3BWVA 4GMHA 4EVSA 5EKDA 4TUYB 1O0BA 3PZBA 2OB2A 1T9DA 5JTTA 2FZKA 3B53X 2FP3A 1FUYB 2IDMA 3BL6A 4IJWA 4NJMB 3RS2A 1TYAE 4WZAE 5KMGB 1I24A 2PTHA 4GOMD 1IEWA 3T7JA 4BMCA 3A1TA 3B38A 2C99A 1ESMA 4MQEB 4TM7A 4YJDA 1SOVA 3T3EA 1CLUA 2C9ZA 3OCWA 3E22B 1SQFA 4MZXA 1X7WA 1CE8A 4IQFA 3RARA 1GL7A 1KYZA 3LW8A 3DNPA 1OFHA 2QSZA 4X63A 1EDZA 5LIRA 1N6OA 4I55A 2VDWB 2I5PO 4FDLA 1VBMA 1F2TA 4PWZA 4XM2A 3QA9A 1P0FA 2IYAA 1E7SA 2R5WA 2PGAA 3G2QA 3FWZA 4WKNA 3A6GA 1E6MA 1KORA 4M88A 2E37A 5UKDA 1N5MA 3EEFA 5DX0A 1O94D 3AP3A 1L8QA 4KPGA 3K35A 3THXB 3HUTA 3QELA 2NW6A 3D7SA 3KQUA 3HB0A 2QLNA 1UJ5A 1IATA 1UFRA 1UADA 2W48A 1DOHA 1GPYA 1YASA 5JECA 3PD1A 3AR8A 2A9PA 521PA 2YVLA 2CYCA 1Y1PA 3V42A 3ZOKA 4YK7A 2PANA 3CMCO 1HV8A 3CH5A 1Q20A 4IIEA 3IAAA 2ONJA 5FWXA 1W5FA 2EBHX 2ZYAA 3K09C 4KLAA 1Y9AA 2QT0A 1SURA 5DBHX 5GZ3A 3UJNA 3B8HA 5T41A 5DI3B 4CETA 2FN3A 3PDHA 4ZVNA 4CN9A 3UPTA 2F1IA 4HO1X 3HXTA 2GNOA 2GRUA 4DQKA 2IP2A 3G9UA 3MZ0A 2YJNA 5EC8A 2HPZA 4B4DA 3EHDA 3Q1LA 4OB6A 3GUHA 1RWWA 4Y6PA 3SM3A 1W36D 4CT5A 3QPCA 1I6KA 1P2FA 2C1ZA 3D4IA 1NX6A 2B99A 2JAPA 2BT4A 1UXHA 1T2DA 1UJ4A 3EZLA 1I1NA 3S2UA 5A5FA 2IBMA 4Q4DA 3OQIB 4LRWA 4MITA 2OE2A 5DXAA 5CAEA 1JU3A 3OSZA 1U9IA 4WKBA 1NNUA 2R0QC 3M5WA 1EDDA 1JR3D 2C5FA 4E6EA 2UVPB 4FHGA 1B00A 1E2GA 3LD9A 5TSDA 4FX5A 3TW4A 5FL7A 3G8AA 2ZJ0A 3GUYA 1UIMA 3MRSA 4BN5A 3U56A 5IKEA 3HCFA 4IXDA 4M89A 1T36A 4BCCA 1R10A 4XCVA 3GV0A 1I1HA 3R23A 4QPZA 3DOUA 3KZKA 4AKGA 1R9NA 1V4NA 1TNDA 4MYUA 4RK4A 4MWZA 1K6MA 5EE5B 1JIVA 1D1TA 4E2XA 4TRNA 4RF4A 5JY6A 3D8RA 4BP1A 1I94B 1RQ7A 1R00A 1TIPA 4IMIB 1JLSA 3LIPA 4E1AA 2WW8A 1XLVA 2X5JO 3WLLA 1BMQA 2D3WA 4K03A 1VTKA 1XMXA 4DLNA 1KFJB 1UBUS 1CF2O 2QYHA 4FNGA 3W2TA 3WV4A 2JH3A 3Q3JB 4S1TA 4WEOA 4AG3A 5DM2A 4O6VA 4FR5A 4FGJA 3RAEC 2DR3A 2UYOA 2I67A 4JN6B 3W8NA 5BOSA 3RD5A 1ZR4A 1LBQA 4AULA 4G0PA 3O93A 4EA8A 5DBOA 2Z8YM 2YYSA 4KE8A 3ZWVA 8GPBA 4MCAA 4ZHQF 5F73A 4AJNA 1E9RA 2NACA 1J0EA 1S2GA 3H5LA 4MJ7A 1M0SA 1JI0A 2PYIA 1JHAA 1MO5A