3OLXA

Structural and functional effects of substitution at position t+1 in chey: cheya88s-bef3-mn complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTSEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Variable Active Site Residue Influences the Kinetics of Response Regulator Phosphorylation and Dephosphorylation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Chemotaxis protein CheY
total genus 44
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3olxA00
1QKKA 2M98A 5KQGA 3ROFA 1P6QA 1Z12A 2JRLA 4MS1A 2WY2D 2PLNA 3ILYA 3LUHA 3EGCA 3OLYA 5TQ2A 4YR7A 2MYPA 3KLOA 1U04A 3EAFA 3GRCA 1QP7A 1NXXA 1ZY2A 3CFYA 1WETA 3OMWA 3BREA 4N0PA 4JP1A 2GI4A 3IDOA 4RZSA 4MR8A 5TE9A 4FE4A 5IEJA 1LJUA 3LKBA 5B3JC 4MQFA 4M88A 4KQCA 1RZRA 1QP4A 4Z4IA 4LRQA 4KK3A 4ETMA 1ZH2A 1W25A 1GCGA 3S99A 1P8AA 4H3HB 3UUGA 3RVSA 4D6YA 5BR1A 3BRQA 1M5TA 3CHYA 2JCGA 4MQEA 3C3WA 3OLZA 3QX9A 3TX6A 4W5OA 1D2AA 1JH9A 1YK0A 3C6QA 4YV7A 3QX8A 6CHYA 4G0ZA 1CEYA 3Q7TA 2E4UA 4RY8A 3HO1A 3JPYA 3C97A 5T7BA 3NHMA 5EWMA 4O1IA 4EVSA 1PUXA 1TVMA 2YHBA 3RVKA 4RSMA 3HZHA 1H9CA 4Z4CA 3K4HA 1Z17A 1GLGA 2L17A 3A3KA 3GBVA 2NZUG 3QELA 4F12A 2FLWA 3EQZA 1JX6A 2FN9A 1E6LA 2AYZA 1EWKA 1LJLA 2FEPA 3QK7A 1U2PA 2E4YA 5JNSA 1ABFA 5EWMB 1GCAA 1TM2A 4Z9BA 2GBPA 4MYRA 3MYYA 2P9HA 2FMIA 3R0JA 3OQNA 1ZVVA 2PUCA 2R25B 4H60A 2RJNA 4TMYA 4UHKA 3Q41A 3HDGA 1M5UA 2E4XA 4MLDA 3FFXA 4NV3A 2WMYA 5TPWA 1URPA 4G0QA 2WWVD 5FWXB 4W5TA 4RKQA 1BDHA 3K9CA 4IILA 3CRNA 5KC9A 2B1JA 2NT3A 4W5NA 3VNBA 4Q6WA 4WXEA 2PL1A 4Z4HA 4Z4EA 2IOYA 4D6XA 4LE1A 1PHRA 3RQIA 3SAJA 4L4UA 5FBHA 4XAQA 2PUBA 2BGGA 1RXIA 1YMUA 2ZWMA 1B00A 3RVRA 2LBPA 3EJWA 4XFKA 1HEYA 1NXOA 4ETNA 3SG0A 1M2EA 1EAYA 2TMYA 1DJMA 1Z2DA 5IX8A 1Z26A 4S05A 1YTUA 1DCKA 2H0AA 4WT7A 1EHCA 1Z16A 3BRSA 3E61A 3GWGA 2A9QA 1E6KA 5JNVA 1YMVA 2WB4A 3HEBA 1PNRA 1U0SY 5IUNC 1P6UA 1VKRA 3OQOA 3KYJB 2WRZA 5HM6A 1VLZA 2OQRA 3CZCA 5JNWA 3LFTA 1NXSA 4Z4FA 3QEMB 1QMPA 4WXMA 3N0RA 4XASA 5DGCA 4DADA 4HNQA 2YHAA 4RKRA 1SRRA 2I6FA 4MQFB 4TLLB 4MPTA 4Y9TA 3UKJA 4MRMB 2HQRA 4LDZA 4RXUA 4EYGA 1NXWA 2GX6A 1APBA 1Z18A 2IDMA 5TPZD 2XDYA 4OATA 2FQXA 3O1IC 1YS7A 5IEBA 3SY8A 8ABPA 1GUBA 4F11A 3O75A 5F64A 3KSMA 4YLEA 5IUJC 3HVRA 1AB6A 3FFWA 2P4UA 5IUKC 2PKXA 4F8JA 2QVGA 3LTEA 3H5OA 3O1HB 4PE5B 3VNAA 2QU7A 3IP5A 2QXYA 3F6PA 4YS6A 5BRAA 3JY6A 1NATA 4P1ZA 5HQJA 2MYNA 4F3TA 2WJWA 4KZKA 1A0OA 2FEWB 5DKFA 1JLKA 1U8TA 1ISSA 1DCFA 1XWWA 3TD9A 4KV7A 1NXVA 2FQYA 3E3MA 4O1HA 1YVUA 2JVJA 1QPZA 5D2CA 2QV0A 3CG0A 3N53A 4G97A 3CTPA 4KMRA 2IPMA 1U2QA 4LDAA 1F51E 1ZH4A 1JHZA 1LBIA 3RVPA 1EFAA 5IC5A 1JFVA 2HSGA 3H6HA 4N47A 1ZAYA 3FDFA 1BAPA 1PEAA 1A2OA 1MAVA 4WUTA 1JFTA 3I45A 3CNBA 1CHNA 3Q7RA 1LK0A 4JB2A 2F8TA 3GBPA 4YRZA 5EWJB 1F4VA 1USKA 3TMYA 5JS1A 4PEVA 4RV5A 2LP4Y 3NNSA 3I42A 3JTEA 1NXTA 2WJAA 3IP9A 1TLFA 5KWSA 3BILA 3HUTA 1K66A 2H3HA 2IPAB 2L19A 2QR3A 3Q15C 1Z15A 4RK6A 4RS3A 4ML3A 5E3JA 4KFCA 3KCNA 3N8IA 3LUFA 3IPCA 4G0YA 1NXPA 2NZVG 3IPAA 4RXMA 1E2BA 2IKSA 3A10A 4JOQA 4S04A 1D5WA 1FQWA 2FQWA 4IRXA 1NY5A 4P98A 1JF8A 2N9UA 5TQ0A 4KREA 4MRMA 5FWYB 2R47A 3LKVA 3OLWA 3D8UA 3JPWA 1SXHA 4MS3A 4EYQA 4G0OA 4B09A 4N76A 3F6CA 1JDPA 1EWTA 3GA5A 2LIVA 4G0PA 5KQLA 2E4VA 1QP0A 1FFSA 4DQDA 2JBAB 3HDVA 5GOTA 1JL3A 1QNLA 4MR7A 5IBQA 2FKAA 4MR9B 2IYNA 1EWVA 2FSPA 2ID7A 1S8NA 1RZRD 2RDMA 3O2JA 4YO7A 2Q5CA 3LUCA 1BDIA 3FGZA 4MR8B 4DN6A 2M1ZA 3H5TA 4OTZA 3T6KA 3H5LA 4ZMSA 3HXMA 3H75A 4KK4A 4O5AA 4RK5A 4RK1A 3Q7SA 3GV0A 5TQ2B 4W5RA 3F7NA 4ETIA 4L85A 2QVCA 4MS1B 4N03A 4QYMA 3RVLA 5KQPA 3KKEA 4ZJPA 1SXGA 2PE5A 3MIZA 2E4ZA 4IF4A 5KC8A 4LE0A 1I3CA 2MSWA 3SM9A 4RXTA 4EVRA 2FVYA 3NBMA 4PICA 4JAVC 1D4ZA 1JFSA 2AYXA 1A04A 1JDNA 3RVJA 2JK1A 3L6UA 4W5QA 5T3YA 4Z99A 4EY3A 2NUBA 4KRFA 1MB3A 5ABPA 5KQMA 1OXKB 3LUJA 1YIOA 1Z13A 1FFGA 3KTOA 3OO0A 3QEKA 4KVFA 2W42A 1MVOA 4Q7EA 1ABEA 3KS9A 5JS2A 1ZGGA 4MQEB 2O20A 4KNYA 3LUDA 3RVNA 5B3JA 1DBQA 1XHFA 1DG9A 1RNLA 2L18A 1D1QA 1JYFA 3MMNA 2DRIA 3DLBA 1FSPA 4N0QA 2KYRA 2MYTA 4EYKA 1KGSA 2MYUA 2QZJA 1AB5A 2J48A 3HSYA 4EYOA 3OQMA 2PUDA 3MQ4A 3ILHA 2FEKA 4LX8A 5DLEA 3N0WA 1Y1LA 4RK4A 1M2FA 4EVQA 2CHEA 2FMFA 3M9WA 3ROTA 4Z4GA 5HSGA 3HUUA 4QICA 1PNTA 2VYCA 4UHJA 2NT4A 2V0NA 3H5IA 3LUAA 3CZ5A 2FN8A 1QO0A 3SNKA 3FMVA 2PUAA 2VUHB 3DZDA 1YK1A 3F73A 1L5ZA 3LUKA 4G0MA 2HQOA 3MM4A 4HYEA 1T34A 3CLKA 4JB0A 3H1GA 1RXEA 5JNUA 1KRXA 1NTRA 3FFTA 4RY9A 5CHYA 2CHFA 4MR7B 4QPJC 1ZGZA 4KPYA 3H5WA 1DCMA 4NICA 1ZHHA 3LMKA 1ISRA 1TMYA 4MS3B 3CG4A 2VUIB 1USGA 3T8YA 3N6VA 5DCLA 1CYEA 2PJUA 4IMJB 1QO0D 3OM0A 1DRKA 4IGAA 1BA2A 4ZPJA 2CWDA 4RWEA 2ID9A 5FWYA 1VRVA 2LPMA 4N41A 3QLTA 4GPAA 2JVKA 4NCAA 4RY0A 3JS5A 2RJOA 1JYEA 3GYBA 2OENG 3DGFC 1K68A 3A0RB 3C3MA 4PZ0A 1KRWA 2A9RA 2HQBA 3L49A 4D74A 3O1JC 2PUGA 4G0XA 3KYIB 2ZAYA 3HCWA 3KLNA 3QEMA 4LZLA 3TB6A 1Z25A 4EUKA 1ZDMA 3JVIA 2GWRA 2PAFA 1TJYA 2IPLA 4Q6BA 5BRJA 3OO1A 2FXIA 3IP7A 4E7PA 2A9OA 2CD7A 3C3KA 3OM1A 3RH0A 4QYWA 4PYRA 1L5YA 3SQNA 1LBHA 2JBAA 1MIHA 1VPWA 1R8JA 2L2QA 3KJXA 5TQJA 1D1PA 1E6MA 4XLTA 3T38A 3MA0A 2FLKA 4RK7A 2LUOA 2R48A 1OXBB 3N0XA 3QLUA 2X7XA 3UK0A 5BQ3A 1FFWA 3CU5A 5GQSA 3OLVA 3LUGA 4ZYLA 7ABPA 3B2NA 3Q9SA 5EWLA 4YGXB 4JA2A 1KMIY 3W9SA 2A9PA 1JWLA 2GKGA 3CS3A 3QLVA 5EWLB 1ZITA 4F06A 3RVQA 4KQ9A 1ZESA 2RGYA 1J56A 1RPJA 4HNSA 4OBBA 2FTKE 3EDCA 3QLVC 5ED4A 3EQ2A 9ABPA 3DLHA 2E4WA 4H3KB 2F8SA 2PMCA 4HNRA 1PEYA 3NHZA 4EGSA 4WWHA 2R4QA 6ABPA 3H1EA 1IIBA 3N75A 3DGEC 3G85A 4RK0A 4Z0NA 4CBVA 3EULA 3QLUC 3NNNA 1DC8A 2FW0A 2JB9A 5C5CA 2PUFA 3GL9A 3RVMA 4FE7A 5DTEA 5EWJA 1UDRA 4OG2A 3DBIA 4RDCA 1QQAA 3H1FA 1XHEA 2IPNA 2FMHA 3I5AA 5FBKA 4IMIB 4FB4A 5I4CA 2PUEA 4LE2A 1DP4A 4MLCA 3P9YA 1MB0A 2MSKA 2B4AA 3QELB 1GUDA 3I09A 3A0UA 3KG2A 5CNIA 4YWHA 3BBLA 4G86A 2HJ9A 1SXIA 1QQBA 1DBPA 5CNKA 4TN5A 3OLXA 1DZ3A 2HPHA 3O2QB 2JVIA 2QW1A 3LOPA 5TPWB 3TO5A 4YCSA 5C5EA 4GNRA 3H6GA 5TPZA 2PL9A 4E7OA 3CKMA 2VK2A 3IP6A 5PNTA 4OLAA 3OMXA 1C0EA 3NNDA 4RU1A 5CNMA 4Z9AA 4MR9A 5JNRA 3MF4A 4ZMRA 2MSLA 3GT7A 4JASB 1JBEA 5JNTA 3H5VA 5KI6A 3M6MD 3O74A 1DC7A 1DBWA 1Z2EA 1BVHA 4NCBA 1W9HA 4MS4B 3HM9A 4MGEA 2FMKA 3HS3A 1USIA 4OLBA 5HKOA 3O2SB 1YS6A 4TLMB 3D02A 3HK2A 1ZN2A 3URMA 3T95A 1BDJA 4MS4A 5TQ0B 3O21A 3G1WA 3HV2A 4YP9A 1SD5A 3EODA 1P2FA 1DRJA 3HJFA 3KHTA 3JVDA 4NQRA 3M9XA 5IULC 5FWXA 1C4WA 4MAAA 5CNJA 4WZZA 4XARA 3RVOA 4XXHA 2QSJA
chains in the Genus database with same CATH superfamily
5K8VA 4BVLA 4Q34A 1XZIA 5K20A 1I51A 4WJZA 1XD9A 2ERXA 4Q1AA 2JFHA 1BYUA 1WVMA 2R8OA 2G8LA 1BS9A 1BNCA 3V2UA 5AJYA 4UTZA 4DCTA 3U9SA 1WMEA 2PT7A 4ND8A 4Q4CA 2PWBA 1RLIA 4UAGA 5EIAA 2FWRA 4E46A 1XN4A 4O4LA 1T1GA 4R1MA 3AR6A 3DVQX 4YRBA 1S02A 4LOAA 1NBEA 3EVCA 3ZWCA 2M9MA 5LU8A 4GC5A 4EG8A 3IDOA 5TE9A 2XVYA 3UHJA 2NV0A 5SZJA 3M6IA 1LY1A 4BTVA 4NOKA 3GJQA 5IEJA 1V11B 2HKIA 4QGSA 2FPUA 2YWHA 2XXAB 1XEWY 3OX4A 4NCIA 4D8VA 4B3SB 3KKMA 3ZVLA 1TK2A 3LQ2A 2WZCA 2QRLA 5C46F 5EXDA 3CCFA 3TTVA 2XGMA 3HA2A 4OBWA 1QR2A 4PNEA 2EXXA 2WM2A 2I6QA 3ENQA 5GOZA 3BRQA 1UBRS 4DM3A 5JATA 3KPJA 1GM5A 9MHTA 1CUIA 1YB6A 5C3MA 4DLWA 3K5PA 5JE8A 5KQSA 1RZUA 1QOPB 4CVNA 1Z68A 4G41A 1JEQB 3EC7A 1X2BA 4LJ7A 3RVDA 4DV5B 4IGFA 5EP4A 3TFQA 4HWKA 4EG7A 5L9AA 4KPEC 1VJ5A 1EXDA 1EVLA 3FDXA 2ZUTA 5JRJA 2EWVA 5B3KA 1NU8A 2CB0A 3B3AA 3RAPR 3ANLA 5K8IA 1I5RA 3T9BA 3AERB 3BCHA 4Y2SA 2F3TA 5F5NA 2A4MA 1T3TA 5CLJA 3PFCA 3OPQA 2HAEA 3CB4A 2P5SA 3P71T 1PR4A 4PPNA 2HSJA 5DHQA 2BCEA 4YY3B 3FHJA 4HS9A 4NCJA 5TMBA 3R3WA 4ZVMA 3LDUA 1D2HA 2WYIA 1H2ZA 1ISPA 3H17A 1CY6A 3HV0A 3LQ1A 3UMBA 2AQHA 2B6NA 2P2NA 2D3TA 2FPMA 3CH7A 2CMKA 3B3JA 4YRFA 4GD3Q 5EY5B 3UC9A 3ETHA 4ITRC 2AOXA 5TPWA 4DL9A 4EI9A 1CUSA 4CKZA 1JBQA 4W5TA 4NU6A 4RKQA 4EHDA 4N3AA 1C0PA 4PQYA 3LPNA 5AKEA 5THXA 3VNQA 3M1LA 3A4YA 5H80A 4KPGA 1EFRA 4Q6WA 2PL1A 1MX3A 5E9JA 2PUVA 1WJGA 2K7FA 4LV8B 3ZWDA 1XNRB 2UZ1B 1W4AA 3O4IA 2LCQA 3SAJA 1M2OA 4L4UA 3K73O 3JQ7A 4QU5A 2PIAA 5F51A 4NCXA 5AW8A 1XTJA 1XQYA 2V5AA 4B0PA 1G8AA 1U3TA 2JIRA 1C8LA 4HB4A 4BU1A 5I8PA 5IM4A 4LJRA 3DD5A 4E5NA 3I9LA 1D9ZA 5IX8A 5HE8A 3P2YA 2JIOA 3V8RA 3AFNA 2C59A 3KYDB 3KZNA 4ZRNA 2DLNA 3QSGA 4N49A 4BNIA 2YY5A 4DSAA 5C8XA 4OYRA 2OCPA 2BEJA 1PRYA 2GCOA 2WB4A 3HN2A 2IUSA 3FH0A 2JFWA 1MVLA 2GFHA 3W06A 2OQ2A 3T9EA 4XVHA 3WLAA 5IMSA 2AEEA 2ZXUA 2LV8A 4TXHA 4C78A 4E1AA 1JG1A 5JEDA 4LS3A 4I66A 4AY3A 4QNMA 2XGGA 1Z18A 1FLDA 2IDMA 3SY8A 3KZOA 5ILGA 4WZBE 1FEZA 1R4NA 3GRAA 4JI6B 1G2OA 3REOA 3QFFA 1KK0A 4PGAA 5IUJC 3ZDFA 5CB8A 4JR1A 2OV4A 1K06A 2X5JO 4TLEA 1SVWA 3U1TA 2PWPA 3RHSA 4H35A 1A9YA 1VHJA 2QS9A 4F92B 2IVFA 1JAZA 2KBEA 3PGJA 4FM9A 2OHFA 3RWOA 4OMCA 4Z6KA 1SCJA 2PWAA 2OFWA 4MVJD 2VRCD 4ND3A 5ALNA 3VPGA 4GPIB 4TWRA 3T4EA 1KA9H 1U4OA 4WJLA 3DBHB 2V03A 2VDQB 4HTFB 4CUJA 5HOQA 4Z0PA 1J90A 1LNSA 1EINA 1XWWA 1XQXA 4ZVVA 3CF6R 4QELA 1X86B 2XECA 3E7XA 3GT0A 3H4VA 4XR9A 2FG6C 2X9GA 4MV3A 3V46A 5I7EA 5C53B 2I4OA 3K09C 2NTVA 1YHYA 4J0EA 1NN1A 5DT9A 2YHUA 4LDAA 4LWPA 2HFJA 3IAUA 2NYVA 2C61A 2DUJA 2A0UA 2G3YA 2WHQA 2O7SA 4ND4A 2BEUB 4S24A 3KJNA 1Z9BA 4LDNA 3NGXA 2KE5A 2UYQA 2UZ0A 1M9NA 1T1IA 3AONB 1Y7TA 3GGPA 4Q48A 2GDJA 1TM7E 1JMYA 4LXIA 1E4OA 1SNYA 3A6HA 4BV8A 4EBFA 1NWHA 2GPJA 3IR7A 4R8LA 3BZUA 1ZRHA 1CP2A 3Q7RA 2OGSA 4BKOA 5B64A 4ZCQA 2H17A 2AKYA 2B78A 2XNCA 4F5EA 2IXAA 2YN0A 4PW0A 5EEHA 3G5TA 1G16A 3CLRD 4MI3A 4AKIA 3EVFA 1KHTA 4WXYB 1I5EA 1OXSC 4ZZ1A 2HJRA 4WNAB 1EFUA 4V38A 3OCUA 5K3FB 5SZKB 3SLKA 2L19A 5C1IA 1N6LA 4KNVA 2QGFA 2J9XB 3EIFA 2JCXA 1CE8A 5LBIA 2XUHA 2PUTA 4MPPA 5J4VA 5C7LO 2OG1A 2HX1A 4DR3B 5L7YA 3FYUC 1K0FA 1UWVA 5FUYA 5H7XA 1E1NA 2YV5A 5IAAA 4RTQA 4OQ4A 3K0CC 2W2NA 2W2LD 2Z3ZA 1XRMA 1ZYUA 1W4ZA 1F8XA 2BIFA 2DP4E 1Y5LA 3B89A 4I50B 3R7SA 4EIWA 1W49A 4D9KA 1FNNA 2XQVA 4XH9B 1ZNQO 3W2TA 4FFOA 4UTXA 4RLQA 1JIQA 3AY6A 4BUJA 4N48A 1IMOA 4ON9A 3QXJA 4E5KA 4JKOA 1RKXA 2PKEA 3AR4A 3EXEB 2OCBA 4XIJA 1AA9A 4EY5A 4BQIA 5C52B 3CCBA 1NPDA 2Q8PA 3ILXA 1EX1A 2ZSIA 1JTFA 4ZEMA 5I7HA 1X3SA 4NENA 4MITA 3AEKB 3QKRB 3NHBA 2EV9A 5EOVA 1QZ3A 2FFJA 4E2WA 5FBZA 1WF6A 2GN6A 3NBKA 1KDYA 3FCOA 3EYAA 3LW8A 4B3RB 1A71A 4QYIB 2FK8A 5K3CA 2EWWA 2D13A 4DJAA 1YJCA 4D4IA 5H68A 2A5LA 3ND7A 2FN4A 2Y27A 4H27A 1XXHE 3C2QA 3O4FA 5CA1B 3X44A 4JI5B 1DX4A 3TTXA 2Z08A 3KWFA 2AG8A 4M38A 3MERA 4PR3A 4BPBA 4G8JA 3K4PA 1V8FA 2QRNA 4WCFC 4KFUA 4XYLA 5A9SB 1SXGA 4I8IA 3VAAA 3G5LA 1IDOA 2JJQA 2WAMA 3ANTA 1J0EA 3I6BA 3I83A 4IF4A 2IS6A 1CUUA 1M73E 4HPJB 5IRCD 4C3OB 4WOJA 1NJ5A 3DXZA 1NUTA 1GSOA 5T4BA 3STVA 3FI9A 5ICMA 2IQ5A 1KERA 4OLJA 1VP9A 1ABBA 2WMOB 2YJZA 1BH6A 1D2RA 3K32A 4RTLA 1LK5A 2DHQA 2EL7A 2EYUA 3TECE 1QDEA 3F6SA 2OKCA 1P5ZB 1XTBA 1IL0A 4OP3A 6GPBA 4AIIA 4MCJA 4D3ZA 5KNDA 1THTA 2FPRA 1WQ1R 2HK6A 3LUDA 3GK3A 3BMNA 2F43B 2KS6A 1WZNA 3ROKA 3SGLA 4L8YA 4F5YA 2P2YA 1DEOA 1SOWA 1T5OA 2AE1A 3UYLA 1CR4A 1GNTA 3TMKA 1TEVA 1D1QA 3ESCA 2P77A 4U2BA 1BO6A 1TIKA 2PJZA 2PXHA 4AQYB 1XPUA 1N77A 4EYKA 1SHTX 3A2KA 4Q66C 2YIJA 1NW9B 2BN4A 4MWCA 3DMTA 3RARA 4JT4A 3L0SA 4QYTA 4BNYA 3M6XA 2H1WA 2R4TA 1Z2PX 2CHEA 1BXKA 4FZ3A 1RQ7A 4BZZA 5A05A 2JD0A 2YRXA 3H05A 4HZIA 4MKGA 1WG8A 4F4FA 1MQAA 3VKWA 3C5WP 3RADC 3HBFA 1KDVA 4X1KB 5C80A 4GZMA 4Y2VA 5K3DA 4O4IF 1W5SA 4H17A 4HFNA 2O0MA 3RU2A 3DF9A 1KC3A 4BASA 1AV6A 1JEDA 4MGZR 1V39A 4A0RA 4CLDA 3FSRA 4DVGA 3EQ7A 4EX6A 1MQ8B 2CZGA 3OPMA 2PUWA 2CV0A 2XCOA 1GZDA 2PHZA 3INRA 1T2EA 3HXTA 4JB0A 4DNPA 4NI5A 2O3QA 3P97A 4G24A 3ANNA 3OQBA 4PQFA 4Q02A 1L9XA 2EBHX 3PQ2A 1NVTA 4YT4A 1X8KA 1V9SA 3P0JA 4Q1BA 4U6NA 1P9OA 3K96A 4FNMA 5IJ9A 2BZ1A 1WKCA 1USGA 2GCEA 4C1NA 5J1SB 2G0TA 3F3KA 3N6VA 3D43A 1WXDA 3C4VA 4KRYA 4DKXA 1P7VA 1DRKA 3RS5A 1D4OA 1SOUA 4DUPA 2WT4A 1CQJB 2B82A 2O8BB 3C1OA 4R7ZA 1EE1A 4TMKA 4GPAA 3LIPA 4RZHA 5CFMA 3SDZA 2XAAA 3MEQA 2XIJA 1QTNA 2HO5A 1T35A 2VCYA 3R20A 4RM2A 4PZ0A 3A0RB 4BMVA 2ZROA 4QXMA 2I80A 1U7DA 3LK7A 1I4LD 1M34B 3NOVA 4OBXA 2OMKA 4UVHA 1JDVA 4DLZA 4LRXA 2FZ5A 1TM4E 2VHJA 4O25A 3RS3A 5CDHA 4TZ6A 1JQ5A 2QUAA 4HXYA 5D5QA 2ZSHA 3HDJA 4Q6BA 2GPWA 3L1KA 4DWJA 2HUPA 1I01A 3RH0A 1THMA 2O57A 1NYQA 5FLKA 4HUJA 4FSDA 4F4IA 2GAFA 4ZMBA 1EUZA 1SWVA 1B2LA 3VX3A 3JTMA 1FNMA 1XDSA 1P17A 2RKOA 3HUDA 4QJIA 3UK0A 1ID1A 1OIXA 4GQBA 2CEKA 1CT9A 4WIAA 1DU4A 5BQ3A 2RHLA 5FTLA 4XPIA 1JAYA 3Q9SA 1L3CA 1JVNA 1JSCA 1KJNA 1KP2A 2IXBA 3N74A 2IWHA 1PT7A 2YY7A 1N2CA 1O89A 3VO8A 3FTFA 4BE7B 2BE7A 1DE0A 1JECA 4IXNA 5T4HA 3C5EA 2GERA 4DA7A 4AY6A 1TGVA 2PZGA 2R1VB 3ASVA 4B17A 4ED9A 4RTMA 3W8DA 3ED1A 1GZ6A 4Q4AA 3BH7A 1NUSA 4OUKX 1TZ2A 3RANA 3OSUA 2PMCA 1W4LA 2ZYAA 3E9NA 4HNRA 4BN4A 2E6KA 1XRPA 4B3FX 4DMMA 5EP3A 2UKDA 2QQFA 4IWNA 3WKAA 2AWOA 2EWMA 1WV0A 4BGVA 2I4MA 3H1EA 4NYMQ 3ULKA 2AOVA 3I2JA 4EA7A 4EKNB 5EUQB 3N2ZB 1DBRA 3IALA 1OJLA 3STYA 2D1RA 2XE6A 3SC4A 1AX9A 2W2LA 3ZW7A 4CF3A 2I6TA 2B8NA 4RMHA 2AD5A 4NE7A 2QOEA 5I4CA 4ZGBA 2VXYA 5AHOA 3HXPA 4RL6A 4WA8A 1MKYA 1ODIA 3L6CA 2B8EA 2J31A 1FVHA 4LF7B 5BW4A 4ZQIA 1CE8B 2PY6A 3VDMA 3WRXA 2X76A 2IEZA 5HCIA 1U6JA 4MWBA 2BFFA 3KSDO 4FYYA 5BSVA 2AJ8A 3O95A 2MHCA 3U4GA 5GV8A 1CJMA 4F7DA 1ILWA 4QOHA 3CNHA 5LU9A 3IP6A 4OLAA 1IRIA 1RP1A 4U2EA 1C0EA 1IEVA 4B6OA 2M6KA 3I6YA 2F43A 3GDFA 3KX2A 4MQLA 4PZEA 1M7BA 2J3KA 4RF4A 4X90A 2MSLA 5E9AA 1M5RA 4DB4A 1JBEA 4DV2B 4M55A 1BZYA 2P11A 2EG9A 2H4HA 3EG9B 1BFKA 2I5PO 2JJ2D 1FP7A 1PK7A 3FLBA 4XTRA 4B5KA 4F3NA 4ZI2A 4NCBA 1QRAA 2FMKA 4OLBA 2RIPA 1GARA 2IYLD 2RGGA 5I8WA 4WKPA 2VUUA 4Z7OB 4WNYA 1E2PA 1EZ1A 3QWBA 2FRDA 3I28A 1C4OA 1DX9A 1Y8AA 2CKDA 3RT7A 5U1PA 1M2HA 1FNBA 1KHHA 1WP4A 2NYAA 2UVPA 3LDFA 1I3LA 1FJHA 1U8EA 3L82B 4ARAA 2GK4A 4GKAA 4Q3AA 3WQBA 1RYEA 4I36A 1DAIA 2XE8A 3I6QA 5DMHA 2H4XA 1P73A 3LT4A 3N2LA 4C7MA 3C16C 4HADA 4LMBA 2BD0A 1L8OA 2RHGB 3IQGX 3SYMA 5HTKA 3NUZA 4PGGA 4PNPA 3PENA 4KCGA 2WFZA 4IQ0A 2WIJA 3LYUA 4BC1A 3OI7A 4E5UA 4HNAB 3S2UA 3O2NA 3D7LA 2QAGC 2Y1FA 2BHLA 2ZRKA 1Y6RA 4MUKA 4AU1A 3GRCA 4ZHSA 5KYXA 2O5CA 3FBTA 1NXXA 4M21A 5KJFA 1N7JA 2MJLA 2JAPA 2VSYA 5LMZA 2WM8A 5JW6A 4CUZA 1RI4A 1W35A 3BREA 1JA9A 1O6ZA 3PQ5A 4N0PA 4TLDA 4RACA 4BX2A 4EFNA 3JZDA 3CLRC 2Q5EA 1TQDA 2K4MA 3BYZA 4WXHA 5DISB 1YRHA 1B23P 3EWIA 1CQJA 4NMWA 1P9WA 3OPNA 3DDWA 3L06A 2ID4A 4XIFA 1TF2A 4M88A 1VHLA 1IHUA 2J4DA 2Y8EA 2EFDB 3KXIA 5EMHA 3V80A 3R75A 3UHPA 5F5LA 3A70A 3HU1A 5H3CA 4F7WA 4X1OA 2P5UA 2QL7A 4EAQA 2GEKA 1LPOA 2AF3C 3ZV4A 4Q16A 1U6KA 4MRSA 5SYAA 1ODSA 1O97D 1I7LA 1J20A 1LPAB 4IDAA 3EDMA 2RK3A 3NIGB 4Y2PA 4LCBA 4Z49A 3EVDA 5K45A 1KY3A 1NVMB 1PR9A 2YV3A 4TS4A 3RS9A 1J0XO 1IVSA 1CNEA 4RKYA 5ALYA 1G20A 3I9FA 3PSAA 4KOAA 4KWCA 5IAGA 1G5IA 2DUWA 1WHTB 1YRBA 2AUMA 3AG5A 5AW2A 3LH5A 4BNJA 2DECA 4KQ2A 2QLFA 1DOZA 1V5FA 2JEYA 3V33A 4WOKA 1WPQA 4EY7A 1YKFA 4PRYA 4ZYWA 2NZWA 1NRIA 4GSKA 4N7MA 3TGPA 3K5HA 1DARA 4RETA 1WAMA 4Z9BA 3ZHTA 1RYFA 1REQA 3KEGA 4TSRA 3T7DA 3CRZA 4ZGGA 3LLVA 1QGYA 2ZT7A 2FW6A 2JFUA 4RTPA 4G0VA 3K1AB 3SYNA 3AUSA 5DPMA 1O54A 3O3NB 5H5JA 1G2IA 2RJNA 1L1FA 1ODFA 4B7XA 4DNFA 1JNXX 4J2TA 1Y9AA 3D6UA 2WYVA 2E4XA 3I62A 4Z8YA 5B1HA 1TRKA 3Q10A 3VSCA 3VYUB 1T8UA 4BKPA 3TRHA 3DR5A 4IILA 4OH1A 2J5RA 1DAEA 1KK2A 5SZHB 1VXRA 2BHRA 2PQ6A 5HFJA 3VV3A 4AZ0B 5KC9A 1EUDB 1K4YA 3AR2A 2NPIA 5KSZA 2NAFA 1V8OA 2AFIE 2GN0A 2PRSA 2XEXA 3NHJA 4GLBA 3AK4A 2VDPB 5F3DA 1ZNWA 5JR3A 4G5RA 2IOYA 3U44A 5KREA 3K1TA 3IXLA 3NOXA 2ZIEA 1M8GA 4MVJM 1CULC 2DWUA 4IDDA 3M5DA 4L5BA 1XCMA 3WO0A 4BMPB 3LLMA 4YJHA 3SG0A 2YZGA 2VHUA 5TIIA 3VA7A 4MZDA 3PF9A 3BQMB 3PUJA 1ILEA 1T36A 1GGFA 1Z26A 3Q9LA 2ZBDA 2C1EA 3N5CA 4TQGA 3ZYCA 2GGSA 3KYBA 3EZFA 4HX9A 2RHOA 2PBFA 5JO9A 1EFPB 1NSYA 1RR6A 3N2KB 4MDEA 1L2TA 4IOMA 1NQUA 5LLSA 1QTRA 3DFIA 1TZKA 4IIEA 1XAGA 1Y4AE 2H06A 4DRXB 1U3DA 3D8HA 1IY0A 2FWNA 1XKLA 4EO9A 3C7CB 5CBKA 3LFTA 1WW8A 4XEUA 1V5EA 3NONA 1CEXA 1S8OA 4R9VA 4AS2A 1XPOA 4P2GA 5I7WA 1AO0A 3SMQA 4I0WB 2FJUA 3M2PA 1NXWA 1KKMA 3UFXB 1H8HD 4CQLB 3HYCA 3M8KA 4X00A 4NBSA 2I22A 2JEOA 3P7MA 1Y9DA 4L4XA 5EVCA 3UFXA 1K7EB 2OAQ1 1T3HA 3NHRA 1H0HA 3TLKA 1C9EA 3KKOA 5H3LA 1QK5A 3FFWA 2ZYUX 4FBLA 1KDOA 2QZ9A 2ZJ8A 1EX7A 1KMHB 4ND1A 5CLLA 4C7VA 4PE5B 3W6UA 3REFA 5CDTA 4A4DA 3SX4A 1LI7A 1T8SA 2QXYA 3COYA 4DCJA 3SQWA 5KYWA 3PVSA 4QPZA 1OXUA 2C58A 3ZE1B 1B8PA 1RWVA 1DV1A 2CFCA 3F1LA 2E89A 1R6AA 2JATA 4XQCA 2R5WA 2FWBA 4Y2HA 1Z5VA 2AVNA 2IIQA 1C3LA 2N75A 2RH4A 3AJAA 4TKMA 1ZR2A 4KV7A 3UMVA 1PSDA 1LH0A 2GLXA 4LZZA 4ND6A 1N5MA 1P0FA 3BMCB 3SHFA 3ELBA 1IZ8A 2Y2UA 4BO1A 2JVJA 1PWYE 5AVYA 5HP4A 1XTQA 1WA5A 1XDUA 1VLLA 3L6DA 3CTPA 2YWJA 1FQKA 3NWPA 2XMSA 4IGKA 4PZDA 5T5QA 4EJ2A 3R6TA 1LBTA 3GJTA 1GQYA 2A2ZA 5EJAA 3WRWA 1EWQA 1ZS9A 1YULA 1JFVA 1UF9A 2N42A 4FYPA 1CZHA 1UFOA 4OLHA 4QQNA 4AUMA 4CG1A 3I05A 3GP5A 2W6CX 3DBVO 3L8ZA 2MSNA 3NT2A 3WAJA 3R3UA 1CF4A 4WSOA 2ERCA 1BEZA 4IIBA 4EZEA 2ONZA 2BDEA 2X9QA 4Z0TA 3JQRA 2JHFA 5H0IA 3O4RA 3GJ5A 4PEVA 3RAFC 1WEHA 4RV5A 1J1ZA 3M6VA 4EDFA 3RIXA 3T3OA 4GPZA 1F0KA 1TGYA 4M8KA 4ESOA 5KBYA 1X7ZB 3CRVA 4BV2A 1OAOA 5ALGA 4GOOD 1YS1X 2DUMA 2PRZA 3EHEA 4BLWA 3LUFA 1YD7A 5IKPA 1AKEA 3EW9A 1P5FA 1UUFA 2ECFA 4ENPA 4C4RA 5CHEA 4LMAA 3B2EA 3L8DA 4ARZB 4RC9A 1SMKA 2AHOA 3E7WA 4KPUA 3HVIA 3IVCA 1PLLA 1JR3D 1SU6A 5EJIA 1HUQA 2V3CC 1E1DA 4LY0A 3OOEA 4AK9A 2D2EA 1A8QA 4IZHA 1Q1GA 3PX2A 4MVJA 3BTUA 3JSAA 5ED0A 5JDIA 1J42A 5SICE 5K0TA 2LIVA 1W0KD 3HJTA 5ALXA 3L0DA 6REQB 2H48A 3H2BA 1FFSA 2WQZA 5JSFA 2ZJYA 3R6GA 3SZ3A 3EHDA 4KDRA 4HT3B 3OIDA 2HI0A 3F67A 4JC5A 1K6JA 3EZ2A 4JNKA 4U3JB 3USZA 5E1MA 3ZDQA 5JAIA 5LDGA 3GRFA 3U0VA 4RPCA 1X19A 2ZIZA 3SC6A 4M60A 3AVYA 4DW8A 2ZWIA 4EW3A 4YBZA 4C4XA 3LUCA 1JDBB 3G8YA 5B6PA 1KI3A 1EX6A 1X8XA 2FF7A 2NGRA 3D59A 3L0BA 4IQ8A 2GESA 3LYAA 4KIJA 4C6SA 1H6AA 3IR6A 1V35A 5E4YA 4TVKA 4QJ4A 2V9ZA 4LQCA 1M7HA 3WFIA 4YYEA 2VNJA 9ATCA 2UYCA 5JPDA 3QPVA 4RK1A 1RRCA 1J1IA 1GL7A 1T13A 4LJYA 4R0VA 5EKSA 5JCPA 4W5RA 3AI1A 1XZKA 1RRPA 2XYGA 1UAYA 4CKYA 2CJPA 2JFYA 5D85A 5GONA 4M0EA 2JBWA 4P0TA 2EGHA 3PFIA 5HYVA 1ZIXA 2WSSD 4FSHA 4LK2A 1B76A 2DWPA 1YMQA 5J5CA 1P4JA 4LE0A 1AD2A 4D92A 3KUKA 3WOVA 3W7AA 3K70B 4REOA 1W47A 4CCSA 1F0PA 1WD5A 2AUNA 2JZOA 2CL0X 2FVYA 2LKDA 1U7OA 4LZPA 5JZBA 3MXOA 4H6XA 4J43A 5CDFE 5LYJB 3KSAC 1AXGA 5DHRA 1PR6A 1OIVA 2EJWA 1N1GA 3BXHA 3L7BA 1WLYA 4TMWA 4KSBA 2WQ7A 4CMEA 1NBMD 2Q27A 4RTOA 3HR7A 4BCBA 3AM5A 1U80A 2PXAA 4RZ3A 2XR1A 1MB3A 3ZXUB 4EVIA 1Y4ZA 4PYJA 2VIIA 5CU7A 1Y6ZA 1P4SA 3IAM6 2QTWB 3KTOA 1MNQA 2PUJA 1KZ9A 3I5MA 3W8NA 1L4EA 1E0AA 1A9ZA 5G2OA 3CUEF 5DIZA 4JYZA 3OCYA 5INTA 2PFKA 2VL7A 3ZNOA 2ZJ7A 1B3RA 3SK0A 3A1NA 4HQOA 2POQX 1WB9A 1E7WA 3HABA 2FSSA 4WL0A 1DBQA 1EK2A 1UK8A 4R7GA 4RE6A 4US2R 1MFPA 3ITDA 3RC8A 3DDHA 5KNBD 4KFTA 1OBOA 1G4AE 4URZR 1V16B 2MYUA 1VDMA 2B4TO 3MINA 3MTEA 4E14A 1R2QA 2FEKA 3ILHA 4IO0A 4DNXA 3OECA 1KH2A 3GUUA 3HU5A 3V7NA 3QXHA 4D3FA 4DDMA 3R6WA 1SH7A 3Q2KA 1NQAO 4JYAB 1J2TA 3SZRA 4J3FA 3ZGZA 4UHJA 2PRIA 4C7OA 1QO0A 4HJXA 3B36A 4DREA 2YYZA 3NDRA 1UBOS 4V0RA 4CR7A 1P2TA 4P8RA 1QRSA 5F3RA 3SBXA 4UZSA 1NC1A 5JSKA 3KJFA 1KK3A 4IJ5A 1QLWA 2CLFB 5IARA 1PGNA 3ZI0A 1H94A 2G08A 1M83A 1E1CA 2JLQA 4OHUA 4BLSA 4OQDA 4PWYA 3F6BX 4R2LA 3B78A 5F1PA 4E5SA 1KYZA 2J9RA 2ZI6A 3MHPA 1CUZA 3I8XA 1SOMA 3DAFA 3EF1A 5EESA 3TI7A 3TPZA 1T6ZA 3DVRX 3UV6A 2VUIB 4BRZA 1S1CA 3GJYA 4MNTA 2NTYC 1OX4B 2GJSA 1D8AA 1JVBA 8ATCA 1OCEA 1PSZA 1GU7A 5CFOA 2CWDA 4LJ5A 4B3CA 4DC1A 5FWYA 2F9LA 1FUEA 4LYGA 1J6UA 5CB4F 4O33A 1LBQA 3ETLA 2XY4A 4AS3A 3GQBB 2RJOA 2XPCA 4RGVA 1BS1A 1WUHS 4RHFA 2IYSA 3RS7A 1EM6A 4S0ZA 3IAAA 3QIVA 4Q15A 3JWGA 4D26A 4GOJA 2PUGA 4PG6A 4C89A 5T4EA 4JJZA 2PEZA 4GKVA 4PLWA 3TSOA 1O4WA 3WE7A 4JL6A 3FDIA 1XVAA 1Z25A 4QWWA 4DV4B 1TW3A 3DEFA 2O7RA 5EN4A 2GWRA 1U90A 2XRFA 5DBEX 2FF5A 3U1BA 1CV2A 5K0FA 3DHVA 5BSFA 1QGDA 4U7JA 3QF4B 1M8KA 4K9DA 4MPJA 2RGBA 5KPJA 1UMBB 2BCJQ 4NCKA 4ND7A 1ZG3A 2Q5IA 3UPDA 1E3SA 1JR3A 3CTMA 2VDJA 3PA8A 2XF2A 1N2ZA 1T5TA 2REBA 3N0XA 1LDEA 1EDZA 3MK31 2O8BA 2HH9A 4CM5A 3ER8A 4NZPA 3JYOA 5CRIA 2QDXA 7ABPA 3H1PA 5GADl 3EFEA 2Z98A 4MDHA 1CZRA 4KVGA 1U0NA 4B2IA 4PANA 1R8SA 4NDAA 4NG4A 2OPBA 3E35A 3QLVA 4GE3A 4UE2A 5I7AA 1HNWB 1EAMA 1GCIA 2D0OB 2FCRA 4KQFA 3FWHA 5AVRA 4G09A 2IS2A 3EEYA 3R3VA 1MA0A 2OSBA 1LJ8A 3VU9B 1RM5A 4RJJA 3DLHA 1Z08A 3O1LA 1PR2A 4D9JA 2BI7A 3E8MA 4X6UA 3HJGA 3R2JA 1GPDG 1X8JA 1Q0HA 1YZHA 3AFOA 3MGGA 2IHYA 2WD9A 3BHMA 3HCDA 1BGWA 1KEUA 3BGOS 1IIBA 3CJQA 3G85A 4G4JA 1G59A 1H2AS 1IJEA 2C2MA 3CVOA 4C1BA 1W36C 1GNRA 2V96A 3HRIA 3KZKA 1WU7A 5AI6A 2HCBA 5FPPA 2Z6UA 3H1FA 3FNGA 5E1OA 1EX9A 2GJKA 3DWGA 2PUEA 4KKXB 1NF8A 5FBKA 2QG4A 4XSGA 2MSKA 1QM5A 2XTJA 3D3QA 3GJXC 2CV1A 1ULSA 2W48A 4E94A 3ZH2A 2OXTA 1W96A 3N8NA 4YWHA 3PDUA 2MSEB 1QQBA 1UKAA 3K9FC 2HWWA 1X13A 1IN7A 3BTOA 2PUHA 3KB1A 2VLIA 4ODIA 4H1VA 3JD3A 1ECCA 1M6NA 3DZKA 1ZNYA 1CNFA 1KJJA 1JEQA 3EXIB 3VHXB 1NYTA 2I67A 4C4SA 3MWKA 4D3YA 2YXEA 2HRQA 3NNDA 3MWLA 3LA6A 3NTLA 3FKJA 3K8ZA 4BZXA 1QCZA 3ON5A 2L42A 3K5WA 1Z29A 3HACA 3D0OA 1P1BA 1DBVO 1GQRA 4X1YB 4CMEC 5CDUA 3GLGA 4IJKA 4BNDB 2J30A 5C31A 2P91A 3Q3IA 3EZ9A 3M81A 4RCVA 2Z95A 4N8SA 4CIXA 1GYPA 4LWQA 4DUYB 1FNSA 2DHDA 3CVJA 4NATA 2Q29A 1QHXA 4FN4A 4PPQA 3VYVA 5FWNA 1A8IA 5FA6A 3JD4A 5LOVF 3BM5A 4GOKA 1XMVA 4LYFA 5KTTA 1A9XB 1OBCA 5L3QB 1XVIA 4ZO8A 4MUAA 1RYZA 3G1WA 1J8FA 2I66A 3HBNA 3HV2A 2P68A 4N3NA 2I9KA 5DX0A 3KZVA 1DRJA 2QRJA 3KWLA 4RFSB 5EMKA 4NRDA 3BE4A 2M6LA 1GTSA 2WDZA 1FDOA 3KZXA 3N7UA 2QSJA 3LPCA 4F1WA 4LXXA 4ZALA 3IP8A 4GM4A 1KEEB 1DHTA 1OHHA 3VH1A 3U56A 1LB1B 3NM4A 5EG5A 1MC1A 1SIUA 3KE8A 4AP9A 3AV3A 4F85A 2NQ2C 1XVLA 3LUHA 3OJFA 3QXCA 3EIUA 1VIYA 4GIBA 5ERGB 1RADA 3DOOA 3DPUA 4FFMA 5JRDS 1SWWA 3MWDA 1M2JA 2FG7C 4J0FA 4DBLE 3FYHA 1A9OA 2JJYA 3IAM1 2OLJA 3H2HA 3QU4A 4M1ZA 3L8CA 1H4VB 3CVYA 2W7TA 1OLSA 3MAAC 4PGHA 2QI9C 1N0IA 1OBHA 3GJ0A 1MV5A 3LKBA 3RJ9A 4C14A 4YMTA 4EG4A 4JLWA 5KNBA 2PR7A 1Z47A 1TZMA 5E1DA 3K35A 1SPXA 1U3UA 4L8LA 1WBBA 4ETMA 2AK3A 1NIPA 4HDNB 4ITVA 4KAAA 4LC0A 1RMQA 4R2IA 4DTCA 1SZJG 4ENSA 2VPTA 2CXXA 3RS4A 3B52X 3UUGA 3TS1A 5LP1A 1J97A 2BELA 2AZDA 4ITUA 4HYYA 1QMGA 2CZQA 4MEBA 2UUPA 2WJ4A 2WINI 4RQTA 4ZP1A 2OC4A 1KDPA 3TX6A 3MAGA 3RRNA 4BX8A 1ARZA 4MQUA 4WDQA 4ZT3A 5IBRA 3W2GA 1QTQA 3PEVA 4E4TA 2H2DA 3EQ6A 3JX9A 4J0DA 3MCUA 2FKNA 3B3FA 2IOFA 2R2AA 4C0XA 3SKYA 1PJAA 1QOQB 3NX4A 5TDHA 5IUNC 1CY7A 1MCZA 2FWAA 3AP2A 1E7SA 2WTUA 2GHRA 1CB7A 2OCKA 2OY0A 2XW6A 3KYCB 2QTHA 5BNIA 3N3AC 1B8OA 4Z4QA 1QO9A 2PPVA 1U2PA 2H2IA 4OMFG 5EWMB 4YQFA 4TTQA 3VPAA 3WX0A 2JFXA 4J7XA 3U7EB 2O3UA 2X58A 1QZXA 1SU8A 3VYRB 2I6GA 3QA3E 1YZQA 2FJPA 4FKMA 3EVNA 4IFBA 1ESEA 1N2JA 1Z2NX 1JGTA 2JPDA 4PSDA 3V4LA 1WDLA 3G2KA 3TLGA 1E5VA 2WMYA 3FVRA 4G0QA 4KQXA 4AN1A 1WSAA 1N6NA 2KM1A 1BDHA 4HRYA 1UC4B 2WWFA 4DIKA 4MJLA 2QE7A 1UKVY 1VBFA 3NHAA 4S1TA 4BQSA 2XLBA 1ST2A 4QVKA 4MW7A 3A9SA 2JFPA 2F6RA 3NXSA 4F9FA 4LE1A 4HDMA 2H7XA 4ZQGA 4CEJA 1SUIA 4UCWA 2AEMA 3CNOA 5HZMA 4X8HA 1WCWA 4QUKA 2LBPA 3R7NA 3RVRA 3WVNA 1VPEA 5LC1A 4EHKA 2WUFA 4ETNA 2WW8A 1EAYA 2HXSA 4HUQB 2DERA 3RUAA 2QRPA 1WCIB 5AKYA 3R3JA 3MPUA 1YA4A 4QE3A 3KOWA 5BWNA 3AVVA 3NBAA 1DUVG 1XU9A 3DC2A 4NF2A 4S12A 4BUCA 2VF4X 5DBIA 4B6QA 5JNVA 3WBFA 2BEKA 4XCXA 1BFDA 2OYSA 3HLYA 2OB2A 1N6HA 1PJSA 3FG9A 4TTIA 3KQTA 1N2SA 1F5SA 1YS4A 1IJKA 5HDQA 3RSFA 3RYIA 3IUSA 1EEXB 1Z6AA 3MT7A 4X63A 3MD0A 1L7XA 3IAFA 6ADHA 1R3UA 2C4NA 1IQ0A 2OCLA 4YV0A 5IVKA 4OIFA 5FTNA 3GO4A 4BMNA 1W9MA 2GX6A 2JIPA 1I4WA 3JYNA 1FP6A 1W76A 2P7HA 2WHRA 3NDIA 2VJMB 3H5RA 4L0MA 4KXWA 5IEBA 3VOAA 4LPKA 1Z7BA 2J07A 4NOLA 4DR2B 1G66A 3DOJA 2YWFA 4JBWA 1XX6A 2SNIE 2XZOA 2X77A 4REQB 4MYDA 5LB4A 3IKTA 3OFVA 3U4DA 2RD2A 4F91B 4J1SA 3DE1X 3O8OA 1D7AA 2NNLD 1U9CA 1DAPA 1U0HC 1R1DA 3DE5X 3NTXA 5DGHA 2Q8NA 1C1XB 1IN8A 2YWCA 3C48A 4WY2A 3QNWA 5CDYA 2CNLA 1EIWA 3OWXA 2C1XA 4WESB 2PG3A 5JO0A 3EZXA 2FEWB 2PGLA 4P9NA 2R6JA 1CDZA 1MXHA 1Q0PA 4C0AC 3ZHUA 5H9WA 4UBMA 2CHVA 4YP5A 5FL7D 4RDXA 1B14A 1I24A 1MEJA 1W8IA 1UXJA 3SOPA 4DARA 2H3EA 1YV9A 2ZJ1A 3IO3A 3LSYA 1TMGE 4L3VA 3ZZ0A 3TTUA 1KR5A 4MHOA 1U99A 5G1PA 4HP8A 4AWBA 5ITVA 2OESA 2QU8A 2QX4A 3V1TC 5A4KA 3GFBA 3LQKA 5HKAA 4Y2RA 3JD0A 4N47A 1ZCBA 3FDFA 5EKXA 2B1IA 2NO5A 4W1PA 2QMQA 4IQGA 1ADYA 2JGLA 2PKRA 2HD4A 3OF5A 2HPZA 3BT7A 4IDQA 5EGNA 3T52A 1Q50A 2VDVE 3HKBA 2BGUA 3QFCA 4P7FA 4P53A 3T3GA 2P6NA 1MOSA 4UJ5A 4LYEA 1Z22A 1HE2A 2JFNA 3QHAA 5L7TA 2B6HA 5IZCC 2WUWE 3IAXA 4A8TA 5FLXA 1VSVA 1SZDA 4JXZA 3R44A 2C7PA 4YACA 1GNQA 3OX2A 1VBNA 3JQBA 4NPAA 4RK6A 1NF2A 2QWXA 2B7LA 2WUEA 3OM9A 4NNJA 1TYAE 1ZIYA 4H77A 1PGJA 2W37A 1DC4A 4S04A 3ANSA 1CEEA 4W9NC 4D6PA 1SU7A 1J0DA 1IPEA 5BURA 3N0VA 4DZTA 3Q3EA 4HATA 2PFGA 2C57A 2CLSA 3DAOA 3HZOA 1V6AA 2R47A 3NASA 5CLFA 2CZCA 1UOQA 2VSFA 4UTNA 2R8YA 3L4BC 5HTOA 4FP9A 4FD2A 1W2WB 4QWMA 5FI5A 4CG3A 5C35A 3TQCA 4R3WA 3Q7QA 3Q98A 3V6MA 3D7MA 4ZVPA 4AYTA 4DWVA 1EFPA 3KQOA 4ERXA 3BORA 1J70A 4KSYA 1AKVA 1K8QA 2GN8A 2C00A 1G8PA 5BN1A 4FUQA 2EW1A 4OJKA 4D25A 4W9RA 1NVWQ 3O82A 4N1AA 5DW3A 2F64A 2IF0A 1NQWA 2ZJ0A 3QV2A 4LY9A 3OEED 1N3YA 1XEXA 4ZYUA 1E63A 5FBLB 3W5DA 2DY1A 2J1LA 4LECA 4R41A 1V26A 1Y5MA 2FPXA 2XE4A 3AHJA 3IIEA 4GSYA 4KIFA 4J1TC 1A5SB 3A32A 3PNBA 3R5TA 5J2UB 2BSAA 2ORIA 3WLFA 4EKYA 2JIZA 5BR8B 1P8JA 4Z86A 4AJHA 3GQVA 1A27A 3PS9A 1J24A 4L5AA 5DN9A 2YYSA 2ZJ4A 1C29B 3FOCA 4FBGA 3SBEA 2YUTA 1GTL1 1OT3A 3PQDA 4HSGA 5EZ6B 3KQMA 1J09A 2QLNA 1MF7A 3Q7EA 3G6WA 1M1UA 2VNKA 3F47A 4ZQEA 3QF4A 3BIXA 6AT1A 3NT4A 3LGSA 5ALOA 3E7DA 3O47A 4X54A 2C9ZA 2G1KA 1MEOA 5KQPA 3NV9A 2QY9A 4YUXA 3DKVA 1UK7A 2JCYA 3M83A 4ZAWA 1EQUA 3DLCA 2FFBA 3AFIA 2AX3A 3IBYA 1JT2A 3A1VA 3WGVA 5KNDD 1FVOA 4AJIA 4D9BA 4EGJA 4AB1A 2YOGA 2ODEA 2WBLC 4ETWA 4F9TA 3PEEA 2O8CB 3CPHA 5CFPA 1KDTA 4D8XA 1ZUWA 5F9MA 1I1QB 1JFSA 1M0TA 4E11A 2Q5JA 1GG5A 3WLPA 2E3JA 4IL5A 1CRZA 4S1WA 3QVSA 4EPVA 1JKMA 2QKYA 3IODA 4M0PA 1SFRA 2JEZA 3H9GA 1TVCA 1KFJB 4Y1RB 5DWVA 1ZX1A 2FP3A 1YIOA 3F90A 3G0CA 3DTNA 1NOIA 1Q0UA 3Q5EA 2Q2VA 1UXHA 3OZVA 2R6HA 3R8CA 3VUFA 2BSQA 3H2KA 1Q14A 5UKDA 3GMTA 1L5KA 4DR6B 5H16A 3KKZA 4GICA 1VA5A 4JHXA 1V5GA 2OD7A 4NOJA 3GNSA 5TX7A 2ZYWX 1L4NA 3FPCA 2V54A 1OUMA 4OOEA 4FYWA 4N0QA 1U1FA 2R00A 4M0FA 1AXRA 3D64A 4R51A 4UMVA 5K05A 1AB5A 2V7WA 2QB5A 4OXIA 2GD6A 2VP9A 3DT6A 2IYQA 4HCJA 1ACJA 2QTVB 3N2NA 4QGFA 4LFCB 3PX7A 1U7TA 2EZTA 5BMOA 5K0JA 2CL6X 4I5EA 1E1QD 3C0KA 4PTLA 2NUTB 3FUCA 1A97A 3HU2A 3P19A 4FNAA 3T1TA 1JG7A 1WE2A 4L95C 2V0NA 4PLGA 5JS7A 2RG1A 4AP6A 2JLYA 4YRAA 1T2DA 2WNSA 1GPMA 3FMVA 3ONWA 4J1QA 4RVCA 3VO1A 2FPSA 1MABA 4IHJB 2VCEA 1LV8A 2ZYIA 2WTEA 4KLNA 1EQ2A 3EDYA 3FYUB 5CGZA 3GPBA 1E0JA 1R0XA 3ZIUA 3K70D 2C29D 2QXUA 4RY9A 1IWOA 1FLVA 1NZFA 2G72A 1ZGZA 2R9VA 3IBTA 3PNKA 3RT9A 3SD7A 2V59A 3QKSA 1VIMA 2VXCA 5EL0A 4F1JA 4DLVA 2UU9B 1WP9A 3DVAA 1SCUB 2PV7A 2R7KA 1MC4A 4N7RA 2HDOA 2R84A 4QASA 2YDYA 3IO5A 4BYMA 3Q8LA 2E9SA 3KSZO 1VPTA 4TKUB 3QKWA 2ZCUA 1G21A 5EMNA 4YAIA 5E6SA 4U7DA 3RUFA 1UFKA 2X7JA 3GEHA 3PICA 5DIFA 3O4JA 5F2EA 2OMEA 2K6GA 1TZCA 5LA6F 1YOBA 3SS9X 3TSCA 4CCYB 2P2CA 4I55B 4PO3X 4FB5A 5CITA 4L8WB 2VQ6A 5EJ6A 1MBZA 3EMBA 2ALJA 3DVSX 1QHFA 2V97A 3RTBA 1Y81A 3C3MA 5FTMA 4G1UC 2ZTHA 4KIWA 3G8CA 1KK1A 3U3JA 4EFMA 2WU4A 5E4FA 4DSTA 3HH8A 4F12A 2PQMA 1MO4A 1Q21A 1V7CA 4NXNB 1OY1A 1PW5A 2HRZA 2JCSA 5B1DA 5T6BA 4FFWA 4TYNA 2WYOA 3M6WA 3WIOA 4B7AA 1E9DA 5GONB 1A7JA 1DAFA 5BRJA 2NMVA 2Y3IA 3MD9A 4GXTA 3OO1A 4Q7JB 3TJRA 2CD7A 1RCTE 4TVBA 2VEDA 4UARA 1OE0A 4D4HA 2D1FA 2D8MA 2QD3A 1E2GA 1KEZA 3THSA 1SXPA 3ND6A 1N6RA 1FMLA 1SVKA 2PK3A 2W11A 5B1IA 4ER5A 4CEHB 1LDNA 5F9HA 1EESA 3FHLA 2RAVA 1RIFA 2JD1A 4HFJA 2Q4EA 2O50A 1Z2CA 2GXSA 2V6JA 2NVBA 3CLSD 3D31A 3DZCA 3T1QA 4CFYA 4BV3A 1N2CB 4KTTE 4F96A 4A5OA 1TLLA 521PA 2DPLA 4F56A 4YRQA 4YGXB 4JA2A 2BEUA 1QQ6A 1U0TA 1TFUA 1ELOA 1G5QA 2GKGA 1BE8A 4FYXA 2WTNA 3TLEA 3RAEC 3ZJVA 4LTDA 1B26A 3KAQA 3T3HA 4CN9A 3G2IA 4IZIA 5BQOA 3RVQA 1YOVB 3GRUA 4R01A 4EGCB 2QPAA 1U5AA 3CIOA 5P8WA 1PWZA 4FX2A 3Q40A 4HC4A 4MIEA 2O8VA 4ZWNA 3U3RA 3ZTWA 5AVXA 4W63A 4BQNA 4K6MA 2OFFA 1TTPB 4E88A 2VZ8A 2P5YA 5CA1F 1YASA 1CSEE 2MMGA 2Z5FA 3DGEC 1QAOA 1Z33A 2FW0A 3D6FA 1DKPA 4LGVA 1ZHOA 4V0SA 5LDHA 1OQAA 3D5QA 3KJZA 4A0HA 3KETA 1MT0A 2H4YA 4EF5A 5FUVA 5GJBA 2QSZA 3HKDB 4LE2A 1SAYA 2J32A 1DXHA 2X4DA 3MQ2A 1Z4NA 2J6CA 1NHWA 2B4AA 4AVYA 1JEYA 4JI7B 3LT1A 3B8EA 2EIHA 2FR8C 4PFKA 2QRQA 4YAOA 4URYR 4X9XA 5BQPA 2YW9A 3GRZA 3WXMA 2WFAA 5JY6A 4BO8A 4TN5A 5BN5A 1H2FA 3DZGA 3HSSA 3OMLA 1FLAA 4FEGA 4UQOA 2BTOA 4GNRA 1G5FA 1Y7HA 2YDXA 3EPRA 3WRXC 1DL5A 1OLOA 2PCLA 2J0VA 5BPFA 3MOGA 2XV1A 4RD2A 4P4NA 3EDRA 4BB0A 5LQMA 4QECA 4BATA 2GZ2A 4QODA 4CG2A 1ENZA 1JQJC 1YZNA 3ZWWA 3KYDA 1UWKA 1W5AA 5CVUA 3RBZA 1JA1A 4KXYA 1TL7C 2Q4DA 5TS2A 4HV4A 4DV0B 3NIDB 1Z62A 1RHQA 3HYTA 5H59A 4O2BB 4UOEA 2W00A 1CQXA 1NMSA 1LDBA 2J6HA 1JU4A 1C9KA 4TLMB 3D02A 1ZXLA 3ZU2A 3OIWA 2HDHA 3C39A 4MS4A 4KFSA 3OESA 3BICA 3JARA 2W2TA 1PO7A 4FKZA 1E3IA 1P7YA 5DGDA 4F8EA 3I76A 5IXJA 3ICOA 2CNDA 3WC4A 1J8DA 3ROXA 5B7QA 1UK6A 2KW5A 1RXWA 2PX5A 3LE8A 4O5OA 3K0AB 5IXYA 1I7NA 3SBOA 1PL6A 4U7WA 4RH3A 2XA1A 3FJYA 1RC1A 2XCLA 1E89A 2YBEA 4XDGA 3UGQA 2AK2A 3PHBE 4BBZA 1U63A 2JGKA 1F4PA 1YZYA 3U0BA 3FPAA 2MTBA 3TR6A 3GUHA 5HVNA 2ROQA 4ZVNA 3ILYA 3Q1KA 4W4TA 4FILA 4JSRA 2HHCA 3JYPA 2V9PA 1M7GA 3F4LA 2MYPA 3NBYC 4L3WA 4NY1A 4TZTA 1EPUA 1HKHA 1NVVQ 4Y30A 4PSKA 3S70A 1ZBDA 2R86A 1FUKA 2KMLA 3OEHD 1EDEA 2ZJAA 1C4XA 1KO7A 1MH1A 1O03A 4HN2A 2GEUA 1JYSA 4J6FA 4MTCA 4QTXA 3PC8A 1PR3A 5A1TA 2H4WA 4K0KB 1TVKA 2P6UA 1LJUA 4HPWA 4NBRA 1W75A 2VJNA 4PZYA 3MBIA 1XCJA 2VXBA 3PCTA 2QM8A 1ZCFA 3QQ5A 1WDMA 4HDKB 4JOBA 4LRQA 1U7ZA 3HBAA 3H7IA 4F6RB 1SCDA 4HUTA 1QE3A 1T3GA 1ONOA 2WG1A 4DG5A 1OC2A 3S99A 2JZNA 3H4TA 2O05A 2P6PA 5JOQA 5FHQA 4WAUA 1QH9A 3EARA 2XXJA 1AKYA 3AZPA 3PDWA 1CJVC 4EA8A 1AS2A 5TJHA 1S3SA 5IN4A 3UV3A 3ORYA 1RZVA 3TFWA 3FI0A 3LUBA 2JGNA 1N2IA 4MUJA 4QBIA 4U2KA 4U8HA 4E51A 3QVVA 4RVDA 1GFWA 3AOEA 3JZFA 4E30A 1ESCA 4D8UA 1IB0A 1WMDA 4DN6A 5C1DA 2VYQA 1Q7BA 1CUGA 3MNFA 3LZ6A 3SFVA 2YHBA 4L3OA 3TUIC 4DAOA 5HNKA 2O5VA 2P69A 5JSQA 1A1VA 1WHSA 2V8BA 3GNLA 5CYOA 4C7OB 1IOVA 2NZUG 1FJXA 5HIAA 5FNVB 3EQZA 3OEEA 3EVTA 4TXJA 2IV7A 3U7IA 5EHZA 1CR6A 1WV1A 4U02A 4G1MB 1GCAA 1RKBA 4LA4A 3V4RA 3LXUX 1HE4A 4KI7A 4Y8VA 2NTNA 4TMZA 4PHGA 2FMIA 3R0JA 2CNKA 4B84A 1C80A 2YVQA 3RE1A 5HIKA 7ADHA 3IULA 4LFAB 4J6EA 4RJTA 3FFXA 4FS3A 1ZJYA 1VJCA 4E6PA 1QDUA 3K5IA 3DTVB 2IBSA 3EQ8A 1XCLA 2Z43A 4Q5IA 2IZZA 3U7HB 1V43A 3IQFA 2O0KA 4XFDA 5FD8A 1NN0A 2GDZA 3HB4X 3RWBA 2G5PA 2YTZA 1JFFA 2Z1MA 1CUBA 2Y0PA 4CMIB 3F4BA 1QF6A 2FPGB 2PUBA 1YMUA 4BVAA 1B00A 1HFEL 2DSNA 3H19A 2JIQA 4BOYA 3G59A 3K15A 2JKYA 1Q84A 5AK5A 3FDZB 4U5QA 5B55A 1UPCA 4Q0MA 3BCSA 2HEGA 4GI7A 1SKYB 4EDHA 3DDUA 2VT7A 2TMGA 4HBGA 5CYPA 4DYDA 5K0BA 1YVRA 1Y5RA 1UCFA 5JWRA 1NMYA 2ATEA 3H65A 3OX3A 1TQHA 4KGZA 4ZJYA 3R9XB 4HHEA 3JQ8A 4FR5A 4UHCA 4BDTA 2FR0A 3LT0A 2ZXFA 5JS8A 3QWFA 4XASA 4FMCF 4OGLA 3IA7A 2R8RA 5AXDA 2Q3HA 4OYLA 4W5HA 1U6IA 4WKOA 1COWD 1I4DD 1ZP6A 4C76A 4CODB 5K3EA 2D7DA 3WWPA 1FJGB 5MHTA 1BVRA 1YS7A 2FY8A 3AV0B 3PXBA 4R1NA 4U2GA 1GZ4A 5D6NA 4UMFA 2IL1A 1VKHA 1M2VA 2HMAA 3SWWA 3EOBI 3IDAA 1IB6A 3I61A 1O57A 2AFIB 3OLQA 2QVGA 1AO3A 4HDSB 4AWXA 1RT9A 2CJWA 2XWPA 2ZQ5A 3W1EA 1XLVA 2QU7A 3IIKA 3X1ZA 1GN9A 4LOLA 2H85A 4B75A 4RFLA 1A4XA 3GWZA 2ZIFA 2ZPTX 4L9RA 4F97A 1GOTA 3CKYA 5IJXA 4E1BA 5H83A 2B94A 2C3OA 4R8VA 1F0NA 4P4GA 3IKLA 3PUKA 2F4NA 3KK0A 3LO8A 1N57A 3DHWC 1TD1A 3U7JA 4NV1A 1JDTA 1LXCA 4N3GA 5JASA 2ZT5A 4CV1A 3V8MA 3ADBA 1NQOA 2FOIA 1UM9B 1CIJA 1L8LA 4YI5A 2CXNA 3HDHA 3W8FA 4CMIA 3PLRA 4MV5A 4OGGA 4JCOA 4NECA 1F51E 1N8SA 2GTHA 4WZBB 1P5JA 1TA9A 3TK1A 3BL8A 4XKJA 2HSGA 1UANA 4NFHA 5FWAA 1K3FA 3DBHA 1MN6A 4EL5A 4YR9A 1XR3A 4WUTA 5CTJA 5LA6A 1X7ZA 2PZAA 1XMJA 3E27A 1YJBA 3PGKA 4U9UA 4YDQA 4I1PA 1Y37A 4E5YA 3H9EO 2EZ4A 4FTWA 2GF9A 1CUJA 1TQ8A 5JS1A 5FUQA 3UAZA 1AN0A 2RH9B 3EAQA 1WRBA 2G4LA 3WJAA 5JJIA 2CF5A 1VHTA 4DMFA 3UW3A 3A1FA 3JATB 4NR0A 3OTQA 4OKIA 1CBUA 1JJBA 2A3RA 3L8FA 4IX9A 4OH7A 1NRJB 5TF0A 5DBGA 3TM4A 4ENQA 1CQWA 2QR3A 4NAUA 2ZOSA 3VRHA 4C87A 2AXQA 1MX1A 2ATVA 4PINA 4KXQA 2NVWA 1PGOA 4JUFA 4Z7NB 4BP1A 4GM1A 1NXPA 2JHPA 1AQNA 2GA8A 3B82A 4TSFA 4XX1A 3ZHXA 2FXVA 1UH5A 4ZO9A 4DXHA 1GQFA 1IQPA 1UZAA 4H4CA 1AKUA 1J49A 3W79A 4AXXA 1U9ZA 5FFFA 4HFMA 2CUKA 4JS0A 4AJNA 2KX7A 2DH6A 4RM3A 1V5WA 2X5NA 1M3SA 1P74A 3B6IA 5LD2C 3DO5A 5FPKA 3EXEA 5FBWB 5JQGA 1I0LA 3I1YA 1ISMA 1IPFA 3PITA 4IVNA 1L4LA 5AUOB 1JDPA 1FP4B 3RGWS 4KWIA 1JIVA 2Q0QA 1CKEA 2H16A 1N5OX 3PFNA 2CXOA 1I3OA 3KD3A 4LX0A 4N8EA 4OHKA 5SY9A 3UFBA 1T0BA 4TSKA 4KUGA 4XDHA 4MH0R 1BH2A 1C30B 2H2AA 4B7ZA 2CHGA 3CBGA 4MJ3A 2YVUA 4OJMX 4QDUA 4KVZA 2XOEA 4A8HA 5EIBD 1BHO1 5AW1A 1BWPA 3KR2A 3R24A 4S35A 3V1UA 3FDJA 1X7XB 3ZK7A 5JFGA 2XLCA 2FQ1A 2WF7A 3UMSA 3K8OE 3ESAA 3ZHCA 4YRKA 3NAQA 2UUBB 1PFWA 3WOHA 3FAZA 1THGA 4V24A 4AECA 1QGAA 1Q1ZA 2OGTA 3FZGA 3TR5A 2N3ZA 4M1OA 4F04A 5IN5A 2WV9A 3WTBA 4XDYA 1GP2A 1EGQA 3C6MA 3KLMX 3U3DA 3BSWA 1ZCJA 1N4AA 2OYRA 2VJPA 4JDPA 1NBIA 1ZOOA 2QDKA 5GM2A 1H1LA 1HR0B 3V2IA 3U81A 3HFRA 2PE5A 2PTGA 2GMWA 3H3XA 2HM7A 3V3TA 1OWLA 1VP3A 4Q7KA 4MQ5A 4XCVA 2A4KA 2Y76A 4RDIA 1JQDA 3OD1A 4FK8A 4U6QA 1JI3A 1PEKE 1ZK4A 3OLCX 4FJ0A 5LIRA 1GITA 2VN8A 3LYHA 5KIAA 2WWGA 3FKSA 1OXTA 2JK1A 5D3KA 3EF3A 1CU1A 2AD1A 3IB6A 4KKVA 4X7PA 4EY3A 1XTUA 4MSUA 4M9QA 4AS1A 2XXAA 2Z4RA 2EHDA 1LEHA 2H11A 3LUJA 4FS8A 2VXOA 3KKLA 4BLPA 2X14A 2FMTA 1X1CA 3B9QA 4HAIA 5IHXA 1ICIA 3IV7A 1SBIA 2IYPA 1MJGM 4RJKA 4YB8A 2OA0A 1M75A 1M1YE 1KJWA 4M54A 4MW4A 2YYYA 3NYRA 4DZRA 2HK8A 3IP1A 4P5PA 3OOJA 3VDXA 4S2EA 3FY4A 2VBFA 2H1CA 4KIGA 3QYAA 2XOKA 1V16A 1V0JA 1XHFA 1ZSYA 2XMRA 4UCQA 1O96B 3OY7A 4BFLA 4AXBA 4YAJA 2XXBA 2MYTA 4C4TA 5BYAA 2C3UA 4JGGA 1O96A 5HJEA 2XCRB 1PE0A 2O2DA 2EF0A 3NKLA 4L02A 3H11A 5TSDA 4BAUA 4JVNA 4BU0A 1FYFA 1P2VA 2HWYA 5E7MA 3BHNA 1N9GB 1LTQA 1VC2A 5C81A 3O8NA 3UMGA 3EPHA 4C0WA 3PQ7A 4QICA 1C0LA 1BW9A 1DKNA 1GO2A 1V6CA 2AOTA 3ZCTA 1Y7LA 3DZDA 1HTTA 3UEOA 1J9GA 1TB4A 1E0SA 1TEXA 3DO6A 3GEPA 3Q0TA 4AG6A 5JROA 2IYXA 3THXB 1LGYA 3DZIA 5AW0A 1JXAA 1G20B 1VIAA 3NORA 1ZR4A 5DF1A 5JLJA 1R64A 3ZTTA 3BGDA 5B1EA 1T5HX 1CUAA 1EDOA 4J0KA 4JQCA 2ZUVA 3K30A 5ICEA 3AR8A 5B5SA 1W30A 4S1OA 5KVAA 3LMKA 4ATNA 1NVDA 3ABSB 3ITEA 3KHSA 2M6SA 3AP1A 3DQZA 3LK6A 2G06A 2ZEJA 3M2TA 4MS3B 4YP0A 3ZW9A 4DYHA 1USUA 2FX5A 2IU3A 3VPCA 3OM0A 3JQAB 2IW3A 1KSFX 4IXDA 5BQXA 3OU6A 4HPXB 3RSZA 3HKEA 2BISA 1BXGB 2CNBA 1MRNA 3IXQA 3N2EA 4Q4DA 3PWTA 2PSHA 4HNHA 4QXOA 3UB3A 5G1NA 3OPXA 2ZR8A 1H23A 1SK8A 1YQQA 2WIBA 4NCAA 3HLTA 4J7AA 1LS1A 2E5LB 1NX6A 5EZ5A 3EGDA 1VKNA 1Z75A 1TI7A 3U4CA 4NEHB 2HQBA 3ES9A 4L0QA 4B40A 1GG2A 3UOAB 2IXTA 1NSTA 2JZCA 3GLGB 3G02A 3A3PA 2QUZA 2RHHA 5A71A 1LBSA 3LY5A 2D7JA 1F6WA 2PGNA 4GVPA 4PXAA 1GPYA 3TB6A 5MF6A 3LY9A 2IY9A 5EA2A 3ETNA 3DCNA 4KC0A 4AJLA 2IH2A 1FU7A 2IDZA 2GD0A 3G0BA 3QEAZ 5HRUA 2NZ2A 1NUUA 3OM1A 2IYFA 4DMGA 3SR3A 4WKCA 3WAKA 5IC6A 4IYRA 2X3UA 1KF0A 2R8XA 2JLSA 1D2EA 4X0EA 3BMOA 4IS3A 1DTSA 3O4HA 4OSPA 3T12A 4EJSC 4FT4A 2QQGA 2QYTA 3OD5A 2Q1YA 2WHPA 3ANMA 3FSEA 4QGGA 4D4GA 1DQZA 4KE7A 4RD3A 4G9GA 1E3WA 5K6RA 4ZIRA 2BR4A 4R71A 3AM3A 3ICVA 3MOIA 3MTAA 5E2BA 3DD1A 4F06A 3NZEA 4KQ9A 1ZESA 2RGYA 1XP8A 2YKGA 4GC9A 4K9OA 1QE5A 1WZUA 2Z8XA 1YA8A 3L7AA 4H15A 5IDWA 2IWRA 1PEYA 2JGFA 2BMAA 2C5BA 3ILVA 1DI0A 4OXXA 2HRCA 4XDZA 3RUCA 2R4QA 4OXKA 4DG8A 4CF7A 3HI4A 1GR1A 2FDCA 1QH8A 3HU3A 3DDCA 3EGVA 3T94A 1XQVA 2H4ZA 3PC2A 4ISCA 3TIVA 3NNNA 3DVLA 2JB9A 3BFPA 5LJLA 2VR1A 1P19A 2UYGA 5F4BA 4D0LB 2YX1A 4EZBA 1W93A 1AMNA 4WEOA 3C3YA 5FULA 4DEVA 1NW7A 1VCHA 4LJ4A 3LT5A 1DP4A 1SUAA 1F4LA 3I0ZA 4HGQA 1FYVA 2JHCA 1H85A 1P0CA 1Z39A 2YVAA 3MQFA 4B2LA 5LJIA 1P9NA 1U28C 1EDBA 1VG9B 4IJWA 4MYHA 1GPKA 4F4DA 2WR8A 2BC9A 3DC7A 1HT3A 3N2YA 2DWCA 1F9EA 4WKNA 1E2EA 3LOPA 5LLDA 4HAXA 4J2HA 1XZGA 5C5EA 1A7AA 2PL9A 2HQSA 1NBHA 1G9XA 2Y1OA 3DCIA 3E3LA 3P2KA 2GPAA 1TM5E 3CNLA 1T6BY 3QMVA 4I55F 1UC5B 4L6AA 2EF1A 2D2XA 4JI0B 4FDUA 1PU2A 3IAEA 3AYXB 4Z9AA 3CLVA 2WNIA 4TKZA 3DMRA 4A15A 2B1QA 3JAKA 4P4UA 5AKHA 3UJPA 2UXBB 3IERA 3BGIA 3ZJUA 3HCRA 2XMPA 4DVJA 2ZB2A 1M66A 3LW7A 5KYYB 1I2BA 1J7KA 1DPGA 2PYIA 3FNBA 3LAWA 2CXSA 1ETHA 1GYQA 3LNTA 1Z2EA 4PLFA 4PZUA 2ICAA 1W9HA 4UUOA 4MGEA 5LVAA 3KZMA 3TTTA 4C7JA 4NZ9A 1E69A 1JB1A 1RRFA 2I2DA 2JIZD 3OCVA 5I9BA 1L5LA 3JYLA 3RSCA 1WTAA 1IHOA 2C31A 3TBHA 1DVRA 3BRWD 1U3CA 1E3WB 1Y3FE 2UYOA 3MJ4A 1UPTA 3T95A 4B31A 4G1CA 5AVZA 2OE2A 2C7GA 3ODPA 1JSLA 3KPVA 3E5HA 3RU9A 2V55B 1YZ3A 4E12A 3UJAA 2Q3MA 1XMIA 1R27A 1YQXA 2XNHA 1RU3A 3ONEA 4LJSA 2F2TA 3UJ6A 5JCOC 3OTOB 3MB8A 1NJGA 4J9UE 2W6PA 2PVSA 3VX4A 5KNCD 3PC8C 3REQB 2O2ZA 2YIVX 3KOUA 1RHRA 3EGXB 5CW1A 1N5IA 4EB8A 4W8GA 1XD2B 1ZNXA 4TXLA 2PH5A 1A3CA 2VT2A 3O0TA 2YICA 3U37A 4ABTA 1PQWA 3CT6A 4P4SA 5LQSA 1TK9A 2HT6A 4PVCA 2QTAA 5TQ2A 4BMYA 4JCCA 3VKFA 4D9IA 2NZXA 2GHQA 3FUUA 1X1AA 1BS2A 2DFVA 3R5XA 3GCXA 4CGZA 2P0EA 3IOCA 2Q46A 1JI0A 1OH7A 4HRVA 4OAQA 2BF4A 4NABA 3W4KA 4J9VA 4EF4A 4BWGA 1SZPA 4GGPA 4RZSA 3WB2A 3I2YX 1GZ7A 1U0RA 4FE4A 3CA8A 3GY0A 1MU0A 2QX6A 2XEDA 4H7DA 1I0IA 2X1HA 5CIWA 2Q7OE 1MC8A 3OTGA 2Y1GA 2FE1A 3ONNA 1FK8A 1W85A 5CT8A 2C7RA 5FORA 4Q39A 5EJFA 3HP4A 3EVZA 1EVIA 3SYLA 3LECA 3H2SA 5CBPA 4J91A 4JU9A 4O2AB 1MX5A 4XQ9A 1XTKA 2A30A 3GLHE 3M4JA 3ZV7A 3ML1A 4I1YA 3ESBA 3BWCA 3NGLA 4UE6A 3WA6A 4AZ3A 1RWNA 3B1WA 1TU3A 2V6IA 4CW7A 3GPDG 2HFKA 4W5OA 1D2AA 1G63A 3EYWA 4OYYA 3ZI4A 3A27A 5JBNA 1VZ2A 4NZMA 1CUVA 5B30A 3ROQA 2V6FA 3U39A 3P20A 3I1JA 4CUKA 3FHTA 2QMOA 2WVHA 4WV3A 4HF7A 3TN7A 2I1LA 1FYXA 3ZZUA 4BWYA 1HG1A 5D01A 4JQOA 2BJVA 4S2UA 1GA4A 3GBVA 3A3KA 4WCFA 4ACBA 3AETB 3UKOA 4QEKA 4DLYA 3SICE 1MDBA 2ZIWB 1G7RA 1T4CB 4L2IA 4R68A 2ZVQX 1DEXA 2E4YA 4DY6A 1ABFA 4B47A 2GXQA 5FPYA 3PHHA 3R0QA 2X2PA 2NADA 2PYZA 1ZSNA 1CTQA 3OCXA 4BNNA 1NPTO 4NMMA 2BR3A 3CWZA 5DT2A 1NA5A 1L7VC 3G17A 1H1DA 4BRUA 4ZU1X 1FBTA 2AG5A 1GGNA 3A11A 5LUBA 4BGIA 4QM6A 1LX7A 1I3NA 1H93A 1Y6JA 4RVOA 4R1PA 2O8CA 4ZV7A 5D3MA 1PT9A 2P9QA 5AKZA 4S3MA 5FR1A 3CWCA 4E2FA 2ZRDA 2DQZA 2WVGA 2DPXA 2PMBA 2CJXA 3W6PA 4NMLA 5KSYA 5MDHA 1T36B 2PIDA 1PHRA 3QPAA 3JARB 5FAKA 4O6VA 2AL7A 1DMRA 1V7ZA 2VHCA 2BFMA 3GZJA 3IE2A 1CYDA 1JHMA 1SU4A 3DVAB 3LLSA 4FC7A 1NXOA 2QW8A 2YWGA 2NTJA 2OVBA 3NFRA 4CGYA 3O9MA 2F9MA 1MJHA 3F8WA 3OE7A 4D56A 4D9GA 3TQHA 1XNJA 2A9QA 4MWZA 4B45A 1HTWA 4Y6OA 5FPTA 3VVBA 2P2LA 3C74A 3MWFA 3L5KA 4Z1MD 3FYUA 2FB9A 1Q15A 5K3OA 3SIXA 3E9MA 1EJ2A 1VKZA 1ECBA 3FLAA 3FSGA 1E2IA 4P4TA 5HM6A 4PNZA 1G19A 3MWEA 1POWA 4WXMA 3N0RA 1TYZA 1RPAA 4XFJA 4HNQA 4DADA 4U2DA 4J8PA 1JDZA 4CMKA 3PUWA 1L4YA 1PJ8A 4RUKA 3T9AA 5IBCA 3DL0A 3T34A 5JISA 1EFTA 1W0CA 3UGKA 5LB2A 2G1PA 2DYKA 1NWCA 2O1WA 2XGSA 3LBFA 8ABPA 4Q18A 1QB7A 4QNNA 4RZQA 4IW3B 2I33A 3BMOB 1EEHA 5EIHA 2XH8A 3HLKA 3IOYA 1NJSA 5JVDB 4AM8A 4POOA 1E9VA 4NHOA 4M1QA 4CN8A 3ERCA 4MQ6A 4F8YA 4UDYX 4XSHA 1G3MA 1QVRA 1JSRA 1Z2AA 2VPXA 4BNHA 5T67A 3R9WA 3AL3A 5I9MA 1CVRA 2IF2A 4I14A 4UBIA 5BRAA 1EHYA 5JQGF 5K3SA 2MYNA 4JSYA 8GPBA 2QRKA 3P96A 1WDWB 1XYVA 1YNSA 4W5JA 4WN9B 1GG8A 4Q9JA 1E3MA 1YUNA 3LDGA 1JLKA 2VZ9A 3VXKA 4E21A 2AQKA 3I37X 2GZRA 2I6SA 1XMPA 4FFVA 3TLXA 2VF2A 4TZKA 4K05A 4R1UA 3FVWA 4CQMD 1IG0A 3LPMA 4U7HA 1KZ4A 9GPBA 5ALPA 3NATA 3CG0A 5EP1A 5LQCA 2ZJ5A 1YT5A 1RPZA 1JB9A 4I1RA 2VF5X 4H1WA 5J59A 1RJWA 4R8SA 1KI6B 4O4HA 2ZWVA 4M87A 3D7KA 2R8PA 3LBAA 5L95A 3WYDA 5BSGA 2IHUA 2SKEA 5J4LA 1MAVA 1MJGA 2OECA 2YWRA 2V7BA 4FEAA 3TFOA 2X2OA 3HKDA 2NXCA 1VLMA 2DXIA 4XQGA 4B8WA 3RUPA 1PWXA 1JEJA 1ZGAA 4GYKA 3WWOA 2CT8A 2F8TA 1D0SA 2G04A 2QVYX 3M4XA 4K6GA 4HH4A 4YP7A 1PV4A 3IQIX 1EH5A 2FUKA 3MRVA 4IH9A 1PGQA 1XTTA 4ENVA 3WYCA 1QHNA 1LLUA 3M4ZA 4C0BA 1NXTA 1M74A 2WJAA 4H7IA 1HETA 1YDFA 4R40A 3WB0A 1CDOA 1GRRA 1OFGA 3L1IA 4G56A 4EI8A 3W5AA 1FMJA 1K66A 3D3NA 1O5TA 1QIMA 4ML3A 2WF5A 1J5EB 4UASA 1EVYA 721PA 1BQEA 2E5WA 2FW7A 2J6IA 3D8SA 3QFTA 3IV6A 3I9V1 4KDFA 2Z2JA 4RXMA 4UC0A 5CIYA 1BC5A 2K87A 3VYSB 4A8JA 2IP2A 1Y9ZA 8LDHA 1HORA 1TDJA 5D86A 4EB6B 2QY6A 1HURA 1OMOA 2RFLA 2H1IA 3QPWA 1D2GA 1FX1A 3D6HA 4UUAA 4MRMA 4CLHA 4NHEA 4QDJA 5E6SB 1NX9A 1EGVB 3ZNNA 3F4KA 4UVGA 3RNOA 3JCZA 1PFQA 3BL6A 4LF4B 2A1UA 3RJ5A 3RJTA 4UU1A 1AGNA 1K0UA 2QTBA 3NI2A 3QVGB 4QU0A 1KE2A 4S1NA 1H3EA 2ZYDA 5A3RA 4XM1A 2AWNA 3VHRA 4MCAA 4Q00A 5KUTA 2OHHA 3I1FA 2H1HA 2KSQA 4FFDA 5AJVB 3ZE2B 2LIPA 4WN9A 2XOKD 2HV8A 4F60A 1QIJA 1YH3A 5HKLA 1EDDA 4CCWA 2Z2XA 2IYEA 3F5SA 5AM1A 1YRLA 5LQRA 2Q5HA 3ECSA 2IKQA 4PG8A 3H16A 1PV2A 3M3HA 4B6JA 3EX7C 1BKDR 1KEPA 4YJ2B 2I2XB 4L16A 4CNBA 4IIYA 5J4KA 3PEWA 2Z6AA 3HHEA 3QWAA 5IJAA 1Z4KA 2GXAA 1J8VA 3ASUA 2ZUDA 4KVAA 4M7WA 3DTVA 1EP9A 2I1WA 4K9SA 3CT4A 4KX3A 2QTRA 4UAVA 3WRYA 2DU8A 1U7XA 2VQ3A 2WZDA 1SO8A 2B8TA 2ZDGA 4W8HA 5EUBA 3VYTB 3KAJA 1OU0A 4BNFA 2FRXA 1BX3A 3R77A 1ETUA 3E7PA 1JTVA 3WMEA 1SCUA 1WY7A 4WOPA 5T8KA 2C7BA 3VC1A 4DCUA 3AESA 1HMPA 3RYIB 2D1SA 1KMCA 3JQPA 3WHLA 3SJ7A 4MHSA 1TAQA 4YRLA 5DN6A 2BKXA 1PEDA 4C9BA 1IQRA 3DV0A 3DV9A 4EVRA 3AJ8A 1J39A 4ALIA 1ZK1A 3RFTA 1FSZA 1SBHA 1XRQA 4ZC8A 2G9QA 3GMDA 5DHAA 5J5VA 2VWQA 3AHCA 2GILA 1XZFA 4G1FA 1MRSA 1ODKA 1Q0ZA 1ZUNA 1RBZA 3PGLA 4RPLA 1XAHA