3OLYA

Structural and functional effects of substitution at position t+1 in chey: cheya88m-bef3-mn complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
b'ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTMEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheY
publication title A Variable Active Site Residue Influences the Kinetics of Response Regulator Phosphorylation and Dephosphorylation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 45
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3olyA00
1S8NA 1D2AA 4D6YA 1NXTA 1W9HA 2IPLA 1BDIA 2MYNA 2YHAA 4Z4HA 4D6XA 4G97A 5FBHA 1L5ZA 1I3CA 3CNBA 4HYEA 2N9UA 5EWLB 1TVMA 3RVPA 5HSGA 3JTEA 3OM0A 5KC8A 5T7BA 3QLUA 4H3HB 2R4QA 1FFGA 3HJFA 1JHZA 2FMFA 2OQRA 2L18A 5EWJA 3S99A 3LMKA 3CG4A 2CHEA 4Z9AA 3NBMA 5DKFA 5KWSA 4NICA 4G86A 1CYEA 4EYGA 1EWTA 3HDVA 5IUKC 1Z2DA 2PJUA 3C3MA 5KC9A 3LUDA 1NXWA 1U8TA 3SM9A 3TX6A 5F64A 4MQEB 5HKOA 4HNQA 1DCKA 1LBIA 3FMVA 1QP4A 2FSPA 3IP6A 4UHJA 4MLCA 5TPWB 1NY5A 1R8JA 2I6FA 3KLOA 2PKXA 5T3YA 2H3HA 1LK0A 4IILA 1DRJA 1YTUA 1F4VA 1ZH2A 3N0XA 3O75A 3NNDA 3O1HB 4LDAA 2LUOA 4HNRA 2BGGA 1PEYA 2E4YA 3NNSA 2A9QA 4LZLA 4IRXA 1DJMA 3F7NA 1JFSA 3HUUA 3I42A 4RXUA 4EYQA 3IP7A 3JPWA 5FWYB 3H1GA 3H6GA 2WJAA 2J48A 7ABPA 2QR3A 1EWKA 2FMHA 4G0OA 3R0JA 1BA2A 4EUKA 4JB0A 4MS1B 2P9HA 3DLHA 3LUJA 3FDFA 4IMJB 3HV2A 5B3JA 4IGAA 1L5YA 4DADA 3SQNA 2B4AA 2P4UA 3QX8A 5CNJA 3HK2A 3QLTA 5EWLA 3D8UA 3ILHA 2HSGA 4Q6BA 4YS6A 5JNSA 3CZ5A 2MSWA 2NZVG 5ABPA 3M9WA 1WETA 5IEBA 4F06A 1YVUA 2B1JA 3N0WA 3K4HA 3OLYA 4S05A 5IULC 3OQOA 3FFWA 2PLNA 3H1EA 5FWXB 1RZRA 3UKJA 3CKMA 5KQMA 4YR7A 2PUAA 2FQXA 2JVIA 3DZDA 1NXSA 4ETIA 5E3JA 3ROTA 3GYBA 4KQCA 3H5IA 4MRMB 4M88A 5JNRA 4RY8A 2LPMA 3OM1A 3RVRA 1Z26A 2RDMA 4RK5A 1D4ZA 3M9XA 2NT3A 5I4CA 5DTEA 1DC7A 1Z18A 4Y9TA 1D5WA 4RS3A 2WMYA 2JB9A 3VNBA 5TPWA 1BDJA 1GCGA 1U0SY 3LUKA 4EGSA 4KREA 4YP9A 1FFSA 1YS6A 1ZH4A 1A2OA 3O21A 3OMXA 2AYXA 1GLGA 4KVFA 3GWGA 3IP5A 4IF4A 1GUDA 1XHEA 3I45A 4Z0NA 4WUTA 3KKEA 1D1QA 3UUGA 2F8TA 3GV0A 5KQPA 1DCMA 4W5NA 3HM9A 4LE2A 1FSPA 3SAJA 3KG2A 3KYJB 5FWYA 2FW0A 1KMIY 3LUAA 4P1ZA 4W5RA 1JDNA 2FXIA 3L6UA 1FQWA 2MSKA 1QKKA 2FN8A 4JA2A 3M6MD 3QELB 2FMIA 1E6LA 4MS1A 2A9OA 3CZCA 9ABPA 1QQBA 1CEYA 4WWHA 4L4UA 1MB3A 1ABFA 3OQNA 1RZRD 4RV5A 4XAQA 1EAYA 2PE5A 2FEWB 3ILYA 4MQFB 4RSMA 1VLZA 1W25A 3T38A 1P6QA 3HDGA 2JVKA 2CWDA 3CRNA 4LX8A 5TQ2B 1USIA 5JNTA 2VUHB 4RK1A 1LJLA 3T8YA 2E4XA 1DBQA 2NUBA 4YV7A 1J56A 4YWHA 1SD5A 3I09A 4W5QA 1YK1A 2IYNA 5FWXA 3H5OA 2L19A 3JS5A 2PL9A 3Q7RA 4RU1A 2RJNA 4MLDA 4WT7A 4N0QA 1YMUA 4MRMA 2W42A 1KRXA 1OXBB 1ZVVA 1USKA 3O74A 1NXPA 1LBHA 1JX6A 4XARA 4Z4GA 2AYZA 5BQ3A 2NT4A 1AB5A 3HEBA 1ZITA 2FKAA 4WZZA 3H1FA 5D2CA 2IPAB 4RZSA 1ZDMA 5CNKA 2IKSA 3CFYA 1P2FA 4XFKA 3DLBA 3CTPA 4N03A 4WXEA 3Q7TA 2GX6A 3ROFA 1VRVA 1D1PA 3H5WA 5KI6A 3LUHA 4MS3B 1APBA 5KQLA 2QU7A 1DBWA 2HPHA 1ZN2A 2HQBA 4Z4CA 3MF4A 4KV7A 2X7XA 4XLTA 5DGCA 5IBQA 4ML3A 1HEYA 1U04A 3LUCA 4Z4FA 2DRIA 4EY3A 3A3KA 1XHFA 3A0RB 2MYUA 1B00A 3JPYA 5GOTA 3W9SA 4ETNA 3SG0A 1XWWA 3L49A 2JK1A 2R47A 4FE7A 4PICA 4QICA 5CNMA 3F6PA 5C5CA 5ED4A 2QV0A 3KSMA 3O1JC 3HSYA 4G0ZA 4LRQA 3RH0A 1SRRA 4ZMRA 2M1ZA 2WY2D 4N76A 1ZY2A 3EAFA 2L2QA 5IUNC 4KK3A 2ID7A 4OBBA 3B2NA 3O2QB 4G0YA 4MQFA 4ZMSA 4W5OA 4NCAA 3KTOA 2MYPA 2Q5CA 4RY0A 3RVOA 1E2BA 4TLMB 1JDPA 1RXIA 1PNRA 2E4WA 3CU5A 3GT7A 3DGEC 3MMNA 2LIVA 2XDYA 3HS3A 5CHYA 4QPJC 1ZAYA 1DBPA 3RVSA 3E3MA 4YO7A 4PE5B 1JL3A 4G0PA 2LP4Y 3RVLA 5DLEA 1K66A 3KS9A 2WRZA 4P98A 4YGXB 1UDRA 4MGEA 3RVMA 4JP1A 3IPCA 1JFTA 4RKQA 4PYRA 2GI4A 3T6KA 2PUFA 3FGZA 6ABPA 3CS3A 3QEMB 4ZJPA 3F73A 2R25B 1SXGA 2GWRA 4W5TA 4JB2A 4E7PA 4MQEA 4IMIB 5IX8A 1NATA 4OLAA 3QLVC 1DCFA 3RVJA 4EVSA 3HVRA 3QLVA 1P8AA 2ZAYA 4MS3A 2A9RA 3IP9A 1PHRA 3K9CA 2IPNA 4RWEA 5TQ0B 1MVOA 3EJWA 3OO1A 1IIBA 2VYCA 1BVHA 1RXEA 3Q41A 3TB6A 4EVQA 1P6UA 1OXKB 1PEAA 3I5AA 3LFTA 3MM4A 3OQMA 3EULA 2QVGA 5C5EA 2VK2A 3BRSA 3FFTA 1ABEA 3H75A 4KK4A 2JVJA 1M2FA 3Q7SA 3LUGA 1PNTA 2E4VA 1Z15A 1EWVA 4F3TA 2FQWA 1BAPA 1T34A 3EQ2A 3DBIA 3G85A 4F11A 4O1IA 1GUBA 3LOPA 4JASB 3GBVA 1QPZA 1E6KA 1JLKA 2H0AA 2FN9A 4G0XA 2QVCA 3H5LA 3DGFC 2QSJA 4PZ0A 5BR1A 4XASA 3RQIA 3KHTA 3MYYA 1EHCA 2A9PA 3Q9SA 5TQJA 4ZYLA 1KGSA 2WWVD 4ETMA 2GBPA 4RK6A 4MS4B 1ISRA 2PUEA 4HNSA 3Q15C 3OLXA 5CNIA 3EGCA 1Y1LA 1AB6A 3CHYA 1Z17A 4LDZA 3TMYA 1EFAA 3A10A 2HJ9A 4MYRA 3N8IA 1PUXA 3H6HA 4N47A 1QQAA 2FEKA 2PUCA 3LKBA 1BDHA 4KZKA 1C0EA 2QW1A 1YK0A 3RVKA 2JRLA 4Q6WA 3CG0A 2PL1A 3KCNA 4Z4IA 2V0NA 1M2EA 1URPA 3TD9A 3G1WA 3MA0A 3T95A 3O2JA 4KMRA 3O1IC 3LKVA 4DQDA 3BRQA 1U2QA 2PMCA 4PEVA 1JF8A 3N53A 1QO0A 3BILA 5TE9A 2FLKA 2PUBA 5FBKA 3GA5A 3RVNA 3C6QA 3IDOA 4MR9B 1Z13A 5TQ0A 3URMA 4H60A 3N75A 3QLUC 3QEKA 3MIZA 4OG2A 4EYKA 3SY8A 2E4ZA 3NNNA 3GL9A 3EDCA 2YHBA 1YMVA 2TMYA 4EYOA 4OLBA 1GCAA 2FMKA 3VNAA 4RDCA 3H5TA 5HM6A 1A04A 1MAVA 3GRCA 4F12A 2F8SA 1TM2A 1H9CA 1JBEA 1K68A 4KFCA 2FLWA 4QYWA 4TLLB 4Z9BA 3TO5A 3IPAA 5IC5A 3JVDA 1LJUA 2WB4A 3N0RA 1QMPA 3HUTA 4YLEA 1QP0A 1DG9A 1M5UA 1TLFA 3EODA 4MR7B 3QELA 4Z99A 5TPZA 4F8JA 5DCLA 1MIHA 4KNYA 4ZPJA 3QK7A 4Q7EA 3UK0A 1JYEA 2ZWMA 1JH9A 1DC8A 5BRJA 4N0PA 3O2SB 5EWMB 5KQGA 2IPMA 4H3KB 1YS7A 4MAAA 4MS4A 4LE0A 3BREA 3P9YA 2RGYA 4RK4A 1RPJA 3A0UA 5TQ2A 4O1HA 3FFXA 1TMYA 3KYIB 4NV3A 1SXHA 3JVIA 4LE1A 4D74A 4E7OA 1DRKA 2PUDA 2JBAB 2MSLA 4RXMA 2CHFA 3RVQA 3LUFA 1E6MA 5IUJC 1QO0D 1ZESA 5PNTA 4S04A 2RJOA 2OENG 2HQOA 4RXTA 5BRAA 4L85A 4KQ9A 1JYFA 4TMYA 5JNUA 2FEPA 3HO1A 3QX9A 4Z4EA 1CHNA 1YIOA 1C4WA 3MQ4A 3N6VA 5B3JC 5IEJA 3HCWA 2FQYA 4RK7A 4MR8B 2M98A 4JOQA 4YCSA 1U2PA 4XXHA 4MR9A 3EQZA 4CBVA 4UHKA 4G0MA 3C3WA 3F6CA 4GNRA 4B09A 1Z2EA 2IDMA 2MYTA 3CLKA 1NXOA 1TJYA 3E61A 4JAVC 4RY9A 4YRZA 1Z25A 4NQRA 4N41A 3OLVA 3NHMA 2PAFA 3OO0A 1JFVA 4G0QA 4GPAA 5TPZD 4DN6A 1ZHHA 4KRFA 3D02A 3OMWA 1RNLA 4QYMA 2R48A 2KYRA 5HQJA 3KLNA 3LTEA 3C97A 4OTZA 4TN5A 5EWJB 5JNWA 1ZGZA 1MB0A 2IOYA 3HZHA 4MPTA 6CHYA 4MR7A 1NXXA 1QP7A 1A0OA 2FVYA 1NXVA 3H5VA 1JWLA 1VKRA 4O5AA 2NZUG 2L17A 4WXMA 4KPYA 4RKRA 3NHZA 1QNLA 2LBPA 5EWMA 1USGA 5JNVA 1Z16A 1FFWA 1Z12A 2FTKE 2O20A 3JY6A 5GQSA 2HQRA 3SNKA 5JS1A 2ID9A 2QZJA 2JBAA 1NTRA 1ZGGA 2E4UA 4EVRA 2JCGA 1DP4A 4FE4A 3GBPA 1M5TA 2CD7A 2WJWA 2GKGA 3OLWA 4OATA 3HXMA 1KRWA 2QXYA 3C3KA 2PUGA 1F51E 3BBLA 3KJXA 4FB4A 3OLZA 4NCBA 1DZ3A 4RK0A 1VPWA 1ISSA 8ABPA 2VUIB 5JS2A 1SXIA 3QEMA 4MR8A
chains in the Genus database with same CATH superfamily
1GCUA 1C8LA 2Q4BA 1BHJA 2AEFA 5AP9A 1MX1A 3JAWB 1NBIA 3NUGA 4Y9SA 3AEQA 1RI5A 2X42A 2O8CB 5KYXA 1D5CA 3ASZA 3FNGA 1G2IA 3RTEA 3UNXA 4AWXA 3U4GA 3JTEA 1TQ6A 3QBVA 3FCOA 3QLUA 1SCBA 5AM1A 1UMDA 3Q9LA 4YJFB 1CS4C 1GL7A 4KODA 2FSIA 3K5WA 4L57A 4UVHA 5AK0A 1B0UA 1MKYA 4J0IA 4J2OA 4CIAA 4NOMA 1UC8A 1NR5A 2JLCA 2WKPA 5LQMA 2W71A 1TZMA 1YBFA 3IVXA 2PGJA 4E0BA 1IVYA 3DDZX 4QPCA 5HDQA 1CYEA 2BFCB 3CGWA 3JATB 1L9KA 4URHA 3K20A 1EWTA 5FPTA 4JUBA 5KKCA 3DMHA 1BOOA 3AFMA 2GCOA 5FIUA 1HE3A 3WGZA 4M4SA 3IR6A 1NXWA 4OQPA 3TW8A 3STXA 3TLJA 3I05A 3U6BA 3BTUA 1QLJA 2ACEA 2XD4A 3FUWA 1TEXA 3GELA 2F1OA 4DJ5X 3O4VA 3KD3A 3AKDA 3EWAA 4ZCSA 3TOVA 2ZITA 4EYSA 1DBVO 4K05A 2ZTHA 2IT1A 2PTGA 3QBDA 3L7LA 1RM5A 3KZVA 1H2EA 4FNGA 3TW8B 4CFZA 3GLFE 1N5JA 3N0XA 5AIBA 4OJMX 1QZTA 1LA2A 2RJ3A 3UW3A 4J3JA 4DRXA 1ES9A 3BL8A 3O26A 3AM5A 3NNSA 2JGDB 2EWWA 1OLUB 2R6ZA 4P34A 3F96A 1XA0A 5JUWA 4G5YA 4RXUA 1LTKA 1PJSA 2AN1A 3ANMA 5EJ7A 3IP1A 1Y5NA 4QULA 2RGRA 4E07A 1I7LA 4ZOQI 1SOWA 1TTHA 2B99A 4KEAA 2EJCA 1YR8A 4JI3B 1DOAA 1R6DA 5ALMA 5JATA 1ZD2P 3WB0A 1ONBA 2RBEA 2YZKA 1QRDA 3JXEA 4DJFC 3ZE6A 3K53A 4NYJR 5IXYA 1JLMA 2QMUA 1E3DA 1MZPA 1UP7A 3AUSA 4MICA 1F4PA 1SUIA 1N5KA 1PFKA 5AKYA 1CCWA 1G20A 1XRLA 3NBFA 5H1YA 5KTPA 4X62B 5SZHB 2X4LA 1U63A 1OIXA 2D13A 2OP1A 4BNMA 3DLIA 4EUHA 3AF6A 4OX9B 3JQFA 1UZUA 3VKVA 2H8GA 3F5MA 3GRVA 2E48A 1SQGA 2OCYC 2QTTA 3H1EA 4HC4A 4AZ3A 2NNLD 2YL2A 4BP1A 5KQMA 4J49A 1C0PA 2DFDA 5LYYA 3BOSA 3GLGE 3HJNA 3I8XA 2GEFA 1Q50A 2NTJA 3W8RA 3GYBA 4Y6OA 3HCOA 3AUAA 3G8CA 1OLXB 3BWBA 3O90A 1DAEA 4P5DA 2FZKA 1LPOA 5IJ9B 3WB2A 3I61A 3OM1A 4OHFA 1CUUA 3F7TA 4J91A 3FHLA 4C08A 1NPYA 2OLJA 1BQ4A 4B5LA 3EQ6A 4OKIA 4PPGA 3AESB 4WVLA 5HKAA 3I5UA 3EZNA 2JAQA 1C1DB 1S0UA 1Z8FA 1Q0PA 4KXLA 2CXQA 2QPOA 4BZXA 2C7VA 4TN1A 5IT5A 1JZQA 4X0EA 4BWVA 1MQSA 5DBFA 4I9UA 3CUEF 1KJWA 3GJ5A 1WMEA 3GLRA 4NG5A 5SZJA 4TTIA 3VVLA 1M2VA 4GI5A 3WGYA 1NZJA 1B2RA 4IF6A 4UNQA 2WFZA 1Z6QA 4UATA 1TX4B 3C2QA 1DTSA 4KBGA 4ZYWA 3H4MA 1WP9A 3DMTA 4KGZA 3ABIA 3CNEA 2VP4A 3BGWA 1ZU5A 4L2IA 3TLGA 2PT6A 1EFTA 1R9GA 4QO8A 1TADA 2WKSA 3GLHB 3L0CA 3FBWA 4HJRA 4OFWA 3T12A 4W5RA 2DBVO 2A2ZA 1P6XA 3EGWA 4HNAA 1T35A 3TF5A 4M22A 4BVLA 2DETA 2IEDA 4FCVA 4IJKA 4JR1A 1UOOA 3LDUA 1IG0A 2PE5A 4WN9B 4XI9A 5FV7A 3T38A 4DSOA 3IKLA 2R66A 4QUIA 2FAXA 1R37A 4DT1A 1RXUA 2WSMA 2WM3A 4ZO8A 1QB7A 2FXVA 5CTJA 3GEBA 3WGOA 3CEHA 2LKCA 3R4VA 1V7PC 4YFVA 4A0HA 1GKLA 1Q3TA 4U2CA 3HL4A 1VKZA 1Z5PA 4O0MA 4MULA 4Y2RA 1W2HA 2L19A 4HAVA 5JROA 4KYUA 2W7TA 1PSDA 3ZIAD 1XCPA 4MDHA 1EFHA 2XWJI 5IJ0A 4H0CA 1XVUA 3Q9NA 1G5TA 4N8DA 3T5BA 4C7OA 2G9NA 3VO2A 1PJ8A 3VISA 2DUJA 1M66A 2W42A 1OXBB 1TECE 1USKA 4AO6A 1UM9A 4X8HA 3I53A 1Z6YA 2PGOA 3AI7A 2HTEA 1XKXA 3ECSA 3FRJA 4ZARA 5JXJA 3B1KA 3GVHA 3GAZA 4P2BA 4A8HA 3L79A 1FNDA 4BMSA 1AGXA 1VI5A 1J7KA 3RSSA 4PM4A 3VFDA 4EI8A 1PWXA 2AN5A 3WWZA 2WD9A 1H2ZA 1ZN8A 3OEYA 3CFYA 2R86A 4M8SA 5EE5B 2FP3A 3ZDQA 4BV8A 3FA2A 1NQTA 1CLEA 4CKXA 2ATCA 1SQSA 4MP8A 2OK7A 3ORFA 4RIEA 1RYEA 1TU0A 2YWRA 1N6HA 2HNKA 2HU7A 3LUHA 1VDZA 3UJ3X 4CFYA 4F5WA 4R1UA 2VP5A 4XYLA 2V7TA 4YRKA 2VVTA 3IAHA 5JQGF 4FI3F 5DGCA 5EGSA 1COWA 3N8GA 3HJRA 3HDHA 2WF7A 5F78A 1GR0A 5EL0A 4DR7B 3HLTA 3L04A 4WEQA 3DMNA 5DGIA 5GAJA 3ERCA 1F14A 4Z1MA 4QBKA 2VTBA 1RPNA 1XPJA 4E5MA 1RJ9B 2WMDA 3DFKA 5G41A 5KEIA 2ZUFA 3MUOA 3MN1A 4WESA 2I71A 1XYVA 4ZCQA 2EHJA 3BZWA 2ZAMA 1U7ZA 2XMCA 4K9QA 1G20E 3NTQA 2SECE 4MW9A 1QAMA 4QDJA 1IOZA 2SICE 4RC9A 3QU2A 3AB3A 2PH5A 1N5IA 4RCZA 5IUNC 5CLJA 4HUQB 1BCSA 2KBEA 4W7IA 4BE9A 4MQFA 1LZLA 3O2QB 2D0PB 4NNJA 4Q01A 1ZX1A 2BKEA 4DMCA 2WWYA 3EXIA 4IO1A 2BFPA 4YT5A 1HYBA 5JPCA 2GBGA 1BH2A 2PSHA 3L8EA 5I7WA 4OQQA 1Q1ZA 3OU7A 3R24A 1C0LA 1KJYA 2C8VA 3WYEA 3MMNA 3UJ8A 1EFPA 4UAJA 2V74B 5AI9A 2Q4EA 1ZAYA 4A3SA 2G4LA 3AXTA 3T9CA 3PNKA 4AL4A 5A3RA 5J5AA 3PFWO 3QFHA 2P9YA 1A98A 1VLJA 1H2XA 1G8SA 1S2MA 3CZAA 1YJQA 1MAAA 4CCAA 1VMKA 1CK4A 3NLLA 3LYAA 5KOHB 1UDRA 1XCOA 4JQYA 1Q95A 5I7FA 4RKQA 1US8A 4M76B 1NYLA 1X7DA 4JVSB 1W5TA 3S8EA 2FPXA 4CGYA 2QENA 2A1UB 2H1SA 3CZ4A 2IJGX 2EZUA 3JQ7A 2OBXA 2Q8NA 4Q7LA 2WMNB 4IDAA 1RD4A 4GO1A 4NYMR 1SA0B 4DWOA 4NBUA 3KCQA 4MQEA 1KY5A 2CNBA 3ISVA 4FN4A 5BN5B 3ZCUA 5FEMA 3K6RA 2V98A 4EY8A 2C4VA 4ZT6A 1RKXA 5DX8A 3NEJA 4FNAA 3NTVA 5B6PA 5CA1A 4QEDA 3N0VA 3K9FC 1QRSA 2J9RA 1Y7TA 2XMDA 3H05A 1AA6A 2ZB7A 3CW2A 2YVKA 4RGQA 3C1OA 1PEAA 2O8NA 4HYYA 4PU0A 4B2YA 5IWAB 2HBQA 5EP4A 3LLMA 1IAVA 3T7IA 4TOIA 3GVXA 3QVSA 5DRTA 5HW0A 4KR6A 1EE1A 5FWAA 2BP7B 2BCEA 3L7DA 3ZOKA 1XA4A 4JROA 2H54A 3T3IA 1N2HA 1LPPA 5I4IA 3WKCA 1U3DA 3CX3A 3FM9A 4DMGA 1J2EA 1IK6A 4JXJA 5CT8A 5I3CA 3MWJA 1QPZA 2J0EA 3H17A 3WGIA 3QPWA 1JFLA 4WY5A 4D4IA 3MTJA 3PE4A 4Y6GB 5BVGB 3CW8X 4N6OA 3VJRA 4Q3KA 3W4KA 5FH9A 3MYYA 3DZCA 4YCLA 3BSFA 3DXFA 2A86A 1KI6B 1Z38A 2HDWA 3AJAA 3PYXA 1XTJA 4GOJA 5AKGA 3WBJA 2D0DA 4C3VA 1V1MB 2C8LA 5A2GA 4G5QA 5JRDS 4KXVA 2ZAGA 1IB0A 3QF4A 3QPBA 3EGCA 1JSXA 1FDOA 1MC1A 2QYOA 4U6QA 3C8MA 2ZQZA 4JD5A 3PXDA 4Y6LA 2F1KA 5CXXA 1P18A 4BE4A 3GZ4A 3N8IA 1KHHA 2LVBA 3E03A 4GEGA 3SS8A 1T4MA 1W35A 1DIRA 3D31A 3IXLA 1F5NA 4GS5A 4NJMB 3VUEA 1T91A 3VVCA 2VN8A 5FL7D 1K92A 5JMPA 1U80A 2XADA 1N33B 3RIEA 4MUXA 4FB5A 1NI4A 2NIPA 3E9RA 5FOWA 4TTQA 3V8QA 1BD3A 4X65B 4GXRA 2PMCA 1FNSA 3V7FA 4NZNA 5FF9A 5G0SA 6PFKA 1XJQA 1UK8A 3A7EA 4J8PA 4UFNA 1N78A 3GB9A 1RCFA 4B8YA 1KBQA 2C54A 2Q7DA 5JBQA 3SKYA 3MQFA 3QENA 3FG9A 1M2WA 3N75A 4HWTA 1X7XB 4UBNA 1B23P 2PNJA 2YJ5A 3WGTA 1Z0IA 4OHXA 3MJEA 3LW8A 1HDZA 3A1DA 2CLEB 3KE8A 2D1QA 4UMFA 1L5GB 2DQYA 1MF7A 4M21A 2O2XA 2QPAA 1KJ8A 3Q1LA 2JZCA 2IOQA 5ECDA 5FI5A 4B3SB 4P0QB 1QGED 2FUCA 1FLVA 3LCRA 3ZYCA 4XUEA 2WU1A 3B52X 4YP6A 1NWHA 1U4OA 4XR4A 4GSKA 3IPAA 4ZVTA 3W2TA 2DHDA 4B3DA 4NXMB 5EJ4A 3IEXA 2COKA 3FPHA 2VDUE 3HUTA 1QP0A 2FPLA 3CLSD 5KHAA 3A2LA 3BXZA 2V6FA 1OZGA 3P26A 3AERA 1GARA 2AC2A 1SU8A 4ZPJA 1U0LA 1SNYA 2I2XB 1UT6A 5AICA 2Y76A 2QRZA 5BRJA 1R7RA 1SZDA 4OHCA 4J1TA 2VHUA 1JKMA 3I4CA 3ZK7A 2AW5A 1LLQA 4KL8S 4UD2A 5DTQA 1I3LA 2CCGA 1EEXB 3KYIB 4BBPA 2W0SA 1AMNA 1DX6A 1QVZA 2XY4A 1VHQA 3Q87B 2C2KA 2ZSBA 1EFLA 2I76A 2ISQA 1OT5A 3IGFA 4HVAA 5EKXA 2N1BA 3LOUA 4GMHA 5CD9A 1JKJB 2HEIA 3S7ZA 4LI0A 4ZQEA 3UMJA 2RAFA 3WYCA 1O54A 1PT6A 4DBLC 1QIJA 2ERCA 3L4EA 3Q1KA 2Q4TA 5CRIA 5JNUA 3ZHQA 4LF6B 5F23A 3CO0S 3HBAA 5CYGA 5JDIA 4CQLB 2V7EA 5FTKA 8ATCA 3VKFA 2PGAA 2RH9B 4RZHA 2FSGA 3J81A 4MR8B 3CEAA 2JHCA 3S5JA 4WKBA 5A4JA 3TUZC 5U9CA 2VAWA 1H23A 1LLDA 2VBFA 1P9LA 2FHSA 3DC7A 4RQAA 4GNRA 4B09A 2FNAA 3H42B 1Z2EA 1GTRA 2X41A 3PNOA 3OZUA 1I80A 4QJ3A 2A0KA 4Y3UA 3VSCA 5I7HA 1Z25A 1A8IA 2GSDA 2NTYC 4RGYA 2I4LA 4FBLA 4CV1A 5CMLA 1TVKB 1UMBB 5KDLA 4RGBA 1DQZA 3BS4A 3F90A 2BEWA 3OF5A 5ICEA 1C9MA 2FG6C 5CVJA 1OC4A 1GHTA 5JSFA 3RC8A 4EAAA 3ZK8A 3KOYA 3P94A 3CZQA 2JNWA 5HHTA 4A15A 1UOEA 2ZT8A 2OZEA 4KPUB 4NENB 3RR2A 1YA8A 1UZNA 3V55A 1JALA 2ZBDA 1K7EB 4HWKA 3S2EA 1Z4PX 1JWLA 4K26A 1A77A 2EU8A 1UFKA 4OXRA 5AW0A 1H1LB 1II8A 3A6ZA 2D62A 3OQBA 5JNVA 1R10A 4W1RA 1QVRA 1OI2A 3C8HA 3RYFA 3S28A 1N1DA 3TXAA 2GRAA 3SX2A 2FPSA 3U40A 5J5CA 2HQRA 2QMOA 4FGKA 4RANA 3RS0A 3STYA 4WK0B 4YAKA 5JS1A 5FQOA 2FZEA 1QGDA 1SCUB 2Q2VA 3EE6A 2JCGA 3VR1A 1FDIA 1JEDA 3WLIA 1ZC4A 3EVAA 4NU5A 4R1OA 1W4AA 3OLWA 4PANA 2B30A 2GCNA 4JT8A 1NNEA 2B94A 1JT9A 4INOA 3KKPA 4XD2A 3B38A 4OBWA 4U9IS 5JOQA 3FPGA 1GFSA 4BJ3A 1UBEA 3EG9B 3K5IA 3K73O 5IKOA 1EHYA 1FFEA 3EVCA 4AJJA 3W6OA 3RODA 3UT5B 1LDYA 3WDKA 4LV8B 1I94B 3U4IA 3UGTA 2R2AA 3FWYA 4MWGA 4UCFA 5C0OE 2JFNA 3W0LB 3RUEA 4L9AA 5C8YB 4F38A 1Y3CE 5AVWA 2X4GA 4ROTA 3PD0A 4CMCA 3PC4A 3GVCA 3WISA 2P7HA 3HJGA 2QN8A 1DFHA 4QOIA 1FCJA 1MORA 1E0DA 4UDXX 1Y5RA 5H4GA 1CDOA 3L43A 4MMZB 5DHPA 3PVSA 2R7NA 3R0QA 1JECA 1EVQA 3KB6A 1KS9A 2VATA 3M9LA 4H3HB 5U4QA 1QUFA 3QEBZ 2BTEA 1TF7A 1U2SA 2UYQA 3MGGA 4KXWA 4MV7A 5KTOA 2UUPA 4H1UA 4DWWA 1AUVA 3D7RA 3RBVA 4ER0A 3BDIA 1KAEA 4H7EA 1ZGAA 4PPNA 4UZEA 3ZE7A 1K0FA 2CHEA 1VGVA 1RLOA 2GZHA 1NRIA 3BFXA 5MGBA 3OSUA 2BJWA 4ZCLA 1U1CA 2F9LA 4I4TA 3LLCA 1EDZA 5E4FA 1TM5E 3R5HA 4EUEA 4TVSA 1IZ8A 2JL1A 2Y77A 4TMKA 4GPBA 4PWZA 1MAWA 4QU0A 5HKOA 4RELA 4LXXA 5JTUA 3VVMA 1X1BA 4AQ7A 5J5VA 2VZ8A 5LZ5A 1ZJWA 2OG1A 1PJCA 3WS7A 1M8PA 1OF1A 3R0IA 4YMWA 1NSYA 2Q1XA 2FCAA 5FOUA 2BM1A 4OI2A 1DUVG 4CMAA 3IUBA 3FSJX 4HDMA 2WQZA 2ADMA 2G7ZA 5ESXA 1E9BA 5C34B 1XLWA 8LDHA 1EUZA 3ZGNA 1AF4A 1RLIA 1E7MA 3FPJA 4E94A 1BZYA 4MLZA 2PMDA 4NFLA 3AF0A 1Q12A 4R83A 3V1KA 4IAOA 4H4EA 3LY8A 1NE7A 5BURA 4IDQA 1EUYA 3SKVA 1XZJA 2V45A 4BX9A 5JCJD 3UT6A 1R0BA 1I4EB 2YRFA 3K94A 4OQ4A 4C4XA 2P11A 5CDYA 5B3JA 4NH4A 3UENA 3QX8A 3AFNA 2Z9CA 1S3FA 2MTBA 4NIMA 4INJA 4P54A 1CV2A 5EWLA 4W8GA 5BVHA 3C5HA 3WLNA 3CE6A 2WYIA 3WJ2A 4UPVA 2QX8A 1CR6A 4FW8A 1XPRA 3ODGA 1PW7A 4F06A 2XXAB 3GDFA 2Y67A 3DZIA 2G82A 2JLZA 4XGRA 2QW0X 2P9ZA 2VJOA 1NZDA 1EQUA 2FQQA 3V4PB 3GRKA 4HB0A 2B3TA 3R3UA 2EJUA 1E1QD 3FPFA 4KQCA 1RWOA 4AJPA 3MGKA 6REQA 4ARCA 1EJ6A 3HSSA 5FX2A 1TK3A 1BJTA 3ZZTA 1DIGA 4KAAA 4OB6A 1BFDA 5CDSA 3OCWA 2O8FB 3L7IA 2J0UB 1JR3D 3W1EA 3ZC3A 4TTPA 2QUBA 3B1VA 4QXPA 5E9AA 2WMYA 2FE1A 2GN8A 3EF0A 2B0JA 1BDJA 5TPWA 2V6GA 3PKJA 1PZXA 2IK8A 3VH3A 1YS6A 1HEIA 2EXXA 1G60A 2BGTA 1HYHA 4U4AA 5JQGA 1A2OA 1GQYA 4RACA 4WLUA 3HR4A 3DEFA 2YJNA 1E3QA 1XHEA 1ZUD1 2QG4A 3GFFA 4WUTA 3KKEA 2BN4A 1HC7A 3N2IA 1F2UB 4LRYA 3EZLA 4EEKA 1SKYE 2IXAA 3ZD8A 4IDDA 1GPH1 2YVUA 3R0VA 5KTNA 4YQYA 3HNOA 1OBVA 2DB3A 5FWYA 3WYGA 1NQXA 1W87A 1KMIY 4PGHA 4U2BA 5CBPB 1GA4A 1I14A 2AZTA 3C6ZA 3IODA 3IAEA 4E22A 5LZ9A 1CEXA 1AUOA 3ZDCA 2GASA 2NUPA 3NASA 4PC3A 3SXPA 3Q5EA 3VOAA 5TIIA 2YIJA 4NOLA 3C5EA 4GQBA 3D1JA 4FJ2A 5CB0A 3KBBA 3ZTTA 5ITSA 1U31A 4KMSA 4TT3D 1PJLA 1TO6A 3PDIB 3G9TA 2GJAA 5JADA 3MPUA 1ORIA 2HX1A 1UKBA 2H85A 2E4XA 5REQB 2V7PA 3CURA 1HNWB 3EIFA 2AF4C 1J56A 1L5NA 1SD5A 1G9TA 4G1MB 3TTSA 3BX1A 5J63A 1LI4A 4TL7A 5FWXA 1PR0A 1ACJA 2ZRGA 1SCNE 5FTLA 3HNPA 2WQ7A 1Z7BA 3WQHA 3FH0A 4BPRA 1AS0A 1YMUA 2NU6A 3GBSA 5GONF 3ADCA 2TMKA 1U2GA 2HBYA 2KHZA 2R65A 2WTMA 1MQ8B 4ZOEA 3RU9A 2VDQB 4QRDA 2CCKA 2NO7A 4MA4A 4M6WB 4J7AA 5CM8B 2BFOA 3FYUC 4L4XA 1M6VA 2Q9UA 5JH7B 3H1FA 1REQB 3JX9A 4CTKA 3V8BA 1I1HA 2CXRA 5DHSA 4DM4A 2EHDA 2CKMA 2B83A 3Q85A 4FFRA 2I29A 4N03A 3U3ZA 3M1AA 5H70A 5T4EA 1VRVA 1D1PA 4K9OA 4XWWA 1NV8A 3JARB 2WIBA 1U8XX 4UUMA 5DNEA 1EB8A 1K9SA 1WCWA 1V9CA 2CGEA 3EVGA 4IVNA 2X0FA 3RE1A 2HA7A 1ZCZA 3SR4A 4L50A 2UZIR 4X71A 3JVUA 3GT4A 1FF9A 4Z51A 4QHTA 1EXVA 1RACA 2HHJA 3KKQA 1KZ9A 3IUQA 5CJPA 3RSCA 3ZCXA 3DCYA 4B4DA 4H27A 3UPUA 2BWJA 2I4TA 2QV0A 4RTRA 5FAXA 4YAFA 1MJFA 1FMTA 3NX4A 2QR5A 2CJPA 1F0PA 4URFA 2CXNA 1ZY2A 2ICAA 2JGLA 2NXJA 3FNIA 3RGWS 3RJTA 2PV7A 1IMJA 1XVAA 2X0DA 1NN0A 1UC9A 1YDHA 2D3TA 1M1NB 4EMSA 1R1DA 4CEIB 5C53B 3CRRA 1E2BA 1IM5A 3PC8A 4FR2A 2ZRDA 3WWOA 1M2HA 4GPZA 3A9UA 3I28A 3D6MA 1PNRA 1VXRA 3D4PA 2Z98A 4KAJA 3V4OA 3UG7A 3U7HB 1Y9DA 2VJDA 3HS3A 4RD3A 3L0PA 2D2IA 3HO8A 4GM1A 2NMVA 2I1LA 2QTAA 3G13A 3HXTA 3T15A 1QGYA 5LWQA 4IH9A 5J59A 5F12A 3FXAA 4FZRA 5M3BA 1ZBDA 4G0PA 3NANA 3VVBA 2JD1A 4B3JA 4ECAA 3TGPA 3RVLA 1K3FA 2DKNA 2C78A 2XTMA 2WRZA 3UK7A 4G0VA 3HG7A 4DDMA 2OBNA 1E9RA 3ZWKA 5KTSA 3DS8A 4FGWA 4N7RA 5IAJA 4G1EB 1IYZA 2H07A 1X7WB 4HPWA 3NM5A 4JL5A 4JXKA 1DLJA 2HMTA 2ONJA 4QAJA 4AJKA 4BNVA 1ESNA 1ZRSA 2GWRA 2P6NA 3KZXA 2ZRHA 3U7GA 4EHLA 2W58A 3EGIA 2QNIA 3PFIA 2GF9A 3NHJA 1J1UA 4GWLA 2LW7A 2HJVA 4ZHQB 3TNYA 5I4BA 1Q74A 1ID1A 5HFAA 3NBUA 4LZAA 3E18A 5DHAA 4YK7A 2X19A 2FB9A 4G5GA 5FL7A 4RMGA 1WMDA 1ISHA 3Q41A 2Q21A 1PJBA 1P6UA 5EG5A 1FX0B 2I22A 3LFTA 2P9BA 2SNIE 1GPLA 2IYEA 3EULA 3N0TA 4E5PA 1QOQB 2ZXEA 3ONEA 4LXHA 4WZAB 2GO1A 1T8TA 4XYGA 3QF7A 3GJRA 3ZE9A 1OKKD 4MHSA 5EZQA 1VPVA 1PNTA 1Q0RA 4HX5A 1ITZA 4PX3A 1A8PA 2JAXA 3GU3A 3IQWA 3HJBA 2ZIWB 5DHUA 2E6KA 2ZKLA 3MWDA 3LOPA 1W581 2XQJA 2K2QB 1HDGO 2XMGA 2DKOA 5HRUA 2XUAA 1ETUA 3L4SO 3I9NA 1B41A 3IPXA 3Q9SA 2PT9A 4KVAA 5BV8A 2CEKA 5TQJA 1TJ4A 3T5AA 1V8BA 3UMRA 4IBOA 3SYTA 3ORYA 3H0EA 4NL4H 4EY6A 1QCYA 1ZUWA 1DEKA 2B4RO 2G06A 2HF9A 3A4NA 1H65A 4FMDB 4KLAA 1E99A 1Z68A 2D4HA 3KWLA 2YYZA 4K6FA 4URZR 4EPRA 1D8AA 1EGVB 1OI3A 2XA1A 3WXBA 1FS4A 4WXPA 1O6GA 1VJGA 3KTDA 2A5LA 3CPJB 1K63A 1QIKA 5A1TA 3AOEC 4KG7A 2ZUDA 1XAGA 3RS2A 4JI0B 4A7PA 3G9ZA 1X1RA 2VT6A 3GAMA 2I8AA 3VKGA 3M89A 3PWTA 4Q19A 2BFBA 2JRLA 4Q6WA 5ILGA 4DUPA 2OZLB 4QYIB 3BHJA 3H9UA 1URPA 2JH8A 2OGWA 4CF6A 1LFAA 1GN9A 2CXHA 2OB2A 1FUEA 5AHKA 3PR3A 2CLIB 2J87A 4MWBA 5AOBA 2EFDB 4TLAA 2D1YA 3DV2A 1KF0A 5G1OA 3BILA 1CY7A 4FFWA 3E27A 4AYWA 3TCKA 3OI7A 1E2MA 1SZPA 2CJWA 3K8YA 4LJ9A 4RQUA 3O95A 2AKYA 4QXRA 1MMFB 4NYIQ 1OV6A 4H60A 4XCQA 4YRDA 4YQEA 1PGQA 1QH8A 4F1KA 4ZZIA 5D84A 1J0XO 2C88A 2Y68A 3WGMA 3AHEA 4Q9IA 1ETHA 4N48A 3ZN2A 3UCXA 3PQ4A 3X3HA 4IUCS 1OI7A 1XEWX 4HZUA 4K9DA 4JVLA 3RQSA 4RE6A 1W5SA 4WBNB 3JQAD 3KDSE 1GCAA 5JASA 3QEJA 3RK0A 3V00A 3R3VA 3HR7A 3WKBA 2F8SA 2YY5A 1WVMA 5FI3A 4YYZA 5NLLA 1JKFA 1FYWA 1JTVA 2G0NA 1HOTA 2Y1WA 5CVVA 3H3XA 3LHFA 4ZC1A 5ADWA 3G82C 4FONA 2XYPA 3AVOA 4S1PA 3RBAA 4GVXA 3TLEA 4LEIA 4D1YA 1N3LA 5HTOA 3KFVA 1E3TA 4OA8A 4NU0A 3WNVA 4CIXA 5LP6F 1BS1A 5F4ZA 3AUYA 1HT1E 4WCDA 1O5TA 4BBZA 2VSXA 1K5GA 4M98A 5D1NA 5DH9A 3KFLA 4A2WA 4B0PA 5AVKA 8MHTA 1X2BA 5DJ5A 4FUTA 4RSGA 2J6CA 4QUKA 1A9TA 1T8PA 2Y0EA 1JDTA 4I50B 3TEFA 3EZ6A 1ISMA 1FSGA 2KPOA 1VE9A 3F5SA 3JYLA 3KKOA 4AG6A 4ERXA 5JANA 1JXOA 1SELA 3UANA 4Q48A 4YCNA 3FX2A 3BMQA 4CMIB 1Y9AA 8ADHA 2OZKA 5A5VA 5EZSA 1JI3A 5I9BA 1ZESA 2OORA 4PO8A 2Z6QA 1ZKMA 3LX5A 5AD1A 3CSSA 1ZZGA 3N2GB 2HQOA 2LCQA 3FZYA 1JYFA 4XQCA 4AM8A 5KU1A 2W2MA 1XD2A 1V3VA 3ND9A 5INTA 5JSQA 3CRZA 3TQOA 3Q4GA 3ZQUA 1VCIA 3COSA 3MQ4A 5FD8A 3A6DA 3WL6A 4CLOB 1IZ7A 1JNXX 2A57A 3QW2A 1GGMA 4RCYA 3PXXA 4F2DA 3BDAA 3PGJA 4Y30A 5KSWB 4P36A 3DEJA 3R4CA 4LY6A 2ESRA 2C97A 3MUFA 3TNFA 1UBOS 2H17A 3DAYA 2CL6X 3IS3A 1ZCJA 5BYJA 4UHCA 3WG9A 2CLLB 2ZBFA 4BWFB 4AMVA 1H0KA 1T36A 5F1OA 4J43A 5FUWA 2C4HA 1CTQA 2OR3A 1RQ2A 1XVTA 1SCKA 3SJUA 1MD9A 5EJ6A 4UDNA 2RE8A 1IN1A 3P4YA 3LFUA 4D4HA 4NCJA 2R48A 3EBLA 4JUCA 2IZ0A 1ZGCA 3PQ2A 2QRMA 3KPVA 4FJ0A 4FYHA 1E64A 4ZRMA 3R5XA 4CKWA 1P81A 1R3DA 1W5BA 1X80B 2XNSA 3MGAA 5K01A 5L53A 6CHYA 1JT2A 6ADHA 1K8QA 2F1JA 3VOSA 3SHWA 3VGPA 4DE5A 1Y9ZA 1A0OA 3GRRA 3E2IA 4DMMA 4UPEA 5L51A 4FHCA 2G7MC 1E58A 2Q3MA 4FBMA 2OO3A 3BRCA 1XMPA 4D0SA 1F5SA 2XB8A 4PLGA 3KALA 2WAAA 3ZDYB 4AO7A 5EWMA 4J75A 3ABRB 1Z16A 1FFWA 2JFOA 3NTXA 2X15A 3QVMA 1RLUA 3BKXA 5JZ9A 4F1JA 2MWMA 5HE8A 3OA0A 1Y1KE 1X19A 4HDSA 4C0XA 4CPDA 4EHAA 4JI8B 1FVOA 3KTFA 3UBTA 2JBAA 3K0FB 4KW7A 1VHJA 1SC9A 2REQB 3FLBA 4IO0A 4QYTA 1HZZC 4BY9E 4RJJA 1G4AE 2WYWA 1G55A 4G2TA 3ZHCA 1H6AA 1V11A 1VB3A 4YV0A 3QFRA 2VAXA 2O4UX 4MJXA 2DFNA 4X8OA 4BZZA 4CT0A 4LNHA 4NPHA 5D3MB 5F5NA 2FETA 1DXYA 1YZUA 4JVOA 4Z54A 3V48A 1KK2A 2O0KA 3A1FA 2C07A 4RK0A 1Z5NA 2P90A 1TE2A 2CDAA 1C3OA 4MMXB 3HVRA 4OMUA 4ZHSA 3OKPA 3UFXB 2IV7A 1GYPA 2B4TO 1NXTA 1W9HA 3DZGA 2QM7A 4JH0A 3O8LA 4ZAWA 5AKLA 4KQMA 2VQEB 1OZHA 2JFWA 1M0SA 1XNJA 1S9DA 3VYUB 4AURA 3ZHTA 1G7CA 4C7BA 3MJDA 1I3CA 4XOIA 4FFNA 3RVPA 4QUHA 1Y8RA 3WVNA 1XQVA 3M3PA 4D8TA 4N7MA 5JCJA 1SEVA 2GM3A 4TROA 1LI5A 3BPSA 4S1OA 4KQKA 1U5BB 3Q5GA 2L18A 4HZIA 4L5YA 4MVJM 4XCVA 5E2AA 5ES4B 1ECJA 2ZRFA 1QANA 1EK2A 4RVFA 4NWIA 4EG3A 5LNK6 5DKFA 4MWCA 3T99A 2VRWA 5K05A 4AI6A 1NM5C 4L3WA 1WUHS 1CB7A 4J3NA 5CEJA 3C3AA 5KNCH 2H9IA 1FPMA 1VBKA 5LQNA 2R1VA 3G2QA 5GV8A 2X3UA 4YRSA 1XAJA 1ZIYA 2QE7D 3D7LA 3WHIA 1PSWA 1FE8A 1N6NA 4BMCA 4D25A 4GLLA 4DC9A 1RP7A 1E1QA 2CD9A 4I3FA 2F7SA 4QUJA 3BGIA 3DW1X 4DAOA 5E2BA 1GNVA 4RX1A 4LZNA 1XX6A 2OZPA 2RHGB 1LU9A 3GX1A 3KM0A 4D3DA 1JR3A 1OY1A 2Q28A 4PLCA 3W04A 2YJ4A 1XEAA 4DLSA 4LW8A 1QIIA 4LZLA 4TMWA 2A9QA 2BI4A 3L8MA 2JDID 2ZXUA 1YZTA 5IYZF 2H0RA 1JLLA 4GPTA 3IP7A 4HSGA 4M7OA 5HK9A 3ZDEA 1IQRA 4JBGA 1FJHA 4XGIA 1Z06A 4O1MA 4Y1RA 4AUMA 1E6UA 3FUUA 5FUYA 1N5LA 2PYZA 4MIYA 4R84A 3VSBA 1EX7A 1WHSB 1J9EA 4JB0A 4MS1B 3DP9A 5JJIA 4E4YA 3VHXA 2CDCA 1D6MA 1LWNA 1RQLA 2G40A 5ALOA 1K7XB 4YWJA 4R05A 5H82A 5MHTA 4PZ9A 2AX4A 2NX2A 3WO1A 2CWWA 1EP9A 4IJVA 4ZWNA 3R8XA 2YS7A 3B3JA 3ILHA 5I8PA 2J59A 4CQMD 2CZCA 3ZH2A 4DWJA 5F4BA 1W8IA 4O29A 4NCNA 3E7XA 5C31A 2JLSA 4BO8A 4Q9HA 5GGXA 3D0OA 1G17A 2EJBA 3MRXA 3OLYA 3OQ1A 3ETLA 1XZQA 3IQGX 1HE4A 1KVUA 2G5GX 4JLNA 3VA7A 3HA3A 1LBQA 1PLLA 1B8NA 1J2YA 1XTPA 4TT3A 1BEUB 1M54A 5KSPA 3WGHA 3SHVA 3MTBA 4WMLA 1GRRA 2O8EB 2WM2A 3N8DA 1L4KA 3P19A 4MA5A 2NU8A 4C29A 1I3NA 1M0WA 3DDOA 1HDEA 1T6ZA 3DWIA 4M88A 4QU5A 5LXTF 4A8JB 4YO8A 3RVRA 1VE3A 3EHDA 1C1XB 4KH0A 4QPDA 1KRHA 4RKEA 3V2IA 2C99A 1NOKA 4NU6A 2FJUA 4B46A 4YV1A 2ZI4A 1RAAA 3H18A 1PV2A 3FYUB 4Y9TA 3V80A 4UARA 1IXRC 4XQ9A 3A2MA 3TL3A 3ZDXB 3ICVA 4KREA 2HBRA 3LUKA 4BNDB 2IKQA 4KIFA 2C9MA 5JI2E 1X94A 3EWIA 4PAWA 4XKJA 5IN5A 3WX0A 1KI4A 4DY4A 3O21A 4GIBA 4QATA 4GUAA 4TVBA 1VGRA 4IF4A 3F67A 2NVUA 4K2HA 4JU9A 4TYQA 2WHPB 5AJZA 2QTVB 1IC6A 4Z0NA 1HL3A 4OXIA 1U4NA 4X1IA 2MINB 5IHPA 5LQUA 3HCDA 4AO8A 2Y4OA 2GS9A 1E32A 4WQMA 3RFXA 5HIMA 4EEZA 4RQTA 2NM0A 2QA5A 3IA2A 3HM9A 5BSMA 1JJFA 4PBTA 3OZRA 1AHHA 4UW9A 1Y3DE 2PBLA 2WKWA 3GK3A 3R1IA 1YOBA 4ED9A 5B5SA 1XZGA 1YZYA 2UZ1B 4BQEA 5KNLA 1XKLA 3GEPA 2IOHA 4LS3A 2V8OA 3HKBB 1L4MA 1ULSA 1PFYA 3HRHA 1IHYA 1QR6A 1EG7A 1XJCA 1BVUA 2QWXA 3NBKA 3H19A 3NHFA 1K4KA 4E33A 3CUSA 3ZBUA 5DO9A 3IQHX 4PN7A 2UZ3A 3RTDA 4RW0A 1ZOOA 1ZC3A 3MWKA 2IYRA 4RK1A 4YPVA 3ZI7A 2WPNA 2PZ8A 4NCXA 3QKSB 3LUPA 2J6IA 3RC7A 2OFPA 1L7VC 4IL5A 4KXYA 5K3FB 4DUGD 4FB4A 3C14C 1V25A 3H5OA 5LPNA 4MRRA 1A72A 5F9HA 4RVHA 4NNOA 4N3AA 1GM5A 3DE3X 1H0HA 1QFSA 3HXQA 3RU7A 1QB8A 3QX7A 3CUTA 1GU1A 4LSGA 4BNKA 1CQWA 4EH1A 2R2GA 5AJWA 1U99A 3IALA 4EW1A 3T3DA 2VNHA 3F74A 5KYWA 2Q1TA 5JY1A 1GL6A 1IHDA 2I3GA 4NABA 4WN3A 1PR9A 4M54A 2YUTA 4M9CA 1DBSA 3ER9A 4CCYB 2IYFA 3NKFA 2FKAA 2ACWA 1P0MA 4XQ0A 1J42A 4UZSA 1JR3E 1XLTA 4B1FA 1GPMA 1UBMS 4BU0A 5KWJA 4LJ6A 3GUUA 1TD1A 3AVTA 4MKFA 2WICA 1BNCA 1NP3A 1YJCA 5A7GA 2W2XA 1NN3A 2ZSJA 3QJ5A 3FWZA 3RNOA 1VTKA 2WT4A 3I0ZA 4MS3B 4P33A 3UMBA 2A5FA 3D2AA 3EA4A 4Y2TA 1VLQA 1HPLA 3OTOB 4PBRA 3PUKA 1Q1EA 5FPSA 1H2HA 1AKVA 4HQLA 1KIAA 4E14A 5AYVA 4B74A 4FXPA 2FUG1 3I3SR 1D1SA 4HGQA 4MWTA 4UASA 1C7IA 4DJJA 1CFZA 1Q0TA 4YJKA 2J7KA 5K9ZA 2CVOA 3FUTA 3H2JA 3UJAA 1CQJB 1LFDB 3QVOA 4GKJB 2DQKA 4PTYA 2WAXA 2OOSA 4OXKA 1LX6A 2P6OA 1FFHA 2GVDC 2ZWVA 1CUAA 1R6AA 2BSQA 1YV9A 3DZKA 3T5TA 2NO6A 1PL0A 2WSIA 3MCUA 1CDEA 4HNHA 2W6OA 1AQ6A 1OKKA 1RYBA 2X9QA 3A3PA 3GVIA 3HXKA 3KXLA 2XE6A 1K3TA 1N2GA 3DQZA 4KWTA 4TLMB 3NDJA 3VR3D 5JYEA 2ZTUA 1P7PA 2NZYA 3LRTA 2ZE7A 1CXZA 1YJAA 2XDYA 1X13A 1UKZA 1SMKA 1VKNA 3BQNB 4DCCA 1GL3A 1N6OA 2OG2A 3U5ZB 2CVZA 2VL7A 1DBPA 2Q9BA 2P79A 1ECBA 1SUEA 1YB7A 1P1HA 4N3GA 4V0QA 4KR7A 2F3RA 2RGNC 2ZBUA 3SOPA 3AL0C 2OAGA 2XQKA 3ZW7A 2XUOA 4BC0A 2RHCA 2BZGA 2ADOA 3KKZA 4JVNA 3RVMA 4MROA 5JH7A 1JUDA 3FNRA 2QVBA 4LJKA 3WDMA 4FYYA 1S89A 4ZDIA 4PN3A 3DKKA 4X3PA 4DG9A 5MN4A 4TSRA 1MO4A 4B6OA 1Z0SA 5EIXA 5AHWA 1P74A 3D59A 2R25B 4E5VA 1PQYA 3DYBA 5EZ6B 2XOKD 3P9NA 3K70D 1DQRA 2LV8A 2OESA 5CM2Z 3BHNA 5EVCA 3UH1A 1O96B 2PGNA 2GZAA 3G17A 4QGBA 1ADFA 1T8WA 2AR0A 3LYLA 3IMKA 1ACLA 4WNCA 5EQDA 3MIIA 3PT9A 3Q3IA 4Y2SA 3FHOA 4A4DA 4AKIA 1VSUA 4FEAA 3TB6A 1A9RA 2G09A 3ACCA 3C8DA 4UEKA 1SCDA 2AEJA 1J06A 3FNBA 5AJHA 3WIEA 1YTLA 4BFCA 4FIZA 4FWTA 2WG1A 1ZH8A 1HQKA 1S2LA 2RMKA 1TM7E 3B85A 3IHLA 3VSEA 1TMOA 2IU3A 3HYLA 3WYNA 3OCCA 2JK0A 2QKYA 2PH3A 4KN6A 1Y98A 2FVXA 5LP6A 2Z95A 4IGEA 3VYVA 1L4FA 3AGQA 1QGUA 1GSHA 4P7JA 1E1RD 4ZAFA 1B8PA 4MO9A 5FQNA 5EKTA 3K0KA 3JQAA 3KQTA 3QPCA 4AIRA 5C35A 4PFSA 3I9MA 3ABZA 2H5JA 2VUSA 3LVQE 2Q6VA 4LMRA 3Q6NA 1LZKA 3IAM6 3QXCA 2A9PA 2BONA 3TZ6A 2GXQA 3SC6A 1YC2A 3L6DA 2HHCA 1OXSC 1HQCA 1QHFA 1WXDA 1OOEA 2PUEA 3V46A 1JEQB 2OO5C 5HOEA 1U3VA 2G08A 2BCJQ 1QIMA 2IE8A 3BJRA 3DOOA 1NF8A 3TOSA 5GMOA 3FOBA 3W4JA 4YMUA 2I5PO 2QUIA 3A1SA 2JI6A 3ZZ1A 3LWZA 2FFBA 4YRAA 2QW8A 1HSZA 2Y6UA 4HN9A 3TQQA 1C0EA 1CIPA 4IEEA 3RVKA 2D8AA 2FOLA 1GGNA 2ZULA 1OAOC 3T1YB 1FS6A 5M5BA 1UBTS 1I7QB 1AKUA 3G1WA 4RFLA 2O7RA 3TECE 3O2JA 1KEKA 4WH0A 1GCIA 4I1UA 2B92A 2XVMA 1T5HX 3HDQA 2OXTA 2OAP1 3D7NA 4CRWB 2W6NA 3L8CA 3OZCA 3EY9A 5KREA 3K70B 2O0JA 1TIPA 2VO1A 2IYUA 4GQAA 5BT8A 3MAGA 5LA6B 4NMHA 5FP0A 1EA7A 1JR2A 3O38A 4B6RA 5CFOA 1NU8A 4Z7QB 2GERA 2BZ0A 1XL1A 4EA7A 1DOHA 3C4JA 1N6KA 2C7RA 1P5JA 1RCUA 3B6JA 4YLYA 3PIRA 3WJAA 1RWMA 2QQGA 3B9QA 4KAXA 3I1JA 1NIPA 1NUTA 1XCJA 3STUA 4B8WA 4QM7A 1XKTA 1Z7EA 1DV2A 3GRCA 3P27A 3RSOA 2JBWA 1JFFB 2HV8A 1RLJA 2FLWA 3LP5A 3QWAA 2R6CA 3HDYA 4HY3A 4RYDA 2BGLA 5JYBA 1YI8A 1TAUA 3IUJA 3KK0A 2EVWX 3SM3A 3V6MA 3JWEA 3ROPA 1PX2A 2FUEA 4CUJA 1TLFA 3R20A 1KQFA 1RZVA 4CM7A 5BXQC 5K8IA 1OFGA 3WLJA 3PUJA 1LTQA 2DKFA 1VG0B 3RCBA 2B7BA 2X58A 3AY6A 4B2IA 1PHPA 4YUYA 4BCBA 5DLYA 3THXB 1KKMA 4LE0A 4UU8A 4CM9D 1B93A 3KAQA 4LCJA 3OY7A 2R8ZA 1MOQA 3FFXA 2GAJA 4U1RA 4NV3A 5CGQB 3WQBA 1QK5A 3T9DA 1UAGA 3UOGA 1W5AA 4G1BA 3U1VA 1RM0A 1E3LA 1NX6A 1K7YA 3AFHA 2HFKA 2YRWA 1LNZA 4V0LA 2PRYA 2R7LA 1GPKA 3TOXA 1JHUA 3EDOA 4F4IA 2F2TA 4B6QA 3SQOA 1GTMA 1I2ZA 1ESDA 2BDTA 1WQ4A 2BI7A 3QMMA 1P3JA 1YR7A 1MB9A 3M6IA 3RI3A 1ZD1A 4DJAA 3QX9A 4Z4EA 5DYIA 3PEYA 2VDVE 1DXHA 1XK6A 3DFMA 3UXHA 4CM6A 3RAEC 1LW6E 5A2QA 5IFLA 4DXAA 2X4DA 2GCGA 4YP1A 3TOZA 1JEYA 5JLAA 1XN4A 2Z4RA 4CBVA 4TWRA 1WSDA 4UHKA 4BKUA 1I6MA 3VPCA 3IKTA 5KYUB 1KWGA 2R8BA 1LPNA 4IIGA 2CFSA 2YZGA 4NMLA 4CDNA 1O6CA 3Q0EA 3LLUA 2OAQ1 4ZT2A 3ZXSA 5DNDA 2PO7A 3RREA 1X7ZA 5AUQA 2VP0A 1BQEA 2Z5FA 3DNFA 1Y3FE 3EGXB 3OMWA 3ZE1B 4C07A 5HQJA 1NRJB 1CNFA 4JWKA 4EFKA 3A70A 3MRVA 4IUBS 5CLLA 2QIPA 5L4SA 4OTZA 3ED1A 3IE0A 2VDMB 4UBJA 2AG0A 3RKRA 3IR5A 4ZGWA 1LRJA 1TU4A 2AN3A 4HQNA 1E6EA 5E6SA 1I7SB 2JLYA 4CQJA 3DCNA 3MGCA 3DM9B 4IX9A 4P5EA 3ZTYA 3KR9A 3OCYA 4JL8A 3LGSA 1SO8A 5EPUA 2JIMA 5AW9A 1F3OA 1JE0A 1QM5A 1FU7A 2I9PA 4KX5A 3U9SA 3WICA 2FSVA 3CXUA 3NO4A 3O8NA 2HA4A 1ISPA 2D7DA 4EX7A 3DP7A 1YDGA 3D3WA 1KYQA 1MT3A 1PS0A 3LXUX 4LY3A 3ZWNA 1R3UA 1U9YA 4BQQA 1MNQA 3U6KA 1BS2A 4BLQA 1EP1B 2AZXA 1ZM7A 3I6YA 1L5SA 1CR2A 1CE8B 4CODB 2UU9B 3I5XA 3TW4A 4UAGA 4QUBA 2QE7A 2GKGA 3RLFA 2JFGA 3VR2A 4ATNA 1NQWA 4HTAA 3B6MA 5IYZA 1UIMA 1U1DA 1D3AA 3F7OA 3LU1A 3U09A 1J23A 3KAPA 2H1HA 2ZSDA 4QSMA 3FCXA 4A8TA 3ZV6A 1SD1A 2WM9B 3MW8A 2ZUUA 1Z7YA 5HKBA 1JHAA 2G76A 4F5YA 3CH7A 3QU4A 4BO4A 1TK2A 2BBWA 2VUIB 4NFYA 1ML4A 2I91A 1DB3A 1IEVA 4JLDA 3PHCA 3W9UA 3FI9A 4S1NA 4COKA 5JPDA 1QONA 2OHJA 3NHAA 2BGMA 2OFWA 2XUPA 2Q7XA 2C2WA 1NNSA 1Y9JA 1U3CA 3O8QB 2BHSA 5M29A 2YHAA 3SJBA 2JDIA 3GDWA 4A73A 5DMHA 1JIQA 2HGSA 3RPEA 3DNMA 4ESEA 4HLUA 2UVQA 3G5LA 3TOCA 4BO7A 3BA6A 4NI5A 2A0YA 4TYWA 2OUKA 4RIGA 4CETA 2R4QA 5JJ5A 1MVLA 1OYOA 3ZLTA 3QE0A 7MDHA 1CJVC 1JHZA 2F43B 5IZ4A 2BKXA 2ZJBA 3AOGA 1DIHA 4LYJA 4YMVA 4CKBB 4KUGA 4Z5XA 2PR2A 1SHKA 2J9GA 1UK7A 3Q8LA 3DWEX 1A5AB 2ETXA 3C74A 3IQIX 1GQQA 1Y1RA 4TKUA 1Z0ZA 4CQMA 3TPZA 5LXTA 1XRNA 3OPXA 1H6DA 5CDFA 4ZT3A 3REQB 1VIAA 1K97A 2PT5A 3GPBA 5BOSB 2ZBGA 4RQBA 4Q18A 4F6RA 2IZ7A 2YHIA 1A9QA 3CMCO 1CY8A 1J8QA 2AFIB 3AP3A 2EBHX 1XK7A 4BMPB 3BT7A 3TZKA 4BMZA 3KV1A 5L8VA 3EIWA 4HNQA 2R1TA 2REOA 2V4MA 3DONA 4J4HA 4HP8A 4FBGA 4WW0A 5T8KA 3IBCA 4I3GA 4Q24A 1N9GA 1XZCA 2O3TA 2B2XA 2YXBA 2GCPA 1O94C 3H1AA 4UTZA 2DUMA 1N36B 5K0FA 5I48A 4K8OA 5EY5B 4DCTA 1F4VA 4KXFB 1V45E 2QAJA 3P9IA 3NCHA 4LHWA 2CNKA 5P8WA 1SHJA 1SG6A 2A6PA 1RLMA 1NFQA 2DHCA 2GA8A 4LKOA 2I54A 2V59A 2C5BA 3PHHA 3RRBA 2FG5A 3HUUA 1SOAA 5KYNA 1MABA 2QUHA 4PSCA 1PX0A 3W7AA 3TYXA 3AYXB 3E7FA 3W6ZA 2QR3A 2BOVA 4C88A 3OKAA 2VH5R 1OLSB 2HK6A 3RUFA 3RYHA 1UZAA 5AVYA 1JW9B 1E60A 3KHUA 3O3CA 1OYWA 1OTHA 4I8XA 4V3CA 2PS1A 5TF4A 1QGZA 3DLHA 2O54A 1QCCA 1R5JA 1VRWA 4CM8B 2AVNA 2ZB8A 4IIJB 4E4TA 1PKXA 2DGDA 1CJMA 4NK4A 2F3QA 1YZKA 4KDEA 4B82A 3WAJA 4TKZA 1CQIA 3MSXA 3HCBA 2QRVB 3RKUA 3VC1A 3ZEIA 1ABBA 4TZ6A 5IDQA 4NDZA 2PUVA 1PSZA 2E6UX 4S2UA 5TLSA 2VP6A 1G7SA 3H2KA 1I0LA 1Z5VA 2VJMB 3FFWA 3HI6A 4I1OA 4UQOA 2OC9A 4P3PA 5F98A 3EMVA 3QZUA 4UMVA 2XDQB 1L5WA 3OKFA 1KK3A 4DLAA 4LOLA 3ROTA 4MEBA 1QFMA 3JQGA 4MRMB 3DAGA 1ZJ6A 4ZVQA 5A9SB 3G1TA 1LBEA 2PX8A 3AHIA 1D9XA 1YDMA 4I1VA 4DUGA 5GINE 5AJXA 1VE1A 3SC3A 3NHSA 4C6SA 2FR0A 3SE7A 2TMGA 3W5CA 2AWOA 1U8ZA 4RS3A 3VNBA 1NUUA 1GCGA 3GEDA 1EBBA 2F9MA 4FOOA 3RARA 3NT4A 7MHTA 4CT5A 3NHWA 1EEHA 4JEHA 4JT4A 5A02A 3NVAA 5L3ZA 2ZUEA 3B7WA 4WZ6A 1F8GA 5GM1A 3PRYA 3OMXA 1T3TA 3EZXA 4MKXA 1V2HE 3O8BA 1A7UA 1XN1A 4F72A 3GV0A 2W22A 4BGEA 1Y8ZA 1UJ2A 3D0QA 4LRXA 3LCVB 3KG2A 3P9KA 4P31A 4OOFA 4D8WA 3I72A 1MZVA 4D8VA 5ILQA 2FXIA 4PIVA 1GPBA 1OSNA 2GZ3A 3N5CA 2Q1SA 5EJIA 1RKUA 4TXJA 2JIQA 2MSKA 5EERA 2V5VA 5B3KA 1SXJC 3QELB 1H93A 3UKOA 3IELA 2Q6OA 1H2YA 4R8LA 1ABFA 1PL8A 2ZLBA 5KHOC 3EPJA 1W94A 4RV5A 3RK4A 3OCZA 3ZOZA 4PHCA 4RSMA 4E5SA 1R0YA 4TZTA 4XVQA 4AS1A 1P6QA 2ISCA 4JBXA 2I8LA 3RU3A 1EVZA 1NOJA 3PX7A 1DBQA 2NV6A 3NC4A 1CRLA 1FQKA 3OUZA 4II2A 3BWEA 2CYCA 1IU9A 3GLUA 1P7ZA 2CE2X 2QNBA 1FUYB 2WUDA 4I55F 4QELA 1VA5A 3U4QB 3CJRA 1IVNA 2J3JA 2H92A 2OV1A 4W8OA 4N0QA 5J9FA 2Y1CA 4EECA 3VR3A 3EFOB 5LMZA 4GVLA 2C9DA 2DLNA 3B1XA 4G23A 3LPDA 2WYOA 4IUDS 4DLKA 5E9JA 2C3MA 2Z30A 3FVRA 1PKEA 3PA6A 2QROA 4OD0A 3DD1A 2QYTA 1AB5A 1ZIDA 3JZMA 3E48A 4HTFA 1JBKA 4P22A 4BMOB 5FXMA 2IPAB 3CLTD 1FNCA 3NYRA 5D51S 4P86A 2IKSA 4DSUA 1L5HA 2C4UA 1CW2B 2DBYA 3EXHA 4WXEA 4MVJG 2BL4A 2OCLA 1OMOA 3DEZA 1SWWA 3DHEA 2NGRA 1H6CA 5AXAA 1F0YA 3GA7A 3TQIA 3GA0A 4B2LA 1ZN2A 4QL3A 4I99A 3ME5A 2D59A 2IVZA 4RIFA 2YNMD 3HJUA 4D5EA 4RH3A 4UMDA 1B8OA 1KXJA 3LUCA 2XOKA 3RS7A 4UHDA 2OP0A 4YMLA 4RPHA 3B6EA 5G0WA 4ETNA 1C8VB 4TLBA 3Q7EA 3ZWYA 2GZ1A 5ED4A 2RK6A 2BGUA 1FVFA 1F8XA 4HPXB 1KMHB 3DSRA 3O1JC 1E92A 2P2GA 3T61A 4CMBA 3D8RA 4INPA 2BFFB 3JD1A 5I5EA 1NVTA 3ELUA 3KJIA 1TYZA 1JWBB 3B2NA 3M33A 2Q4OA 3OFND 3D6UA 4G0YA 4HDRB 1X9HA 4R31A 3FNQA 4FQ8A 3CIOA 4RY0A 1E69A 4HGYA 4NE2A 3HP7A 3ZDRA 1MHTA 3L9XA 4B6PA 3U7QB 4HOYA 4RD4A 3OF2A 2FEOA 5DW3A 1E1RA 2IOFK 3DTVB 1L9XA 1JQLB 4G67A 1SQ6A 4BX8A 3GJ6A 5AVQA 2UYGA 3ABQB 3CVJA 2XA2A 3OA2A 2HLNA 2IYVA 3RVSA 5JC8A 2BKLA 5D3QA 1A69A 1TM3E 1JL3A 1M2NA 1R12A 5K3CA 2Q5QA 3TSCA 1AHPA 4O4HF 2P4QA 3KS9A 1U2DC 1V8DA 1MRNA 1TUBB 2FMXA 3C6KA 3N74A 1Q7RA 3P96A 2YDXA 1R4MB 3PDCA 3X1YA 1TM4E 5H4HA 1TQHA 5FA5A 5KTYA 3IEMA 2ZR9A 1IRXA 4LYEA 1Y4AE 3HTXA 1WZ2A 1MC5A 4QDOA 1JZSA 5JFOA 4U9UA 4C21A 4BCCA 4CIVA 2QYHA 4BO6A 3CNHA 1XZEA 2BVNA 4J07A 2WNIA 4KB5A 3H1BA 1JPNA 1FLDA 1YA6A 1XZIA 1QGAA 2X22A 3KIPA 3OPQA 1UWLA 1ISGA 4GMFA 2JCVA 1EFCA 1E7YA 3HYTA 3OO1A 4H1HA 2Z2KA 1KNQA 3UMCA 4DJTA 4H1WA 4ZYXA 2CLHB 2ZJZA 1AKMA 2CDNA 4HDNB 4RV9A 5BV1A 1SIWA 3PDUA 3GMDA 4R5MA 4AD8A 1ST3A 4U6NA 3EQ8A 2P3OA 2H1WA 2X8BA 3BXFA 4CYMA 2I1QA 4IFBA 4HB4A 2RHLA 3FD8A 1CZLA 3CC8A 1OV4A 2WYHA 2B4YA 4MJ7A 2DH6A 1NJSA 3WE7A 4C4SA 2HXGA 3IYLW 4F3TA 4HPJB 2HMWA 1O87A 1KOJA 3ET4A 1NYRA 4KH1A 3RBXA 1RM3A 4NU8X 3DZFA 2FPWA 3KUXA 4B7AA 2BMDA 1JLKA 1VPTA 1CUEA 4JQCA 5HJEA 1FTQA 3DJFA 2ADFA 2C77A 4DIMA 2IEYA 4WGFA 2I3BA 1L0BA 2Y3IA 1EU1A 1AQJA 4ARBA 2PX5A 4C0JA 3OX3A 2VSFA 1CYDA 4ARZA 1MN6A 1I7DA 4DB2A 1MFZA 2ZRCA 3H1PA 3TR5A 2ONYA 1D7OA 1P2BA 2Q4RA 3AL2A 4IG4A 4IFEA 5H9VA 5KOJB 5P21A 3R40A 5CVTA 4OB8A 3VPSA 2PVPA 4UXIA 1QHHB 5ALRA 5EWMB 3TMYA 1EVJA 3VO8A 3G5AA 3QVGA 4UHEA 1EYZA 2QTWB 3LC1O 3UV3A 3H6HA 1PL7A 4RHYA 4PNHA 5IDXA 2BF4A 2CLSA 3CX4A 3N76A 3K2IA 3Q0TA 5C7YA 2WFMA 1B8VA 4CM9A 4UNNA 3LOQA 1WRBA 3UK6A 5L4LA 3CG0A 3LA6A 5JG7A 2BBSA 3DB1A 1G4UR 2PEYA 1W0JD 3GCZA 3GRAA 3PITA 4ZV9A 5IJ9A 4P7KA 2AYYA 3EGEA 3CINA 2VHVA 2I3ZA 3LKVA 4PEVA 3F4LA 3NBXX 2P6MA 4PS1A 5COAA 1J8FA 4N8EA 3E15A 2IS1A 1WF6A 4Y2PA 3DHNA 5DI9A 3GT3A 1UXJA 3B1JA 4QFDA 2VSOA 1U0GA 3M3HA 4HATA 4MR9B 4AKEA 4OIFA 1CY0A 5FNVF 2XWBF 3BORA 3TI9A 2HWWA 4C30A 5BV0A 4CWAA 1AG9A 3LV8A 3VPFA 2BV3A 3KQOA 5IJAA 4N5HX 1XZPA 3RAGA 3RIGA 3VNAA 1J97A 3MWYW 3QLJA 1LDNA 2XNKA 1U3WA 3O8OA 4P81A 1AURA 4BFVA 1XHLA 1GSAA 4RULA 1M8KA 3P8ZA 3SN6A 4J16A 2EQBA 2WIGA 1TW3A 4QNMA 3LAWA 1I2AA 1RYDA 5C7LO 2XTJA 4O33A 4AXXA 4U7FA 3A14A 3CNNA 4H0FA 1YGYA 2Z2XA 2IX3A 3HXOA 3N07A 4L28A 2VNAA 2VDPB 2RH4A 4C1BA 2BR3A 2ZVJA 4XM1A 3B6ZA 2WYVA 1XAHA 4AICA 1Q1NA 4GXTA 3VX4A 4XWOA 1JAYA 4JXXA 4N0DA 4NE7A 1AUXA 3I2IA 3AH8A 3O2SB 1B1CA 3X1ZA 4PNEA 1E2PA 3FCUB 3GZNA 3RIXA 2B8EA 2A9VA 3RFVA 2O23A 4ILEA 3NU1A 2VPZA 3K3PA 1NDHA 3LC0A 2GA9A 1LPSA 1RKBA 2EKZA 3AJ8A 1NW4A 5BUSA 2WAYA 4O08A 3SQWA 3I1YA 4CLRA 1ZXXA 4FK8A 2ZYVX 5FTNA 4FLMA 1D6JA 4B40A 5IKXA 5PNTA 3KWJA 2Y05A 1T13A 3A1TA 3Q88A 1LLFA 3CJTA 1R0ZA 2RAPA 2ZT7A 3PFBA 4MGZR 1V4BA 2WR8A 1ZQ1A 2PSDA 3MGBA 3OHMA 5L45A 3WL5A 4LV6A 5D85A 3KYDA 5KQRA 2WTAA 3U3RA 3CRW1 4Y2YA 1R66A 1RWXA 2ZBEA 3DYIA 3UJHA 4IVPA 2O2IA 1KJQA 3FPLA 4FLEA 1D2GA 4V0ME 2A88A 5L7YA 3SJ7A 3V9PA 4F6LA 9LDBA 3LF2A 1J24A 2RKWA 1RFGE 1ICEA 2DPHA 2E87A 4MVXA 4E4RA 1NPTO 2B4KA 4WOBA 4JAVC 4QM6A 4RF2A 3BE4A 4CMEA 4XW2A 1SVNA 4TMVA 4F3RA 4CF5A 1FTNA 3PTAA 3G8AA 1ZHHA 3ADPA 5D1HA 5DHRA 4DN6A 1RNLA 3RRYA 4OQFA 3THWB 3N87A 1EJ0A 3EN0A 2WU0A 3HMQA 3LTEA 1UANA 3NM6B 4M7RA 2V55B 1CDDA 3M82A 1Y5IA 5EWJB 1KY2A 4CVNA 2VDRB 5EIEA 5JWRA 3CJQA 1ZGZA 3OE4A 4FP9A 3AR8A 4KMMA 4JKIA 3NQ41 3TGWA 1U8YA 4BO0A 2JIDA 4QTYA 2VXYA 3PNPA 4MCHA 2R8PA 1V4VA 1ZD3A 4L74A 3K4QA 1H66A 3G2KA 3PKZA 1RYZA 3H6KA 4X6UA 1JSRA 5SICE 3ZW8A 4KPYA 4HWSA 3ZY4A 2RGXA 3B1WA 2ZIZA 1JJ7A 3PNQA 4WK6A 4C6HA 2ZB3A 1KI8A 1R8YA 2IYYA 2O20A 3AHDA 2IZ1A 1HR0B 2DLCX 3RDPA 4FPXA 1Q0UA 3MVEA 4TV9B 2GN6A 3WMEA 5KKNB 2Q1WA 1U9IC 1WDWB 2QRGA 1AVTA 3G7SA 3PLRA 4PX2A 1RXVA 5KVVA 4PCAA 4PCLA 2CNOA 2XEXA 2OTCA 4M7PA 2ZIXB 3HVHA 2DH5A 1BCRB 2WIJA 1FMJA 2WM8A 3ETJA 4PIPA 4DLZA 2EEPA 2JGRA 1P7VA 2Q8PA 2WTEA 4F2PA 2ZBRA 3OTGA 1CEEA 5GM2A 3F8TA 4FGLA 2NADA 3OMLA 3TI7A 5LD2C 2VPQA 3TLAA 5C2JB 5KOHA 3ESQA 4PRLA 1OZAA 4INAA 5AJTA 3V7NA 3QA3E 1VPWA 4R2IA 3L3BA 1L5RA 2AJTA 4DPLA 2P65A 4HHEA 3BD7A 1YL6A 2C20A 3AVQA 4ZJZA 3QOWA 3E2PA 4R81A 4E30A 4JY7A 4IDCA 4KJXA 1EGAA 4MQ6A 1L3BA 2QLJA 2JFVA 2LCFA 4LAFA 3MFQA 3HVUA 1WF3A 3KQWA 4MK4A 3ZV7A 1B6TA 1UWCA 1A88A 3CA8A 4K1LA 5TB5A 4PC1A 2HCJB 1XP8A 3GLHE 5JSUA 3ZXUB 1W2WB 1I9GA 3B2EA 1WKVA 2VJPA 5G1NA 1I51A 5T7BA 4AP9A 1OYVA 1B43A 2C7BA 3QE4A 4IWYA 4ND5A 1JZTA 2W11A 2YH2A 1MFPA 5BYKA 1PT9A 5EFZA 4Q4JA 3NZEA 3C98A 3KBOA 4Q7JB 3EXAA 1RRFA 3EGDA 5JR3A 3DM5A 3ICWA 3WMGA 2ZJ1A 3QTLA 4H4CA 1D4OA 3PRJA 5AM5A 2CZGA 3PJFA 5FHRA 1HH4A 4H6XA 3LYUA 3MLAA 4JIGA 1S3GA 1Z2DA 4ER6A 1XSEA 5BV2P 5KTRA 3QRWA 1IEWA 4L0CA 3NRJA 1R5BA 2VJQA 3GDHA 4M8IA 4XX1A 3GJZA 3K1JA 4DFDA 5BVGA 4KQ6A 2PO5A 3E5HA 5LJIA 1AKQA 2NTNA 4IIYA 2PX4A 1D2EA 7YASA 3KQVA 3QKRB 3D1VA 3BWXA 1E5LA 2P7IA 3CPEA 5FULA 4C2AA 2P8JA 3JAKA 1V1MA 1YR2A 3FSRA 4JZYA 5AI4A 1GR1A 1ZN7A 4PNPA 3AHCA 4K87A 3FCAA 5A04A 1A5TA 2CJXA 2DCMA 3O1HB 2QGNA 3SZ3A 4I4NA 5A6SB 3DBLB 1PR1A 2ZYRA 1E3EA 1KEPA 5LDHA 1RWNA 1XYGA 1Q6YA 2EJVA 3HB7A 1KMCA 1DG3A 3I32A 1OJ7A 1UIRA 2Q3JA 4LHYA 4YMIA 3TSOA 4TKVA 1KI1A 5E6RB 4WK2B 4FSHA 1YUNA 4KPGA 7ABPA 2DX7A 4B45A 4AN1A 5KSZA 1UADA 1MGPA 3R0JA 4AF8A 4NZPA 1M8GA 1IJBA 1SXJB 1KE1A 3WIOA 4DKXA 1D09A 3JWPA 4Q37A 2G3YA 2QLFA 5HYVA 4KRXA 1XYYA 4PYMA 2IS2A 1LC3A 1NNLA 1G3RA 3ZEAA 1OXUA 2DPGA 3GZJA 4UAUA 3QLTA 3JZAA 3ED5A 3TXYA 3COVA 1KSHA 4ZOLB 3LHSA 1DIOB 1X7XA 3R44A 4D8XA 5JD5A 1RAIA 1TRHA 1RIFA 1E3SA 4B7UA 3FLMA 4I55A 3ZGLA 5UKDA 1QWOA 1WEHA 2XUFA 5IULC 1U3GA 1ATZA 1IUKA 4RIIA 1IXKA 1NC3A 1SOVA 2PLNA 2XWSA 4ZU3A 5LQCA 1HRKA 1FW6A 2AOTA 2WABA 3E23A 5AUOB 1YVEI 1Z6PA 2QIOA 2FW1A 4S1TA 4W99A 1U5AA 1P5ZB 2H2WA 2NYAA 5DWQA 1MW8X 3CVUA 2COEA 4Y2JA 2QD3A 5IJXA 1A2BA 1SUCA 1NAIA 3GXBA 2XYHA 3BH6A 4P0PB 3BGOS 5I9IA 3F46A 4GAEA 4CMJA 4I5DA 4X7PA 3LX8A 3M9XA 5C7OO 2VNKA 4ZYTA 3VTAA 4G5RA 4F9GA 2FRDC 1TFRA 1Z6TA 3L7JA 3ZWOA 4DM7A 2XYGA 3ZKWB 4OU5A 2WC1A 3BKWA 3C43A 1K5HA 4J03A 2F4VB 1O3YA 1BMTA 2D5BA 2V7VA 5D7NA 1WXWA 1V5WA 3X2EA 4E3WA 5IS2A 4B3CA 4L3OA 2CLMB 3J80A 3PIIA 4HGZA 3BXHA 3UXYA 1QTIA 4DXHA 3BC1A 1PVDA 2W8BB 4DVJA 1XCGB 1GUDA 4EB6B 2G0AA 5B53A 1L4LA 1SN7A 1JHRA 1KDTA 2TYSB 5AK6A 3T1HB 1XJ0A 1BXGB 1FSPA 1E2NA 3EVFA 1LF5A 3HKEA 4RUKA 1C4KA 4AN4A 3DOIA 2CLOB 2ZI6A 4GH5A 5L3VA 4K03A 1DHRA 4R9NA 1SKBA 3NVDA 3DVAB 1DARA 1HMPA 2YFYA 2H4WA 2NLOA 4I08A 3IJEB 3NGMA 1QFXA 2GNOA 2YNMA 1VHWA 2Z2ZA 4KTVE 1QQBA 3SE0A 4PPQA 3OZAA 5EMNA 2CNWD 5JVDF 1ZNYA 2AFVA 3CB4A 1VI2A 3UO8B 2ZZNA 2JD0A 1ZW1A 4QFCA 3TE6A 1VZ3A 2GPSA 2C7QA 4QBGB 2AOUB 1S2GA 3DL7A 1ZONA 2OUIA 1EK0A 2VPIA 3AR9A 2P4HX 3E1SA 3N7AA 1ENOA 1ODLA 4FXOA 4GE0A 2EC5A 4R98A 4YBRA 3ZBPA 5K8CA 4HVLA 1ESCA 1G4HA 1HV8A 3OUUA 3EIUA 4RDHA 1T25A 5DW0A 3HFJA 1I1NA 5HGXA 1CUGA 1KGDA 3PUZA 3RSZA 5HDBB 5DEIA 4HNTA 1IM8A 3OFNA 4X91A 1HGXA 4O4HA 5JZOA 3K2QA 2XOEA 5FOTA 4WT7A 3DA8A 1UBCA 4E5NA 1KFEB 4XD7D 1G8FA 2N1MA 5C81A 5J4HA 1UMCB 3C8UA 3CN9A 3FSGD 2X5XA 2BEKA 2VJBA 1HK7A 1NXPA 1LBHA 1JX6A 1QBKC 1WCIA 2NPOA 1NG1A 3IOCA 2NOAA 3HEBA 4I8DA 1T9DA 1X86B 3U9TA 4A27A 4ETWA 5J1SB 3G8YA 1G59A 5IKEA 5ELLA 4GL2A 1H1LA 2XUQA 1TYBE 1BGVA 3H86A 3KXIA 1JN0A 3OX4A 4GVPA 1KDVA 1PTKA 2GX6A 4IHJA 2YN2A 1L5QA 1KARA 1R8XA 1T0PA 2BMFA 1QKJA 5BNTA 3MK31 3EFBA 3MILA 2XVXA 3NXKA 4GT1A 2VNSA 1QIGA 2I2WA 4L16A 1U04A 2A4KA 1YH3A 2VQ3A 4B85A 1H6BA 3PJRA 3OJEA 2HW8A 5CAEA 2G1KA 3LM8A 4X54A 3FKQA 5DGXA 3R7LA 3SG0A 4BBAA 1QZZA 3W90A 4XIJA 3ZWPA 4MRPA 3LZDA 1SVMA 2H1RA 4PYOA 3ZZNA 3E9DA 3JRWA 2ANBA 3V8NA 2JFBA 4UEOA 1PG2A 1JPUA 4UCWA 3PSHA 2HM7A 1KYWA 1T5DX 3HHPA 3JZIA 1EQAA 2XRYA 4OBBA 3ZUPA 4QG3A 3EVTA 5IK2D 3K72B 4L4RA 3O9MA 1LKZA 1OLOA 1LQUA 1PZNA 2DE0X 4JLKA 4U7HA 3AQ4A 3C39A 2YIMA 1B16A 4YCMA 3COWA 5ITZA 1Z47A 4H6VA 2WDZA 3PQ3A 4LRWA 5I9NA 2PGXA 2JGAA 4ZDKA 4RVUA 3PHLA 1UKAA 4UHHA 3HR8A 2QZSA 4B79A 2HZBA 4YO7A 2A5GA 3NHYA 1EK5A 4FOPA 3SBOA 4BNWA 3OEWA 1G5RA 4BP8A 3U1TA 3TSZA 2X23A 3LT1A 2FFJA 2XIQA 2HK8A 3QGMA 4Y9RA 4D44A 2CV1A 4MUJA 1X1SA 4GBJA 3H9BA 4ZOBA 3FAKA 2Q5IA 1SC6A 5F3RA 1SG0A 4HH1A 3F5DA 4UOZA 3OIGA 1I2CA 2WP0A 2D2EA 4GM0A 3CS3A 3KAKA 1K08A 3IP3A 3WNBA 4FC6A 4MAMA 3VNQA 1XD9A 3T1NA 5TC4A 1BW9A 4Y0NA 4WOPA 2B5VA 5FNVA 4DC0A 4EG4A 1KAOA 4PZAA 4EQ6A 2RIPA 4RV4A 4KOEC 1SXPA 1T29A 2W93A 4K0KB 1E9VA 1X8LA 4KQ2A 2ORVA 3NFRA 4X1KB 2PYIA 2ZYTX 2VYCA 1W0JA 3A6JA 2PVSA 3SCZA 1G38A 4UU7A 5YASA 5F3WB 1GA6A 5ALIA 3D2CA 1A95A 1Z0DA 3VU1A 5L6MB 2QSYA 4DA0A 3QY0A 2HEGA 1PJAA 4E15A 3HN7A 2VK2A 1LWOA 1ORHA 1QHYA 4IXTA 2BTQA 2ECQA 3EOAI 4MPJA 1E1LA 1RP1A 2JVJA 4PZDA 2UYHA 2AJ8A 2JIZD 2XYVA 3RYIB 3GP3A 3I6IA 3U3JA 1NNUA 4MV1A 5KJFA 3MBIA 3M5WA 4U3JA 5DWDA 2GCEA 2VUTA 4P2GA 5H3LA 3B3FA 3IV9A 5CH8A 3LRPA 3ZBTA 5CDTA 1X42A 1M8JA 4DCPA 4DG8A 2IHTA 2VKQA 1YBAA