The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
154
|
sequence length |
585
|
structure length |
532
|
Chain Sequence |
LRYDGRVAVVTGAGAGLGREYALLFAERGAKVVVNAADIVVDEIRKAGGEAVADYNSVIDGAKVIEILVNNAGILRDRSLVKTSEQDWNLVNDVHLKGSFKCTQAAFPYMKKQNYGRIIMTSSNSGIYGNFGQVNYTAAKMGLIGLANTVAIEGARNNVLCNVIVPTEGILPDILFNELKPKLIAPVVAYLCHESCEDNGSYIESAAGWATKLHMVRGKGAVLRPSLDDPVTIEYVKDVWSNVTDMSKAKHLGAIAEASGTLLEVLEKLKEGGGDAIEDAFEFNSKELITYALGIGASVKNAKDMRFLYENDADFAAIPTFFVLPGLLLQMSTDKILHGEQYLEIVDDLPTSGTLLTNGKVFDVMDKGSGAVVVTNSESFDESGRLLVRNQSTTFIVGDPIAGVVPLQPAPNRQPDATVQYTTSEDQAALYRLSGDKNPLHIDPQMALLAGFKTPILHGLCTLGFSVRAVLAQFADNNPALFKAVKVRFSGPVIPGQTLRVDLWKQGTRINFRTVVVETGKEVISGAYVDLK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Peroxisomal multifunctional enzyme type 2 from the fruitfly: dehydrogenase and hydratase act as separate entities, as revealed by structure and kinetics.
pubmed doi rcsb |
source organism |
Drosophila melanogaster
|
molecule tags |
Oxidoreductase, hydrolase
|
molecule keywords |
Peroxisomal Multifunctional Enzyme Type 2, CG3415
|
total genus |
154
|
structure length |
532
|
sequence length |
585
|
ec nomenclature |
ec
1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase. |
pdb deposition date | 2010-08-27 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00106 | adh_short | short chain dehydrogenase |
A | PF01575 | MaoC_dehydratas | MaoC like domain |
A | PF13452 | MaoC_dehydrat_N | N-terminal half of MaoC dehydratase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Roll | Thiol Ester Dehydrase; Chain A | Hotdog Thioesterase | ||
Alpha Beta | 2-Layer Sandwich | Double Stranded RNA Binding Domain | Double Stranded RNA Binding Domain | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | NAD(P)-binding Rossmann-like Domain |