3OMLA

Structure of full-length peroxisomal multifunctional enzyme type 2 from drosophila melanogaster
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
585
structure length
532
Chain Sequence
b'LRYDGRVAVVTGAGAGLGREYALLFAERGAKVVVNAADIVVDEIRKAGGEAVADYNSVIDGAKVIEILVNNAGILRDRSLVKTSEQDWNLVNDVHLKGSFKCTQAAFPYMKKQNYGRIIMTSSNSGIYGNFGQVNYTAAKMGLIGLANTVAIEGARNNVLCNVIVPTEGILPDILFNELKPKLIAPVVAYLCHESCEDNGSYIESAAGWATKLHMVRGKGAVLRPSLDDPVTIEYVKDVWSNVTDMSKAKHLGAIAEASGTLLEVLEKLKEGGGDAIEDAFEFNSKELITYALGIGASVKNAKDMRFLYENDADFAAIPTFFVLPGLLLQMSTDKILHGEQYLEIVDDLPTSGTLLTNGKVFDVMDKGSGAVVVTNSESFDESGRLLVRNQSTTFIVGDPIAGVVPLQPAPNRQPDATVQYTTSEDQAALYRLSGDKNPLHIDPQMALLAGFKTPILHGLCTLGFSVRAVLAQFADNNPALFKAVKVRFSGPVIPGQTLRVDLWKQGTRINFRTVVVETGKEVISGAYVDLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxisomal Multifunctional Enzyme Type 2, CG3415
publication title Peroxisomal multifunctional enzyme type 2 from the fruitfly: dehydrogenase and hydratase act as separate entities, as revealed by structure and kinetics.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase, hydrolase
total genus 154
structure length 532
sequence length 585
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
A PF01575 MaoC_dehydratas MaoC like domain
A PF13452 MaoC_dehydrat_N N-terminal half of MaoC dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.129.10 Alpha Beta Roll Thiol Ester Dehydrase; Chain A Hotdog Thioesterase 3omlA03
3.30.160.260 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3omlA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3omlA01
5L7TA 1WZEA 2OKHA 4IDEA 4DIFA 4LSWA 3TJRA 2F1KA 4FFPA 4HFRA 1E3EA 3PJEA 4W9NC 4EJ0A 5HTOA 4QO8A 3HDQA 1SOVA 2XXBA 1UAGA 3CTMA 3S55A 1EK6A 1Q7BA 1X1TA 3JD3A 1ZVMA 3QVXA 3SJ7A 4ALIA 2C82A 3QVWA 4B0CA 1IL0A 4RVGA 5KIAA 5EL0A 1W6UA 4R69A 3NDIA 1HWYA 3ZNPA 3OJFA 3LVFO 2HMVA 3EGOA 3DMTA 3KYCB 4N5LA 3V1UA 5FI5A 1E3JA 2QZZA 2CWZA 3NJ8A 4KWIA 4ALNA 1M67A 2JCXA 2EHDA 4TROA 3IAHA 3DDNA 3Q6IA 4ALLA 1C1DA 3VTZA 1V6AA 3HQ4O 3AJRA 1P3DA 4UEOA 2Y1GA 1SBYA 4NFYA 2YQ5A 2DUUA 1CF2O 2BGMA 1TVEA 1E92A 1U3UA 2FN7A 4WLFA 2CVQA 4FDAA 3E9MA 4LISA 1N7GA 1EDZA 3GA0A 4J9UE 2HQ1A 3ZWAA 1U3TA 3FCOA 3KOUA 4CM7A 1I30A 1LQUA 3GAFA 5DF1A 1VJ1A 4HZOA 3TOZA 3C3XA 1R4MA 3W4JA 4PN3A 3ITKA 4WNBA 5T64A 2GF2A 1PWXA 3JQ9C 4FC6A 2X58A 1CERA 1KEUA 3JD1A 4GPD1 1MP0A 1XDWA 3ONEA 1T1SA 3PJDA 5F21A 2PIMA 4MOCA 3KEOA 3R3FA 5EQFA 3KW1A 1GYRA 2HO5A 5EINA 3LBBA 1UXHA 1XKQA 3R87A 3ZU5A 4HUJA 1C1XA 1PGOA 4WK6A 3ZWBA 5BSEA 1V35A 3DZBA 4BO1A 2AQIA 1QYWA 1U9JA 2EGRA 1PZFA 1U4SA 3R3CA 3FNEA 1HDOA 5G0SA 3IJRA 4M1QA 2X0JA 4OSPA 3U4DA 3ZN2A 4DQXA 4IDAA 4NBWA 4CUKA 2D1YA 5TSDA 4E31A 2J5KA 4YJGB 3PHIA 3ASUA 3NDRA 2UUOA 1E3IA 3KLMX 2O3SA 4WLUA 1Q4UA 4OXNA 3ORFA 3PXXA 3NJ4A 4XEHA 2OO5A 4BNYA 4L4SA 1O5IA 1YH3A 1IPFA 1LQTA 3FHLA 4Z0PA 2EKLA 1K6JA 1T2DA 3OQ1A 2E6UX 5SZVA 2G76A 4YR9A 1EZ4A 5C7OO 1MC4A 5JXWA 3NV9A 1K6IA 2YW9A 3RBVA 4B7UA 5JYEA 2CZCA 2XF8A 2ZQYA 4FBGA 2OMEA 4EEXA 4M8SA 3ROKA 4P4LA 1EQUA 1Y9AA 4WCFB 4AG3A 1YONA 2OP1A 4XA8A 4GVXA 3DFZA 1PR3A 4KQXA 3DP3A 5I9MA 4E2ZA 1UZNA 2I67A 3EC7A 3NTRA 4BL5A 1YE3A 4QXMA 4BKQA 4W78B 1Y8RB 3RAJA 1UR5A 4PG7A 4UUMA 5CDYA 3AFMA 2PKQP 5IZ4A 1Z6ZA 4TSKA 1B15A 1XA0A 2UYYA 1DBVO 1F06A 1XHLA 5IDYA 3WBBA 1MFPA 4IBOA 3QY9A 3KYCA 4NBVA 3ZWOA 4RL6A 3IKTA 3TZ6A 2VYVA 4L8VA 2OZPA 1RJWA 2J3KA 3QWIA 2P4QA 3D3EA 3LU1A 5IZCC 3D4PA 4OOBA 3AI3A 1Y7TA 2G0TA 4MO2A 2WTBA 1P1RA 2OKIA 3HDJA 4CR7A 5A9TA 1PN2A 3D5QA 4IJUA 1XIVA 3NTOA 3GVIA 2G5CA 4RLUB 2IZ0A 1PN4A 2TMGA 2DFVA 3WXBA 1O6ZA 1HYEA 4KQWA 1E7YA 1NFQA 1DJNA 5CEFA 3RU7A 4B79A 3ONDA 5HWFA 3JV7A 4NBRA 1J6UA 4XZ3A 1PL7A 1PS9A 4GBJA 1IPEA 4ZQHA 1C14A 5HS4A 4GVLA 5BSHA 3SXPA 3DZHA 2I9PA 4CV0A 4J43A 2EIHA 4ITUA 2HRZA 1PJ3A 1YKFA 2QQ2A 2R2GA 1X7GA 4FOSA 4KMSA 3GGPA 1GFSA 3GPIA 1ENOA 4TWRA 2EJWA 4Y98A 3JQBA 3QHAA 1LDEA 5FI3A 3WGOA 3WIDA 2VUUA 1PJBA 3KO8A 3ZZNA 3FR7A 5I9NA 3UCEA 2HK8A 2X0NA 4QD8A 3INGA 2HKIA 1U1IA 4M49A 2DTEA 3HUDA 1W8DA 4GI2A 1OOEA 5EGJA 4Y8VA 2AE1A 4HFJA 4MVJP 4D3DA 3GC6A 1I0ZA 2EV9A 4YWJA 3WNQA 3KZVA 5KVCA 2DUWA 4DGSA 5GZ1A 4X54A 1ZKIA 4YJGA 4EZBA 4NH4A 2O6TA 3ED0A 3DP2A 5JAMA 3TZQA 2DU8A 3OM9A 3HSKA 5TQVA 1G0NA 3F5QA 5B4TA 4B4WA 1TBUA 5SZUA 2PH5A 4D7AA 4CLXA 1K89A 1ZSNA 4B8UA 1GV1A 2BLLA 4BNKA 4U5QA 1K3TA 3KYDB 5FFFA 2EP5A 3CMCO 3DWFA 1DC3A 3ANLA 4XY6A 1BWSA 1T1RA 4KDFA 3TFOA 5HRUA 5G2OA 1TA4A 3V5NA 4ILKA 2FUJA 4LN1A 2RCYA 4RDHA 5TT0A 1GV0A 4WCFA 5HS6A 2J3HA 3DXFA 4XYEA 4OOEA 3MWDB 4CR8A 4HNGA 4J0FA 2NTVA 3OEYA 3WB9A 5T8KC 4WOJA 3ANNA 1GZ4A 4PLHA 2YV3A 5JO9A 3AK4A 4BNWA 1UXGA 2PA3A 4IIUA 4M87A 3WWYA 1DOHA 4W78A 1Y8RA 2R00A 5B1YA 2GZ3A 4WNCA 4NIMA 4TKLA 4U0KA 1E5LA 3JYPA 4J1NA 4E30A 1WM6A 3AOEA 3KSDO 4FGSA 3TQHA 3C8MA 2VRBA 3EY4A 5ENVA 2NWQA 3G17A 4NBUA 3HJAA 1Z75A 5JAIA 1MV8A 1U1ZA 2H5LA 3E18A 3LC2O 4IXWA 3AU9A 3WGTA 4BHTA 2GLMA 3ZDFA 1M76A 1PWZA 2FR0A 3UKOA 3ITDA 4E4YA 2V6FA 1N5DA 1XGKA 1VSUA 1B2LA 2NVUB 4DQVA 5JDCA 1TT7A 3TL3A 1C0IA 3QRWA 3KSZO 4MZQA 2J5QA 4WLVA 2W8ZA 4B8WA 5I7FA 3GFBA 4D3SA 3QLJA 1EE9A 3CK1A 2I99A 3AZ9A 4RLUA 1AE1A 2GN9A 2JJYA 4XIJA 3W1VA 2UV8A 4YYZA 4TRJA 2I3GA 3QV1A 2GGSA 2CUKA 4J2OA 3UF0A 1WLVA 4HBGA 4O1MA 4HZNA 1KVQA 1Q6WA 4Z3KA 3GUYA 3V1TC 4BO8A 1HT0A 5IJZA 4JJIA 3O26A 1NAIA 1ZK4A 3TFQA 5F1KA 4CMHA 2D5CA 3X2EA 2B5VA 4CMEC 3INTA 3MOIA 1ADFA 2YHIB 4BO7A 3SPSA 3H5AA 2CF5A 3ZU2A 4AE7A 1AUPA 3GDFA 4FJ2A 3JYLA 3PHJA 5C37A 1UH5A 4UVGA 1EK5A 1AHIA 5ITVA 1KYQA 3GN2A 4PRLA 2PY6A 3ULKA 2B69A 3LBEA 1Z7BA 3N58A 5IN4A 2YFQA 1MC5A 2WYUA 3UOGA 4ZHSA 3WMWA 2E4AA 2GLPA 1NVGA 2BFOA 3VH4A 4DRYA 1ISHA 2B4TO 5LDGA 4DUPA 4HFMA 1NQ5A 2VT3A 4P8RA 4HV4A 1H6CA 2I6TA 5G4LA 2PTGA 2NM0A 1UP7A 4OIMA 3K6JA 4MDHA 3W4IA 5L4SA 1SB9A 2GD1O 5T5QA 5KJ1A 3EHEA 1HEUA 3VVBA 2D2IA 4ZQFA 3KYDA 3BZUA 1HKUA 4ND4A 4R3NA 4NFSA 3PJGA 5COAA 3KETA 4NI5A 4J49A 4UEJA 1PZHA 2IZ1A 1NM5A 2VWGA 5CDTA 4GX1A 3DTTA 1GQYA 4YBVA 3V2GA 4K4AA 1X13A 3GY0A 4I08A 5BSGA 4CODB 2PGLA 2PRXA 2UV8G 4II2A 3ZV6A 2OWNA 4K4BA 1U5AA 2BMAA 2VHWA 4FFUA 4CMBA 4MKZA 4WNIA 4F6CA 1DFHA 4CR6A 1O95A 1LRJA 5IXYA 5L51A 3LK7A 4NR0A 5JW6A 2VZ0A 1XQ1A 4OJNA 5COQA 4LK3A 2OGUA 3L6EA 5GZ6A 5CP8A 1AGNA 1ZSVA 3F4BA 1CEQA 4NU5A 3SJUA 4J3FA 3U4HA 4YRAA 4JP2A 2YDYA 2HX5A 3CIFA 3TDKA 4ROSA 1E1KA 2Q2WA 4JK3A 1EFKA 4I4JA 5HBRA 4EEZA 1XU7A 4I9NA 2NVUA 2FPGA 2AEMA 5DM5A 5T06A 1V3VA 1YVEI 5TX7A 4MVJA 1MUUA 2QRKA 1NJKA 5CFZA 5G4KB 1KEPA 3UW3A 3CUKA 1FDVA 4MVJF 5JNLA 4I82A 2DFDA 5AXAA 2Y05A 5K6AA 2QQ5A 4FC7A 2GZ2A 3WS7A 4BO3A 1Y7UA 1PX0A 2F00A 1M6WA 4MVJE 1DFGA 3E9NA 4KP7A 1SB8A 4NK4A 1UXKA 1H5QA 2ZB3A 3L9XA 3CXRA 3GRPA 4UUOA 5JAZA 4PLZA 1C3VA 3EUWA 3PJFA 4JQCA 1V3TA 4J7CA 3PEFA 1YJ8A 4WCDA 3LWGA 4H3VA 5SZYA 1NAHA 5THKA 3FBGA 3RASA 3WLEA 1JLLA 1A71A 1J0XO 3NRCA 2BH9A 3OJEA 4E6PA 2YHIA 3QVOA 3IS3A 2WE7A 5DNAA 4AJ2A 1PJSA 1DIHA 1YO6A 3U3XA 2AEFA 3AM5A 2VOEA 3C1AA 1GADO 4BNIA 1LLDA 1JVSA 3QQPA 3MJSA 4Z6KA 1M2WA 5GMOA 1VPDA 1F8GA 1EFLA 3LLVA 4CLDA 4OSOA 3GVHA 4NNJA 1PR9A 1X7DA 5JYDA 1VL0A 4ZN6A 3O4RA 4OAQA 1DC4A 3COSA 3L4BA 4RCVA 4B3HA 4AE8A 1K5HA 1IHXA 3WG9A 2Z5LA 3CMMA 3DQPA 3BHJA 4XDZA 4PVCA 2RIRA 4UVEA 4CMGA 3IP3A 1DLJA 2O4UX 1PS8A 3VZPA 4RF3A 4BNMA 4CMKA 2O5UA 5I7SA 3OICA 3BMOB 5K0ZA 2B83A 2O48X 2FR1A 2RH4A 4M55A 1RYEA 1PEDA 1T2CA 4N5NA 4TMFA 5JMPA 4BVAA 3OBBA 4AJHA 2PK3A 3DFUA 2Z1NA 1DDOA 4MP3A 1WVGA 1T24A 3BXXA 3PYLA 3QW2A 3WQSB 3I1JA 1PGJA 3H8VA 5L95A 1GYPA 2NTJA 2Q3EA 3TNLA 1EMDA 1ADCA 3V8BA 4JJFA 1NTOA 5TRTA 4RLTB 4CM3A 1A9YA 1JKJA 2O23A 2CVOA 3SC4A 1RYDA 3L4SO 5H83A 4A0XA 5KL9A 4KUGA 2FZWA 2WSBA 1JTVA 3I6IA 1PJ2A 1NYTA 3DR3A 4F45A 4PLCA 4L4RA 4JLWA 2QRJA 5KJCA 2YV2A 3SX2A 1VPMA 1HETA 3R1IA 3P19A 4S1VA 5JE8A 8LDHA 5CEEA 4RV9A 3QWFA 1LRLA 3ROQA 1JAXA 3WGGA 5HWSA 2G17A 3G1TA 4HP8A 2JAHA 4B4VA 4JX8A 4NBTA 3HWRA 1N8KA 5I8WA 4FS3A 4TZTA 3SEFA 1DSSG 1T25A 2P2SA 4UVHA 4E21A 2C0CA 1DHTA 1GCOA 4P4NA 1I3NA 4CMIB 4HY3A 4U6QA 3OF2A 5IDWA 4GWGA 1BXKA 2FRDA 3PYXA 1SEVA 3R6DA 4I83A 1E7QA 3F6YA 3LF1A 4YJDA 3ZW9A 4AL4A 3AFNA 1KEVA 4GSLA 4ID9A 1ML3A 1UAYA 3FWNA 4B7CA 4RPGA 4GSKA 3D04A 3B1FA 4MVJH 4GAHA 4UAGA 1NFFA 3UFXA 3JYOA 2UUPA 4CV2A 4FJ1A 4ND2A 4BNJA 4PCVA 1Z54A 2NUAA 4A27A 4R51A 3GAZA 3M1LA 3EVNA 2H63A 4G5HA 4BS9A 5EP5A 1LDGA 1MA0A 1Z45A 1XQ6A 4FJ0A 4J1SA 4PRKA 3UGKA 4DYDA 3DOYA 1VJTA 3B70A 2GERA 4YAGA 2NQ8A 1KS9A 3E8XA 3FI9A 3WGQA 1E7MA 1DB3A 5J23A 1AXGA 1DIRA 4KOAA 4BMNA 1TT5B 3OQBA 3AZ8A 1MFZA 5DCYA 4XB1A 1CRWG 1GEGA 5JCXA 4RVSA 3FNGA 2GR9A 3LF2A 1A7AA 3RFXA 3RKRA 2F41A 4FFMA 4FFRA 4DLLA 3DAPA 4FFNA 4ALKA 4BKRA 2DT5A 1WLUA 2RHRA 2OUIA 3I6QA 1GDHA 1NQAO 2QYSA 3JD2A 4J7UA 4EI2A 5K9ZA 2DM6A 5EGLA 1IY8A 1E7RA 1Z7EA 5IDXA 3GNSA 3RIHA 2JAPA 2VHXA 2V7PA 3HHPA 2WYVA 1C0LA 4W82A 5T67A 2Q45A 4QO7A 3E82A 4CM9D 1ONOA 1UZLA 3QP9A 4BO4A 2DTDA 3P2OA 1QV6A 5TS3A 4BMSA 2FP4A 3QWHA 4J16A 2CY0A 1K6XA 3FBTA 4AJJA 1AHHA 1W4ZA 3PFWO 4YBZA 3Q9UA 4FIZA 2Z95A 3BMOA 3BMQB 2X9VA 3AY7A 3GGOA 5L7WA 2J6IA 3MOGA 4PGFA 3GG2A 3Q1LA 3RFTA 4CM5A 5ITWA 5ICMA 1E7WA 5T6BA 4I45A 4AJLA 3OJ0A 4IENA 4DMMA 4D45A 1G0OA 2BI8A 1I10A 4B3JA 1Q0QA 4A5OA 2OOSA 4DC0A 1QLHA 1ZK3A 5ADHA 4WLEA 4RLTA 4GLOA 3L07A 3AUSA 4OL9A 4XIYA 3Q2IA 3NDJA 1I2CA 4OHUA 4B0IA 3WBFA 3NT4A 3PZBA 4UULA 4BMVA 4RJTA 2CD9A 4II3A 3RFVA 4P4GA 4ZU3A 4BIIA 3CEAA 3ZWYA 2D4AA 5AXDA 1NXQA 2Y0EA 3KB6A 1QKIA 4IDFA 3WFJA 1HYHA 1HZJA 2HU2A 1M75A 3FRJA 1G6KA 3HADA 4OOFA 3KV7A 4AICA 3PHHA 2FS2A 3C85A 3ZHZA 2GO1A 5AVOA 4I5FA 3I9JA 2I65A 4XQCA 1TXGA 4XYGA 2WDZA 5TNXA 1B7GO 1BGVA 3GEMA 3PTZA 5JPIA 1WN3A 4H7PA 4IDBA 4PVDA 4I9HA 4MP8A 4CMIA 1X0VA 2DSLA 4Y9DA 4YXFA 3WQRA 2O3RA 4IY1A 2AEJA 4GLLA 5G4KA 1GYQA 3UVEA 3D4NA 1P31A 1ADBA 1ULUA 1QYDA 2JD0A 3GR6A 2D0IA 2YY7A 1GQQA 3I4CA 3W8EA 3PLNA 4IGEA 3L6DA 4IDCA 4BO5A 1GR0A 1PQUA 5F1OA 2O6UA 5GZ3A 3GDOA 3MCVA 4DPKA 4YB8A 1LNQA 5EJ2A 2Q4BA 4YCAA 4HNHA 1HSZA 1PL8A 5JAQA 4BNXA 4E3ZA 1ONNA 1RM5A 3W8FA 4TKMA 4O0LA 4RF2A 4PLFA 4BV8A 3Q9NA 1V0JA 5C7IO 1R0KA 3RSHA 3ZV4A 2DBQA 4NFHA 1QLJA 4YRDA 1TT5A 5A9SB 3CF8A 1ZFNA 4CUZA 2I5PO 3KUXA 4AJIA 4QD7A 3W8DA 3AM3A 1T26A 3HN7A 3I9LA 4Q3EA 1J5PA 2P68A 3GEDA 5HZ4A 3ZGYA 3JQ6A 1E6WA 1ORRA 3LDHA 1K2WA 4WECA 2EGIA 3IUSA 2PZLA 4IDGA 3ADPA 1LDBA 5TLSA 1QYXA 1DC6A 1CQJA 1EQ2A 5JCJA 3DP0A 1BHSA 4XGIA 1RPNA 3AW9A 4ZD6A 3IC5A 3K67A 2A94A 3PIDA 5ENDA 1Q1NA 1B14A 1CYDA 3BTUA 1EE2A 3DHEA 4J4TA 4A0YA 5L53A 2B6EA 1OC2A 3VAZA 3AUTA 2NU9A 1HZZA 3I5MA 1D8AA 2GNAA 1E3LA 3AUAA 3ZNNA 1P0CA 2ZB4A 5JBIA 1H2BA 1QMGA 1EVZA 3BMQA 3S2EA 4ZRBA 1AN9A 2C5AA 4O63O 5DCUA 4BQRA 3ENNA 4ND5A 1LSUA 2IZZA 3F1KA 1J1YA 3ONFA 2PH3A 1DRVA 2VWHA 2ZJ0A 1NWCA 2Q49A 3OIGA 4Z0TA 1EDOA 1X1EA 4J90A 4R1UA 4K1LA 4AJOA 1U8FO 4AJ1A 1P74A 4EBFA 3OQ6A 3GEKA 4YQZA 3DZFA 5EPOA 3NEPX 3VC7A 3TN7A 2EXXA 2Q2BA 2XXJA 3I23A 1BW9B 4ZICA 2J5RA 1FDTA 3AOEC 3PQDA 4BO0A 2B36A 2YV1A 3PRJA 1NWHA 1P77A 5JDIC 4XJTA 2GN4A 1WDMA 2P91A 2VUSA 1YQXA 3D6LA 1BTOA 1LO9A 3KV8A 2Q1SA 5BUWA 1N9GB 3KX8A 2PNFA 2IXBA 3MZ0A 5TGDA 4QTZA 4CMJA 5F1PA 2HRBA 2BKAA 3CH6A 2OP0A 2WD7B 4GX2A 1Y1PA 1EVIA 4YJHB 1I8TA 1VL8A 2POQX 4XKJA 3ZV5A 2RH8A 3BMCB 4R16A 3T7EA 3ETEA 4MVJD 3DBLB 3QY3A 3RC7A 3B1KA 4GMGA 4MP6A 5SZZA 3H9EO 4CL8A 1Q2XA 4H4GA 4W9NA 1KETA 2JL1A 1F17A 2X4GA 5DN9A 3CKYA 3PWZA 1ZNQO 3I9KA 1LDMA 2QG4A 4NJOA 2JD1A 4CM4B 1NP3A 4NHEA 5KKAA 1VKOA 3VHRA 3OH8A 2P4HX 3T4EA 1XYGA 2YUTA 4Y6RA 2FY8A 3T7CA 4ZGWA 3FWZA 2YHUA 3VOSA 4NJMB 4R5HA 3ST7A 4CL3A 2Q78A 2HMUA 4PLTA 4J1TA 2YYYA 3ZWNA 4PG4A 3SVTA 3WIEA 4FOOA 1ZEMA 3TL2A 2VZ8A 2NVWA 3QOOA 3JYQA 1ZK1A 4OYRA 3V2HA 5IF3A 3RJ9A 3F3SA 3WR5A 1DIGA 3RC1A 5BSFA 4RVUA 5A9SA 5A02A 5FYDA 2PZJA 4LCJA 2HMWA 2C7VA 3VH2A 1T4BA 2G82A 4BNGA 3D7LA 1Z73A 2PZKA 4O6VA 1IOLA 2H1SA 2DLDA 1LSJA 1RM4A 4O5OA 3VPSA 1D1SA 1KIFA 1ISFA 3WX0A 5MGBA 3U5TA 1J4AA 3M2TA 4FFOA 3BTOA 4R3WA 4PFJA 2X0IA 2YFHA 2ILTA 1T4DA 1YRLA 4RPKA 2J3JA 1B3RA 1LUAA 4HZPA 1NR7A 2JKVA 2XAAA 2ZB7A 2EG9A 3PPIA 3PVZA 4INAA 1WXDA 3AOGA 3JQ9A 5LCXA 3GUCA 4AVYA 2Q1TA 5IN5A 4CM9A 2OL4A 3M6IA 1SOWA 3H5RA 3NWZA 4J1QA 1BXZA 2V6GA 1Q4TA 1WW8A 4RQTA 4DYVA 4R41A 3K31A 4IQGA 1FF9A 4DA9A 2W2KB 3WICA 2FZEA 1YOCA 2PGDA 1DAOA 3JYNA 1BG6A 1GZ3A 3HDYA 5KCZA 5H82A 4E5KA 3UH1A 1LC0A 4GKVA 1PSUA 4XR4A 2XPCA 3EDMA 3I9NA 1DIAA 2BFAA 1VI2A 5A05A 2VCYA 4C7KA 1NPYA 3WWZA 2JHGA 1LLQA 4XWYA 3LT1A 1HE5A 5L40A 1Y9EA 4OQYA 2JFHA 4RZHA 1ZXLA 4L4XA 4TRNA 2UDPA 1HRDA 1MKAA 1DFIA 5L3ZA 3JQ8B 3LYLA 1BW9A 3VPFA 3G1UA 2VRCA 2CF6A 1WPQA 1ENZA 1H9BA 4S3MA 4TVBA 4DQUA 1GCUA 3EMKA 1GUFA 1Q4SA 1B0AA 3AI2A 3Q11A 1X7HA 3A9WA 4W99A 1ZBQA 2VYND 3NKLA 1NR1A 3PDJA 3KH8A 2CNBA 4PLYA 1N9GA 4Q39A 4RLHA 5F6RA 4I5GA 3QE3A 5KVQA 3MJTA 2H6EA 2WD7A 4YJHA 3STHA 3GFGA 4R1TA 1JQBA 5DULA 2PZHA 3BMCA 1HTBA 3TOXA 2I3AA 1UXJA 4DREA 3H3FA 4QECA 5EN4A 3BJKA 1RM0A 2HUNA 1B3BA 5HMBA 2OBNA 3DBLA 3H3JA 3KRTA 3RD5A 1MXFA 1MKBA 3A28A 3WYCA 5A3JA 3I9MA 3QVTA 3WSVA 4ZJUA 4QSMA 1U2GA 4UUNA 1KVRA 5JO0A 1N2SA 2PKQO 2EWMA 3UUWA 4R9RA 3ENKA 1WMBA 3OA2A 4CM4A 3C7CB 4U8GA 3HG7A 2V1OA 2B0JA 2NUJA 5JMWA 2HCTA 2V65A 2XEMA 1YB4A 1C0PA 4MIEA 2EKPA 2CDBA 4NJMA 2NSDA 5DDIP 4GQAA 1FJHA 3IUPA 4BNVA 3P2RA 1QORA 1I32A 3M2PA 3Q62A 3H6KA 3JQFC 8ADHA 3OETA 2OIWA 4KWHA 1B8VA 1UP4A 2X1HA 1R0LA 1LC3A 2C7GA 3RBXA 3VKUA 3RC9A 2AXQA 4FN4A 1R37A 1O94A 1IQ6A 2HJSA 2QIOA 2DVMA 4OXYA 7MDHA 3RUEA 1R4NB 1P1HA 6LDHA 2O3UA 1SC0A 2X5JO 4XD2A 5G0TA 1GD1O 2Y99A 1EBUA 1KC3A 3MEQA 2GSDA 3DZGA 3TEAA 4RVHA 3WMXA 2AE2A 2X22A 4OH1A 1NHWA 4CPDA 3F5OA 4TVOA 4XQEA 1KEWA 4L73A 1BVQA 1VLLA 4IDDA 2HBOA 2CY9A 5KJFA 4TRRA 1JDJA 1ZHGA 1CIVA 3H4VA 3UCXA 3F1TA 2HLPA 2W2KA 3K5PA 2PD4A 3C1TA 2HK7A 4MIYA 4ZQGA 4IGFA 1YL5A 4W7IA 4YRBA 1E3SA 3WJAA 2I66A 4BV9A 2QZ9A 3ZW8A 5A5FA 4ORDA 4DIBA 3GGGA 4F6LA 3UAGA 1YS4A 3PGJA 5JS6A 1ZO8A 2EGGA 1PU2A 3KXDA 4I1IA 4E13A 3R37A 3KVOA 4BNFA 3IMFA 2B4RO 3RBZA 4WKGA 3DKZA 5THQA 3GQVA 3ICPA 2JFFA 1QXSA 2NLOA 4DWVA 3AUUA 5A9RA 4L0QA 3JQ8A 3JQGB 4K6FA 2AQHA 4MKXA 3DBHB 4J4HA 1SH8A 3MJVA 2FMUA 3LZ6A 2GVHA 3WGZA 4LW8A 5EERA 5FF9A 1S5UA 5G0VA 4PZCA 3KVIA 5BQFA 3MTGA 2Q46A 3P3IA 4L75A 4D44A 4ZVVA 1DC5A 3DOCA 3A4VA 4RLWB 1BDMA 4Y6SA 4HX5A 3VDRA 2CMDA 1SC6A 5HD6A 1PZEA 2ZTMA 1A72A 4BB5A 5T8KA 3H2SA 4E2YA 3VZQA 2ZYAA 1QYCA 1CJCA 2WE8A 2IXAA 2X23A 3AU8A 2QYTA 4J9VA 4A7PA 2V6BA 5HA5A 5B4UA 4BKOA 2Y1OA 3DONA 3ZWMA 1E6UA 4WE3A 2CDCA 3GHHA 9LDBA 3WOHA 4IUYA 1EVYA 3DO5A 2ZCUA 2VQ3A 3C24A 1IZ9A 2ZIZA 2HAEA 3ESIA 1YBMA 2YZ7A 4QFCA 2W2LD 3PZRA 3H9QA 3LT2A 5IDQA 5JY1A 1E1MA 1LDNA 5I7EA 2F3XA 3O03A 5BNTA 4WLNA 3OIFA 4E0BA 1ISJA 1BVRA 1Y5RA 5H81A 1DLIA 4I8XA 4ZA2A 4OXKA 4CV3A 4YT5A 1P9LA 1JW9B 4Q3AA 2PKRA 1DEHA 1T2AA 2AHRA 3K2BA 3EYWA 3OHSX 1R4NA 3ZWWA 5C5IA 4H15A 1PJQA 3DZJA 3SLKA 2ZJ1A 3ROPA 1XELA 1CQIA 5JC1A 3ASVA 5C7LO 2EF1A 3BMNB 1PIWA 4QDBA 1O8CA 4B4UA 3ABIA 3RI3A 1YB1A 1KY4A 4CJXA 7ADHA 5JCJD 2Y1EA 4I5DA 5CPBA 4OKIA 1FDWA 4BNNA 3OSUA 1WDLA 3LMBA 3DB2A 4JBGA 1HDCA 1MG0A 1VL6A 4LRSB 4NMHA 1A7KA 1VSVA 3JCZA 3KM0A 3OA0A 4WOKA 2O7SA 3EZYA 3VDQA 4CMEA 4D43A 5CDSA 5IXSA 1TLTA 4WLOA 5L4NA 2P9EA 1DJQA 2JCYA 1E3WB 1WMAA 2ZATA 2DPHA 2JCVA 1KVSA 5DBFA 5EQDA 1FDSA 1DXYA 1MB4A 1MLDA 1UP6A 4D41A 3U09A 3W6ZA 4K00A 4J91A 1NQOA 4XR9A 1OI7A 1GUZA 2WWRA 2H4UA 3BHMA 2E37A 2GLXA 2EP7A 4RGBA 3L9WA 4DMLA 2X9NA 3LT4A 1ZIDA 3P3FA 2Q4EA 3PQEA 4GL4A 3K73O 4XX0A 3K8ZA 2B37A 1GU7A 2EW8A 2AQKA 4ZRMA 4DLBA 4FB5A 1ZK2A 2O2SA 5C3MA 1Y6JA 4ZQBA 3LLSA 3JQGA 2JHFA 1ZEJA 1H2HA 4K4DA 1G1AA 1LXCA 3DBHA 3MJEA 4Q3CA 4XYLA 2IYOA 2XFLA 2TMDA 1SPXA 2A9FA 1BSVA 1TI7A 1X14A 4YJFB 1YQDA 2VYNA 3E48A 1LRKA 3DMTC 4RORA 1ONPA 2ESSA 4RLWA 3I9OA 4RPHA 2DQ4A 1B8UA 1JWAB 1K0UA 1JN0A 3A14A 3WTBA 4KUEA 2IDZA 4R1SA 4HWKA 4EJ6A 4K6CA 3LZ7A 4E5NA 3NUGA 3I3OA 5LDHA 5BNFA 3DP1A 1LSSA 3D4OA 4Q9NA 1DIBA 3JQAD 4DBZA 3D6XA 1EBFA 2AMFA 4OQZA 4N7RA 3W6UA 1JKIA 4MOBA 4AJEA 1XCBA 1IUKA 3UICA 3GNTA 2CVZA 3TWOA 1BXGB 4QD9A 1LJ8A 3HNPA 4QDAA 3ANMA 4OMUA 5CG2A 2BI7A 3QIVA 5I9LA 4NZ9A 4RLJB 1ZKMA 2E82A 2C2XA 3F9IA 4YT2A 4GH5A 4IZHA 4QFDA 1SO8A 5MDHA 3U62A 3WFIA 3ETDA 6ADHA 1F8FA 5GY7A 3QA9A 4R4JA 4XGNA 2LDXA 1HDRA 3BAZA 1B16A 4UVIA 2EJVA 4A73A 3GRKA 5TF4A 4W4TA 4P22A 3DBRB 1HF3A 3BMNA 2CYEA 4RDIA 3JQDA 4ZQEA 2OHXA 4RMMA 3RCBA 3R35A 1HYGA 3GHYA 4AJ4A 4IZIA 4PLVA 2PD6A 4LMPA 2PLAA 3RROA 5TC4A 4R68A 3PHGA 2HK9A 4YAKA 2Q1WA 4IJVA 2C2IA 2CFCA 3IDSA 4RQUA 4FSHA 2XOXA 3INRA 3TZCA 3S1LA 4B0BA 3KSUA 1E3WA 3AY3A 2WJPA 3UHAA 1V3UA 3R32A 3H2ZA 4BGVA 1O89A 4JROA 4BNLA 4IMRA 1H94A 2X6TA 5DBIA 4Z3DA 3PDUA 3PP8A 4K02A 3PIIA 1PZGA 2DBVO 1PGQA 3QWAA 1S9CA 2X0RA 1HE3A 2A35A 3HFSA 4WGGA 2J8ZA 4CLOB 1BVUA 5A06A 2LDBA 1RWBA 4L76A 4AJNA 3Q0EA 2HMSA 3U9LA 5EMHA 1YB5A 3K2EA 4I9UA 4CQMB 1M6HA 1S6YA 2P5YA 4D0SA 2SCUA 3HN2A 4QQRA 4BUCA 1Q7GA 4YA6A 3EXZA 2VRCD 1A4IA 5L9AA 1P0FA 2WM3A 1UZMA 1YQGA 1L1FA 4AFNA 3CINA 3U4IA 3PGXA 1O0SA 4TZKA 4YJFA 4YVFA 1KVTA 1MX3A 1NX6A 1PTJA 1KVUA 5TJ9A 2RHCA 3QSGA 3R3JA 1ZW1A 3R34A 1J49A 2EGHA 1ZK0A 3CPSA 4Y6PA 4B0JA 4GAKA 3WJ7A 3KEQA 3R0IA 2VT2A 3H9GA 2OXIA 5KNLA 2BI0A 1GEEA 3VZSA 3CZMA 3KVUA 3B7KA 2VOJA 1QV7A 1E1LA 3WEWA 3R3SA 1X0XA 1U28A 2JFGA 4XYBA 3AM4A 4M20A 1E6EA 1ZH8A 4XDYA 3ADOA 5G0UA 4CM6A 1L7EA 4QUKA 3JQAB 4ZRNA 1GPDG 3KLPX 4BB6A 2VZ9A 2C29D 4RF4A 4RLSA 1BXGA 2X86A 4C4OA 2VTEA 1GQ2A 2W2LA 4JXKA 3KTDA 4CMCA 4B4OA 5TT1A 5BUXA 1RKXA 1HLDA 3DZIA 4RLJA 2HLJA 3E29A 3RU9A 1Q0LA 1Q0HA 1Z6BA 3JQBC 4L74A 1GPJA 4A2CA 1O9BA 4L9RA 3OIDA 1CDOA 1OZAA 3FR8A 1OFGA 3ZWPA 1HDXA 1I2ZA 4LRTB 1N1GA 2E49A 2IODA 4FR5A 1LO7A 2W90A 3DBRA 2OFPA 4XB2A 2NVBA 2BHLA 4ND3A 2IRWA 2F0XA 3DAFA 3OJOA 3H9UA 1IE3A 4K9DA 4FGWA 4FPXA 4D79A 2VWQA 4LSMA 5AXCA 1WWKA 1N92A 1VI8A 2PR2A 4RZIA 5B12A 1YDEA 4EYEA 3SBOA 3RQSA 1NVMB 2UAGA 3BA1A 2YJZA 3HM0A 5HMCA 1E77A 1VC2A 5T57A 1Y8QB 3FNFA 2C07A 4JGBA 4MPDA 2I76A 1H6AA 1WLYA 2C5EA 2PV7A 1C0KA 3RUHA 4FD3A 2Q50A 2DTXA 1P1FA 3C7AA 4J7XA 1UJMA 5DOVA 3E1KA 3UN1A 1KY5A 2FR8A 1U2DA 4OGWA 4WCFC 1HDZA 3WGHA 4CLOA 2OAFA 1U7TA 1ISIA 3D1LA 1XSEA 3B20A 4J6FA 3B7JA 3K9QO 4Q3DA 3B1JA 4XGKA 4M86A 4IM7A 1DPGA 1JWBB 5L4LA 2O3QA 4CQMA 1BRMA 4BGIA 2GN6A 3LW3A 1SNYA 2R00C 2Q99A 1SZJG 3BYZA 4UUPA 1UDBA 2AG5A 4NQZA 4BNTA 4C7JA 3F5SA 1P33A 1PS0A 3HDHA 4R54A 1UDAA 3E8PA 3GF4A 4YEDA 4K28A 3KVZA 1NPTO 3R3AA 1R15A 3FD8A 3JQEA 3O9ZA 4OKNA 4ALMA 1WP4A 5F3RA 4CV1A 3DTYA 3GH3A 3P5SA 4WASA 5EESA 1VKNA 1R16A 4GX0A 1C8UA 1EEHA 5JDCC 3ETGA 3L6OO 1EUZA 1YL7A 4P38A 3WYEA 3OFSA 3ZNOA 5TJHA 3ZU4A 4LVUA 4LVCA 3NTQA 2G1UA 4GAEA 1TB4A 4BNHA 1KERA 3RUIA 2AV9A 1F14A 4OM8A 3JQAA 1P1IA 2A92A 2X5OA 1T2FA 3UCFA 3MJCA 1H6DA 3RVDA 1D1TA 3K30A 3FTPA 2VTDA 1W0CA 4YDRA 5ER6A 1T2EA 3HE3A 1X15A 1IXLA 4LMRA 4MVJI 1NPDA 2NU8A 4YT4A 4E33A 1I24A 4G65A 4XCVA 3ZU3A 2GRAA 3L77A 3O8QB 1E0DA 1YJQA 1Y81A 1BDBA 2FPIA 4KTTE 1UDCA 5CDGA 4BO6A 3GOHA 4K4CA 4XQ9A 4BKPA 5ICSA 1RM3A 3GG9A 5B37A 3JQCA 4N5MA 1LTHR 2BFPA 4E5MA 3T4XA 4BOYA 2J3IA 1N1EA 3NT5A 3ZHBA 1LI4A 4BQPA 2HSDA 4DBVO 2GPTA 2Y93A 4F46A 1PJ4A 4YAJA 1MG5A 4URFA 1VM6A 4IXTA 2NNLD 3GDGA 4MTUA 2BRUA 2H9IA 4KEHA 4KTVE 3AZBA 5FWNA 5EO4A 2EKQA 1ZJZA 5I8ZA 1Y8QA 1HL3A 3FN4A 3N74A 3RUFA 3VVCA 4BGUA 1U7HA 4WPGA 2ZK7A 1ULSA 4A12A 4I5EA 5KWEA 3H7AA 3AWDA 3PQFA 4QT0A 5BYUA 4ONEA 4M89A 4IPTA 3ZI0A 9LDTA 3OJLA 2EISA 4YAEA 1F12A 5DOZA 4MKRA 3HDUA 1CWUA 1I2BA 3F1LA 3H9JA 3GZNB 5BR7A 2CSUA 3F4LA 1I01A 3KBOA 2WEKA 4PG6A 3HMJG 1YGYA 3M1AA 2BFMA 1JU9A 1NFRA 2PD3A 1ZUD1 2ZTLA 3U0BA 3KX7A 3BTSA 5ES3A 5KVSA 2VHZA 2FPPA 5ER9A 1ENPA 2ZTVA 5CPFA 1NHGA 3IJPA 2NTNA 2UVDA 4G2NA 2FWMX 1GY8A 3D3WB 5B4VA 2YDXA 2EW2A 4TQGA 3IR3A 2D8AA 2P9CA 3BIOA 4MJLA 3F47A 1PGNA 5T07A 1PGPA 3L0DA 4GKBA 3WDSA 3WYBA 4PG5A 3G0OA 4PLGA 3VH3A 4MINA 5BT9A 1JAYA 4XY5A 4BO9A 1YWGO 4IMPA 4CUJA 2BGLA 3KUVA 3WNVA 4DL9A 5IFLA 5KVVA 4HFNA 3CSDA 4K26A 4D46A 5L7YA 1YDWA 2HDHA 3H65A 5G0WA 4Q3NA 5K6AC 2QX7A 4CL6A 1U3VA 4QX6A 4YACA 1P45A 4DTIA 2WMDA 4EDFA 2VHYA 5JDIA 4AJPA 3N7UA 3ZHYA 3G49A 3CF9A 3NT2A 4TRMA 3V2UA 4XYMA 2Y1DA 1HDGO 2AW5A 1FDUA 1XG5A 1U4OA 2GCGA 5A03A 1HE4A 2EEZA 1QSGA 3CE6A 1EVJA 4HADA 5IZCA 3O8QA 3PI7A 3FSRA 1A27A 2DBRA 3E5RA 3DOJA 3W4KA 1VJ0A 5EGKA 2Q2QA 3GMDA 4BGEA 2C20A 3QVSA 4U0JA 3GPDG 4RV2B 3SC6A 2O6BA 4DPMA 1N7HA 1E7SA 4JBHA 2ZQZA 2GYYA 4E5YA 1EUCA 2NU6A 1KOLA 4PLWA 3PYMA 1NQTA 2DC1A 2OBYA 4YQYA 3K96A 3WGYA 5U4QA 4J4BA 3PLRA 1XLTA 3L4BC 1I3KA 3I83A 1WNTA 3RUAA 5A1TA 1GZ6A 2C54A 3C1OA 1D4FA 3ZWVA 3ZWCA 4EUEA 1YL6A 2PFGA 2QHXA 1MGOA 4GGOA 2X7HA 1Y5MA 3KV3O 5JFOA 2QRLA 2AG8A 3PFFA 2B3MA 5EIOA 3G79A 3OEWA 1IHYA 5A3VA 3KYBA 4A0SA 2IEBA 3DL2A 3DMYA 3FTNA 3DHNA 4GMFA 4IQ8A 1GUYA 5KJEA 3ON5A 5IG2A 1VE9A 1HDYA 4GX5A 3GT0A 5CG1A 1E5QA 4EUHA 1ZCJA 3U4CA 4E2XA 1E1NA 3D64A 3QWBA 5KTKA 2VNAA 3BHIA 5BNIA 1ENYA 1Z82A 5FEUA 4EITA 4E3EA 1QYVA 4RPLA 4ZV3A 3BTVA 2D59A 1A4UA 2EGJA 3GZNA 2R6JA 1IB6A 1LU9A 2GLLA 1NVTA 4CMAA 4E12A 5AQ1A 3LC7O 1HSOA 4WJZA 3QJ5A 2RAFA 1HXHA 1MXHA 3E6AA 1W73A 4E2WA 1VH5A 2C2YA 5COBA 1YXMA 2Q1UA 3K92A 2FSVA 4MVJM 4CLRB 1SCUA 4IINA 5DT9A 4Z0HO 5CAEA 3D3WA 4F3YA 5L45A 3P2QA 1ZZEA 4CM1A 3E9QA 4ESOA 2O3TA 4Q3BA 3VZRA 2VNSA 3JQ7B 1QR6A 3A06A 4PZDA 2DPGA 4PG8A 1R12A 2Y67A 1SBKA 3DEYX 3E03A 4XRGA 3TPCA 2ZTUA 1P44A 5F5NA 1BMDA 2YQ4A 1PJCA 1M66A 3LQFA 3GNQA 3ROMA 5TIIA 1DHRA 3P7MA 3S2GA 2JD2A 1GL3A 4QEDA 5A04A 4NCPA 1YOVB 3NGXA 1LO8A 5JLAA 2BGKA 3ZNQA 1U5CA 3DBVO 3RJ5A 3IP1A 2B35A 4OO3A 3TZKA 5IAAA 3VPXA 5DP1A 4UVDA 5I7VA 3IIEA 5CHEA 1Q7CA 2AA3A 5DIOA 3RC2A 1UUFA 5CDUA 4NDNE 2GLVA 3FNHA 2A4KA 3GVPA 2DBZA 4CQLB 2QWZA 4J0EA 4UREA 4IIVA 3TRIA 3KUWA 3TF5A 1V8BA 3FPCA 5AXBA 5ILGA 4BKUA 2DAPA 1VH9A 2Y68A 4UEKA 1PQPA 1EUDA 1HE2A 4FCCA 4R1NA 3NYWA 3IKVA 3HB5X 5JSFA 1IZ0A 5KOIA 4EUFA 4RV2A 4Y67A 1H6BA 5KKCA 1PSDA 2NU7A 1ZSYA 5LC1A 4A0ZA 5DP2A 3UXYA 4U6SA 3SLGA 1KC1A 1XWFA 4W6ZA 5EO2A 1AXEA 4D0RA 4R5MA 3MTJA 2E48A 4YTEA 3GN1A 1B8PA 3D5TA 2RBEA 1H93A 1QG6A 1UXIA 1ID1A 3A1NA 4BNUA 2Y1CA 3S2IA 1LEHA 3JQFA 1A9ZA 2IYPA 4YT8A 2Y0CA 1PJLA 1PJTA 4BNZA 2Z1MA 4M54A 3R36A 1I36A 3NX4A 4RVDA 2ZCVA 3ZH2A 1NASA 2GUGA 4CLHA 2FHSA 4A03A 1QRRA 2ZKLA 4RF5A 4U7WA 3VH1A 1P1JA 5DZSA 3FPLA 4IJWA 4IS2A 4R01A 1LBEA 4PZEA 1R66A 4YAIA 3S8MA 1DRWA 3DHYA 2IEDA 4Z9YA 4DVJA 4JN6B 3IOYA 1NNUA 2VUTA 1LDYA 2PZMA 3JTMA 5AYVA 3R3DA 4LCEA 4FQ8A 2Y0DA 5U1PA 2Y66A 4EW6A 4CLEA 4XQGA 4DC1A 3HZZA 1D7OA 1PL6A 2GDZA 1XR3A 1DAPA 4CQMD 2O7QA 3VTFA 4WUVA 3G3EA 2GF6A 4ZRFA 4NK5A 3RKUA 3PHLA 1CETA 1YBVA 4XJSA 4HKTA 3WSWA 1OAAA 4FFLA 4Z9FA 4A10A 4CLRA 1GAEO 2P9GA 2W98A 4KUHA 4RPJA 2OORA 3EVTA 3LC1O 4HXYA 4MVJG 2O3JA 4GWKA 4CM8B 4KDEA 3GMSA 2GASA 4G81A 3JQ7A 5DCWA 1H9AA 3NAQA 4A26A 4WEOA 2Y1FA 4E32A 3D0OA 4RVFA 5CEJA 1LLCA 3MWEB 4JIGA 2D5AA 1I3MA 4XRRA 3OECA 3V1YA 3ZCXA 4R9SA 4PLPA 2O2YA 2O4CA 4N18A 5HM8A 4WEQA 2ZB8A 3LSYA 3R3BA 4ZJBA 3FF4A 3Q2KA 3ZWXA 3S4KA 4B8ZA 3KHPA 3AI1A 1YOVA 3DZKA 4W7HA 2QW8A 5JY6A 1A5ZA 3IL2A 3Q3CA 1GTMA 3I52A 2ZYGA 3C7DB 1SAYA 4MIOA 5DBGA 3S2FA 3TZHA 5A4DA 5BUYA 5ILOA 1LLUA 4K49A 2WD8A 2ET6A 4N54A 3H5NA 3HFGA 2VYVD 3B6ZA 4KZPA 1XEAA 4CQLA 3OMLA 4Z9XA 2PWZA 1FMCA 2VWPA 5JC8A 4IJKA 5A5EA 3GVXA 4FQ9A 5CPGA 3P2SA 1C1DB 1OBFO 3VPHA 2WYWA 2V6MA 1WDKA 1P1KA 3PWSA 1LX6A 2X9GA 3KHUA 4NPCA 4PIVA 1L7DA 1SEPA 3CZRA 1F0YA 3GVCA 3RUCA 1U3WA 2NADA 3DOOA 3GK3A 1I5RA 1IULA 1WZIA 4IQ0A 4ND1A 4DPLA 2B4QA 4JCOA 2OV9A 3KG8A 2BELA 2VN8A 2NV6A 4ALJA 2O50A 1OMOA 3EAGA 1FK8A 5KJ6A 2EERA 2C59A 5U9CA 4NG5A 1D3AA 1R4MB 2FSSA 3TSCA 1HLPA 2D3TA 4DIOA 3PWKA 3LT0A 4WNBB 2B5WA 3AZAA 5AOVA 1TEHA 2GZ1A 3GLQA 1I33A 2GN8A 3WTCA 4JJGA 3I4FA 3WQQA 1DRUA 3DC2A 2DKNA 1KBZA 1ADGA 2P5UA 3E1EA 1DO8A 1WAMA 1U8XX 2HJRA 1IYZA 1T82A 3GZ4A 4LGVA 4JBIA 1C1XB 3EW7A 4BO2A 2NQTA 1VRWA 2HMTA 3X2FA 4DLAA 4H16A 4GGPA 4ZW0A 1I3LA 1FXSA 2ZYDA 4JP3A 3ZV3A 4IS3A 4D3FA 3RWBA 1ZJYA 2AQ8A 2W4QA 4NU6A 1V9LA 3E5MA 1YLIA 2VHVA 2BD0A 3JD4A 1SMKA 3DOZA 1ZXBA 3EK2A 3WLFA 3ICCA 3JD0A 3NGLA 1JA9A 2NACA 2X8LA 5F5LA 4AJKA 3O38A 1PQWA 1Z74A 2PGJA 3HB4X 2CDAA 3OP4A 2X5KO 3U49A 1QP8A 3VPGA 4EGFA 3JSAA 3RUDA 1B26A 1R0SA 3EZLA 1XU9A 1LSOA 1ZMTA 4E5PA 1ARZA 5T02A 1LA2A 4EJMA 4MOWA 1ISMA 3F46A 2FOIA 1H0KA 1JKFA 2VKZG 1S7CA 1NBOA 4YPOA 3AY6A 3P2YA 4DXHA 3IQDB 1JVBA 3GEGA 4FW8A 4B3IA 3BNVA 2Q2VA 4JNKA 3ZHXA 4CM8A 1ISGA 4J2HA 3VKVA 1ZMOA 4B7XA 3WGIA 4RO0A 2BF7A 1R6DA 2W3XA 3MJ4A 2IE0A 3PK0A 1YBAA 4O59O 4D42A 3DAGA 1OC4A
chains in the Genus database with same CATH superfamily
1NA5A 2KB0A 2AN4A 4F06A 5JWRA 1O6CA 3PR2B 2G25A 1X1TA 4O8ZA 3QVXA 4WFQA 2JLUA 2DLKA 4DHEA 3LVQE 1KHHA 2X0FA 1OLUB 2YMMA 1YMQA 1V6AA 3IQZA 4MQBA 1P3DA 2PUWA 3GRUA 1CF2O 1U3TA 5FL7D 3ZS8A 1USKA 3A6FA 2PIMA 1G5HA 5AK4A 3UGJA 2J33A 2G08A 2OAEA 5G0SA 4OSPA 4MUKA 2C61A 4IRXA 4I6JA 2ICAA 3B8HA 2NO5A 4L4SA 4IOLA 4C06A 1N32B 3NHFA 3OQ1A 4ARZA 4PSVA 2KOUA 1XYYA 1EZ4A 4MUMA 1YS2X 3NV9A 1CLUA 4LOHA 4INOA 3R0XA 2OP1A 1ZQ9A 4E2ZA 1D0IA 2GFIA 1NNLA 2YZTA 1XB2A 4C2AA 3CJTA 2DR2A 2YZ2A 3G2QA 3AFHA 2OKIA 4Y6QA 2ZU6A 1Y3AA 3COVA 2VNIA 5DTEA 2YH2A 2EE8A 4X24A 4OHXA 3WL3A 3X1XA 4LBWA 2BWJA 1YKFA 2R2GA 4HQLA 2NV2B 3GPIA 4TWRA 3MCAA 1JXMA 2ACVA 3O21A 2MINB 2VBFA 4KXWA 2H1OA 3UEOA 3TVDA 2VR1A 1LJUA 2Q1XA 3EBPA 1ZKIA 2VJOA 2O6TA 3FHOA 3V32A 1U81A 1ACJA 2YTOA 3TD6A 2E18A 2PH5A 2YWDA 4CLXA 4C6SA 3MTAA 1ZD3A 3QBVA 1ETHA 2A84A 5IEBA 1DC3A 4XY6A 1XMOE 4GVPA 5JADA 2G5PA 4RDHA 2QQFA 4OOEA 3AEXA 2NTVA 2P2CA 3ELWA 1MTOA 2VK8A 3S1AB 2AB0A 3ZG6A 1L6RA 1L1EA 4NIMA 5K0TA 3C8MA 1SIBE 4M7RA 2IBMA 2H5LA 3HA3A 2ATEA 5JH7F 1I7NA 2YN2A 3ELDA 3OWXA 1TJNA 3RVMA 2EM3A 1FYFA 3HHEA 2MKDA 1IDOA 2W2XA 1OJLA 4BO8A 2H00A 4E4RA 4K9MA 5HKAA 3OFND 3LUJA 1EM8A 3NM6B 2CE7A 1X86B 2R4TA 3OZTA 4M6WB 4V2UA 4ZDJA 5IN4A 2WYUA 3PUIA 1TTQB 1AKTA 2AZDA 4HFMA 3T3IA 1C2YA 1E2DA 2GTHA 1UP7A 2R7LA 3K6JA 2IUFA 3EGXB 1PW5A 3K0EA 1QTIA 1NM5A 1DCFA 3LTEA 3V2GA 2XA1A 4C7OB 4F2JC 4QNNA 1D04A 3WP0A 5BV0A 4C87A 1O95A 1N2EA 2JBHA 4L0DA 3N9IA 1N4DA 2EL9A 1XC7A 1OT3A 3H83A 4C88A 3LUAA 3ZHRA 4XPIB 2HU7A 4GIBA 3H5WA 1DRKA 5G4KB 2QQGA 5FHRA 3O2JA 4JELA 3IQGX 3QE4A 4PNHA 4PSCA 2OLKA 3K3PA 2LTRA 3GRPA 4DMRA 2R87A 4NENA 1ISSA 4F5YA 2RHGB 1JLLA 1F38A 1JU4A 4MKGA 4JHXA 3WIBA 3IEPA 3CVXA 4YASA 4R2PA 4IHJB 1M2WA 4JEMA 2XNJA 3R9KA 1JYFA 2Z8XA 4OAQA 3QH4A 3L4BA 3WSTA 2Z6AA 4UVEA 1K4YA 4ZT2A 2BFBA 2FG6C 3LAWA 2IOQA 4G4JA 4IVRA 2ODRD 3I1JA 3UK6A 3HKEB 1WO8A 3OZSA 4D8TA 2ZBFA 1FSGA 2WUWE 4MMZB 1CRZA 4EZEA 1A9YA 2PBLA 2QL7A 3GAAA 2QRJA 5KJCA 2CSXA 3SQMA 3QWFA 1WBBA 4R2IA 2MTBA 1PWHA 2Q21A 2FOLA 3P0FA 4H18A 2F1RA 4QKQA 5FPKA 1QVRA 2B7CA 5IDWA 4NHRA 3PYXA 1KE2A 3L1HA 5BUQA 5KTRA 3D6NB 3CF6R 4KX5A 4MVJH 2V0CA 4PCVA 1L5HA 1HURA 4OHKA 5I9BA 3DNFA 1YB2A 1MA0A 2HHAA 3DOYA 1L7AA 3DF9A 4LRWA 3E8XA 2DECA 3RRJA 1CRWG 2QYHA 3W2IA 3HO8A 2A7QA 1ZCZA 2YIMA 3KHTA 4FFRA 3I2IA 1UMCB 4BKRA 2RHRA 4IHJF 5F7JA 4UNRA 1HFEL 3ZLJA 5LNK6 1EGQA 4DR3B 4OAPA 3OX2A 1SKYE 4TMVA 1TOAA 2VJAA 4QFMA 1Q14A 4RCZA 2I0FA 2YU8A 5L3QA 5EHIA 2AOVA 4F3TA 4I45A 4WNAB 1NBHA 3U3JA 3HFRA 2CMGA 2NUEA 3MWKA 3DPSA 3SYMA 5D3QA 2IBTA 4BPRA 3BGDA 4URZR 4AY3A 1G6KA 5AUOB 3BZBA 2FS2A 5AVOA 1QAOA 1T39A 2BE7A 2DSYA 1F9AA 1RKQA 5C1DA 2WSYB 2NO1A 3RQBA 1V1JA 4ILEA 4C4SA 1WL8A 4JYAB 5B1EA 2XADA 2OB2A 1E63A 1G8HA 4DVGA 5GAJA 1A1HA 2EM8A 2M6RA 3TZEA 5A3QA 1D09A 3ZCSA 1MCZA 4E3ZA 2Y8EA 3I4LA 4O0LA 3R2JA 2PKEA 4DDKA 2AUTA 3PX3A 1LK7A 4Z54A 3W8DA 1T26A 2Z4RA 1I2AA 4B5LA 5DBEX 1Q1AA 3LDHA 1TCUA 4KRGA 2MDRA 4HAOA 3BPSA 1XRRA 4A0YA 1FFHA 3D0QA 4S04A 2PH7A 4YRRA 2EPLX 4IYRA 2ZIXB 2C5AA 4P84A 4ND5A 2XMCA 2FU5C 4OQXA 1XRNA 4AT1A 3VV2A 4LYEA 3NKVA 2G83A 2HJGA 3GEKA 4CTJA 3A1EA 1W85A 2J45A 2NIPA 4MS3A 1N9GB 3MZ0A 4DJ5X 4QNRA 1FMLA 1CR4A 3ZV5A 3QY3A 5DGHA 3H9EO 2GEDA 2JL1A 1KJIA 3MCTA 2EZ9A 2QG4A 3MD9A 1KH3A 3ZW7A 4CM4B 4Y1RA 2DJ5A 1B43A 1FPMA 1Z8HA 1GRRA 3DDZX 4WZAE 3ZWNA 3E15A 1ZEMA 3T5TA 2NVWA 1GNLA 2CDRA 2I9IA 1PFKA 1FSPA 4YRSA 4BP3A 3FUUA 3ABZA 4AVYA 1L3CA 3IEUA 1ZD1A 4Q1CA 1E1CB 1WCIB 2GEJA 3WKCA 2GJAA 3V4SA 1X87A 5G40A 1HE5A 1I4DD 2QTZA 5LA6A 2WF7A 2COUA 4ZHQA 4TTTS 2VXCA 3A9WA 5FCDA 1P9RA 2DLNA 3C3PA 1HTBA 2GHRA 2XMBA 1MXFA 3QVTA 4L5BA 4QSMA 5JO0A 3VC1A 3ME5A 4G0OA 4KHPB 2CHEA 4A36A 4NJMA 2JZNA 1ZR9A 4G8DA 1U9CA 2LJHA 1S8OA 1WVIA 4LFBB 1TPYA 3EPRA 3IEIA 1BHO1 2RSMA 3IUJA 3F74A 3WWEA 2BEVA 1D7AA 4NCAA 1EBUA 1ZOLA 2HA2A 3MEQA 2YXDA 1R0WA 1E2PA 4ZTUB 4IDDA 2GHQA 5FTWA 1RFGE 5J4HA 3FTFA 1SIUA 2QRVA 2DERA 3N2IA 4XWOA 5CFLA 2HNAA 5IANA 3OZ7A 4CNBA 2BJWA 5EIFA 1X6FA 4DIBA 3FLEA 3VKWA 5BN5B 5TXGA 2I4TA 3RJTA 3LZDA 3LZ6A 2CBGA 4WMLA 2VDLB 4DLRA 1DPFA 2GJSA 3KB2A 1D07A 1Z6PA 5B4UA 2X23A 4D4HA 2V6BA 4WZBB 4NC9A 1GG5A 1G66A 2Y76A 3PIRA 3H9QA 4H7JA 2Q9UA 4HGYA 5BNTA 4NYMR 1LKZA 1RYFA 3B3GA 1DC8A 4Q21A 1JW9B 4P7GA 2P0AA 2EZ8A 2YJ4A 1R4NA 4H7EA 3PGVA 3G9XA 3K0AB 3SC2B 5BUCA 1QF6A 1GAJA 2EOAA 1WD5A 3COWA 4CJXA 5CPBA 2PUBA 4RBNA 3WA7A 4ZI7B 4LRSB 2JGKA 3AUJB 2O7SA 4HS9A 3WAKA 2ZATA 2ON6A 2O1EA 1W2WB 1EU1A 1IXZA 4BB0A 3PG5A 4RGBA 3D6UA 2OXEA 3NOQA 3EA4A 5ECGC 4FB5A 3THOB 5KKNB 2XI4A 2VS1A 1V48A 3AVUA 4CKCB 3T0GA 3WGNA 4LYAA 4RLWA 5TR9A 4AAYA 3EMBA 4G5QA 2E5LB 3LX8A 5KREA 1IUPA 2GHIA 1EBFA 1PT7A 2M1XA 1Q44A 1R88A 4OCZA 2C2ZA 4NOKA 4FQ5A 3I5AA 4ZK6A 4RLJB 2XMSA 3HA7A 1ZKMA 1UBCA 2D5LA 2NVOA 1QDEA 5EP4A 2VJCA 2H4ZA 5E6UA 4KQCA 4S1NA 1AUOA 1YZ9A 3IRVA 3OF5A 2D0PB 3ZCTA 2XGJA 3GHYA 4MI1A 5J5CA 2CFCA 2QZPA 1XEWX 2DUJA 4ZI7F 2QGNA 3FKSA 3R8XA 4IV5A 1E3WA 1V3UA 3AXSA 2WYOA 4IMRA 3LQQA 2EKZA 4DUYB 1Y7PA 2A30A 3R3XA 3MWYW 3HBAA 5G53C 4I9UA 3QLEA 1KJYA 2SCUA 4NMMA 1OQAA 4QQRA 1Q7GA 4HR7A 2PZBA 1N5IA 1C80A 4TZKA 1UBKS 3DCNA 2EM0A 1KVTA 4MI3A 5A6SA 3EE6A 4C01A 3GLHA 4PIMA 3PEUA 2OPBA 5SY4A 2ZPTX 3W5UA 5KYWA 1DX9A 1OCEA 4M1MA 1YCDA 4JXKA 4MW4A 3KTDA 5IHPA 3TCXB 4KIWA 1Q0HA 5ALNA 5CIWA 4ABTA 1THMA 3HWX1 1I2ZA 4GOMD 4IIDA 4FNMA 4LF5E 3RTDA 1LBQA 4JI3E 3KFVA 4RULA 4DANA 1QQTA 3RRYA 4P34A 3BAFA 3ZD6A 1JHXA 1N0HA 1H42A 2AK3A 1AG9A 1Z5NA 2W8BA 5DHQA 3PD7A 3PDWA 4J7XA 1KY5A 3AETA 2FR8A 5TQJA 2IUEA 4OGWA 2FB9A 3OKCA 2OAFA 4YUYA 3K9QO 3C3EA 4H7HA 4TYMA 4KRFA 4MAAA 3PNLA 4F9FA 1M8PA 2ZG6A 3SIRA 4AMUA 4G41A 2OPHA 1WP4A 1XLUA 4DHWA 3AFOA 4CEJA 1HQKA 4PYKA 1KGDA 3HDGA 3T7RA 3WYEA 4JQYA 1NXPA 1HNWB 3WYAA 1PWEA 4KFUA 1FOEB 2X77A 2G28A 3EISA 3AVOA 2CXTA 1H0SA 4CEHA 3RVDA 4UMVA 1I1NA 1QGZA 3ESXA 4C3VA 3F7TA 5HNKA 1T0HB 4JMLA 3R8FA 4BKPA 5ICSA 4AO8A 4ARBA 4G67A 4RSHA 4E5MA 1VHWA 2FE4A 1PJ4A 4DG9A 3BWBA 2YVLA 3C4JA 1ZONA 4KTVE 2P40A 2EKQA 4WBNA 3TKYA 4MV6A 1WCYA 1IATA 3HN6A 2W6ZA 2OFFA 2E5WA 2IYXA 1GTRA 4OBWA 4GM0A 5F64A 1JE0A 5BO5A 3BH6A 1YGYA 4U39A 4YUAA 1DG3A 3AESB 4IXDA 2I6XA 2GF0A 3VR4H 1B6TA 4GZLA 2GN1A 5CAEB 1ZDMA 2BL4A 1MPTA 4DV2E 4WKCA 1NXXA 1QU3A 4IMPA 4LZLA 1GUAA 3H5TA 1EJBA 1QVVA 2ATXA 1GNQA 3CUYA 2VHYA 2QVBA 4RMGA 2L3JA 3NT2A 2Q2OA 1G3QA 4XYMA 3B6MA 1WB6A 2JARA 4N6GA 4KPEC 4I9GA 3NTLA 4HZUB 2P2NA 2FFRA 1AMNA 2FWAA 1VA5A 2XWJI 1WLSA 4BFTA 4GUAA 2VAXA 1DRJA 1YIDA 2QU8A 4RL4A 2NU6A 1M7HA 1PR4A 3SSNA 1RIIA 2OV8A 1JZTA 3I83A 3CHYA 4I7EA 2C54A 3ZWVA 1BIFA 2B3MA 5EIOA 3FKSD 5D3ZA 3USZA 3IBGA 1GUYA 1NI4A 2VHJA 1G5FA 4L51A 4F7DA 4GLJA 3HYLA 2J6CA 4GL2A 4D9KA 4EITA 3AEUA 2D59A 1LU9A 5FUWA 1JDVA 2Q1UA 2J0UA 2YC4C 1K8RA 5L45A 2UUCB 4HL6A 1FMFA 4G1MB 1NKSA 3FB4A 5CT5A 3R6LA 1RWQA 3NGXA 1TTPB 2EMAA 2H4XA 2VPIA 2ZFUA 1V8BA 3Q15C 2ZSUA 3QU7A 4FCCA 1MIHA 2NYUA 1KMMA 2GRJA 1ZUNA 4EG7A 1JAIA 5EIBC 3RSGA 2R76A 2Y1CA 4YT8A 2Y0CA 2NP7A 5K03A 3OIYA 3X0DA 5FXMA 3IALA 1QRRA 2R47A 4TLLB 4K6MA 9ABPA 1JDZA 2GCEA 1SVWA 3IOYA 2UXCE 1LDYA 1K68A 3NBZC 4C0XA 3Q3GE 2VCHA 4CDNA 1EFUA 3KDSE 3C43A 4HWTA 1P0QA 4X7PA 5JAUA 2W98A 3IMGA 3EVTA 3WXMA 3ENZA 1T9DA 4G81A 3CB2A 4E32A 2D5AA 5TMDA 4MCIA 4UXJA 3DMFA 1ZN7A 2KLBA 2Y6VA 5DYYA 2Q3JA 3NEYA 2AOWA 4H77A 3A9UA 2PWZA 2VWPA 1E1YA 2JI9A 3P2SA 1G64A 1OBVA 1HTTA 3GVCA 3VJMA 4F72A 4YNBA 4ZI2A 3AZQA 1G20E 2IYFA 2FSSA 1U0JA 3W3AH 4I50A 2H8KA 3E9DA 1GPWB 2NUPB 1N36B 3IUNA 3EFBA 3VGPA 2GESA 2JI7A 1YRAA 2XUJA 2GPJA 1VRWA 1BMFD 3L8DA 3X2FA 3O4FA 4PFQA 3SU8A 4BP9A 1V9LA 4Q9AA 5HJ5A 4W5OA 3H75A 3N8NA 3TSWA 3U7QB 4E3WA 4AJKA 4KWYA 1R6BX 2OBMA 2O8EB 1ARZA 3CO0S 1ODJA 3GYBA 3J80A 4OP2A 4L85A 1JVBA 3GEGA 2W3XA 5EP2A 4KZSA 2A25A 5A6VA 4W9NC 5JASA 4MR8A 3ZNPA 2QL9A 4X00A 3RIYA 2XQGA 2W6NA 2ZRDA 1QS0A 2XF2A 2ZYVX 2HA6A 2DUUA 3R24A 1TVEA 1I51A 1TRKA 3R9IA 1EHCA 3P9SA 2IDJA 3AW8A 4ZMRA 3L0SA 3MF4A 1VMAA 1P6UA 3BB4A 2DHQA 1JXAA 4QAQA 3ADDA 1MP0A 3IERA 1TC2A 3I1YA 4TTPA 5EINA 2RHWA 3FPAA 4KSCA 1QH8B 2X0JA 3VU3A 1WJPA 4R2EA 1NUUA 2BGWA 4INZA 3ORFA 3NJ4A 2AJTA 5B7NA 4JWTA 4ZVSA 4YP0A 2R6CA 1IBCA 1P2DA 2P11A 3MTDA 4M8SA 1IWPB 2VJBA 4EM6A 1E20A 2BISA 3EC7A 2A6PA 1KMQA 4Y2PA 1PL0A 3L0BA 1TRHA 1MORA 2RHTA 3AI3A 1UXOA 1X3SA 2DFLA 1PN4A 2BGJA 1O6ZA 3RU7A 4CG3A 4RTLA 2ACEA 4ZQHA 5EJ4A 5D51S 1SUEA 2E4YA 5AFSA 3JQBA 2NXJA 5GV8A 1JLHA 3SKVA 2VC2B 3I8SA 1G7CA 3LFHA 1JJAA 3HKCB 5KVCA 2R8EA 2ZS8A 1E1DA 4RFVA 4B3XA 5TY0A 3ED0A 1QDUA 4QUBA 1L8QA 5MN4A 2ZIGA 4AK9A 1R0RE 3DA8A 2HR1A 2ZRGA 3T4UA 3P2EA 1FVOA 4KX3A 4LZZA 1E99A 4DY4A 1GV0A 3C45A 5FBZA 2W2MA 2XDQA 2J07A 1UK7A 4UDNA 3ANNA 4PLHA 3SX4A 1AURA 5FA5A 4CDMA 1AM4D 4FDLA 3K1ZA 4Z4FA 1UEIA 1YOBA 2VXYA 2IYWA 3GLKA 5EJAA 1XGKA 4NZYA 4FGKA 1AXRA 4ZVUA 2VZEA 4WLVA 4MKFA 3QLJA 4NEQA 3H0KA 4LHEA 4TRJA 2P9FA 3UMGA 4B2IA 3A26A 2CUKA 4J2OA 4JUDX 1KVQA 4R9VA 3SXJA 3V1TC 3QXGA 4NPHA 2K5UA 4EI8A 1QHHA 4A23A 4TS3A 1TADA 1JEQB 3AERB 2HHCA 1UH5A 4JVNA 3ULKA 4OUDA 4I3FA 2BFOA 1C7FA 5AKYA 3GP3A 2XAUA 4XWAA 4HDSB 3F90A 1HEUA 2G1PA 1M2OB 3R9XB 4FINA 1BBOA 1NXVA 4HNTA 4K4AA 3EOAI 3H42B 4GR5A 4K4BA 4JU8A 3WL4A 4HTFB 1XQ1A 1RWXA 1Z0SA 2ASEA 4J3FA 3EVFA 3A2NA 1BJKA 1EHIA 2R11A 4I4JA 1V4NA 3T0IA 1NLMA 3JWJA 3PS9A 2XMDA 3KZMA 4INPA 3OX4A 4HWSA 3UFXB 4FOTA 2V7BA 3LUFA 4XCXA 4Q12A 2VP6A 1FUKA 4H3VA 5SZYA 2I9KA 2HZ7A 3P71T 2F1JA 2YHIA 1ZICA 3VO2A 3C1AA 2Z83A 1X7YB 2VIIA 1IK6A 3GCZA 2CXHA 3RR2A 1KBOA 1MVOA 4KL8S 4HB2A 4ML3A 4M8LA 1Y4ZA 3DQPA 2RIRA 4HPJB 1IN6A 1YK1A 2G0NA 4N82A 2O5CA 1SELA 4DLTA 3DFUA 4M1EA 1T24A 3WQSB 1U0EA 4WGFA 2FF7A 4JA0A 1GYPA 1EMDA 3B2EA 4Z7JA 1P4GA 1A8IA 4DR6E 5H83A 5ESRA 1NXOA 4TTAA 3ANSA 2BFWA 2B78A 2Q3FA 3G1TA 1UOOA 4Z51A 4FX5A 3WKEA 3ND9A 2WWFA 5KQRA 2FJUA 5C8DA 1BXKA 4YJDA 1SEVA 4I83A 3KZOA 4U3JB 3P9YA 5LWHA 4ID9A 4R1PA 1MHTA 2Q8QA 1Z7WA 2DE0X 4C4YA 2NUTB 3IWBA 2OHHA 3DQQA 5JNSA 2GERA 4C3ZA 4UJ3A 3HSYA 3C8UA 5KU7A 1LH0A 1VG8A 2GR9A 3REQB 2F41A 3DAPA 4FFNA 4ALKA 2D54A 4TMKA 2DH6A 4REQA 4X63A 2JAPA 2V88A 1SUDA 3AF0A 2RGEA 2AX4A 2OHJA 1NUHA 2NU9B 5CA0B 4KO3S 3FBTA 1A1GA 3Q9UA 2G67A 4DR2E 3ITNA 4EB0A 4E08A 4N3AA 4OHPA 1Q0QA 2FWJA 3NNDA 3NDJA 4HNAB 1M2GA 3FYSA 4IDFA 3QPCA 4OOFA 2GO1A 3MFYA 1PV2A 1WN3A 4TN1A 3N6XA 1GYQA 3T7KA 3CX4A 4KO8A 3H8SA 4QM7A 3AVYA 1ONBA 2O6UA 3GV0A 5GZ3A 4MPTA 5HKOA 2JRCA 4AN0A 4YCAA 4MUNA 4YRLA 5E4TA 4HDNA 3PC8A 4QXQA 4AJIA 3MRXA 3W5DA 3I9LA 4LDZA 2HJWA 3KLNA 1Z15A 4OATA 3WK5A 1DC6A 1V16A 4ZD6A 1KARA 2UZ3A 1EGMB 3M6VA 1UANA 5EJFA 2ZBRA 2P9TA 5E1OA 1D5CA 4ZANA 5C2JB 2H8GA 1GLGA 4AJOA 3CNNA 5ALDA 3ABRB 3RVJA 3HVUA 4LOAA 3ZGNA 2W2OA 5LKRA 4ZICA 4YQFA 2J5RA 1R9MA 2OCPA 1G21A 3LSTA 5JDIC 2VUSA 3D6LA 1EGHA 3WJ2A 1M34A 3BWXA 3CLHA 2ZR8A 3ETEA 2AN1A 3ZTTA 3LD9A 3FCXA 1RRCA 4XVRA 3IUEA 2C4WA 3CE9A 2MDTA 1VKOA 2NYRA 2J31A 3OH8A 1GTG1 3PRHA 4CTKA 5CB4B 1RADA 2HMUA 3AP3A 4UD6A 5JBNA 3QOOA 1ZK1A 2ALJA 4LCJA 2C7VA 1GPH1 5A7GA 1D1SA 2EKDA 1E2MA 1NIJA 3HM2A 4JEIA 2WBUA 1EH7A 4Z1MA 4UATA 4OXQA 2ZWMA 3PPIA 2CNDA 3T9CA 3M83A 4ARAA 5CA1B 3HFJA 1J00A 1CDZA 2DH5A 3T41A 3IP9A 2XPCA 4XR4A 3GIDA 2LIPA 2ZZMA 2UXBB 4N8DA 3EIQA 3KKZA 1LLQA 3QKRB 4EHFA 3EIFA 3HU2A 2A5LA 4W99A 2BIFA 2R86A 1I80A 1JQBA 2DP4E 5DULA 1GNPA 1E1RA 3EIOA 2QGFA 1MDFA 3WYCA 2VDQB 3I9MA 2XRMA 2D2XA 2EWMA 3AR4A 3UAXA 4B81A 5JMWA 1C0PA 3IUPA 1CNFA 8ADHA 5CB4F 4KODA 2OIWA 1TJ5A 2X1HA 4PYMA 3IEVA 1O94A 3EXG1 3C3KA 4HTAA 3ECCA 3PKZA 4Y0AA 4TV8B 4MGHA 2ZI9A 1OBHA 2OBFA 3G2HA 1P0MA 3WMXA 3F6RA 1LVGA 1TFRA 3IE2A 3FCSB 4M1KA 4RA9B 4ZQGA 4IGFA 2AZTA 4WWHA 1XCLA 4ORDA 4IDNA 3ZBTA 4XX0B 3E23A 2O8DB 1SQ0A 1F6BA 4XSVA 5GGXA 2JLZA 4DV7E 1GXSA 3AUUA 1BN7A 4J4HA 3IESA 1NQWA 2NA2A 1QCDA 1J8DA 4JKYA 3DOCA 1MEEA 4EPYA 2QG9A 1PZEA 4JOBA 4LBZA 4QHTA 1Z4PX 1ZIXA 2Y1OA 4FWIB 3ZWMA 5BUZA 3GHHA 3NYQA 5C4MA 3EGCA 3FOCA 1F6DA 1BWQA 4GKJB 2LKDA 4YPVA 2C4UA 2VJMA 3CPEA 4RD0A 3THWB 4B6GA 3FRHA 1P9LA 2IYLD 1I6WA 3ZWWA 4EPRA 1XN4A 2V86A 1XELA 1PIWA 4TV8F 3LHSA 3NIWA 4C2BA 1HC7A 1D6MA 1VPEA 5AI4A 1IMUA 3OA0A 1A7JA 4TKZA 1YQEA 4FKMA 5C1OA 3CEHA 5A7FA 2A1IA 1GUZA 3TLGB 2E37A 2DULA 3ZI7A 1U8AA 2B37A 1NG1A 4DLBA 1W4LA 1ZK2A 2IU4A 3JQGA 4ARSA 2UVPB 4WD3A 3O1IC 4YJFB 4G0XA 3KQOA 2PRKA 1KJNA 5LL6P 3G2JA 1OVMA 3P97A 4C29A 4Q9NA 1DIBA 3JQAD 4WZ6A 4PV7A 4N7RA 3HJFA 3B48A 2E3JA 4DM4A 5REQA 4I3HA 3IMEA 2ZDQA 3M6FA 5ETJA 2L69A 3V8VA 1VRCA 5GTDA 1PEYA 4W8HA 2H1IA 5WRFA 2WNHA 2I6UA 1CYEA 3KUDA 3IURA 2YQZA 4UVIA 2HWXA 3NCTA 4HLCA 4F97A 4HAIA 4UNQA 3IR7A 4LUCA 4Z1MD 3RHTA 4R2RA 3X3HA 2Q1WA 3T7SA 1NYRA 4P3XA 4BP1A 5J59A 2W6OA 4DCTA 3GFOA 3H2ZA 4UAUA 1YZFA 1PK8A 1EX7A 3G0HA 5TB5A 3PIIA 2QNRA 2X0RA 4W5JA 3IR5A 5KDLA 1MB3A 5JOQA 3X1ZA 4YA6A 3J7TA 3VBEA 2YN0A 2NYAA 4D9JA 2R68A 1H2RS 5B7QA 2BGIA 3OO1A 1PEKE 5KYNA 4UHEA 4CKYA 4Y6PA 2XZOA 2BI0A 1E1RD 3IEXA 4F86A 2QM8A 4M20A 4XW2A 4XIGS 1BS2A 1H65A 1WMFA 1K9VF 3JQAB 4XOUA 4RF4A 4DJDC 2IYZA 2NO0A 2WQ7A 2HLJA 4RHEA 3ZGZA 2B20A 4E46A 1CDOA 1O94D 4UQPA 5F2NA 1DQ3A 1FP2A 1XZEA 3OT5A 3DBRA 1S89A 4TUYA 3OT1B 3OJOA 2G1JA 3CPHA 4FPXA 1E8MA 4LSZA 1OZGA 4O5GA 5E1MA 2C5EA 3BJZA 1PNTA 3K9HA 1XMXA 1WDTA 1VGVA 1CK4A 2BHTA 1X9IA 2BTQB 2YZNA 1GOTA 2XOKA 1IHDA 3JZMA 3B7JA 5GADl 5CT9A 2O3QA 4CQMA 2P8JA 1XCPA 3PWTA 3BM5A 2M9AA 1GA1A 2DF8A 3GBSA 2FPPB 3D2BA 2QTGA 4HDMB 1PBTA 4R54A 2I78A 3H7IA 4ZO9A 3GH3A 1OWNA 2H08A 1MMFB 3UK7A 1YL7A 2A5YB 4YS6A 4LVUA 4FMCB 3LECA 3TLYA 2YVAA 1QJ4A 4M76B 4QOJA 3DCIA 3Q3IA 1SUPA 3DGFC 2H2HA 2XLBA 2WOJA 521PA 3NW9A 4RW0A 3VNBA 1GGMA 3TGLA 1LS6A 4MJXA 5KNCA 4WBXC 3RTEA 3D3NA 3H8WA 1DAGA 2BFPA 3D6AA 1KDVA 4FTWA 4DXDA 3P9PA 4BQPA 3N2KB 5AJZA 3ILSA 2W71A 4NXMB 1P5ZB 2E4ZA 1M6YA 5I4BA 5DLPA 4NL4H 1ZPDA 3DEJA 3TBHA 2OM6A 2C58A 4WPGA 3PHBE 4PBRA 2Z5VA 4M89A 3FPSA 1EFVB 2QUIA 1QV9A 3C48A 1H85A 4YCNA 1R64A 2XR1A 2WEKA 3HMJG 3IQIX 4C5AA 1XTRA 1GY8A 5H9VA 2XMZA 2EW2A 2O2IA 3P4XA 2JPDA 3STTA 4KI0A 4X62E 4XY5A 5A4IS 1KJ8A 4CUJA 4DL9A 3WNVA 5CW2A 4HFNA 1WHSB 3DP7A 4Q3NA 4QX6A 5JJIA 3RE1A 5DGTA 3MW8A 4FFSA 3BSYA 2P9HA 2IEIA 2CEKA 1QU2A 5JCOC 3FSRA 2QZSA 1RYYA 4BGEA 3QVSA 4HN4B 2X6QA 1E7SA 4RQBA 1KOLA 1NQTA 4LG1A 1KI3A 2BR3A 3CTPA 3PQ2A 3ZGOA 1MGOA 4GE3A 4L50A 4IQ8A 3NIFB 5KO2A 5IARA 1E5QA 4YPFA 1XF1A 1FVHA 4QRDA 2P9BA 1X7ZB 5TV2A 2XYQA 3DKPA 1Z82A 4E3EA 1QYVA 1DC7A 1V2HE 4HBZA 3QPDA 1DAMA 3QJ5A 5D87A 1SFRA 5BSKA 2F8SA 4WXEA 5TEWA 1X92A 4P33A 2XYHA 4DADA 1R12A 1KJJA 1AC5A 3DEYX 1R8XA 5LZ8A 4XM2A 2GK7A 5EC8A 2W2QA 3LIIA 4L78A 2B4KA 2O2ZA 3CZPA 2A3NA 3MAJA 4UREA 5CGZA 4YP9A 4JJ8A 2ZJ6A 4FIDA 2VHQA 1C50A 3NATA 1KQFA 4B80A 5FBLB 1NONA 4RV2A 2NU7A 3TSZA 2XHEA 3MRTA 4M60A 4ND8B 3H5OA 1H93A 1BFUA 1T4MA 3UK3C 3ILVA 3WKBA 5LIRA 3ROXA 3EVCA 3GFSA 4HGQA 2NXEA 3MFQA 3ZDCA 2GNPA 1U4NA 5K09A 1QM5A 2VHTA 4DVJA 3MMXA 2XOKD 2WICA 2Z1DA 3GJQA 3T9EA 3O3CA 3QLTA 3DV9A 2GDZA 4CQMD 4H1UA 3G3EA 3NETA 1CETA 4XJSA 4MICA 1DXHA 1GAEO 4FFVA 5AVWA 3KQNA 3C97A 2VJQA 4NYIR 4Q16A 2PSHA 2UYOA 4LXTA 2HC9A 2BHRA 2GCOA 5ALVA 2Y1FA 3IQFA 3V1YA 5JQGB 1DAKA 1XRLA 1XNQE 3TVYA 5UKDA 4CF4A 4DKKA 3M34A 4I5IA 2OV4A 2ADFA 4Y9SA 2GAAA 3OC6A 2O8NA 2WNIA 1XEAA 5ELLA 3RIEA 4G0MA 1U8YA 2EPNA 4XIIA 2D5IA 2FMTA 2VP9A 4U7GA 4EPXA 5KNCD 1XDBA 3KHUA 3U2QA 1U3WA 4QPZA 2C1ZA 2BELA 4JKIA 2WTAA 4TTIA 2CYAA 1F60A 2X2FA 2P5UA 3JVIA 2FZ5A 1FX1A 4E2FA 1Q91A 3TMAA 4L02A 2L18A 5K01A 4Y2TA 1BU5A 2KM1A 5HQ3A 4Q7LA 2AQ8A 4LHYA 3KPYA 5JROA 1WXWA 4NARA 1K7EB 3DOZA 4TWJA 4YRNA 3B85A 2OC9A 1CQWA 3P0EA 5T02A 4ARZB 2FOIA 1ZISA 3BL5A 5AK3A 4NZMA 2UYGA 2XGOA 1ISGA 5GM1A 2FX5A 2YW2A 5L7TA 2F1KA 5JQGF 4BX3A 2XXBA 5DK6A 3U3DA 3EGOA 1Y1SA 3OM0A 1IQSA 3D3JA 4TROA 1XZGA 2HUPA 1CS4C 2XCQA 4JDUA 4FN5A 4EW3A 2ZRPA 1E92A 3O2QB 4WLFA 4LISA 6CHYA 2CW5A 3FCOA 2KBEA 3KAKA 5A0VA 4CTMA 4O4LA 3QNMA 4A0QA 3WVNA 4FYVA 2CYCA 3KEOA 2WT4A 1FUEA 1E3DA 1O58A 2HO5A 3ZXUB 3D8RA 5C8YA 3KQMA 3RJMA 2EL6A 3LA8A 4JI2E 4DQXA 4E03A 2ENUA 4NBWA 3ZDXB 1L5KA 5JUWA 3SS9X 4B3CA 3WIOA 1II9A 3L0IB 4XEHA 3BT7A 4IIFA 3KG6A 3G89A 3B2NA 4EEXA 1DXOA 4P4LA 3C6MA 3K0SA 5HIKA 3NWPA 2I67A 3O4GA 1W0JA 3NEAA 1O95D 1YE3A 4QFBA 3DT9A 1Z6ZA 3F4KA 3KYCA 1YVDA 4PZPA 4B9EA 1RJWA 2IEYA 2I29A 3ER6A 2J46A 1A1FA 3ZYCA 4MO2A 3H0CA 2YICA 4HAYA 2IZ0A 3JAWA 3WXBA 3EQ1A 2VO1A 3PTLA 2ACKA 1G98A 1JNYA 3KHKA 3O9MA 4QJ5A 1EM8B 3DP9A 1PP4A 1EA7A 4DMCA 4X64B 3D7RA 1KJQA 4MJ3A 3MMNA 3BK2A 1D2MA 4HWGA 1I0ZA 2EV9A 2B8EA 2QMOA 4ZVTA 3AUZA 3USCS 5JAMA 2YOHA 3HSKA 1A4RA 4ZVOA 2N8XA 1K89A 1VE5A 2I4LA 3HACA 3FMFA 5BW5A 1RXCA 4RETA 3V5NA 2DPXA 3HY6A 1WUYA 1U7WA 4FZ3A 3WB9A 5T8KC 4R9ZA 4MB2A 4YMHA 4F9AB 1X19A 4K8RB 4BNWA 1UXGA 1BNCA 5IJWA 5I5EA 5I9IA 1YHZA 3KSDO 3TQHA 4P1ZA 7GPBA 1EFPA 4ID3A 3B2QA 3CLSD 1N5DA 2RI1A 3V3KA 3LLUA 2Q5JA 5HDBB 3FOEC 1YJ5A 3DW1X 4KXUA 3L7JA 1UBSB 4J0CA 5HKKA 3NP7A 4IG4A 2YYAA 4XGRA 2CV0A 3GPBA 2V5AA 2NO4A 5F23A 2NMVA 9GPBA 4CMHA 1JLLB 1ADFA 1VBNA 1WUJS 1N6PA 1NUTA 2A1TS 2Z5FA 1AUPA 5C37A 3FVVA 4UVGA 2HMYB 3Q3VA 2NN3C 3WMWA 2E4AA 3VH4A 2K7ZA 2MYUA 3LOPA 1H3FA 3L7CA 2Z08A 1D6NA 2BFBB 4MDHA 3T3EA 3VVBA 2WVJA 2XZTA 1KI2A 4J49A 1Z5WA 4KE6A 3FPEA 4ES6A 1FS6A 1YJCA 2GD0A 4I08A 5DIZA 5HCUA 3E8SA 3UENA 1U5AA 1YUIA 3K4PA 2BMAA 5BQXA 3U3ZA 3E2PA 4JHLA 2KPOA 3TXXA 4EAQA 2H3EA 3C41J 3PNKA 1KXJA 1J0BA 4I9NA 2QLJA 2P3SA 2CCJA 2QRKA 1QRSA 5CFZA 2Y05A 4R0VA 5MGNA 3G9TA 3MQ4A 4NK4A 1L5HB 3R09A 4UUOA 3PJFA 2JFWA 3R77A 3PEFA 1L4SA 4MW2A 3FBGA 1NQXA 1G291 1N0WA 3AM5A 4JEHA 3D9QX 3KB1A 2JOBA 3V7WA 4G5GA 1YVUA 1AQUA 4XAQA 1MEYC 4QEZA 2WUVA 4WNYA 3OTGA 2YTZA 4PYNA 4B3HA 3WG9A 1XV5A 3ONNA 4YI3A 3QXSA 2HJHA 4MSUA 3RS4A 3FH0A 5I7SA 5L3QB 1G2DC 2B2NA 4TMFA 3F2IA 2PK3A 4JB3A 1TUIA 3GMTA 2FZGA 5B36A 1ECGA 5ABPA 4JJF