3OMLA

Structure of full-length peroxisomal multifunctional enzyme type 2 from drosophila melanogaster
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
585
structure length
532
Chain Sequence
LRYDGRVAVVTGAGAGLGREYALLFAERGAKVVVNAADIVVDEIRKAGGEAVADYNSVIDGAKVIEILVNNAGILRDRSLVKTSEQDWNLVNDVHLKGSFKCTQAAFPYMKKQNYGRIIMTSSNSGIYGNFGQVNYTAAKMGLIGLANTVAIEGARNNVLCNVIVPTEGILPDILFNELKPKLIAPVVAYLCHESCEDNGSYIESAAGWATKLHMVRGKGAVLRPSLDDPVTIEYVKDVWSNVTDMSKAKHLGAIAEASGTLLEVLEKLKEGGGDAIEDAFEFNSKELITYALGIGASVKNAKDMRFLYENDADFAAIPTFFVLPGLLLQMSTDKILHGEQYLEIVDDLPTSGTLLTNGKVFDVMDKGSGAVVVTNSESFDESGRLLVRNQSTTFIVGDPIAGVVPLQPAPNRQPDATVQYTTSEDQAALYRLSGDKNPLHIDPQMALLAGFKTPILHGLCTLGFSVRAVLAQFADNNPALFKAVKVRFSGPVIPGQTLRVDLWKQGTRINFRTVVVETGKEVISGAYVDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peroxisomal multifunctional enzyme type 2 from the fruitfly: dehydrogenase and hydratase act as separate entities, as revealed by structure and kinetics.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase, hydrolase
molecule keywords Peroxisomal Multifunctional Enzyme Type 2, CG3415
total genus 154
structure length 532
sequence length 585
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
A PF01575 MaoC_dehydratas MaoC like domain
A PF13452 MaoC_dehydrat_N N-terminal half of MaoC dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.129.10 Alpha Beta Roll Thiol Ester Dehydrase; Chain A Hotdog Thioesterase 3omlA03
3.30.160.260 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3omlA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3omlA01
4Y98A 4I1IA 2V1OA 2X1HA 3QVTA 1JAXA 4R5MA 2GLLA 1EK6A 1Y5RA 1GAEO 1JDJA 1Y9EA 2NVUB 4BUCA 4GL4A 1YBAA 1VSVA 2G76A 1MXHA 4A03A 4DMMA 5T06A 1A9ZA 3IUPA 5EESA 1GYQA 5IF3A 1TBUA 3DZKA 3V1UA 5T8KA 4C7KA 4Q9NA 1HDCA 4BKUA 2XOXA 3Q9NA 2BI7A 4BNJA 2F1KA 1E7RA 4M20A 4R1NA 3NEPX 3M2PA 2Q4EA 1WLVA 4D3SA 3U5TA 2Q46A 3ZDFA 2EISA 4GGOA 4WKGA 3LSYA 4XGKA 2B4QA 4NZ9A 2G17A 1YVEI 3DP0A 3IOYA 2W98A 4AJKA 1EZ4A 2FR1A 2NQTA 4NIMA 4R9RA 1NPTO 3RUAA 1MC4A 4BNNA 2O7SA 1WDKA 4XYMA 4E2WA 2VYND 3PXXA 4CLOA 4CR7A 5U4QA 3WNVA 3NJ8A 2P5UA 3ANMA 2BI8A 2AG5A 2GSDA 4J2HA 3R87A 5TNXA 3H5AA 3EAGA 5B4UA 1SO8A 4S1VA 4GKBA 3AUUA 2ZTMA 3JYOA 1I30A 1NPDA 2HU2A 1P0CA 3VPSA 2YQ5A 3F1LA 3GDGA 4KTVE 3IIEA 1U5AA 2UYYA 4CJXA 4K28A 5EGKA 3RUDA 2IZZA 2A9FA 1DJNA 1NR1A 3C7DB 4CUZA 2YFQA 4R9SA 3RJ9A 5DBIA 4ZQFA 4BVAA 4QTZA 4CV1A 1HSZA 5A9RA 5GMOA 1QSGA 4X54A 3PI7A 2GASA 2UV8G 1C0IA 3VOSA 3U9LA 3DOJA 4GSLA 1ULUA 4RDHA 2OFPA 2O6BA 1E1NA 2C2IA 2DTEA 4L74A 4WGGA 5ILOA 4RLTB 3NDRA 2C2YA 3PWSA 4J43A 1QYCA 2W4QA 2Q2VA 4JGBA 3K73O 3KV8A 4RPJA 2GR9A 1K6IA 1JQBA 5BSFA 4LMRA 5A9TA 1WM6A 4PRLA 3TN7A 2FR8A 3WMXA 1NTOA 3QHAA 4L4XA 3V2GA 3FRJA 5CEJA 2EG9A 2NV6A 1F8FA 4F6LA 1G0OA 3D3EA 3KRTA 4RZIA 3K6JA 5JDIA 1EE2A 4DYVA 1DC3A 4CMEA 5L7TA 5DM5A 5DP1A 5C7OO 4F46A 3H3JA 3A14A 4GVLA 4BOYA 1WAMA 1NVTA 3PDUA 5ILGA 2C5EA 3GMSA 1KOLA 2FR0A 4J4HA 2PWZA 4PLFA 5JDCA 4DMLA 3UF0A 4WNBA 5BT9A 3NUGA 1WLYA 1KEUA 2FZEA 3G1TA 5L7YA 1T2CA 1XLTA 3JTMA 4XEHA 4DIBA 3OA2A 4RORA 3VAZA 5ITVA 4UUPA 2C54A 3ZWMA 4JIGA 4ND4A 4HFNA 1MFPA 4J4BA 4WECA 5KJ1A 4CLHA 2X8LA 4R01A 3WGOA 2PA3A 2EP5A 3GR6A 3AOEC 4D0RA 1PL8A 3W8FA 2A35A 1A27A 3KB6A 4NI5A 1IUKA 3GG9A 4FCCA 3H9EO 2GD1O 1UDBA 2PLAA 3NKLA 1ZNQO 4Q3EA 4DWVA 1EDOA 1OI7A 4ZV3A 5DIOA 2BGLA 3MTJA 4TKLA 2ZK7A 3ITKA 3R37A 3TZKA 3KVOA 4MVJH 1I10A 2WSBA 4BGUA 2IEBA 2JCYA 4RLSA 4ALKA 5DDIP 3WGTA 1HL3A 4PZCA 1Z54A 4CMEC 1B8PA 3GLQA 3KXDA 3GGGA 3KV7A 1B7GO 4UEOA 1N9GA 1DC4A 1WDLA 4BB5A 3D1LA 2EGRA 3BTUA 3FR8A 5JYDA 1DJQA 1J49A 3D64A 2YV3A 3WFIA 1LSSA 3JQ7A 4HXYA 4E5MA 3KG8A 3NGLA 2PK3A 3DO5A 1U9JA 1MGOA 2EKQA 2IZ0A 4JCOA 1RPNA 3OQ1A 3S8MA 2DFDA 4YT4A 3OMLA 1SOVA 1GCUA 5A04A 2PZKA 3U49A 2JJYA 2GZ2A 4ROSA 4PG7A 5I9LA 4RGBA 4E3ZA 4D43A 1X0VA 1UH5A 3GOHA 1EUCA 4NBUA 4CM7A 4FJ2A 4I9HA 3LU1A 2NU7A 1QYXA 4HNGA 4MOCA 2H9IA 3CZRA 1W6UA 4RV2B 2R00A 4IDDA 3TZQA 3ZNOA 1U4SA 3K8ZA 2CWZA 1PJ3A 1U3WA 3CF9A 1ZMOA 2QRLA 3ZN2A 4EDFA 4RO0A 3KUVA 1G0NA 2VZ9A 3W6UA 4I5GA 3IS3A 1DIGA 3UUWA 4B4OA 1B15A 1GZ6A 3QWAA 3DTYA 3TEAA 3HDUA 4NK5A 4CL8A 5I7EA 3ESIA 1WNTA 1P3DA 4DUPA 1ZIDA 3FWNA 1PZEA 4S3MA 4W7IA 3I6QA 1RYEA 5JO0A 3GQVA 1LLCA 2ILTA 5L3ZA 1I24A 1UZNA 3D5TA 1QYDA 4CM8B 5COQA 3DKZA 1E6EA 4AJLA 4QD9A 1OOEA 1YS4A 1B16A 3ZV5A 2ZYDA 5I9MA 1VL0A 1IXLA 5DBFA 1R4NB 3DZHA 1BGVA 2NTVA 2YHIB 3RKUA 4U0JA 4E6PA 1PJ4A 4HFJA 1P1HA 4Y9DA 5HS4A 2WYUA 2X0IA 4B7CA 3UH1A 4OKNA 4ZD6A 1KY5A 3NX4A 4ORDA 1J6UA 1U1ZA 1GUZA 2WMDA 3E8XA 3JSAA 1O94A 4YACA 4H4GA 3S2GA 2CYEA 2EKPA 4Q3NA 5IDWA 4LCJA 5BNTA 4RCVA 5CDGA 5IN4A 3DHNA 3VH2A 1D7OA 2B37A 2BFOA 1MUUA 4RVUA 4I5FA 1TA4A 2FWMX 4BL5A 5DCYA 3EDMA 3I9LA 5I7FA 5G4KA 3RI3A 5A4DA 1CIVA 1K2WA 4IDFA 4CMGA 5I9NA 4WLEA 3VVCA 2DBZA 4R3NA 5A3VA 2VHXA 2QIOA 2ZTLA 2XAAA 5B4VA 2I65A 4UULA 4YAIA 1FF9A 4IQGA 2O2YA 3WLEA 1EQ2A 2JCVA 4DC1A 4MOBA 1Y5MA 2J5QA 3KZVA 3BMNA 4MO2A 1F17A 3OIDA 2X6TA 3ROQA 2OUIA 4A0XA 3DMYA 4J9VA 3ZWAA 4LW8A 3MJTA 4DIFA 5HRUA 3KH8A 1LDBA 1ADBA 5A9SB 2OBYA 2YV2A 3LLSA 4GGPA 4YJHB 4A73A 3R34A 3GUCA 4BNGA 3VZRA 1PGJA 2GLMA 3HUDA 1NWHA 4U8GA 3JQAB 4IGEA 2PKQP 1FJHA 2TMDA 5I8WA 5ICMA 3U09A 2EGJA 1R4MB 5C7LO 4W99A 2HJRA 3MEQA 3D4PA 2LDXA 3LF2A 1OC2A 3WGZA 3VHRA 3C3XA 4CMKA 4GKVA 1LJ8A 3DDNA 4RLWB 3VH3A 3AZ8A 3NYWA 1SOWA 4FS3A 2BGMA 1ZMTA 5F3RA 2LDBA 5JAIA 3HN2A 2E48A 4DLLA 4DYDA 2EHDA 1A7AA 1RM4A 3B70A 3I4FA 4YB8A 4J7UA 4JP3A 2F3XA 2E37A 4BGVA 1BG6A 3QOOA 3DBLB 2CD9A 2X0NA 3HM0A 4XGIA 4I45A 4K02A 1BTOA 4OH1A 3JYQA 5C3MA 4IZIA 4YJGB 1XIVA 1Z73A 3DAPA 4AJIA 3C1AA 1JVSA 1K3TA 3JQDA 4RV2A 4EBFA 4EUFA 2FHSA 4B8WA 4XKJA 1LSOA 4LN1A 3PQDA 3W4JA 4IGFA 3UN1A 3S55A 2AQHA 4L75A 3ANLA 1Q0QA 4BNXA 3F4LA 1ADFA 3UKOA 5CEFA 4XQCA 3MWDB 4AJEA 5HZ4A 1P33A 2Y1DA 3B7JA 3WFJA 5SZYA 3NDJA 4B3JA 1JW9B 2YY7A 3W6ZA 3ZHXA 1P74A 3WGYA 3O9ZA 2ZB7A 2BH9A 2CZCA 3KM0A 3PQEA 1E1KA 2ZYGA 4RJTA 3U62A 3ZU2A 4Z0PA 1PR9A 4NQZA 2O23A 6ADHA 3KLMX 5KVQA 3MJVA 3IKVA 2VWQA 3HN7A 3LWGA 3BMNB 3PHJA 4MDHA 2IEDA 4XIJA 4TRJA 1LU9A 3NAQA 4MIEA 5TX7A 2ZTVA 4G81A 5A03A 4J16A 3GGOA 4AFNA 4E32A 4IXTA 2YHIA 4ZQBA 4BB6A 4XZ3A 4L0QA 2E6UX 1C0PA 1M67A 2AQ8A 5EQDA 1DPGA 5GZ1A 1A71A 1X7HA 4BNHA 4OQZA 3E03A 4AL4A 4F45A 2JD0A 2EERA 1E3WB 3KW1A 1PL7A 2VT2A 1A5ZA 2CF5A 5A5EA 5CFZA 1ONNA 3R32A 4QFCA 1ENYA 1TI7A 2Q2QA 2RH8A 1LDEA 4XY5A 3FBGA 3QWHA 4RMMA 2RCYA 2EF1A 3LYLA 3WWZA 3K31A 4JK3A 1T26A 4IQ0A 4NU6A 4Y8VA 3STHA 3W8DA 4DQVA 5JCJA 3TOXA 1U3VA 4E12A 1MG5A 3EGOA 5L95A 1C0KA 1JKJA 1R66A 3UOGA 2FPGA 1N2SA 2CDAA 1W0CA 3BIOA 2OOSA 4CM1A 4UUNA 3I9MA 2UAGA 2NVUA 4D41A 3D4NA 1LDNA 3EVTA 4Y67A 3TFOA 4BGIA 1KVQA 5KKCA 1FDTA 1XELA 3VPXA 4UVHA 2X22A 1DDOA 1YJ8A 3D5QA 5JFOA 4DL9A 4E2ZA 4GBJA 4FPXA 1NJKA 4NCPA 3UICA 4I4JA 3DZJA 3AUTA 3HWRA 2POQX 3UHAA 1YBMA 1DLIA 3I9JA 4IS2A 4CUJA 4W78B 1I8TA 3DMTC 1NQOA 2WD7A 4NH4A 3SXPA 3EC7A 5CG2A 4QX6A 1OBFO 4OL9A 1P1KA 2VRCA 3VDQA 2P91A 2Q3EA 1EVIA 1O6ZA 3R0IA 2QQ5A 3U3XA 2CNBA 3IP3A 5HWSA 1ZVMA 2VHZA 3PLNA 2CVZA 4D7AA 1U1IA 1PZFA 1LQTA 3V5NA 2O6TA 3E5RA 1Y6JA 5ENVA 5KTKA 2W2LA 3BHIA 5FF9A 3LZ7A 4II3A 2JL1A 3DZIA 4EJ0A 3LBBA 1E3LA 3JQGB 3PLRA 2V65A 3PHHA 3WIEA 3FNFA 3ETGA 2JFFA 4YJGA 1LRLA 3PGJA 5IDQA 4IZHA 3RBZA 3MTGA 1OC4A 3QV1A 4NU5A 1MLDA 3OQBA 1U7HA 1O8CA 2Y93A 3TZ6A 1GZ3A 4EJ6A 3QE3A 3G17A 5CDUA 1SBKA 3CF8A 3JD1A 2XFLA 1U2GA 1W8DA 2YUTA 2BKAA 1PIWA 2A92A 4QUKA 1NQ5A 4XRGA 5EQFA 1LC0A 2PKRA 4L73A 5CDYA 2O3SA 3C8MA 1WMBA 1YONA 1T24A 5K9ZA 1W73A 2AEFA 4BO3A 2GN6A 1HEUA 2OHXA 1B3BA 4BNKA 4O6VA 4NR0A 4LGVA 3E9QA 4N5NA 5JDIC 3CZMA 2AE2A 2C7VA 1GYRA 4RPGA 5B37A 3INRA 4W82A 3DOYA 1LLDA 2X5JO 1RWBA 1C1XB 2I3GA 1JU9A 5HM8A 3AY6A 1MX3A 2ET6A 3OJ0A 3IMFA 4GLOA 3G0OA 5L7WA 2NTNA 3WS7A 1AHIA 1F8GA 1WZEA 4E2YA 1EUZA 1S9CA 4B0BA 1HYEA 1PZGA 2ZQZA 3EVNA 3JD0A 4IINA 4XX0A 4DPMA 3AJRA 3DZGA 3WOHA 5FI3A 4FW8A 2RIRA 3Q11A 3CUKA 3ZW9A 4BIIA 4R69A 5A02A 3L4BA 2OP1A 4WE3A 1T2DA 4OMUA 2O3UA 2UUPA 4R1TA 5COBA 5F1OA 3JQ8B 2HK9A 3AZ9A 3D3WB 4J49A 1BW9A 1PEDA 1SC6A 4JJGA 3OFSA 1DIAA 2H4UA 3O8QA 1YLIA 4XB1A 3TZCA 3DZBA 4DQUA 4JQCA 4YT8A 2WM3A 4WLFA 4M49A 1Y8QB 5DOVA 3AW9A 4Z9XA 4GI2A 3MJ4A 1R0LA 2Y66A 3KX8A 4I82A 2VNAA 2JFHA 4PG5A 3WBFA 1GCOA 3FPLA 5T5QA 4AJJA 4NMHA 3DL2A 2DSLA 1I2ZA 3MJEA 4GSKA 5DT9A 4J6FA 4A10A 4ITUA 1GL3A 1C1DB 1V3TA 3UGKA 4ZW0A 2X5KO 2XXBA 1U5CA 2ZIZA 2E4AA 3WBBA 3GHHA 1HTBA 2JCXA 3PDJA 4PVCA 4R68A 2I66A 1DSSG 2J3HA 5BR7A 5F5NA 5IDYA 5I8ZA 4F6CA 2DLDA 1R4MA 2H5LA 5KVCA 1VI8A 2IYPA 5T8KC 1DO8A 1E6UA 1SMKA 2HAEA 3DQPA 1RYDA 4E5PA 3JQEA 5DNAA 1HYGA 1P77A 4W4TA 3RCBA 2XEMA 1HZJA 2GF6A 3PQFA 1NQAO 2WDZA 4KUGA 1VPDA 1YL6A 4NBVA 3ZHZA 3C24A 4MVJA 1IE3A 2JKVA 3ROKA 1N1EA 4JN6B 2J6IA 2ZCUA 1HE5A 3KUXA 3AOEA 1YDEA 2P4HX 3CTMA 3JYPA 2CY0A 5HTOA 1D8AA 1KETA 3DZFA 5BSHA 3GEKA 2P4QA 3C7AA 3PGXA 4MKZA 4BMSA 1ZKIA 3LC1O 7MDHA 4NFHA 3RROA 3QA9A 3RASA 1E92A 3E9NA 4R16A 4QEDA 1UR5A 2AW5A 5TIIA 4A0SA 1F0YA 4ILKA 4J91A 2O2SA 1EK5A 3X2FA 1ZK1A 4G65A 4D46A 1B26A 3A28A 3PIDA 1VLLA 4FJ1A 3ITDA 3NDIA 3SC6A 4LRSB 3AY3A 1N92A 3SLGA 3NGXA 1YB1A 3MZ0A 1PJTA 4FIZA 1PL6A 2WJPA 4RF3A 4EGFA 3NTOA 5A05A 1QMGA 2HMUA 1B8UA 4WOKA 1VH5A 1X1TA 2B5VA 3WICA 1YQXA 3Q2IA 4EI2A 3FWZA 1KC3A 4B0IA 4XYEA 1N5DA 4IJVA 4KEHA 3GAZA 2VN8A 4KDEA 4WNIA 3U4DA 4M1QA 4QT0A 1N8KA 5ENDA 1PSDA 1Z6ZA 2DBRA 1R16A 4YXFA 1R4NA 3TPCA 4U5QA 2IXAA 2I5PO 1B3RA 2QZZA 1EVYA 1XG5A 1H2BA 2WD7B 4HNHA 5JYEA 3ZU3A 5LDGA 2FZWA 4BO2A 1H6DA 3GC6A 4R41A 1DXYA 4DGSA 5IZCC 3VKVA 1AXGA 3TFQA 3KX7A 2NNLD 1YQGA 2VUUA 4FJ0A 5JCJD 2OGUA 4MP3A 2PZLA 4BO7A 1I5RA 3P2YA 4FC6A 4NBWA 5DZSA 1RM5A 1I0ZA 1PS9A 5F5LA 5FI5A 4IENA 3TF5A 3H4VA 2DPGA 4MVJF 1AGNA 3INTA 3WQQA 4HZOA 4B4WA 1PGQA 2H63A 1YJQA 2PNFA 2BRUA 2ZB8A 3ED0A 2VTEA 1I36A 1PQUA 1J4AA 1CQJA 3PEFA 2BFPA 2CUKA 1Z82A 3DEYX 5DULA 1SZJG 4BGEA 5L4NA 2B69A 4II2A 1HZZA 1Q4SA 3DBVO 4NFSA 3EZLA 2VUSA 4YRAA 2GNAA 3WYBA 4EYEA 4A27A 2GN4A 3QQPA 3N7UA 1A7KA 2EW8A 3GFGA 2Q1WA 3RD5A 4QFDA 3BMCB 3RFTA 3BZUA 4XJTA 2OBNA 4OAQA 4OM8A 1NHWA 2VRCD 3Q9UA 1UZLA 5F1KA 3RUCA 5L53A 3HG7A 3KVZA 1E1LA 4RVHA 2IE0A 2O3QA 5KWEA 3WTBA 2B35A 2PZHA 1N7HA 4FDAA 3UXYA 3F3SA 1DFIA 1M76A 4QDBA 1E3EA 5EN4A 1CJCA 1NFQA 4UEKA 1UUFA 4TRNA 2PY6A 4GAHA 3I3OA 5EO4A 1HLDA 3E1EA 2OO5A 2P5YA 3UAGA 4CV2A 1NWCA 4J1SA 1J1YA 1KEPA 4MKRA 3MOIA 3RC9A 2WTBA 3WG9A 1HE2A 1XA0A 3ZWWA 4XR4A 1ZKMA 3DBRA 4OOBA 1HXHA 2V6GA 3EW7A 4YQYA 1VKOA 4TROA 2BELA 4K4DA 3OBBA 3NT4A 3MJCA 4XD2A 4CV3A 2DC1A 2CF6A 4AE8A 4BNZA 1HDYA 5IG2A 2H1SA 3ZHYA 2R6JA 3BXXA 4RQUA 3TQHA 4E13A 2VOJA 1DLJA 4GAKA 2UVDA 4J3FA 4RZHA 4XY6A 5ITWA 1R37A 3AUAA 2HK8A 3JQ8A 1ZEJA 3IDSA 3UCEA 1WLUA 1B14A 3GZNA 5LC1A 1HE4A 1F12A 3TOZA 3ZV3A 2OKHA 1PGPA 4UEJA 2VT3A 3AM5A 4KMSA 3LZ6A 2O3RA 5JY6A 4WLVA 5EINA 3Q6IA 3T7CA 3DBHA 4DBZA 5B12A 1I2CA 4F3YA 1YWGO 3ONFA 4RDIA 2I67A 1ZW1A 4XYBA 4BKRA 4NPCA 1LUAA 2AG8A 5DP2A 2ZJ1A 4A0ZA 1DC5A 1KEVA 2CMDA 4Z3KA 4GWKA 4H7PA 2UUOA 3GMDA 1YOVB 4GQAA 3RJ5A 1M6WA 4E30A 2BFMA 1IPFA 3ANNA 2DFVA 1MKBA 2RBEA 5G4KB 2X9NA 3P2SA 2X86A 3BMOA 3BTSA 4D0SA 2ZQYA 3HMJG 1DEHA 4KTTE 2AXQA 5H83A 1WPQA 1PU2A 1TLTA 3UFXA 1BDBA 2VKZG 2GLXA 4MPDA 3JQFC 3ZWXA 4ID9A 3LT4A 1HWYA 3TRIA 2GN8A 1GQQA 2GN9A 3A9WA 5DF1A 3FNGA 2UDPA 5LCXA 2BGKA 1ZXLA 1Y9AA 3M2TA 4UUOA 2Y68A 1V9LA 2O6UA 2IRWA 1ZBQA 1SCUA 2VYVA 1ONPA 1E7YA 2EWMA 3AFMA 1D3AA 1OMOA 3FPCA 5BYUA 2VZ8A 3IC5A 4LRTB 1RM3A 5DN9A 2ESSA 3ZWOA 1IZ0A 2IODA 4ZRFA 3L6EA 1QXSA 2GZ3A 1U28A 2Z5LA 2O4UX 2D2IA 4K1LA 2DAPA 3OF2A 3KSUA 1T1RA 2EGGA 4PZDA 3IJRA 3P7MA 4XQEA 1TEHA 4RLJB 2FN7A 1Y8RB 1OAAA 3L9WA 3M6IA 1IY8A 4Q3BA 4CLEA 4ESOA 3H8VA 4RVGA 5TJHA 3AWDA 3D6LA 1EVZA 1I3MA 2DPHA 1SC0A 2ZB3A 3GN1A 4GX2A 1Y7TA 1CERA 4QO8A 2JD2A 1PJCA 3JYLA 2DU8A 4PVDA 2O48X 4PLTA 3TJRA 3WX0A 4BV9A 4CMCA 5JAMA 2EJWA 4L9RA 4JBGA 3QWFA 1DAPA 1DIBA 3EXZA 2BHLA 3KYDA 1X0XA 2PGJA 3PFWO 3T4XA 5ER9A 3ROMA 5A3JA 3EYWA 2Y0DA 4QXMA 3DBLA 1SAYA 2C5AA 3FD8A 4AJPA 1EDZA 2J5RA 3AI3A 3L07A 3LVFO 5JSFA 1UDAA 3RUFA 5HMBA 2JD1A 1IHYA 3QP9A 4H16A 4XJSA 4K6FA 5KKAA 1D1TA 1UXHA 4CM8A 4IS3A 4P8RA 3KETA 2OXIA 2X9VA 3ICCA 4L4RA 3QSGA 1NR7A 2GERA 1FDWA 4J7CA 2GF2A 4FFPA 2IXBA 4NFYA 3B1JA 3ETEA 1ZJYA 3NTRA 4Z0TA 5G2OA 1YOVA 3RUIA 4CR8A 3EUWA 5TT1A 4RF4A 4O0LA 3DHYA 2JFGA 1L7EA 2VNSA 4U7WA 1HF3A 1SEVA 3FHLA 1WVGA 4DPKA 1QV7A 3GDOA 4N54A 3H9UA 3NTQA 1GR0A 3OM9A 3QWIA 5AOVA 4WEQA 3ZV6A 3U4CA 4XDZA 3AZAA 1O5IA 4QD7A 2D4AA 4IDAA 4MVJP 1JLLA 4U6QA 4BMVA 1LDMA 2GUGA 2I6TA 5TSDA 2CVOA 3GK3A 4DLBA 5KL9A 2E82A 5GZ3A 1SH8A 3KYCA 4KP7A 1BDMA 3CE6A 3F6YA 4JNKA 4PIVA 4EITA 5I7VA 3SVTA 2C59A 4YAGA 2DQ4A 1SEPA 5DCUA 3VPHA 2FMUA 1D4FA 4J9UE 5AXAA 1XQ6A 5JMPA 1DFHA 4DVJA 1FDSA 4AVYA 3G49A 3VH4A 1JKFA 3LW3A 1HRDA 2HMTA 3OA0A 4L76A 1QP8A 5L4SA 1NPYA 3K67A 2AEJA 3E1KA 2VUTA 4BO5A 1E3WA 3K30A 5L51A 3JYNA 3OIFA 3WDSA 5J23A 1SB9A 4AG3A 2ZJ0A 1V35A 2X58A 4WUVA 2Q4BA 1P44A 4P4LA 1B0AA 3GEMA 4CQMD 1HT0A 4D45A 3D04A 2DM6A 4AJ2A 1R15A 4YQZA 2XXJA 5BUYA 3JQFA 4YPOA 3G79A 2J3IA 4JBIA 1P1RA 3FI9A 3G3EA 3QJ5A 2TMGA 4A0YA 3GVIA 1UXKA 4Y6RA 3NT2A 1KEWA 4WCFC 2X23A 4TKMA 2OZPA 2RHCA 2G1UA 3JQCA 2O4CA 3JD2A 3KHUA 3BNVA 3A4VA 4M54A 1EMDA 2ZKLA 4ND3A 1DOHA 3OEWA 2RH4A 4R54A 4ZU3A 2DBQA 1MV8A 3LT0A 3H9JA 2AQIA 4R51A 3RSHA 3MOGA 4CMIB 1VE9A 1KERA 5DBGA 1DAOA 2H6EA 3WYCA 1PN4A 4DPLA 4A26A 1UP4A 1HKUA 1Z7BA 2J8ZA 1IB6A 3ASUA 4QSMA 4TRRA 4WK6A 3EZYA 4U0KA 1ARZA 4TVOA 5IFLA 1XWFA 1X13A 2BD0A 1Q7BA 1BVRA 2EIHA 3GN2A 3DB2A 4W78A 3PZRA 3LC7O 1ADCA 3AFNA 4LCEA 4W9NC 1Z75A 2EKLA 3DWFA 2O50A 4PLWA 4RLUA 1BW9B 4J0EA 1C3VA 5JXWA 5IXSA 4RLWA 1UJMA 3N74A 3WXBA 3V1TC 4AJ4A 3O26A 1VC2A 3HB4X 1N7GA 3LMBA 1ZUD1 1Q4UA 3ZU4A 5G0SA 4RQTA 1JN0A 5TS3A 3R3JA 3L77A 5KJFA 1YO6A 3V2HA 1XKQA 4YBVA 4YRDA 3GAFA 1ENPA 4GWGA 1Q6WA 5EO2A 4WNBB 5CPBA 1LTHR 4JROA 3BHJA 2GO1A 1LA2A 1SNYA 2OORA 2X5OA 2Q1TA 4E33A 3B1KA 1NX6A 5ES3A 1CF2O 5F6RA 4JBHA 3WB9A 3JQGA 4TWRA 2WE7A 1DHRA 4B0CA 1ISIA 3ZNPA 3MJSA 4MVJI 3H2ZA 2B6EA 3DP3A 1D1SA 4BNLA 1S7CA 4J7XA 3MCVA 4QO7A 1K0UA 4CLXA 4A5OA 3PFFA 3WSVA 4C4OA 1P9LA 5F21A 2P2SA 3CMMA 2JAHA 5BUWA 1WN3A 2PKQO 3OSUA 5T64A 3P3FA 3WNQA 1LO9A 1FDVA 1LNQA 4OQYA 3E48A 5A06A 3TZHA 2OL4A 3U0BA 1V8BA 2FUJA 4HFRA 4DC0A 2C0CA 4UVDA 4HX5A 4N18A 3WIDA 2NU8A 1EBFA 1BHSA 1EFKA 1U4OA 5EMHA 4CQLB 3GRKA 4LMPA 5EIOA 3GY0A 1X7GA 2BMAA 3FCOA 5K0ZA 1ORRA 1ZK2A 3ZHBA 5CAEA 1LDGA 1AN9A 3OJLA 3HFSA 4FOSA 4B0JA 1GADO 5AXCA 5AXBA 4D44A 1Y8RA 4IBOA 2B4TO 1EEHA 4J90A 3ZWNA 3R3DA 1UXJA 4MIYA 4YAEA 3RFVA 3D3WA 4OSOA 1ZEMA 1U3UA 4CQMA 1NM5A 3E29A 5T07A 1P1JA 1YDWA 2Q1SA 1H6BA 2QRKA 3PJGA 4CLDA 4YVFA 3DFZA 1K89A 4TSKA 3GVPA 3RAJA 3RC2A 3ABIA 1AUPA 4QD8A 1CYDA 1CETA 4Q3DA 3DONA 5BNFA 4B8ZA 1ISMA 2HBOA 1ZK0A 2AV9A 4WPGA 5FEUA 3SJUA 3K2BA 2QW8A 3C1OA 4J1TA 1GEEA 2HMWA 8LDHA 1YBVA 2JHFA 4BNWA 4TRMA 4ZQEA 5LDHA 1QRRA 4GMFA 4EEZA 5AYVA 3KHPA 4KDFA 3VTFA 4OO3A 1HDRA 1NBOA 4BQRA 4FOOA 3P19A 4CMJA 2GGSA 2QYTA 2XF8A 2WE8A 4FSHA 2G82A 3PJFA 3S2IA 5B4TA 4EW6A 2A94A 2HQ1A 3DXFA 4MTUA 1QORA 3HSKA 3GDFA 1UXIA 2HDHA 4YJHA 4EEXA 4BNIA 3MWEB 1WMAA 4FB5A 4NHEA 4LSMA 4BO0A 3WEWA 4R4JA 4MVJD 3PHIA 1GZ4A 4YT2A 2UV8A 4W7HA 4DQXA 4L8VA 4ZN6A 1QYWA 3KOUA 5IZ4A 3E6AA 3HDYA 2NWQA 5G0WA 2QWZA 3FN4A 3I23A 1T2FA 2RHRA 4I08A 3PPIA 3KSZO 1WW8A 3F1TA 2VCYA 1QYVA 4YBZA 3SEFA 2RAFA 3BMQA 3I83A 1DRVA 4RVDA 5HWFA 1H93A 1PR3A 2I3AA 3FTPA 3PJEA 5KNLA 1ENZA 5HA5A 4BO6A 3I52A 4RLHA 1H6CA 4PLVA 4CQLA 3R35A 3PYXA 2D3TA 5G0TA 1GYPA 5KJ6A 3RBXA 4I5DA 2YFHA 3H9QA 1PGNA 3TNLA 1TT5A 4NDNE 3PP8A 3PRJA 3Q3CA 2W3XA 3O4RA 2SCUA 2F0XA 3W4KA 1ZSVA 2W2LD 1CWUA 5TLSA 1PQPA 1MFZA 2C20A 1PJLA 2W2KA 4MIOA 1F14A 1XDWA 4WLOA 3WJ7A 1LC3A 2CDBA 4I83A 1Q7GA 2YHUA 3JQBC 3WJAA 3DOZA 3VH1A 4BV8A 3H5NA 4ND2A 4OOFA 3VPGA 4NBTA 1PS8A 2VWPA 2NM0A 2FY8A 3S1LA 5SZVA 4XCVA 1M66A 1YQDA 1XSEA 4CMIA 2HKIA 4FGSA 4K6CA 1E3SA 2HRBA 5EGLA 5L40A 3FTNA 4M8SA 5G0VA 3WLFA 2Y1FA 3AM3A 2CY9A 1HSOA 1JA9A 3HJAA 3KLPX 4HKTA 3SX2A 2VOEA 4EUHA 2F00A 4WLNA 4EUEA 1NXQA 4UAGA 5FWNA 3E5MA 3BAZA 3GF4A 4ALMA 4D3FA 3DAFA 1IZ9A 3E8PA 1T1SA 3R3AA 4ZICA 1VRWA 5JC8A 2R00C 1E3JA 4MVJE 1YB5A 3CXRA 4CMBA 4BNYA 3INGA 2IZ1A 3ZWYA 5HMCA 4BHTA 1C14A 4O1MA 3Q1LA 1MA0A 1EQUA 4R3WA 3TL3A 2B83A 1HLPA 4YWJA 3P2RA 4HWKA 3VTZA 3DBHB 1PQWA 4ALNA 4PN3A 3GNQA 4J1QA 1PX0A 2Q45A 3PHGA 4ZRBA 1MG0A 9LDBA 1E0DA 3PWZA 1H0KA 3TDKA 4B79A 1MKAA 2HX5A 3JQ7B 1R0KA 2DBVO 1S5UA 4B7UA 1JWAB 3AK4A 2FPIA 3BMOB 3QIVA 1GPDG 1AE1A 3ZWVA 3FSRA 4HBGA 2NSDA 4RVSA 4PG4A 2ZCVA 4FD3A 2Z95A 3QY3A 1V6AA 3BA1A 4YYZA 4HFMA 2EW2A 3GVCA 5BSEA 2VZ0A 1ID1A 3NT5A 1PWZA 4CLRA 4NJMA 1E5QA 3ENKA 3WGQA 3ZNQA 4GX0A 2PIMA 4OHUA 5U1PA 4PCVA 5KOIA 4D3DA 1U2DA 1KY4A 4QQRA 3FR7A 3VC7A 4Z3DA 3GHYA 1Q0HA 2OIWA 3F9IA 1BWSA 3AI2A 5G4LA 3L6DA 4MP6A 5HBRA 4YDRA 3ZGYA 2EEZA 5K6AA 3JD3A 1EFLA 1B2LA 3I5MA 4ALLA 1UAYA 3M1LA 3WGHA 4CODB 3EMKA 1KYQA 3VZSA 3PJDA 4K4AA 1E5LA 3LBEA 1GTMA 2XPCA 3DHEA 3NWZA 5JNLA 3H2SA 1UP6A 4RLUB 2D5AA 1NFFA 2YW9A 3GZNB 1HDGO 1BSVA 4IMPA 4CQMB 4DREA 3I9OA 1UAGA 3SJ7A 3VKUA 4B4UA 1Y7UA 4TMFA 2C82A 2Y67A 1NFRA 1E77A 1NYTA 2EP7A 2Q99A 4R5HA 2GCGA 3ASVA 4UVEA 1FDUA 3OJOA 4GH5A 4WEOA 3COSA 1PS0A 3P5SA 1DIRA 3GRPA 2IYOA 2HMSA 2FSSA 5AXDA 3UVEA 1TB4A 5AVOA 5CG1A 5JY1A 1T82A 1HE3A 3OJFA 4IMRA 2EXXA 5H81A 4MZQA 1EBUA 1MXFA 4CM6A 1UDCA 1ISHA 3H7AA 4PLHA 1LSUA 4KWHA 1O89A 1NVGA 4IDEA 5DCWA 3IAHA 4ND1A 2JAPA 2YYYA 4P4NA 2EV9A 5A1TA 4WLUA 1Y8QA 2Y0EA 1I33A 3EY4A 3HZZA 3QWBA 5CPFA 2ZYAA 1LO7A 1YH3A 3RC1A 1NVMB 3CK1A 5B1YA 3DP2A 3FNEA 4J1NA 5EPOA 3D6XA 3I6IA 4CM3A 5CEEA 3IL2A 3HDHA 1H5QA 4JJFA 1VKNA 3LK7A 4B3IA 3B1FA 4UREA 5C5IA 2CDCA 4UVGA 2P68A 5BSGA 1P1FA 3JV7A 4BS9A 3E9MA 1GEGA 4N7RA 4RF5A 1P45A 3R1IA 1XHLA 5IXYA 2NQ8A 4Q3CA 4XWYA 3I9KA 2GRAA 3AY7A 4ZRNA 4NK4A 4A12A 4XQGA 5KJCA 2J3KA 1PJQA 3AI1A 4YJDA 5KIAA 1DFGA 1KIFA 3CMCO 3CEAA 4PLGA 1T2AA 5A5FA 2C7GA 3A1NA 2D1YA 2WYWA 4I8XA 1ZK4A 1O9BA 3RIHA 2DKNA 2Y1GA 4BNMA 4PLZA 3JD4A 4KZPA 3HQ4O 1JKIA 1GUYA 2NUJA 1QR6A 3FF4A 1YRLA 3C7CB 4IPTA 2DUUA 1E3IA 3L4BC 3ZZNA 2FPPA 4E0BA 1X15A 3OH8A 2C07A 3IUSA 3BTVA 4JLWA 3H5RA 2ZTUA 5JAQA 1Q7CA 2I76A 2YJZA 5FFFA 4GLLA 1ZSYA 4ZJUA 4W9NA 1BXGB 2FP4A 2PZJA 4E5YA 3NV9A 2EGHA 1GV0A 1XGKA 4FC7A 4INAA 4OXNA 4Q3AA 5CDSA 3AU8A 3DAGA 4WJZA 2C2XA 4QECA 3O38A 2HLJA 4I9NA 1W4ZA 3U4IA 5GZ6A 4B4VA 2PV7A 1FK8A 1ISGA 1TVEA 3PVZA 4E2XA 4OIMA 1DHTA 1KVRA 4BMNA 3KV3O 4Z9FA 3ENNA 1L7DA 5KJEA 1M75A 5T6BA 3U4HA 3BHMA 1VH9A 2V6MA 3JCZA 3GFBA 2PFGA 4UVIA 2Y1EA 2YDYA 3UCXA 3WSWA 3CPSA 1BXKA 3F4BA 1PGOA 3CKYA 1V3VA 4KWIA 1ADGA 1F06A 4WNCA 5KVVA 2QX7A 4GAEA 5IDXA 3KEQA 3P2QA 1BRMA 3ZV4A 1XU9A 4D42A 1LQUA 1DC6A 2X0RA 5F1PA 4IDCA 5JO9A 1AHHA 1JAYA 3BMQB 1S6YA 3W4IA 3AOGA 2DTXA 2VYNA 3LQFA 1PSUA 3DBRB 4IM7A 3FBTA 5C7IO 1K6JA 3KTDA 3H3FA 4FQ9A 1LDYA 3I4CA 4YA6A 5JPIA 1CQIA 3A06A 2CSUA 4TZTA 2QQ2A 4CM9D 2P9GA 2BF7A 2NU9A 1LRJA 5CPGA 3K2EA 4PZEA 5EERA 4G2NA 2GZ1A 3TL2A 3LC2O 1DRUA 5IJZA 1TT5B 4BNTA 3R36A 4IQ8A 1CDOA 1R12A 1XU7A 1ZFNA 3VVBA 5KVSA 1PTJA 2Q1UA 1YOCA 2EGIA 5JDCC 2NLOA 3KUWA 4HV4A 1ENOA 2W2KB 1C1DA 4WCFB 4WCDA 4CL3A 1R6DA 4FFNA 6LDHA 3P3IA 4OOEA 2PD3A 3DOOA 1Q1NA 1Q4TA 4DXHA 4PRKA 4AJHA 3LLVA 4H15A 3L6OO 1KVTA 3SPSA 1GY8A 1ZSNA 1KBZA 3GPIA 4CL6A 1NAIA 2R2GA 3ROPA 4YAKA 3GEDA 3CIFA 4JX8A 2GLVA 4BKPA 5ADHA 4BO4A 4KUHA 4P38A 3E82A 2ZATA 1GV1A 1VJ1A 2B5WA 2D0IA 2PR2A 3GVHA 5SZZA 1UZMA 3ADOA 5CP8A 4ZJBA 3SC4A 4K4CA 4XYLA 4Z6KA 4RPHA 4K9DA 1Y1PA 1YKFA 2X0JA 4O59O 1Z45A 1ONOA 3PZBA 4EJMA 4DLAA 4YTEA 4A7PA 4U6SA 2W8ZA 5HS6A 2PRXA 2QHXA 4KOAA 4D79A 1A4IA 1VPMA 2IDZA 3L0DA 4XB2A 4ZQHA 5T57A 1A72A 3QVWA 4IXWA 4B7XA 2AA3A 3ICPA 1GQ2A 4DBVO 1G6KA 1PJSA 3HHPA 3IP1A 4MOWA 4B3HA 3KSDO 4OKIA 2HO5A 2F41A 1YL7A 3ADPA 1VL6A 4OJNA 1V0JA 4MJLA 4AE7A 3H6KA 4FGWA 1I32A 4TVBA 2Q78A 2FOIA 2GYYA 4CM4B 4E3EA 1TT7A 4GMGA 2DVMA 2JHGA 2WYVA 3QRWA 4YRBA 1O95A 4GX1A 3JQ9A 1PWXA 1M6HA 4YJFB 1LO8A 1GFSA 5EL0A 2B4RO 2HUNA 4E31A 2X7HA 1V3UA 1YXMA 3W8EA 5DOZA 4IJUA 3ORFA 3PYLA 4O63O 4OGWA 1IQ6A 1ZH8A 1ZJZA 4PLPA 2D8AA 4BO8A 5TT0A 1YB4A 1LEHA 5JAZA 1O0SA 1IPEA 2HJSA 2Q2WA 3WQRA 4OXYA 3QVSA 4RLTA 2QRJA 5L9AA 3R6DA 3KVIA 1TXGA 3HE3A 1XYGA 3GA0A 4H3VA 1Q0LA 3OJEA 4Q39A 4KQXA 5THKA 1E6WA 3LT1A 3AU9A 1N9GB 2FRDA 5JLAA 2X9GA 2V6BA 3W1VA 1H9BA 4IIVA 2VHVA 3GGPA 4I9UA 1ZO8A 4KUEA 4E4YA 2I9PA 2PZMA 4HY3A 1LXCA 1IYZA 1SPXA 4NG5A 4MVJG 2ZB4A 3QVOA 1BVQA 2PGDA 4BO1A 3ST7A 2HSDA 2OMEA 3OQ6A 1ULSA 3F46A 1HETA 5JBIA 3GNTA 2DT5A 3ZU5A 1NNUA 4P4GA 1Z7EA 4ONEA 3B7KA 2QYSA 2AHRA 3PWKA 5IZCA 3ZWCA 4RLJA 3ZI0A 1NHGA 2VHWA 2AQKA 5ER6A 3ONDA 4OSPA 1X1EA 3F5QA 2P9CA 4WOJA 4W6ZA 5JC1A 3R3CA 4CPDA 4NNJA 4YAJA 4BNUA 1U7TA 1DIHA 4XDYA 3H9GA 4BO9A 1RM0A 1ISFA 5L45A 2O3JA 4M87A 1SB8A 3P2OA 1G1AA 2J5KA 1ZK3A 2Q2BA 4UUMA 3R3BA 3OP4A 1E7SA 2Y05A 3O8QB 4M89A 3KYBA 1ZXBA 2AMFA 1C0LA 1E1MA 1YGYA 4N5LA 1XEAA 2VHYA 3OIGA 3T7EA 2G0TA 2NUAA 1JTVA 2O5UA 3G1UA 2Y1OA 5G0UA 4A2CA 3UW3A 1N1GA 3OECA 4DTIA 4PFJA 3RQSA 5T02A 2HK7A 4YEDA 3GZ4A 2NTJA 1M2WA 1AXEA 3HDQA 3QW2A 4LK3A 1L1FA 4AJOA 3E18A 3WMWA 1NP3A 4IDGA 3PIIA 1XR3A 2Q49A 1ZCJA 1PN2A 4MVJM 2Y1CA 1LLQA 2E49A 1IOLA 1UP7A 4K26A 3D4OA 3ZW8A 2O7QA 3RBVA 1KC1A 2V6FA 3ULKA 4CM9A 1MB4A 4YT5A 3AZBA 3HB5X 1CRWG 3QY9A 1WZIA 4J4TA 2DUWA 2G5CA 1WP4A 4ZRMA 5JE8A 5TGDA 4DA9A 3FNHA 3I9NA 3IQDB 2GDZA 3GNSA 3R3SA 4FN4A 4ZA2A 2BLLA 4QDAA 3Q2KA 4LISA 3KEOA 4LSWA 2PGLA 4J0FA 3ZWPA 1VL8A 2B36A 1U3TA 4E5KA 1U8FO 3V8BA 1T4BA 3VPFA 3PYMA 2HMVA 3C85A 1LI4A 3S4KA 5IN5A 3WQSB 2FS2A 1WDMA 4FR5A 2Y99A 5JS6A 5EJ2A 4RL6A 3BYZA 2NU6A 2VTDA 2PTGA 4TZKA 2VWHA 2P9EA 2WWRA 3B6ZA 5TC4A 4YCAA 3QVXA 1BVUA 1BXGA 2QZ9A 1X7DA 2D5CA 2A4KA 2DTDA 3Q0EA 3DR3A 1I01A 3VZQA 2OP0A 4N5MA 5EP5A 4TQGA 3HDJA 3N58A 3UCFA 1YE3A 4AICA 4AJNA 4FBGA 1P31A 1EE9A 1XQ1A 2BI0A 4IUYA 1FXSA 1NASA 2VRBA 1MC5A 4JJIA 1T25A 3GVXA 1YL5A 1GU7A 1KS9A 3RFXA 1LRKA 3DFUA 4FFLA 4XR9A 3WTCA 4BKQA 2CVQA 4ZVVA 4PG8A 1IL0A 1CEQA 2O3TA 5GY7A 5C37A 3JQAA 2YV1A 3GUYA 3CINA 3C1TA 3RVDA 1VJTA 4I5EA 1VI2A 3ZWBA 4HZPA 2EJVA 1ML3A 3SBOA 4R1UA 3CH6A 5EGJA 3KYDB 5CDTA 2Z1NA 4B8UA 3T4EA 4CR6A 8ADHA 4FFMA 4FFOA 3F1KA 5MDHA 3BJKA 1PJBA 3QLJA 1LSJA 1I3NA 4DIOA 4AJ1A 1C8UA 1OZAA 1QLHA 4FQ8A 4XIYA 4Z9YA 1P0FA 2YQ4A 4CLOB 5CHEA 1HYHA 3K92A 2C29D 1QV6A 1H2HA 2FSVA 1GPJA 3ON5A 4XGNA 7ADHA 4IJWA 2WEKA 4EZBA 1I3LA 4ALJA 5ICSA 1E7MA 4PLYA 3L9XA 1VSUA 3JQAD 2B0JA 2GLPA 3IR3A 1A4UA 1GQYA 1Z74A 3EK2A 4HADA 4LVCA 2AE1A 3RU9A 1WXDA 3ETDA 1SBYA 4K00A 3OHSX 3VZPA 3WWYA 1ISJA 4WCFA 3K5PA 4ZQGA 5TF4A 3IKTA 3JQ9C 5JCXA 5TRTA 1QLJA 4GPD1 3F47A 4PGFA 3HFGA 1H9AA 3GT0A 3WR5A 5U9CA 3L4SO 3TWOA 2Y0CA 4OYRA 1R0SA 3KYCB 3LDHA 3BMCA 4Y6PA 1MP0A 1Q2XA 3HADA 4J2OA 4XA8A 4G5HA 3RUEA 3WGIA 4MKXA 1KVSA 1C1XA 1E7WA 5K6AC 5FYDA 3DP1A 1P1IA 2QG4A 5BUXA 2I99A 2W90A 4HP8A 3WYEA 4Z0HO 3IJPA 2PD4A 5I7SA 5MGBA 4K4BA 4NBRA 4NJOA 4M55A 3RWBA 3M1AA 1H6AA 1LBEA 4YR9A 4HZNA 3OICA 1RKXA 3AM4A 1BXZA 1K5HA 3CSDA 3DOCA 1Z6BA 3O03A 4RF2A 1K6XA 4RPLA 4GVXA 4L4SA 1DBVO 3X2EA 3KBOA 3SLKA 3EHEA 4CM4A 1QKIA 3GG2A 4IIUA 3OEYA 3D7LA 2PD6A 5SZUA 4RPKA 3K96A 2NVWA 1X14A 2OWNA 1JVBA 4JP2A 4BKOA 3GH3A 4MINA 5T67A 3RUHA 2HRZA 5KCZA 1T2EA 3KVUA 1A9YA 3GEGA 4CM5A 3RC7A 5JMWA 4CV0A 3H65A 4WASA 3TSCA 1BMDA 1U8XX 2PH5A 4M86A 3VDRA 1UXGA 2B3MA 3R3FA 4IY1A 5TJ9A 2VYVD 2NVBA 4PG6A 3PHLA 2OKIA 2Z1MA 1GDHA 4IDBA 2BFAA 4XQ9A 4YJFA 3B20A 2HCTA 1I3KA 3NRCA 2V7PA 9LDTA 3GPDG 2GVHA 5TQVA 1FMCA 3DMTA 1EUDA 1WWKA 2PH3A 1IHXA 2HLPA 4JXKA 1NAHA 3KO8A 4KQWA 4P22A 2J3JA 1ZZEA 2CFCA 4OXKA 2VWGA 1B8VA 4RVFA 2WD8A 4CUKA 4O5OA 4K49A 1IULA 2VQ3A 1VM6A 3S2FA 1OFGA 1EVJA 1QG6A 4LVUA 2NADA 1J5PA 3BTOA 3ZH2A 1PJ2A 4HUJA 2AEMA 2GPTA 2D59A 3NJ4A 3ONEA 1E7QA 4C7JA 4DRYA 4XRRA 5BNIA 1ZHGA 5IAAA 5COAA 5HD6A 4IJKA 1LX6A 4ZGWA 3LF1A 4R1SA 3RKRA 4E21A 3DTTA 1XCBA 3JQ6A 1NQTA 4CMAA 4E5NA 1DRWA 2YDXA 3AUSA 3JQBA 3LT2A 3HNPA 3OETA 4CLRB 5THQA 4BNVA 3K9QO 3F5OA 1Y81A 4ZHSA 3PTZA 1LLUA 1PZHA 4URFA 5L4LA 4Y6SA 4GX5A 1J0XO 4XYGA 5BQFA 4RV9A 1DB3A 1VJ0A 3WGGA 4NJMB 4ALIA 3Q62A 1GUFA 4BQPA 2OV9A 1RJWA 3D0OA 1GD1O 1I2BA 3V2UA 1KVUA 4CMHA 4BNFA 1H94A 3PK0A 3DC2A 3ZNNA 2OAFA 1HDOA 5AQ1A 3RU7A 3S2EA 5A9SA 4PLCA 1HDXA 1T4DA 2YZ7A 3ZCXA 3F5SA 3I1JA 4FFUA 2X4GA 1HDZA 2Q50A 5H82A 4ND5A 2NACA 4MP8A 3V1YA 4FFRA 5JW6A 1JWBB
chains in the Genus database with same CATH superfamily
4MROA 3LUHA 3JS5A 1L7OA 3P9YA 5KDDA 4QUAA 1BHQ1 1H1TA 3FX2A 3MOSA 1JAXA 3HCCA 4K6MA 2ONZA 1EK6A 1Y5RA 1GAEO 3K8OE 3NHBA 5I48A 2WA2A 1IK4A 2FWJA 3PNOA 1JKMA 2WT9A 3DE7X 4PHHA 1E69A 2WUVA 1Q21A 3BH6A 3OG9A 3WIOA 4DMMA 2VR1A 2XMPA 3ZCSA 2PRTA 2HPHA 3HPQA 4BVHA 3LRXA 4DLYA 2BR3A 5HOEA 1AB6A 3DZKA 4RGYA 4UW9A 5IF3A 3AG6A 4NZOA 4PSDA 3LBIA 5T8KA 2V7VA 4ZKEA 4J6EA 3P0EA 4MKIA 5K0LA 5BXYA 1X2BA 2ENHA 1U2ZA 3NEPX 1AS3A 4ENRA 1AK2A 1S4QA 1SG0A 2BFCA 2DIXA 2OBBA 1V6SA 4NV1A 1VPWA 4MLDA 4NEQA 2IKQA 3FFBA 1EDEA 3IV9A 5JNSA 4TLLB 2XCUA 2XRMA 4NZ9A 1JBEA 1V1MA 3OY2A 4LC1A 1QTIA 3GPCA 1D9ZA 1SCBA 3TBHA 4AJKA 1EZ4A 2NQTA 2PH1A 1G5TA 1VMIA 3RUAA 4TL8A 1WDKA 4DG8A 1JTEA 1T8TA 2ZWOA 2RD2A 3P32A 5U4QA 4J29A 3SIPA 2E4WA 1L5YA 1MN6A 3B60A 3EC2A 3HP1A 3R0JA 4OHOA 3MPOA 5IBRA 3P71T 2JGDA 1D5CA 2AG5A 3GX1A 5JPCA 1KKMA 5EIBC 1ESEA 5B4UA 3PEVA 4GC5A 3Q7QA 4Q4JB 3RFFA 4GKBA 2J45A 3H97A 3QEOA 5A0VA 3AVVA 5JJCA 1DZ3A 1NSYA 2R8YA 2ZTMA 3KV1A 3UMCA 2HWKA 3JYOA 2DZDA 2ZJ8A 3ZKAA 4D0LB 4XGRA 2F7SA 2YPNA 2KHXA 3GLIA 3BWXA 1JFLA 3BGDA 3ETNA 4CIYA 5ETJA 4QPJC 4CJXA 1SUFA 1FTWA 4K28A 5EGKA 1YZ3A 5F12A 1KNQA 2PZFA 1L5HA 3RWMB 1UBLS 3HA7A 2A9FA 3I4LA 2F64A 4ZVOA 4BN4A 1NR1A 5PNTA 1OCEA 4CUZA 2YFQA 4R9SA 5HFAA 5JZVA 2LUPB 4MUEA 5DTQA 1RRVA 3EZXA 3M83A 4OV6B 3EODA 4QTZA 1EWYA 4C06A 4CV1A 2XMRA 3QK7A 4GUDA 3BCUA 3PI7A 1F2VA 3GUZA 1YV9A 4Y6OA 3CUEF 1EUDB 3ELUA 2JG3A 1IBSA 1OT3A 1Q1ZA 2AOUA 1FBTA 1XCLA 2Q9UA 5JZSA 4OHYA 1GZSA 1V37A 4F97A 3ZLTA 1VKZA 4ENQA 3H18A 4RLTB 1E6MA 5J59A 1X47A 3NDRA 4IOLA 4J43A 2I2XB 1ZIOA 4MB6A 3I0NA 2Z4TA 1QYCA 2W4QA 1Y4DE 3SN6A 5HRCA 3K73O 4RPJA 2BKUA 1GFIA 3WLTA 2P7HA 1KHHA 2I3DA 3PNQA 5E4TA 4O3FA 5A9TA 3B12A 4PN7A 1QIEA 2GFQA 4HNRA 5ELLA 3SD7A 3U80A 4UPEA 4IFBA 5KQMA 2D7DA 1BYUA 5KL4A 1F8FA 2W58A 2O59A 1DV2A 3DMGA 3U44A 3QUCA 2RGXA 1PKXA 1G5HA 2Q07A 2GPAA 2AZXA 1TPYA 1EE2A 3REGA 4YV0A 4DYVA 2XCIA 1AQ6A 4LZWA 1TEVA 3MRSA 3WDMA 1NSTA 1RXYA 5K20A 5KOHB 4JEMA 5DM5A 3NJRA 3IAUA 4U3JA 5DP1A 4F46A 3FFTA 1RXUA 3H3JA 3OFJA 4RZQA 3PX3A 1W30A 1YIOA 4BOYA 1K4YA 1WAMA 4HPXB 4IIBA 1RXEA 2R65A 1NVTA 1WS6A 4N82A 4JI6B 1L4GA 2RGCA 1W6RA 3FROA 3K9NA 4L27A 5FQNA 5L3QA 1UT5A 3GH1A 1RXSA 1ZOIA 1JZQA 4BVKA 5BT9A 1L4HA 3NUGA 1WLYA 3TQMA 1KEUA 2FZEA 4B6RA 4ZZ1A 1CDZA 1XLTA 4XEHA 3CVJA 4DIMA 4LN9A 2Z8ZA 4FLFA 3F9CA 3PIRA 4RS4A 3TCNA 1E9DA 2C54A 3VAZA 4ZGGA 5JT1A 4LE0A 1YZLA 1EE1A 1UPUA 1UZAA 4HFNA 1MFPA 4J4BA 3PQCA 3A3YA 1JKJB 4CLHA 2X8LA 4PX5A 2EP5A 2IYNA 2JIOA 3AOEC 4P5EA 3MAGA 1FYDA 1PL8A 1ZICA 4G5QA 3HMKA 1VBFA 4TMXA 1T5BA 2YJNA 2ZPTX 3NB0A 1RMYA 4NU0A 4QE3A 3AP1A 1WHSB 2GBLC 3VAYA 1QE3A 2EBHX 1RZRA 5IT0A 1K8QA 1SPBS 1ZNQO 4YRPA 3BL8A 2A9VA 3Q5GA 5LQMA 2PUCA 4GOJA 3CQ9A 1N5MA 1XV5A 3B13B 4HBZA 4YDQA 2FUG6 1J22A 4EG3A 1L5WA 4L3OA 1KU6A 2IEBA 4PE5B 5ALFA 5JU6A 2EOZA 1STUA 1G5FA 4ND7A 4OUDA 5TGTA 4B3FX 2FE1A 5LR6A 3CO5A 4CMEC 2GCOA 4O1HA 3B1VA 2WZBA 4P3PA 3GLQA 1NW6A 2N75A 4PXYA 4NCHA 1FZQA 1DC4A 1WDLA 3DOIA 3HR4A 1U2SA 4H7EA 5EXSA 3THXA 3FR8A 5JYDA 2HADA 2NP6A 3Q3VA 2FEMA 1W59A 2X4LA 1I5EA 1UC5B 1UBKS 4NZYA 1UHZA 2HFKA 4X63A 3VNRA 3KG8A 5JISA 2PK3A 2REQB 1U9JA 3KHTA 1PG5A 4YRZA 4CIAA 1QZXA 1GKLA 4X00A 3FCCA 1VG9B 2F8LA 3GRUA 2IZ0A 3S7TA 2OBXA 2R4UA 1F0NA 3U7RA 1Z0FA 5HF6A 3KAPA 4ZCMA 2G88A 3K09C 2DFDA 2IV2X 1H2EA 2ST1A 3DWGA 1BQ4A 2EF0A 1H8ED 3MJHA 4PG7A 1S4MA 4RGBA 3KOZA 4LJ9A 4KFSA 2BBTA 2GD0A 4NBUA 1JS1X 3W04A 4EX6A 2HWWA 3N1UA 1KK3A 4FMPA 2HBZA 2BSQA 3JVIA 1QYXA 2XD4A 4HNGA 3EXG1 2Z2YA 4YP7A 3DT6A 3S28A 3AEUA 3UTCA 3E81A 1N2ZA 4YV1A 2C8VA 1EINA 3N2EA 3ZNOA 2D13A 5IHPA 1U4SA 3RJTA 5A6BD 1E60A 3VU9A 1QKJA 3CF9A 1ZOSA 2O0MA 3O93A 4R7ZA 1T3LA 4ZYUA 1NBME 2X9LA 2VRDA 4D57A 4ZAVA 2WUEA 2WHYA 4NBSA 3IS3A 3RRJA 4B4OA 4DMFA 3MWYW 2QS9A 3WLAA 3BD9A 4RC9A 4NK5A 4CL8A 3NM5A 5I7EA 1WNTA 3E2IA 1M7HA 1P3DA 3CRW1 4B45A 4DUPA 1KBOA 3KKLA 1TA9A 1KPGA 1W0KD 3FWNA 3LBFA 3OTOE 3I6QA 5HZMA 3AGQA 4C4XA 5LIPA 2YT4A 1JH8A 1LLCA 4U7PB 1I24A 5L3ZA 5C51B 2XTJA 3A3KA 1NZJA 4ZJYA 3K0FB 4TVKA 3I6BA 3E7XA 1E6EA 5IM4F 3R7FA 4YCLA 4QD9A 1RRGA 1WDTA 3I2GA 2ODRC 1OOEA 1XU4A 2GCOB 2WHQA 5KYVA 1K5DA 1A9SA 1B16A 1TUBA 3ZV5A 5HCIA 2ZYDA 2J6BA 1IXLA 1W19A 1R4NB 2G0AA 1XEWX 2HMAA 3DZHA 3OEHA 4X1IB 5D86A 1SM4A 2WV7A 3SAJA 4EVIA 4YXWD 2B92A 1GQEA 4D0NA 3RKUA 4TN1A 2AB0A 4E6PA 1MEYC 1EP2B 5KNDA 1U3DA 4H35A 3VR2A 1WSAA 1H2RS 1N3IA 2R60A 2YNMC 4OTZA 3ET5A 4OKNA 3UH1A 4MYTA 5F9HA 4KRGA 2YOGA 3ANXA 1OBHA 1CY0A 4IIJB 3KDAA 4RD1A 1WSBA 1B6SA 1O94A 3A36A 4ND6A 3HYTA 1QPZA 4L2IB 3S2GA 1NI5A 2R87A 2V3WA 4HMQA 3VYRB 2EKPA 5AKEA 3ZXYA 3A6LA 3EVBA 3HKEA 1FUEA 1SBTA 3BXHA 3WP0A 2CFTA 2QTCA 4MUJA 4MV7A 4PPQA 3MRTA 3CH4B 1ZI9A 4HB0A 4KQ2A 4N6OA 5H3CA 3SU8A 2ORWA 1LBTA 2BFOA 4PYLA 1J2RA 4D9NA 5JUWA 4QOFA 5DCYA 2P2DA 4JR2A 1T3SA 4PO3X 3IPAA 1Y4ZA 3PU6A 3DD5A 2QLNA 4J0GA 5G4KA 3RI3A 5A4DA 5BRNA 3GU3A 5IW8A 1FXUA 2MU1A 2YRFA 4K9SA 5A71A 3DLHA 2FFAA 2PUAA 3T35A 3R6TA 1AUOA 4RESA 1J0CA 2DBZA 4JFRA 4R3NA 5A3VA 3FXAA 2QIOA 3VVCA 3IQXA 5JS1A 4AULA 3UFXB 5I7UA 3F6HA 2HF2A 1VBNA 3AERA 2O2YA 4WJKB 2JCVA 4ZGBA 3IE2A 1L3CA 2J5QA 4ATNA 4GRAA 3DLTA 4MO2A 3ZY2A 1QAQA 3R0VA 4RBNA 2RGYA 4DCPA 3BFKA 2OUIA 4A0XA 2HZBA 3DP9A 3DMYA 3QPCA 4J9VA 5CM8B 3ROQA 1PJAA 4GC9A 2YBEA 4BN0A 3V42A 221PA 3ZQ6A 4FSXA 2OBYA 3LLSA 2RHJA 4FYHA 2DWQA 5JI2E 3DMPA 1SVMA 4F2JC 5HIAA 1PGJA 1ZUWA 2GLMA 1QIIA 1NWHA 2GBGA 4IAOA 3TSZA 1VXOA 1J9GA 3JQAB 4IGEA 1CP3A 4N7MA 5AMXA 3W90A 3SYRA 2Q0QA 1LTKA 1YVPA 4OG2A 1TL7C 4NZVA 1E1RD 2I6QA 2R85A 5GJVC 1Z15A 3RK4A 4AI6A 2NUTA 4O29A 4I4TA 4F9EA 4QDKA 1LVUA 4MV4A 1Z07A 2YOHA 1OC2A 3E3OA 3MUEA 4CCWA 1G7SA 2QRUA 4GKVA 2AKYA 4Y2GA 3CXUA 3IUBA 3QLEA 2FQWA 1QHYA 3UB3A 2C3UA 3AZ8A 4IIJA 1U2EA 2FSFA 3R7DA 2DEUA 3JQPA 2FP4B 2FX2A 1ZMTA 1UPFA 1AV6A 2E48A 4OB7A 5E7IA 2VKQA 2RFLA 4AXXA 4DLLA 1Q95A 1L7QA 2EHDA 4LMAA 4DYDA 3TLEA 1JHVA 5ELMA 3AEKB 4KYUA 4HVLA 1VL5A 3ORYA 4RCYA 4A0GA 1QFJA 1DWOA 2VDLB 5F77A 2C2KA 4XGIA 2PHZA 1UJCA 4LE2A 4EPRA 3SBDA 1EUCB 4DLVA 4AU1A 4EPXA 4DF3A 1BZYA 5T6MA 4MKGA 5HX7A 4E51A 2GLUA 3IEXA 2ZJ7A 1A0OA 3FY4A 1AQUA 4HAOA 1Z3CA 1K3TA 2XNKA 4RV2A 1ORHA 1W46A 2NXWA 3PXEA 1ZZGA 4UBKA 4M0LA 5E6RA 3UG6A 3ZX5A 4XKJA 1LSOA 4LX8A 1R9MA 3BJZA 2CLIB 4L8YA 4LHXA 4FBLA 3TCKA 3UJ6A 3AFGA 3ANLA 1Q0QA 2E2WA 5ICEA 3NVKI 1RJGA 1SXHA 4A1FA 2H1VA 2BC9A 5HZ4A 1RHUA 2R7NA 1P33A 1W2HA 1T5OA 2AFVA 2FSVC 5SZYA 1DJPA 4Q5IA 1OUMA 4G5XA 4BLTA 5B6PA 4M1OA 5FI0B 4N6NA 3R8CA 2BGUA 3HLKA 2VJAA 1VCHA 2DHQA 4UDXX 3A7DA 3A2KA 2CNLA 3OIUA 2F55A 2ZM5A 1KSJA 2Z8YA 4UHJA 5E7JA 1WL8A 4H3HB 4HOYA 1JIJA 4OAOA 2H8KA 1JPVA 5LWHA 2NYVA 2PS0A 4Z0PA 1DBQA 4DR7E 1PR9A 3H5LA 3ZJVA 3DW1X 1SXIA 3VR2D 3MJVA 1DKRA 2VWQA 1FUIA 5EUCA 2IE8A 3BMNB 4TWBA 9GPBA 3IP9A 4E14A 1WPXA 1LWNA 2UXBE 2FW1A 4HEJA 5TX7A 4C0HA 2ZTVA 2BHNA 4J16A 4GO1A 3HXQA 2VJMB 3IT0A 2AN3A 4IXTA 4WZBE 5EHNA 3FYUC 4BB6A 4ER0A 4LJ7A 4L0QA 4AO8A 2Q4RA 1PK7A 4CKBA 1EDBA 3LUGA 4B6QA 3SNHA 3TK1A 4J0KA 3UXEA 1P0MA 3CLTC 3ROGA 3KW1A 4ENPA 1A5ZA 2F1JA 5CFZA 2XCLA 3P2MA 5FPPA 1U8AA 3P4UA 2XKJE 3SC3A 2PWBA 3ESCA 4UU8A 1ENYA 3U3ZA 1E9EA 2H3EA 2Q3LA 5H3HA 1FB5A 2G9VA 3QWHA 2G07A 2HRDA 4FT4A 1NP7A 2OILA 3PDCA 2JCGA 4IP0A 1PJ8A 2OTCA 4O8CA 1NUPA 4F4UA 4QPNA 3OCWA 4IQ0A 4Y8VA 2H5JA 3STHA 4DQVA 5JI3E 3H1EA 2H1RA 1MG5A 4MQ4A 3VYVA 5IKMA 1ITZA 1X7WA 2A30A 1PUIA 2DY1A 2QZSA 3D8NA 5HMMA 5KYUB 3QVUA 1GT91 3T1YB 3JRNA 2FGKA 3IMEA 4RKFA 1W0CA 3EZGA 3MA0A 1W5SA 3JQRA 3BIOA 1WXEA 2OOSA 3C3AA 3FLEA 3O84A 4TMYA 3TQFA 4CEHB 2HCJB 1EWVA 3NH6A 3R5HA 1NKTA 2BM8A 3RS8A 3ADCA 1NXWA 2O20A 4MICA 4DLUA 4BGIA 2WWWA 3UKJA 4BVBA 4HWSA 3VPXA 2X22A 4MYDA 1PEYA 1OYYA 2O1XA 1YJ8A 2AJLI 3UAZA 3G8AA 2V87A 3BGVA 3C4QA 2C0QA 4B0OA 3K53A 2G7HA 2Z0MA 4ZAFA 4Q16A 1NJKA 4NCPA 3ROFA 4CTJA 4RTSA 1MO3A 1U9IA 2DFLA 1WUJS 1WZUA 3PENA 5ARBA 2F3TA 1DX6A 2YWDA 3HWRA 1CD5A 4JL8A 3SR0A 3UHAA 1ZLXA 2H4HA 3UMFA 1YBMA 3QSYA 3OTWA 1FX0A 1NVFA 1SKMA 4W78B 2LUOA 4PTYA 2BFDB 4BC0A 3AB8A 3GBPA 1MB3A 2WD7A 3QJYA 1KARA 1YMQA 4GPTA 4C4YA 4QX6A 2F9LA 1UKBA 1DUIA 1JYEA 4KE8A 4H18A 4L8LA 4OL9A 4QJBA 1XD2B 4Y2HA 5CYOA 2VRCA 3ZDCA 2D4HA 2E0IA 3NYIA 2CB0A 4MK4A 3Q3GE 1Q1QA 4X6YA 5F76A 2QQ5A 3EA5A 3W3AH 4KREA 2CNBA 3IP3A 2VHZA 3U13A 3HKCB 1DBPA 3LWZA 4P0TA 1ZBTA 3PLNA 4OIFA 5FPTA 4YMLA 1U98A 3IVXA 5IJ9A 1RQGA 3OEED 4K9NA 5ENVA 3NYRA 1DO2A 4NOMA 4TXNA 5FF9A 2ACVA 2VSOA 2PMCA 3LZ7A 1UBUS 4C3UA 2IHUA 2GM9A 1I0IA 1JQJC 2XWQA 4WZAB 5KL7A 1Z9BA 3QLUA 4XH9B 3FNFA 4ID3A 2HBRA 2NN3C 2WVAA 3QMVA 1LRLA 2O2EA 4ARIA 4DQLA 4KXWA 4S1PA 4JI3E 1E32A 1U0SY 1WD7A 3BRWA 3NH9A 2OEPA 3RBZA 1FUKA 5CK4A 1EZ1A 4XB6B 3W3AD 1O8CA 1JDVA 3VUEA 3TZ6A 4FLEA 3RTAA 3OKPA 4FFBB 3VMFA 1E4OA 5FAKA 4Q05A 2QPAA 3G17A 2RHGB 2JK1A 4B81A 2PSJA 5D5HA 4EF4A 1ZHOA 3JD1A 4CIVA 2Y27A 3LRTA 3T7DA 1K5GA 1E62A 1D0IA 3K8QA 5TQJA 3ZH7A 3IR6A 3ORSA 2C4VA 2W6JD 3OOSA 1RAFA 1NQ5A 4XRGA 1IN4A 4JLJA 3RV3A 4IV0A 3KHSA 4L73A 5CDYA 2O3SA 2E21A 3SJAA 1FJGE 3C8MA 2G9UA 3CY6A 3FCSB 3ZHVA 1T24A 3HCOA 2HL6A 4LQLA 5K9ZA 2YINC 1W73A 5B30A 3AKEA 4R40A 3OC6A 4TTQA 4BO3A 3FNBA 2IY8A 4Z53A 4JV5B 1PP4A 3ANYB 3E9QA 3KD2A 1U0JA 4N5NA 1JQLB 5JDIC 1EVEA 2C7VA 4LOHA 1TIBA 4M7PA 1GRRA 2JBAB 3PPYA 1LLDA 2X5JO 1L4SA 4PAOA 2YXDA 5JJKA 1HQDA 5K4AA 1TGYA 4EGQA 1LBIA 3OJ0A 1FE8A 3IMFA 1BJTA 2B6HA 2W6ZA 1MJGA 2VDPB 2WD9A 4IJ6A 3K20A 5K8TA 3LDGA 3AZQA 4RTLA 2V0NA 5L7YA 4ZAWA 2GJ9A 4F2HA 2XE8A 2R1VB 4L15A 5B1EA 2UXBB 3DZGA 1CZOA 1MH1A 5FI3A 5AVVA 3SNKA 2CPNA 1E6LA 4Z4FA 2BZGA 2B8JA 3CUKA 5DTJA 4BIIA 2IZ7A 1J21A 3F6RA 1FQKA 4W8HA 3VJLA 1YUJA 1Z0IA 1ZUNA 2O3UA 3L7AA 5COBA 5BT8A 4F9CB 3ENZA 1XAGA 2ANBA 3OFSA 1DIAA 1DOZA 1QZ3A 1OAOC 1PLKA 2WB4A 3D43A 1EX7A 4J2TA 5TPWB 1AA9A 2XIQA 1R3UA 2L69A 2G3YA 3RF6A 4GKKB 2Z5VA 4AX4A 4HH1A 4GI2A 2Z6QA 2HCFA 1LI5A 1WOMA 3CLHA 4DCSA 4P3KA 4Q3KA 5J2TB 2Y66A 4KIUA 5FXMA 4I82A 2QROA 1V47A 5ADWA 2ZI4A 3FPLA 1VJRA 2WUGA 4NPHA 4FILA 4PW0A 2ZM6E 1QV9A 2HB6A 3NHLA 4HGYA 2CVHA 2DSLA 3E35A 1N2BA 3KPVA 3OPYA 4KO3S 3TBKA 1J2TA 1W52X 5CIQA 3VPDA 4ITUA 4D4IA 4UM9B 2B25A 5JJBA 2QI9C 2I62A 4M9RA 3T7JA 1RP1A 3SM9A 3QG1A 2NQ2C 2Y1WA 4XDHA 5LOVA 1KMQA 3GAAA 1ORTA 1ZH6A 2C94A 2QL9A 4LAFA 3AFIA 3IBSA 4KXLA 1N7JA 2C97A 3L1HA 3UBMA 4DARA 5F3WB 3Q72A 4P4SB 4R68A 3UW1A 3A9SA 4DABA 1DSSG 4RXMA 5FTKA 5K0NA 4P5DA 4EF6A 5DNUA 2JJ8A 3E7PA 4HX9A 5IDYA 5TQ2A 4C03A 2X2OA 2IIBA 4V02A 4ZTZB 4DFDA 1R4MA 2H5LA 5HDBB 4W1SA 4ZEOA 3WK4A 1YDHA 3EZNA 3W3AA 2RC5A 4TV9F 5T8KC 4HNVA 5KVCA 2LVHA 1GPNA 2M32A 4YREA 4Q66C 3DQPA 1J90A 3QKSB 4JI1E 5DNAA 5ULLA 1GGHA 3GEIA 3AESB 3UJ9A 4C88A 3KKNA 5LQCA 1NJSA 2JH8A 1QQ7A 4LTMA 4HJRA 3H4IA 2AYYA 4OQ4A 1E0AA 2WDZA 2DMIA 3ZHZA 3NHAA 4IDQA 4JKYA 2JI9A 4KOEC 4ZDJA 1R1DA 2CWWA 1GKKA 1HE5A 2IF2A 2ZCUA 3AOEA 3GIWA 1V3QE 1YDEA 2XVAA 3C8DA 3CTMA 3KUXA 1R64A 1KETA 4L4UA 4LG1A 3REFA 1OILA 3WMEA 5AFSA 4JJZA 3PUJA 3NBAA 2IHJA 2D06A 3TPFA 1MT3A 2ROQA 3C7AA 4TV9A 5BRJA 2ORIA 1GPLA 2AI1A 4QASA 1W9MA 2PQ0A 3OZAA 2JFWA 5KSZA 2M4IA 4UE3S 1TM7E 4IKPA 3U3DA 3TYXA 2PKEA 1YCFA 3K0HA 3O8NA 3QA9A 4QFBA 4CIDA 1WB4A 2BMDA 4MXDA 3TLGA 1W7AA 5CM2Z 1UR5A 1BFUA 3DW3X 3SZ3A 5LOVF 1XO1A 2V5VA 5TIIA 2WSMA 2EARA 2VDRB 4FYMA 4JLKA 4D9MA 1NATA 1CE8B 1ZK1A 4B17A 5DKFA 1B26A 2VS1A 4D46A 1VLLA 5CA1A 3ITDA 2VA8A 3NDIA 3MUOA 1SFEA 3NUQA 2HHLA 2O7RA 1DWUA 1SU4A 1VPLA 5M3BA 3FGZA 4NTZA 1N92A 3RVKA 3SC6A 3SLGA 1EVKA 1PJTA 1LPOA 1RC0A 3KZKA 5HRAA 2JIZA 3G0BA 5K8LA 3FUWA 2FPMA 3IVMA 4Y2TA 4U2BA 4BMDA 2X2EA 5A05A 1G60A 2AC4A 2NUPB 4OFZA 4WNAB 5E9QA 2B5VA 5HEKA 3WAGA 2VCEA 2QD3A 3FWZA 2KX7A 3R3HA 3CGGA 4XYEA 3U7QB 3N87A 3IE0A 3KP1A 4YJ3F 4E6EA 4LTYA 3S2UA 4Z49A 1IHUA 2PAFA 4KVZA 5CLFA 3U4DA 2HIAA 3N39C 1N8KA 4HZUB 4ZT4A 1PSDA 3TECE 4BIMA 1R16A 3HM2A 1ECCA 1Z8NA 3BRWD 5LD2B 5H8WA 2EL6A 2JLYA 3HYRA 2I5PO 2QZZA 2R6CA 4R2QA 3CN9A 1NRIA 1K08A 3GARA 3GZTB 4HNHA 4KC0A 3ZH9B 4GI7A 1UOPA 4L72A 3QLVA 5LDGA 4YGXB 1JQ5A 4BO2A 5EXTA 2A86A 2HIGA 1T0UA 3DOEA 3GC6A 5IZCC 5K1ZA 1AXGA 1TK3A 3TFQA 2EFJA 2MDTA 1O57A 3ER6A 1YQGA 3SXUA 1KI6A 4HAVA 3N76A 1AKYA 4MP3A 3DQZA 1I5RA 4FBMA 4OUDB 2ZRNA 4DR3B 5FOWA 1DIOB 4E09A 5ISMA 1U2PA 5FDFA 1H8HA 2D62A 3AV0A 5CVVA 2XD9A 5FI5A 4C0AC 5BP3A 4DW8A 1Q3KA 3L0CA 3DVLA 4GR5A 1IK6A 1K8XB 3IXQA 3RHZA 3N2ZB 5EHQA 4G0MA 1YJQA 5EWLB 4QJ3A 1I36A 1UMBB 2ZPUA 3S2SA 1KAMA 2XBLA 4KPEC 2V7QD 3NIBA 3P2IA 4RJKA 3TMAA 3PEFA 1Z4KA 3U7GA 3WKEA 2P4SA 4L6CA 3DEYX 4ZJZA 4R05A 3CX4A 4BGEA 2DUNA 1N75A 3OTIA 2D1QA 1HZZA 2BMJA 4KRXA 5CLLA 4YRAA 2XWSA 4NFSA 3UGJA 2GNAA 4URYR 2ATCA 1N6PA 3VYXA 1F3OA 1U0RA 3QQPA 3RIGA 3TSWA 4EYEA 2LMZA 2Q1WA 3AR6A 5K3SA 3DKRA 1X70A 3BZUA 4OAQA 3Q3EA 3K70D 3ER8A 1UZLA 4KO8A 2N1MA 4ZV9A 5KS2A 2IE0A 1JEDA 4MV1A 3WTBA 2B35A 1N7HA 1N6NA 3TOVA 1HY3A 1AQYA 1M76A 2YL2A 4MKHA 1DO0A 2H16A 2XWBF 1T38A 5ICFA 2IDMA 1YA8A 1CJCA 4LHYA 4QPCA 4C3OB 3CFYA 3I3OA 5EO4A 2H1LA 1YQ9A 2VIIA 1NF9A 3N07A 4GYWA 1HLDA 2IVZA 2P5YA 1HRKA 3DFKA 3LFHA 4J1SA 3AFOA 4PO8A 5E2IA 4MGIR 4CTMA 5F33A 4RY8A 3WG9A 1CRLA 1BB8A 4BVLA 3TSAA 1W49A 1SOUA 2O2ZA 1XA0A 3ZWWA 5JWRA 1KJIA 1RI5A 4WMLA 4F96A 1T2NA 3BEOA 2V6GA 4ZYWA 4EMSA 2ZW9A 3CF2A 4TROA 4ZCIA 2MIIA 4CEJA 3C43A 3ODGA 4JLNA 4EKEA 3NT4A 2QSUA 3O7WA 4CV3A 5FUBA 2DC1A 3LFTA 1NUQA 4KEAA 3UXMA 3QEKA 4BNZA 1HDYA 1EAMA 1V11B 3BXPA 4OVKA 4HDAA 1AD2A 3ESXA 2R6JA 1A9OA 1E99A 2CUZA 3BXXA 3IQHX 3T5MA 2JPAA 3TQHA 1M10A 4LXIA 4BJHB 2H9YA 2VOJA 3L8DA 1DLJA 4GAKA 4RZHA 5BUSA 1JFSA 1R37A 2HC9A 2V8BA 1EFPA 3UHFA 3JQ8A 5JD3A 4NX2A 5B55A 4Y1RB 5F7OA 1UAAA 2P0EA 3X1ZA 3ZV3A 5LC1A 4F4CA 1U0GA 1ZM7A 3TSOA 1M1UA 5DH9A 3S2YA 1KBQA 2EC5A 3H5OA 1QK5A 3QW4B 1TMYA 2JIBA 4KMSA 1KYXA 3ZE0B 5E6SB 1Z08A 1K8ZB 3TUJC 3W5JA 2CLLB 4DBZA 1QHNA 2OE2A 3L7DA 2PWYA 1SUWA 4BWGA 5IBPA 3IA7A 4BKRA 1GT6A 2DFNA 4FZRA 4A0ZA 2I4LA 4Z3KA 1OH5A 1D2CA 2UUOA 3K0AB 3H2GA 4WJLA 4LCBA 2QMOA 3R4CA 1A88A 2V45A 3CVYA 2ZE8A 1RFLA 4E30A 1MEEA 3FDFA 1KJ9A 1X8LA 2P8SA 2RBEA 5FL3A 5G4KB 1D2EA 1E94E 3BPSA 3OPMA 4LSZA 4RUKA 2MMCA 2EMBA 1GRNA 2AXQA 3VO1A 1H5UA 1B93A 1V1RA 1EH7A 3EH2A 3UFXA 1YCHA 1BDBA 2VKZG 2ZUVA 3IP8A 4BVEA 4WXPA 2J7KA 4ID9A 4EFNA 1PRYA 3AF5A 3OX1A 3R0ZA 4IS1C 4UU0A 3AGPA 3FNGA 1A8PA 1TJ4A 4ZODA 4ZO7A 4CKCA 5JRDS 4AN0A 2KYRA 3M2TA 2GCIA 1PR4A 1L5GB 4C21A 1TM3E 3RV4A 3JZDA 2VYVA 1SCUA 2AYXA 2BGIA 4UUOA 1E7YA 3AFMA 3X1MA 4JBWA 3ESAA 1SXJD 4LRTB 4C5CA 5DN9A 3RG8A 1GCGA 1IY0A 1GSHA 2IODA 4TQ9A 1S2GA 1Z4JA 3V33A 5HG0A 4TL6A 1S2MA 1E9SA 1T1RA 5LXTB 1DQRA 5C4MA 4K9PA 3IJRA 4I4TB 2J07A 3P7MA 4ETWA 5KO2A 1SCAA 1FRZA 1TEHA 1G8JA 3LUFA 3MCAA 2HJGA 4NJEB 3EOBI 2QAIA 2YC2C 2FN7A 4WCDA 3ND5A 1SC3A 2TRSB 2W6ID 3L9WA 3HUUA 1IY8A 3LECA 4Q3BA 3AVUA 3H8VA 4MYCA 4XWAA 3L0PA 5TJHA 2ZB3A 2EBUA 4GX2A 4ZYVA 1SC0A 1E8NA 2ZVJA 3QFFA 4RZ3A 3BFVA 2LWIA 4I8DA 2JD2A 4QO8A 5DE3A 2DU8A 2NUBA 3E61A 4CMCA 2UZAA 3V2IA 2EJWA 4L9RA 4QUJA 1FFDA 1CY6A 1SCQA 4ZVNA 4CE6A 4GMHA 2EOOA 1N33B 5LVAA 1P1CA 3EXZA 4JUFA 4OQFA 1AF7A 2D2FA 4WNYA 1VG0B 4ABTA 5A3JA 3ROMA 3OT5A 4OKSA 1SAYA 2XADA 4NCIA 2NU6B 1EFCA 3FD8A 1G17A 4AMVA 2J5RA 5KTMA 4YMIA 3H86A 2ZUEA 4M2ZA 4MQFB 1UDAA 3HUEA 4B33A 2JD1A 4H4DA 1IHYA 3I12A 4H16A 2Q5JA 4K6FA 3ZY3A 5C8ZA 1UXHA 2G08A 3CSUA 1CZUA 2V74B 2FQQA 2EFEB 2ADOA 1IOWA 3I2IA 3QSGA 2H5EA 3KYIB 2GERA 2FZKA 2R1UA 3IAM6 4LYYA 4MTLA 1R0CA 2UZ1B 5AJYA 3HYLA 1DU4A 4MRPA 3BIJA 3KTFA 2JYAA 1YOVA 1OLOA 2NZXA 3EUWA 5TT1A 5LQUA 3THYA 5F5XA 4BX3A 2JFGA 3OQOA 3R09A 2HWYA 3NQ41 5LZ8A 2QAGC 3NTQA 4PR0A 1GR0A 1D09A 3KJFA 3OM9A 1RJ9B 1JL3A 4Y9UA 4N0PA 4Q47A 1P6XA 1O5IA 3TJMA 2AZMA 1VHDA 4MVJP 2QT0A 3AJAA 4MR7B 3Q7SA 5JQWA 2ZIFA 1FP4B 1WKVA 3PPWA 1BN6A 1Y1LA 2Z8YM 3ABRB 4AUKA 3GK3A 1AKNA 4FOPA 1V43A 2IUSA 3ISVA 4AP5A 5HHTA 1C9EA 3GQBB 3GCZA 2RBKA 1DCMA 2QTWB 4YRNA 4PIVA 5JXGA 1O94D 3LDUA 3ZY4A 4EQZA 3VPHA 3F4KA 4FWTA 2ZDHA 1D4FA 1Y89A 2ZIEA 4ZCSA 1JJIA 4NYIR 2DFKB 3L01A 3HN6A 2A5FA 5I7RA 5L8VA 4MR8B 4AVYA 2A5LA 4FHFA 1JKFA 4LXQA 2ODRD 3KQPA 1J8YF 1US8A 1QP8A 2PSHA 4L76A 3RS3A 2BGGA 3K67A 2VUTA 3Q10A 4KSBA 3CF0A 5CXSA 5J23A 1QK3A 3EG5A 3KSBC 1ZWLA 4AG3A 3SHOA 2ZJ0A 3JSXA 5HQJA 3DE1X 4B74A 4WBSA 4DCGA 4NXME 4CNBA 2I3BA 5KEIA 1URPA 3TW6A 2CXPA 1B0ZA 5BQ5A 1PWHA 1AK9A 2Z3WA 2XXJA 4UEQA 4A3SA 3JQFA 5ITSA 4RTPA 2EZ4A 2J3IA 3ROZA 4JENA 3W7VA 3PQ8A 2MKDA 4HLUC 3LWNA 1PR2A 1UXKA 2VJBA 2DRIA 3QIAA 3DHWC 3WMRA 3F9RA 3H4MA 3OO1A 1P2GA 3JQCA 2G1UA 1IRXA 3JD2A 3IVGA 3KHUA 3A4VA 4M54A 2VQFB 4F6RA 1EMDA 3L1KA 3OEWA 2RH4A 2ZZMA 1MV8A 3A1VA 4LDRA 5C1IA 3RSHA 4QWMA 4BAZA 3D7KA 2EPUA 1Z1BA 2WJ6A 3MOGA 3NBKA 4IH9A 1KERA 2YWBA 1MTZA 5ALLA 1A3CA 2H6EA 3IP6A 2OQVA 2CVPA 4TLAA 3DVAA 3QV2A 2V54A 5EPUA 5F51A 4RY2A 1QHIA 3N05A 2MSKA 4TRRA 3HJCA 5KTOA 3TLXA 2ODNA 3ZBUA 4LJKA 1RHJA 1DQYA 5IFLA 5AIAA 2DQZA 1X13A 4MWDA 1X8KA 1DQZA 2BD0A 5I3ZA 2D5IA 4MAMA 1Q7BA 1BVRA 1SN7A 1E79A 2ZAIA 4LDQA 3ZBPA 2EIHA 4OGFA 5HJ5A 3DB2A 3HCAA 3OWXA 2FSHA 1MX5A 4W78A 3HUFA 3B6IA 1JE1A 3AFNA 3LA8A 2EN2A 1B69A 1TK2A 4I36A 4KE7A 1YZFA 1BW9B 1C3VA 1THMA 4PLWA 4W8GA 5HR5A 3FKSD 3N74A 3SM3A 3BB1A 3V1TC 2FQ1A 3WXBA 3RRMA 2EM5A 1WV1A 1QQ5A 1QVWA 2SBTA 3FPAA 4QYSA 5IV8B 1RWKA 1N7GA 4A6XA 1FLNA 1ODSA 4X7MA 4EELA 5JWOA 3U39A 3R3VA 1CDDA 3BAFA 4LV8B 4PC3A 3NEJA 3V8VA 3ZUGA 1QIGA 2EPPA 3R3JA 4DUGD 1J39A 3I8SA 4JJEA 4E5SA 4F8JA 4RDXA 3V2HA 1P7ZA 5CFOA 5DYGA 4ZEXA 1Q6WA 4UM5A 3MCZA 4JLPA 3W9SA 2P1RA 1LA2A 2P8JA 2Q1TA 3MHHC 1J2YA 2VP6A 4KYTA 1CF2O 1VA4A 2YXPX 3WYDA 3NOOA 4S1NA 4D98A 1BDIA 1BROA 2OGTA 1OQAA 4B0CA 1N4AA 3GJ0A 5FBKA 3ZNPA 4UZSA 3MJSA 4K46A 3VR5H 3KXLA 5AVYA 1IFXA 4H7DA 1QH9A 3G89A 1QR2A 4BMCA 1D1SA 2PJUA 4PBSA 4J7XA 4Z2YA 3AJEA 3MCVA 4CI9A 4CLXA 3SK0A 1N6OA 3ZJ4A 3CF4G 5F7XA 3SIRA 4A5OA 2A7XA