3OMLA

Structure of full-length peroxisomal multifunctional enzyme type 2 from drosophila melanogaster
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
585
structure length
532
Chain Sequence
LRYDGRVAVVTGAGAGLGREYALLFAERGAKVVVNAADIVVDEIRKAGGEAVADYNSVIDGAKVIEILVNNAGILRDRSLVKTSEQDWNLVNDVHLKGSFKCTQAAFPYMKKQNYGRIIMTSSNSGIYGNFGQVNYTAAKMGLIGLANTVAIEGARNNVLCNVIVPTEGILPDILFNELKPKLIAPVVAYLCHESCEDNGSYIESAAGWATKLHMVRGKGAVLRPSLDDPVTIEYVKDVWSNVTDMSKAKHLGAIAEASGTLLEVLEKLKEGGGDAIEDAFEFNSKELITYALGIGASVKNAKDMRFLYENDADFAAIPTFFVLPGLLLQMSTDKILHGEQYLEIVDDLPTSGTLLTNGKVFDVMDKGSGAVVVTNSESFDESGRLLVRNQSTTFIVGDPIAGVVPLQPAPNRQPDATVQYTTSEDQAALYRLSGDKNPLHIDPQMALLAGFKTPILHGLCTLGFSVRAVLAQFADNNPALFKAVKVRFSGPVIPGQTLRVDLWKQGTRINFRTVVVETGKEVISGAYVDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxisomal Multifunctional Enzyme Type 2, CG3415
publication title Peroxisomal multifunctional enzyme type 2 from the fruitfly: dehydrogenase and hydratase act as separate entities, as revealed by structure and kinetics.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase, hydrolase
total genus 154
structure length 532
sequence length 585
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
A PF01575 MaoC_dehydratas MaoC like domain
A PF13452 MaoC_dehydrat_N N-terminal half of MaoC dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.129.10 Alpha Beta Roll Thiol Ester Dehydrase; Chain A Hotdog Thioesterase 3omlA03
3.30.160.260 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3omlA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3omlA01
2QG4A 4RQUA 1DDOA 3DP0A 2AEJA 3QWAA 5F1OA 1LSJA 3C7CB 5G4KB 4D3FA 4UVDA 5ITVA 4HXYA 1I8TA 1K6JA 1BSVA 2QQ2A 3O26A 1JA9A 3QA9A 4IDGA 5EQDA 4K49A 4LMPA 2X58A 5G0UA 4CM8A 1J0XO 2UYYA 5JAZA 1Y9EA 2V6BA 5EJ2A 3SLKA 3W4JA 1GUZA 1WDMA 2FZWA 2IZZA 1FDVA 2B4QA 1SZJG 3MEQA 3P2OA 4M86A 2J3HA 4DUPA 4E5KA 4HNGA 3PTZA 5G0TA 1ADBA 3VH2A 4PLZA 1QR6A 2FHSA 4TZTA 3KSDO 4TVBA 1RM0A 1JVSA 3CEAA 4E2WA 1HE2A 3KXDA 2OL4A 5T6BA 3EZYA 3JQAB 4A5OA 4BO3A 8LDHA 1OC2A 2WYVA 2QYSA 1P77A 3DZGA 4RVHA 3DDNA 2PZJA 5U4QA 5EERA 3Q0EA 4CM9D 5ILGA 4CUJA 3GK3A 2BKAA 4NFYA 4OSPA 4ZQFA 2EF1A 1YGYA 2EJWA 1P0FA 1FDTA 1V9LA 2JAPA 4OSOA 3KLMX 2C0CA 1ZK0A 4UUOA 1ZBQA 1SPXA 2NUAA 1ISHA 2WJPA 4BQPA 4BO1A 4KTVE 1UXIA 5KVSA 4K28A 4IDAA 1S9CA 2DPGA 5JAQA 4P38A 3L4BA 4B4UA 3UICA 4IXWA 3WNVA 3R3CA 3JQ8A 1LEHA 1T82A 1ZIDA 2NWQA 3L9XA 4E30A 4L76A 5A9RA 5U1PA 5HBRA 3K2EA 2DM6A 4N5NA 4A2CA 2CYEA 2NU6A 4J7CA 2P9EA 2ZCVA 4Y6RA 3DMYA 5FFFA 1PGJA 4CLEA 4RZIA 4LRSB 1LSOA 3ABIA 4NFSA 4W82A 1H6AA 4GGOA 1NFRA 3WJAA 1PJCA 1R0KA 1MUUA 2GGSA 3QWIA 4ZN6A 4ND5A 3G1UA 3N58A 1GCOA 4FGSA 4MVJE 4U6SA 3QY9A 4R9SA 3IKTA 4B8UA 1BVRA 1X13A 2XPCA 3D0OA 4P4NA 4F46A 5IZCC 2GF6A 2DUWA 4ZQBA 1Y8RB 1S5UA 4RF2A 3AM5A 1QYDA 4BNNA 4B3IA 3AFNA 1UJMA 4FJ1A 3UUWA 5BSGA 2X0JA 4ZV3A 1PS0A 3MTGA 3KUWA 2I76A 4JBGA 1W8DA 3G17A 4L0QA 2JFGA 2I5PO 2XOXA 1DEHA 5CHEA 3P7MA 4NJMA 4QD7A 1PJ3A 1ZK3A 3GFBA 1IULA 3BMOA 3OICA 3ONDA 4NHEA 4EBFA 5IDQA 2W3XA 2PA3A 3DMTC 3L6OO 5AVOA 2H9IA 3PWSA 2AE1A 3GRPA 1F8GA 4CLXA 2C2YA 3CTMA 4IIVA 4IS2A 4DPMA 3R36A 2DUUA 4GAHA 2YHIA 3WOHA 3ZWNA 4CMEA 5KNLA 2EKPA 4BV8A 4RLWA 4QD9A 2BRUA 4CMKA 2VOEA 1YB1A 1NP3A 5HS4A 3F47A 1IXLA 3WGHA 1SAYA 2CNBA 1BHSA 1UXKA 1U5CA 4CQMB 3I6IA 3DB2A 5KJCA 1I3LA 4KZPA 4CV3A 1B15A 2CVQA 2EKLA 1OI7A 3CPSA 3VPXA 1LX6A 3HUDA 1EDOA 3I9OA 1Y8QB 4CLDA 3BZUA 3JQBC 4GKVA 3PHIA 4YEDA 5IG2A 3MTJA 5BYUA 1P31A 2IEBA 3PPIA 1PU2A 3F1TA 5TQVA 2GASA 1PL7A 3JQ7A 3RUEA 2PH5A 4D3DA 2O4UX 4WECA 4DPLA 5F21A 2ZQYA 1HLPA 4PG7A 4ND3A 1DC4A 1ADFA 1CWUA 1ZUD1 3KUXA 4BMNA 5I9MA 3KYBA 3GVCA 4UREA 2YY7A 4OMUA 4WLVA 2EXXA 4LCEA 4OM8A 1DXYA 3DHYA 3D64A 1GADO 3PYMA 4XYGA 4DIFA 5ADHA 4B3HA 3WTCA 1ZNQO 4P8RA 1WXDA 4BUCA 4NDNE 4YJHB 1VPMA 2DBVO 1E3LA 2NTVA 4IDCA 1LRLA 2V7PA 4JBHA 5I7SA 4K6FA 1SBYA 2J5KA 1ZMTA 4Z3DA 1PEDA 1T1RA 2C07A 4DC0A 3LMBA 1E77A 3ASVA 4GBJA 4CLRB 4CM1A 3IJRA 5L7WA 3P3FA 2VT2A 1KETA 4MIOA 4W9NA 4DBZA 4E0BA 4CMJA 4PG6A 2BLLA 4DYDA 1DIAA 3P2RA 2I65A 3AWDA 3P2QA 1SB9A 4YR9A 4BNFA 4R01A 5KJEA 3GNQA 1B0AA 1A7AA 5ENVA 2EP5A 4B8WA 2HK9A 2EGJA 3VPHA 2EJVA 4N5MA 4W6ZA 1VSVA 4RVGA 1N1EA 4EGFA 1E92A 1KEPA 3D6XA 2W2KB 2GLMA 2O2YA 3DBVO 1Y5MA 3R35A 2JCYA 3WJ7A 3RROA 3DOOA 1XSEA 3A9WA 1BRMA 3GNSA 1N1GA 3RBXA 3W6ZA 2BMAA 2GDZA 3RFTA 4YT2A 1X0VA 3FRJA 4MVJP 3ZU4A 4EITA 1ONPA 3GEDA 4DA9A 4PZEA 2I99A 4MKZA 3UKOA 2G17A 4WUVA 5A05A 4DTIA 1X7GA 1YOCA 3Q9UA 2F41A 1MG5A 4BMVA 4CMIB 1PJQA 2J8ZA 3CF9A 4DC1A 4CJXA 3BMQB 2C2XA 1BDBA 3JQ6A 5A3VA 4O0LA 1VKNA 5IZ4A 3WGQA 1DFHA 1GQYA 1K89A 2YDYA 1ZZEA 3ADOA 3IAHA 4HADA 5T67A 3TL3A 4CM3A 3E8PA 3C7DB 3D3WB 5K0ZA 4IDDA 5A9TA 1Z54A 1N5DA 1IE3A 1OZAA 2EISA 3KSZO 4XIJA 3SBOA 1A27A 2A35A 3E29A 1ZVMA 4OKNA 3BMCA 1SB8A 3PGXA 4UUMA 3T4EA 3RD5A 4ALNA 5TJ9A 2DTXA 4YACA 2IE0A 4GLLA 2RCYA 2EIHA 1PN4A 1BDMA 2O7SA 4K00A 3HFGA 4N54A 2HK7A 3DHEA 4BO4A 2GN4A 1ZO8A 2ZTUA 3LSYA 4YAIA 2FPPA 1PQWA 3NYWA 2Q4BA 2G5CA 3R6DA 5TF4A 3IUSA 2FZEA 3H9EO 5LCXA 4XB2A 1FF9A 1I2CA 4P4GA 5AXAA 4MVJD 4RLTB 1EE2A 2OGUA 5CG1A 1P1JA 3HJAA 3VZRA 2YYYA 2HUNA 4I9HA 3WBFA 5HD6A 3GN2A 4Q3AA 1GUFA 3JSAA 1GZ4A 3FN4A 3V1TC 4K4BA 3GF4A 2O23A 2WYWA 2X9NA 4TVOA 1LDMA 4CMCA 2FN7A 2F3XA 4YQZA 1DJNA 3PHHA 4CM5A 4RF5A 2DFDA 3BMNA 2XEMA 1CDOA 3RBZA 1PZEA 2YV3A 4XB1A 3KV3O 4KP7A 3RUHA 5T06A 3WXBA 1PL6A 1X1TA 5L95A 1RWBA 4XD2A 1C0PA 4PIVA 5CP8A 3UHAA 4D42A 5A4DA 1TLTA 3DZHA 3R32A 2HAEA 4NPCA 2CD9A 3JYQA 4RF3A 3V8BA 4BO5A 3C85A 3QVOA 4CV0A 2G76A 1NR1A 1E3WA 4PLYA 2VYVD 1R4NB 3D5TA 1PS9A 1NQTA 2PR2A 1E5LA 3WS7A 4UUPA 3U9LA 2HLJA 1MC4A 2O4CA 3ZN2A 1ENPA 1JN0A 4EJ0A 4LRTB 3HN7A 4AJHA 1AHIA 2CF6A 3IDSA 3LYLA 2EGRA 4RPJA 4J6FA 2FUJA 2EHDA 5TLSA 1UDCA 1Y6JA 3LW3A 3EK2A 3EYWA 4I9UA 3WB9A 2FPIA 1UUFA 4RZHA 2BH9A 4NIMA 4Z0TA 4ALJA 4ZQHA 4J1NA 1IHYA 1PX0A 1XHLA 1Z75A 1G6KA 2ZIZA 2H63A 4CMHA 5AQ1A 4CL8A 3B7JA 4I83A 1ENZA 2X5KO 1GQQA 5BUWA 3F5QA 4XRRA 4FC7A 3WYCA 3F4LA 4LVUA 3TF5A 2JFFA 2EG9A 2J3KA 1I0ZA 1T2DA 4R1NA 2PH3A 2D0IA 2Q2WA 4CM9A 2NVWA 3FD8A 3D6LA 5SZUA 3CF8A 1G0OA 3BHJA 3OEWA 5I9NA 3PDUA 4BL5A 1WPQA 1GY8A 2B5WA 2PGJA 1GZ3A 1L7DA 1GQ2A 2D59A 5DCWA 3E5RA 1QLJA 3ENNA 3WGGA 3A06A 1GYQA 1YH3A 4CQLB 2Z95A 1E7MA 2I66A 2P68A 2UUPA 3RIHA 3IOYA 1P1KA 1F12A 4WLNA 3M6IA 2GERA 3TZHA 1JKJA 1FXSA 4PLWA 2O3RA 5EL0A 4PG5A 4B7CA 4YA6A 4MOWA 1VJ1A 3R1IA 3V1UA 3DEYX 3OJ0A 1H2BA 1HZZA 2VOJA 3RUDA 3DHNA 1NPYA 2RIRA 2OUIA 1O0SA 3OHSX 1B8VA 4NH4A 3GDGA 4D3SA 4WKGA 4G81A 3QLJA 3DOJA 4RLUA 3AU8A 4A7PA 3EVNA 4BNWA 1HZJA 1UP7A 1XU9A 4RLHA 4R1TA 4FQ9A 3HN2A 4J0FA 3MJ4A 3NEPX 2HLPA 1DC6A 3IUPA 4FCCA 5THKA 2AEFA 4BO0A 4KQXA 1LA2A 4KWHA 3GMDA 4J9UE 2FR8A 1GZ6A 3OJLA 4WASA 1W73A 3TNLA 1Y5RA 3ZHZA 5DBFA 4RV9A 4DMMA 5TJHA 2E49A 3KEOA 1DB3A 3AW9A 3WSVA 4DL9A 1O89A 4J4HA 5GZ1A 4J9VA 5DN9A 3KTDA 3WYBA 4CR6A 4XQEA 4EUHA 1G0NA 1LQTA 5MDHA 1NVGA 3WICA 1A4IA 2J3JA 4JGBA 1A72A 4BGVA 4WEQA 2DKNA 2AV9A 2AG8A 3FHLA 3KVZA 4NK4A 1EVIA 5KWEA 4TRMA 4NBRA 4FIZA 1E1LA 1DC3A 4YJFA 2X9VA 4NI5A 3UH1A 4MINA 1C8UA 2JCVA 3N7UA 4FFUA 4L75A 2JHGA 3G79A 5JBIA 2JD2A 1JQBA 1GDHA 5F5NA 5G2OA 4RPHA 4ESOA 4MP6A 1PJTA 3ST7A 2JCXA 3KB6A 3LLSA 2B0JA 5HMBA 1DAPA 3KX7A 4AE8A 2AQIA 5C5IA 2JAHA 3OM9A 3PDJA 4GMFA 1PQUA 2O3JA 4NZ9A 2DQ4A 3H9QA 4QXMA 4Z9XA 3Q62A 1R37A 2ZB8A 3ZH2A 4OXKA 3D5QA 3EXZA 4IJVA 3VZSA 3ZNQA 3V2UA 4BKUA 4DLBA 5L40A 5L53A 3OIDA 2GN8A 1H6BA 4J1SA 1C0IA 1E6EA 1PS8A 3AOGA 1DHTA 2WMDA 4F6LA 1XIVA 3I9NA 3JD2A 3OA0A 4LGVA 3ZWWA 3GGOA 1X14A 4IQ8A 5DM5A 1EFLA 4Z9FA 2Q1TA 4WOKA 3W4IA 1DO8A 5JAIA 2B4RO 4AE7A 1FK8A 2RAFA 3BTVA 4FBGA 1LXCA 3ZV3A 1NR7A 5T8KC 1BXKA 2FWMX 1KVSA 5H81A 1KERA 2VHXA 2H6EA 2VWQA 4U0JA 1GTMA 1HDXA 4B0BA 3QQPA 4I5GA 1EQ2A 1UP4A 3B1JA 4LSWA 4RVDA 1LC3A 1RM4A 1PSDA 3GGGA 2NM0A 3ZW8A 4BKPA 2CUKA 1PWZA 1EQUA 1NHWA 1MG0A 1OOEA 1IOLA 3ETEA 3FNHA 4HFNA 4J49A 4CL3A 2WDZA 2B37A 3PLRA 5GY7A 1V3VA 3R3BA 1N8KA 4X54A 3KVIA 3VDQA 1KVRA 4I5DA 2PKRA 4UVEA 2NVUB 1M66A 2E37A 4OL9A 4QECA 5JDIC 3PP8A 1LDYA 1ONOA 3INRA 4OXYA 4Q3CA 3RCBA 1X0XA 1AE1A 3B6ZA 3NT4A 1DJQA 1VLLA 4YJGB 4JROA 4W78B 4GSLA 1CJCA 1DRWA 3F46A 2WSBA 3NUGA 3PZBA 3GMSA 4XZ3A 1FDSA 4O59O 4CMGA 1GFSA 2UVDA 1JW9B 2ZJ1A 1KBZA 4FGWA 4NNJA 2EKQA 4KEHA 2O5UA 4MP3A 1Z74A 1FJHA 4PRLA 4R3NA 4AJEA 3AZBA 3GGPA 3T4XA 1QP8A 4CMEC 3AZAA 5ES3A 3NDRA 1QLHA 1LO9A 2HK8A 3PYXA 4CLRA 3U4CA 3I5MA 1R16A 1W6UA 2BGKA 2PGDA 2X86A 3ONEA 2Y99A 1JU9A 4RLSA 3WNQA 4MDHA 1CQJA 1XR3A 3WQSB 4GSKA 1FDUA 5GZ6A 2AW5A 4D44A 4EW6A 1TT5B 4WNBB 4ZRFA 4ZHSA 3NRCA 1LDNA 1EUCA 4QO8A 3HHPA 5TGDA 4E32A 4B8ZA 2CY9A 1NXQA 1KIFA 1N9GA 5TRTA 3NTOA 3BIOA 4AJ2A 2Y1FA 4N18A 3E1KA 1LLCA 4LCJA 1P44A 3OF2A 3SLGA 4D0RA 2P9CA 4RJTA 4AJ1A 1SC0A 3B70A 2PIMA 5T57A 2R00C 3INTA 3ROPA 3GZNB 2PZKA 4MVJA 1E6WA 1YOVA 2YHUA 2Q99A 4ND2A 4PZCA 1DC5A 4EI2A 4XRGA 1XU7A 4DLLA 1UP6A 3MJTA 2NU9A 3PWKA 1CETA 2OOSA 4C4OA 2OKIA 3O38A 3DP3A 3RC1A 2DU8A 4FFPA 1X1EA 4JIGA 4XEHA 2O6BA 3ZWCA 1MLDA 3BMQA 4YAJA 5JY1A 3SJ7A 1NWHA 3DQPA 5JYDA 4Z0HO 1JVBA 3C1OA 1EK6A 1I5RA 1X7HA 2OORA 5JLAA 3F5SA 5HM8A 3QVXA 5IAAA 4HP8A 3CMCO 4YB8A 1DOHA 3PLNA 3OA2A 4E5MA 4WCDA 4RDHA 1E3IA 3DL2A 4JXKA 4H15A 1WMBA 4E4YA 5CAEA 1WDKA 5C7IO 1I10A 2O3SA 3KYDA 4GX5A 1BGVA 4DMLA 1PGOA 2FOIA 1YB4A 3DBRB 3MJEA 3K67A 4RV2B 1PTJA 4KQWA 5TNXA 3DAPA 2GVHA 3ZU2A 4O63O 2VYVA 3U09A 1F0YA 3HG7A 3IJPA 1RKXA 1VL8A 2C2IA 2CVOA 4E21A 2P5UA 2OWNA 2EV9A 3GT0A 3GFGA 4PRKA 2PTGA 1LI4A 1OC4A 3K5PA 3H5NA 5EMHA 4OOEA 5JDCC 5B4UA 3GVHA 4R1SA 4ALMA 2VWHA 3MOGA 4FJ0A 3B20A 1XDWA 2X23A 4L4XA 1JWAB 3G49A 3OJEA 2D2IA 3IC5A 3KG8A 5EO4A 1ENYA 1KVTA 2Y0DA 3EDMA 3ROQA 1VE9A 3QVTA 4WLOA 2B6EA 1YLIA 1G1AA 3WTBA 3WLEA 2O2SA 4CV2A 4ALIA 5KVQA 3QSGA 2VUTA 1LRKA 1SNYA 3DTTA 1YWGO 3U4IA 1Y9AA 2XF8A 1K2WA 3WSWA 3O8QB 4E13A 4E5YA 1LRJA 2X5OA 2P4HX 3R3JA 3FWNA 3P3IA 1KOLA 5K6AC 5HS6A 5IDXA 2BFAA 2ZATA 3WIEA 3NT5A 3OEYA 4ILKA 2NQ8A 3E82A 1SOVA 2Q4EA 4MIYA 5L45A 3M1AA 1IL0A 4E3EA 2VZ8A 2W90A 3DO5A 3FNEA 4HBGA 2OBNA 2F0XA 3UXYA 3AUSA 2GLLA 1NHGA 4CLOB 4ZQGA 4HV4A 2Y1DA 2VZ0A 4LISA 3HDUA 3QP9A 1R4NA 1WMAA 1V3TA 3QVWA 3WX0A 1E0DA 2C20A 3C7AA 1U3WA 1E1MA 1PGQA 3AZ8A 5K9ZA 4DGSA 5J23A 3SC4A 4Q3DA 1SMKA 1GPJA 3AU9A 3FPCA 3JQGA 4NJOA 3LLVA 4Q9NA 3K30A 3EY4A 3QV1A 5GMOA 3HE3A 3JQAD 4XYMA 1Q7CA 4E6PA 3H9JA 5L51A 4FS3A 4TRJA 2YV2A 1GV1A 4OOBA 5CG2A 4XGNA 5IFLA 1OAAA 1UZMA 3WLFA 1H9AA 3BA1A 1C0LA 3WQRA 5KVCA 2X0RA 2VYND 4P22A 1HYEA 2ET6A 1C1DB 3RWBA 2YFQA 1GUYA 4YBVA 4L73A 3K8ZA 4F45A 1DBVO 3WFJA 3C3XA 2HBOA 3EMKA 1LU9A 3LQFA 4M1QA 1YJQA 4BHTA 1B16A 4I1IA 1P1HA 3PIDA 3PHLA 4U8GA 2PD4A 3DBLB 1YQXA 1ULUA 1R6DA 4K9DA 1N7HA 2Y68A 2OZPA 1V35A 4ALKA 1R66A 3WGTA 3DBHB 1U7HA 1DLJA 4ALLA 3GH3A 2BF7A 2BHLA 3DONA 4OKIA 4PZDA 3GPDG 2VTDA 3CINA 3PVZA 4U7WA 2X6TA 2Y05A 2ILTA 4IZHA 3DC2A 2V6FA 3OJFA 4LVCA 4YPOA 3HB5X 4UUNA 3E9NA 4PLHA 5G4LA 4D0SA 5GZ3A 3KM0A 1ZXLA 3JD4A 2D3TA 2J5QA 1Y7UA 4LW8A 3I9MA 3V1YA 3TFQA 3BNVA 3L77A 1P45A 1UR5A 2X22A 3EC7A 2BI7A 1X7DA 5T02A 3GQVA 4NQZA 3INGA 3BTUA 3COSA 4UULA 4M89A 2UAGA 3IR3A 5A5FA 1U3UA 1JAYA 4KMSA 4YT8A 2GR9A 2VNAA 3HDQA 2VKZG 4Y67A 3ZWYA 5HMCA 4O6VA 1YVEI 3K31A 3VHRA 2WM3A 2CDBA 2OIWA 1QORA 4DLAA 1PJLA 5A04A 4QX6A 2POQX 4ITUA 3I1JA 1PJBA 3E18A 5DP1A 1KEUA 3RKUA 3ICPA 2ZYAA 2CVZA 4AVYA 1Q4SA 1ZEJA 4OYRA 3RAJA 3QHAA 1NPDA 4R3WA 4RO0A 3VH4A 4JX8A 1B8PA 2VNSA 3PQDA 1YRLA 4AL4A 1N92A 4CQMD 5JY6A 4II2A 2HMTA 1I36A 1YL7A 4YAGA 4E3ZA 4H4GA 1BW9B 4R4JA 4R16A 4UEKA 3OQ1A 2A4KA 1JAXA 1T2AA 3PQEA 2Y0CA 3JQ9C 4PGFA 2GZ2A 4QSMA 4HFMA 4CR7A 1ZK2A 4XJSA 3GUCA 3DKZA 3AY7A 1QXSA 4MP8A 3PIIA 2DBQA 5TT0A 2BFOA 5BNFA 2X7HA 5H83A 1KEVA 4O1MA 2GLPA 2DC1A 1HRDA 4YTEA 4GKBA 4BIIA 1GR0A 1YJ8A 3D7LA 1WLUA 1DAOA 3GC6A 3ZU5A 1WLVA 2HX5A 3VVCA 4MOBA 4ORDA 2FRDA 1HKUA 3JYNA 3BAZA 1CRWG 1YXMA 1E1KA 4RLJB 1NM5A 1LTHR 1I33A 2XXJA 2VUSA 2O6UA 1VH9A 5EN4A 4GH5A 3S1LA 3A28A 4YAEA 4B0IA 5COBA 4IY1A 1I32A 3CUKA 1HWYA 2E48A 1B2LA 1T26A 1JWBB 3WWZA 2IZ0A 3AZ9A 3R3DA 1XEAA 5B4VA 1EK5A 8ADHA 4MPDA 5KCZA 2DFVA 3KYCB 5AXDA 4Z3KA 1Q2XA 1R0SA 3RJ9A 2E4AA 2VRBA 5DBIA 5A1TA 4RQTA 1HE5A 5H82A 4RF4A 1DHRA 3UAGA 2HMWA 4CM6A 4B4VA 4WJZA 1RYDA 2VT3A 4URFA 3DP1A 2NNLD 3KBOA 4OO3A 2C54A 5DNAA 3ZHYA 5BSFA 4PLPA 4ZRNA 5EGLA 5CDTA 4CL6A 4S3MA 3JYLA 1NQ5A 3JQDA 1MKAA 2X5JO 4R5HA 2EGGA 4IGEA 4EJMA 1GAEO 2D8AA 1MC5A 3NGXA 3TZQA 3AI2A 1Q0LA 1UDAA 3CIFA 1T24A 4A26A 4GAKA 5IF3A 4J4TA 4A0XA 1YS4A 1A4UA 3AI3A 5C3MA 1IPEA 3DOCA 3CK1A 2NU8A 1BTOA 1E7SA 3MJCA 2C59A 3E6AA 4GQAA 3UF0A 3WQQA 2NVUA 3C24A 1LSUA 1SO8A 4J2HA 1K6XA 1WAMA 3F3SA 1YQGA 2FY8A 4CM8B 1F14A 3SEFA 3AY6A 3RSHA 4ZW0A 4ID9A 1HSOA 1UZNA 1HE4A 1WDLA 2HRZA 4J91A 1F8FA 2Q49A 4Z0PA 4BNGA 3ZDFA 1GV0A 4A10A 2ZQZA 1Q6WA 3CSDA 2GNAA 2UV8G 3W8EA 2GN6A 3O03A 2BGMA 4IIUA 4U6QA 3KH8A 1PJ2A 2V6MA 3DFUA 4I9NA 1YL6A 4J16A 1ZW1A 1K0UA 1P1FA 1YKFA 4J3FA 3BHMA 2WD7A 4L4SA 2AQKA 4JN6B 5IZCA 1PGNA 2NADA 4IJKA 2D5AA 4XDZA 5I9LA 4CLHA 3S2FA 2J5RA 4BNKA 2NACA 3EAGA 4XY5A 4RPGA 3FBGA 3G3EA 3JQCA 4CM4A 1N7GA 1JTVA 1UDBA 5JCXA 4G2NA 1TT5A 3DMTA 3MJVA 4GWGA 1C1XA 1J49A 1EDZA 2Y1GA 4IGFA 5AYVA 2TMGA 3GHHA 4J7XA 1H2HA 3AY3A 1KC1A 1A71A 5T5QA 3UCEA 2O3TA 3GRKA 3JYOA 3GR6A 3JQ8B 4WCFA 4PFJA 1HDOA 1BVUA 3AUUA 1LNQA 3AM4A 3HQ4O 4ND1A 4YDRA 5LDHA 4YAKA 2DPHA 1DIHA 1WW8A 1VI8A 3GZNA 5JNLA 2YQ5A 3ZNOA 3P5SA 1UXHA 2Y67A 4IBOA 2VRCD 1ISFA 3JYPA 4OJNA 1LDEA 5F1KA 4ZD6A 3JQBA 4UEOA 5KJ6A 3FPLA 3LBEA 4WPGA 4NR0A 4D46A 3ZCXA 3PFFA 4RORA 1HEUA 1P74A 4JJFA 1KVUA 3H3JA 1NVMB 3LF2A 3G0OA 3LT1A 3TQHA 4NBVA 1ORRA 1R4MA 5BSEA 5U9CA 5BUYA 2LDXA 2VCYA 1U1ZA 4FQ8A 2Z1MA 3UCFA 5CPBA 1I30A 5DDIP 4AJJA 4J4BA 3M2PA 4HZPA 5G4KA 3AFMA 2YQ4A 1N2SA 3H2ZA 1T1SA 2GPTA 3V2HA 3BMOB 1U5AA 3M1LA 1M67A 2ZB7A 5EPOA 4D79A 4GLOA 3GUYA 4ND4A 2VQ3A 4E2XA 2AA3A 4RDIA 4BO2A 4XDYA 3PGJA 4HZOA 2F1KA 5T64A 2D5CA 3E1EA 1DIRA 1HDGO 2J6IA 1X15A 4J1TA 1P33A 3HMJG 3EHEA 1IQ6A 3LK7A 4FFMA 4YWJA 5B4TA 1XQ6A 1KC3A 2H1SA 3LC7O 3D4OA 4BNUA 5A9SB 2R6JA 1NFQA 2DBZA 2OO5A 2FR1A 3JQAA 3R3AA 2PKQO 2IEDA 1MGOA 1YB5A 4XQ9A 3H65A 3MJSA 3GHYA 1YDEA 4YCAA 3TPCA 2IODA 3VPFA 1C3VA 3RKRA 2VYNA 1M6WA 5A06A 3D3EA 3JQ7B 4F3YA 3KETA 5ER9A 3L4SO 2Y1OA 5CDUA 1XKQA 3U4DA 4M87A 4WGGA 1H94A 2FR0A 2NQTA 4L4RA 5DZSA 4BNLA 1ZSVA 3TDKA 4J7UA 1TA4A 3ZHXA 2CDCA 4C7JA 4NBUA 3PHGA 2CMDA 3LT2A 3E9MA 5TC4A 4RL6A 1D4FA 4XQGA 1VPDA 4FW8A 3LT0A 2JD0A 5AXCA 4LK3A 4E33A 2W4QA 1AUPA 1D8AA 1VKOA 3LZ6A 1ZMOA 1BXZA 2NU7A 3CZMA 4QQRA 1VI2A 4L74A 4Z6KA 2NTNA 5FWNA 4GWKA 3STHA 4QDAA 1NAIA 2IZ1A 3C1AA 1D7OA 3CE6A 4IMPA 4S1VA 2CY0A 4U0KA 1C14A 4DWVA 3PFWO 3ANMA 3F1LA 3DZKA 3FNFA 4NG5A 3P2SA 4J43A 5COAA 3TFOA 2JL1A 1BVQA 3H8VA 4D45A 1QYCA 1Y8RA 3GPIA 4QUKA 3R3FA 3R34A 4AJKA 4H7PA 3TZCA 5IJZA 1ZK4A 5DP2A 2DTDA 4IM7A 3OJOA 2H5LA 4B0JA 3OIFA 1XLTA 5IN4A 3KUVA 4R68A 5ICMA 3ZWAA 1JKFA 1T2EA 1NAHA 1O6ZA 1HSZA 3LU1A 4R41A 3TN7A 1QYXA 3WMWA 4D41A 4HUJA 4NU6A 4EYEA 5CPFA 3JV7A 2NLOA 3PJFA 4CMAA 4A03A 3JD3A 1Q7GA 2B69A 4ZICA 4BS9A 3TZ6A 1KY4A 2X0IA 3JQEA 2QX7A 3CH6A 5IDYA 4R54A 3Q2IA 5DBGA 3TOXA 2PZMA 3L4BC 2EEZA 4WE3A 3T7CA 4AG3A 3L0DA 1LC0A 3GLQA 3PZRA 3HDYA 1U1IA 4CQMA 1AHHA 3QE3A 1WNTA 3X2FA 2IDZA 2HMUA 3IKVA 4JLWA 4BKQA 3HADA 4I8XA 1UH5A 2GD1O 2X9GA 2VWGA 1LJ8A 2P2SA 1Y8QA 5DCYA 3VZQA 1ISIA 2AQ8A 4BKOA 4BO9A 1XCBA 4DIOA 2FSVA 3LBBA 2OP0A 3FR8A 2CWZA 2B4TO 2E82A 3TOZA 3UOGA 1PZFA 3W4KA 3PJGA 1JKIA 1UAGA 3VTFA 5JXWA 3C1TA 1QKIA 3AUAA 3BMCB 4FPXA 3H7AA 3ADPA 4G5HA 5JMWA 3W8FA 4R51A 1ENOA 1MFZA 2WE8A 3PJEA 2WWRA 3X2EA 2PWZA 3UFXA 2YW9A 3ASUA 1I3MA 4FOOA 3IP1A 4Y9DA 1IYZA 5EIOA 1WZEA 3A14A 4TKMA 2AMFA 1DFGA 5I8ZA 1SH8A 5L7YA 5HWFA 5EESA 2BI0A 4Y6SA 3PK0A 1NVTA 4FR5A 5JYEA 1AXEA 1VL0A 1LLDA 2PRXA 3BXXA 4YJHA 4N5LA 1UAYA 2ZKLA 3GY0A 4KUHA 4HWKA 4NFHA 1RM5A 1VC2A 3WGYA 3ZV4A 4FD3A 3UGKA 2AQHA 1E7YA 4H16A 5KIAA 4GX1A 4D7AA 4EJ6A 5G0SA 4Q39A 1J4AA 2IXAA 2B35A 1CIVA 4IJWA 5IN5A 2GF2A 1YBAA 2OP1A 2I3AA 4CPDA 5EGKA 3WGIA 4FFNA 3QIVA 4MO2A 4GPD1 3EGOA 3S8MA 5B1YA 3BMNB 5JCJA 5KJ1A 4HFJA 1ZFNA 3KEQA 3S2IA 2O3QA 1UZLA 3IMFA 3E5MA 2HJSA 4RVSA 4IZIA 1GU7A 4DYVA 3RUIA 5EP5A 1DLIA 4WK6A 2UUOA 2W2KA 1CYDA 3K6JA 3QVSA 4Q3EA 2XAAA 2RHRA 1VM6A 4TQGA 5L4SA 4WNCA 3WYEA 1NYTA 1NTOA 1BXGB 2RH8A 2OHXA 4JP3A 4GL4A 4BNVA 4YXFA 4OQYA 3ROMA 5BSHA 1O8CA 2QIOA 3ENKA 3MWDB 1DIBA 2QHXA 4YRDA 2BELA 4CMIA 1WN3A 2C5EA 3H9GA 1U2DA 2Z5LA 3ZW9A 5CFZA 1Q4TA 5JC8A 3GVXA 4LN1A 2HRBA 4Q3NA 4WLEA 7MDHA 5JAMA 2EGIA 3FBTA 3VDRA 3I3OA 5KKCA 1F06A 2GUGA 1Q0QA 3D3WA 4KOAA 4W9NC 4XKJA 5DULA 4AICA 5BT9A 4E5NA 4JK3A 3MZ0A 4DBVO 4EEXA 9LDBA 5EQFA 1B14A 2W2LD 5DCUA 1DRVA 5SZZA 2X8LA 4WNIA 5MGBA 1T2CA 5FF9A 3CZRA 4RCVA 5A3JA 3TSCA 2HO5A 1SEPA 1PIWA 1LLUA 3ESIA 3L6DA 5TSDA 1B3BA 4B79A 1FDWA 2BD0A 1ADCA 1PN2A 2YJZA 4IDEA 4AJIA 4CUKA 5L4LA 4RVFA 3ITDA 1EMDA 2HKIA 3ZWOA 3H5RA 4RLTA 3FTNA 4LSMA 4M20A 5B12A 5TS3A 1XELA 1U4SA 2VHZA 3ZNNA 1LDGA 4TRNA 3IIEA 5JE8A 1OMOA 2ZYDA 5TT1A 2PLAA 5IXSA 2H4UA 4PN3A 2VRCA 4DIBA 4E2ZA 2WTBA 1QRRA 4BGIA 3C8MA 5THQA 3WIDA 6LDHA 4WLFA 2C7GA 4RLUB 2VHVA 1U8XX 3ZNPA 2G1UA 3I9LA 3VVBA 1TEHA 5I7VA 1QYVA 1F17A 3DAFA 4CV1A 3D04A 2IYOA 3NTQA 4Z9YA 2NVBA 1MFPA 4DREA 4J0EA 3ZZNA 3NWZA 1PGPA 5FYDA 3VOSA 2Q2QA 1E3EA 1R15A 4ZQEA 2BGLA 4CR8A 4RPLA 1D3AA 1ZKIA 1J6UA 3DWFA 4QFDA 2CF5A 1CEQA 4ONEA 1BMDA 1U2GA 4IPTA 4U5QA 4HX5A 1O94A 3BYZA 3KV8A 4PLGA 2BFPA 5EINA 5G0VA 2I3GA 4IS3A 4XGKA 3IS3A 5A03A 5T8KA 1ZH8A 2XFLA 3JTMA 1KVQA 1R0LA 3HFSA 1HLDA 4OAQA 1WVGA 4YJFB 3P2YA 3I4CA 3S55A 4FN4A 3ULKA 4WEOA 2OFPA 2Q1WA 3VZPA 4FFOA 4GI2A 5DOZA 4R9RA 4YT4A 5BUXA 4MVJM 3VKUA 1EZ4A 1LO8A 4FB5A 1AN9A 1M76A 5BNIA 1HDCA 3ZV5A 4K4CA 1Y7TA 4XCVA 2O3UA 4ZA2A 2VUUA 1ISMA 4BNMA 1RYEA 1Z7BA 2P4QA 3HDHA 3AK4A 3VC7A 5C37A 3A1NA 3HNPA 3N74A 2V6GA 5JDIA 3SXPA 2O48X 3H9UA 3I52A 3ZWMA 3LC1O 2ZB4A 3K73O 3V5NA 3DZBA 4A73A 3RFXA 3R87A 1HDRA 4FSHA 2VWPA 4W7HA 1CQIA 4CQLA 2D1YA 2JKVA 3VAZA 1I3KA 3NX4A 2UDPA 5F3RA 3KHPA 3AOEA 2DBRA 1ISGA 3WG9A 4ZJUA 3BHIA 1DSSG 3ANLA 2C5AA 2A9FA 3OBBA 4XYBA 1IB6A 1EVZA 2B83A 1EVYA 3W1VA 4M49A 1RM3A 3RBVA 5I8WA 3ZWPA 4XQCA 1E1NA 4WCFC 1I2ZA 3SC6A 3WDSA 1ZEMA 4MOCA 3R0IA 4R69A 2DLDA 2Q3EA 4KDFA 4B0CA 3GN1A 4FFLA 5HWSA 4K6CA 3U0BA 1Z6BA 3ZU3A 5A9SA 3B1FA 2Y1CA 4OQZA 3RI3A 4I5FA 5F5LA 1ISJA 2JHFA 1PSUA 2Y93A 3F9IA 4W99A 3K96A 3SJUA 4XA8A 4BB5A 3AM3A 2ZB3A 2QZ9A 3RVDA 4INAA 4HKTA 1IZ0A 1TB4A 3B1KA 1L1FA 2PGLA 1WWKA 4FOSA 3VPGA 3TZKA 4XY6A 5COQA 2QQ5A 2R00A 5HZ4A 1QSGA 1GYPA 1H0KA 2HCTA 3FNGA 3ORFA 1H5QA 1TVEA 4GX0A 1Y1PA 1Z82A 1MX3A 2GLXA 3AJRA 3JD1A 3FTPA 1QMGA 4I82A 1LUAA 5AOVA 1M6HA 3WR5A 3JQFA 4BB6A 3NDIA 4PVCA 1P9LA 4E5PA 5JSFA 1KYQA 2FMUA 3I23A 4XJTA 1HTBA 4BGEA 5BR7A 5DF1A 2QZZA 4GVLA 3ROKA 5L7TA 1NX6A 1KEWA 5FEUA 3PI7A 3VTZA 1ZJZA 3D4NA 5F1PA 2PD3A 1LSSA 4B4WA 3IP3A 4JBIA 3U3XA 3KV7A 1PR9A 1HDYA 4OGWA 3NJ4A 1QG6A 3H5AA 1J5PA 1U3TA 5CDSA 4I08A 4UVIA 3WFIA 1EFKA 3K2BA 4Y98A 3OQBA 1PWXA 3F1KA 3Q9NA 4BGUA 3LVFO 4EZBA 3QOOA 5BNTA 4A27A 1NNUA 1A9YA 2HJRA 1N9GB 1FMCA 4PLCA 4DQXA 1YBVA 3L9WA 4GX2A 3FI9A 1O95A 3RU7A 4ZRBA 4OXNA 3CKYA 3RU9A 9LDTA 2SCUA 4A12A 1OFGA 3JD0A 4O5OA 5JDCA 5CDGA 1K3TA 4B7UA 4E2YA 4MIEA 2ZK7A 3OP4A 4FFRA 2NUJA 1YOVB 1PR3A 1H9BA 1B26A 2FPGA 1H6DA 5C7LO 1Z7EA 3KSUA 3SX2A 2RH4A 4B7XA 5ICSA 2NV6A 3DZIA 2Y0EA 4G65A 4BNJA 3VPSA 1P3DA 5EGJA 3FCOA 3B7KA 3NGLA 5JCJD 3LZ7A 4BO6A 5LC1A 1QV7A 1VJTA 4BQRA 1VRWA 3TEAA 4A0YA 2PY6A 3P19A 2VN8A 1Q7BA 2QRKA 2W8ZA 4AFNA 5K6AA 1E6UA 4LMRA 1MXFA 2P91A 4I45A 3BTOA 5KOIA 4M54A 2OMEA 4RPKA 3W6UA 4DQUA 1HYGA 1Z6ZA 4QTZA 4CUZA 1NFFA 1YONA 1A5ZA 1IHXA 3GZ4A 2FP4A 4JCOA 1NQOA 5AXBA 4A0SA 1O9BA 4FC6A 1ZHGA 3UN1A 2E6UX 3Q11A 3KOUA 1W0CA 4IENA 1ARZA 1YBMA 1TBUA 3ITKA 1NQAO 3KYDB 1E7QA 4J90A 3DZFA 4MVJI 2Q2VA 2I6TA 1U3VA 3I9JA 3GOHA 3NAQA 2PD6A 3IL2A 1DPGA 3NTRA 3RC2A 4EUFA 1XG5A 5HRUA 1PZHA 1EE9A 3BTSA 2YZ7A 4YJGA 2A94A 1Z73A 1B7GO 3U49A 2EWMA 4MVJG 2QYTA 4RGBA 3CMMA 4W78A 1I3NA 1S7CA 3ON5A 3RUFA 3CXRA 4PG4A 3IQDB 2PZHA 3WWYA 2OV9A 2ZTVA 5CEEA 2YUTA 5L9AA 2Y66A 1QYWA 1U7TA 4TRRA 3RC7A 2CZCA 3PHJA 3Q3CA 4CM7A 2GYYA 4NK5A 4W7IA 4KWIA 3DOZA 2G0TA 1YL5A 1T4DA 1GEEA 2GRAA 2IYPA 4NBWA 4OHUA 4BNTA 3T7EA 3AUTA 3TRIA 2BI8A 5JC1A 3ZWBA 3OH8A 2DT5A 4QT0A 3WBBA 4JJGA 4BMSA 4K1LA 3PJDA 2I9PA 2R2GA 1XA0A 4JNKA 1NJKA 1WZIA 2W2LA 3GA0A 4H3VA 4Y8VA 4WNBA 4DVJA 4GGPA 4HNHA 5ENDA 1D1TA 5IDWA 3EW7A 4WLUA 1WM6A 1DRUA 1NBOA 3PWZA 2GLVA 4XR9A 3E48A 2Q78A 3OETA 3R37A 3L6EA 2IRWA 1E7WA 3UW3A 3E9QA 1I24A 2RHCA 4QFCA 5HA5A 2EW2A 1ZSNA 3U4HA 2O6TA 2GO1A 4CMBA 4BO8A 1ML3A 3KO8A 1JDJA 1PJ4A 4TWRA 4L9RA 2Q2BA 3DP2A 2Q50A 4PLFA 4DRYA 2ZTLA 4C7KA 1V0JA 2GCGA 1YDWA 3WMXA 1BXGA 2IXBA 4OIMA 3GEGA 1HETA 2NTJA 1BG6A 3UCXA 2HSDA 2WEKA 4RVUA 1GPDG 1UXGA 3Q6IA 2PK3A 1P0CA 3PQFA 2Q1UA 4MTUA 1D1SA 3AI1A 3JQGB 5KKAA 4E12A 4PLTA 1NWCA 4HY3A 3WEWA 1DFIA 2Q1SA 3OIGA 1S6YA 3TWOA 1LDBA 4QDBA 2C82A 3BJKA 4R1UA 1VSUA 1A9ZA 3K9QO 2YDXA 2OAFA 1TI7A 4YRBA 1QV6A 5JO0A 3LT4A 1SOWA 3LC2O 3I6QA 4A0ZA 4XX0A 3TJRA 4JP2A 1HE3A 3RQSA 1IZ9A 3F4BA 3ETDA 3GDOA 5KL9A 4NJMB 3G1TA 4WOJA 2B36A 3DBRA 4I4JA 2D4AA 3NT2A 4IUYA 4RV2A 5DT9A 3WGZA 4EDFA 1R12A 5A5EA 1Q1NA 3QRWA 5I7FA 2YHIB 3LF1A 4J2OA 4RLWB 3F5OA 3H3FA 4PLVA 2A92A 4N7RA 2X0NA 4FJ2A 1YQDA 1ZK1A 4Y6PA 3LWGA 5F6RA 1LLQA 4IJUA 3WGOA 4L8VA 3ZWVA 3ICCA 4YT5A 3W8DA 4BNZA 5B37A 4W4TA 1HXHA 2Z1NA 3QJ5A 4EEZA 5I7EA 1LBEA 1U4OA 1M75A 1L7EA 3JQ9A 1ZCJA 3RFVA 3F6YA 1JLLA 1EBUA 3ED0A 7ADHA 3HWRA 3U62A 3KHUA 1YE3A 2VTEA 3ZI0A 5JS6A 5T07A 3HDJA 1EUZA 4NMHA 4AJLA 3O8QA 2W98A 3H6KA 5EO2A 1GYRA 4CODB 4EUEA 3R3SA 5TIIA 1O5IA 4YJDA 3JCZA 3PEFA 4MVJH 4KUEA 4YRAA 1P1IA 2XXBA 4ZU3A 3ZHBA 2WYUA 1ONNA 4ZJBA 4I5EA 3QWFA 4IDBA 5ITWA 1DIGA 2X4GA 2LDBA 2QW8A 2AE2A 1V8BA 1XGKA 2G82A 3H2SA 4GVXA 4IQGA 4XR4A 1GEGA 3RUCA 3ZGYA 4ROSA 4Q3BA 1RJWA 1T25A 3M2TA 4QD8A 1HYHA 1P1RA 4IINA 3EZLA 4AJ4A 4XYEA 4CLOA 4BNIA 3PRJA 3GVPA 3DOYA 4MJLA 4UAGA 3FWZA 2EERA 2WE7A 5KTKA 2OKHA 3FSRA 2P5YA 1T4BA 2VHYA 2EGHA 5L4NA 3ZWXA 3I83A 4B3JA 2Q45A 5CPGA 1B8UA 3ZV6A 1ID1A 2PNFA 3QW2A 1PQPA 3NDJA 1LO7A 1PZGA 2QRJA 1K6IA 2B3MA 3RC9A 5JW6A 2YFHA 1HDZA 4R5MA 3KRTA 2DAPA 2PZLA 1M2WA 1J1YA 2ZTMA 3OMLA 3EVTA 2YV1A 3GDFA 4TROA 2CDAA 3NJ8A 4M8SA 1V3UA 1KS9A 1T2FA 1IUKA 2FS2A 1MKBA 2QWZA 2C29D 1HT0A 2DTEA 2ZJ0A 5JPIA 2WD8A 5DOVA 4MVJF 3KW1A 3Q1LA 2F00A 4NCPA 3D4PA 3HB4X 3KVUA 5JO9A 2GZ1A 1C1DA 4PG8A 3MOIA 1E3SA 3O9ZA 3KZVA 4JQCA 3QWHA 1W4ZA 4GAEA 5KJFA 1MB4A 5JFOA 3TL2A 1OBFO 3RASA 5BQFA 4UVGA 1KY5A 4TZKA 2ESSA 2EP7A 1YO6A 2OXIA 3VH1A 4YBZA 4F6CA 5G0WA 3O4RA 3DBLA 3FR7A 2AEMA 3PYLA 4TMFA 1PL8A 1Q0HA 3GG2A 3GEKA 1SC6A 3DBHA 4IQ0A 1U28A 3GNTA 1LQUA 1H93A 1GL3A 1PJSA 2TMDA 6ADHA 1A7KA 2AHRA 3DXFA 1ZKMA 2PKQP 3PXXA 4ZVVA 2ZYGA 4HFRA 3E03A 1U9JA 1ZJYA 3E8XA 5SZVA 1AXGA 4MZQA 1WLYA 1XWFA 1Z45A 4BO7A 5C7OO 3K92A 4KDEA 4J1QA 1EUDA 2RBEA 4B4OA 4DPKA 1U8FO 3OECA 3SVTA 4FDAA 1XQ1A 3QWBA 1SBKA 3RUAA 5IXYA 1MP0A 2CFCA 2JFHA 4ZGWA 1CERA 1GCUA 3GEMA 3SPSA 2ZCUA 4IXTA 5FI3A 5LDGA 4K02A 3ETGA 1WP4A 4D43A 1GD1O 2DSLA 3VKVA 4YYZA 3NKLA 3I4FA 1AGNA 1E5QA 4K4AA 3S2GA 5A02A 3GVIA 1I2BA 4NU5A 4RMMA 2BFMA 4GMGA 4IMRA 1UXJA 4NBTA 4TSKA 1EVJA 1MV8A 1HL3A 1EBFA 1MXHA 3MCVA 3OQ6A 5CEFA 1NPTO 2B5VA 3NV9A 3GAFA 1E7RA 1HF3A 2GSDA 5DIOA 3DTYA 4PVDA 1TXGA 1ADGA 5L3ZA 4XIYA 3KVOA 3EUWA 5HTOA 2GN9A 1XYGA 4DXHA 1SCUA 2VHWA 3VH3A 2AXQA 1K5HA 2HMSA 4IDFA 4BNHA 2PV7A 3AOEC 5TX7A 4MKXA 1BW9A 1I01A 2C7VA 3V2GA 3S4KA 3UVEA 1C0KA 2HU2A 3I9KA 4M55A 2WD7B 1ZSYA 4KUGA 2HDHA 2O7QA 1EEHA 2EW8A 1TT7A 2I67A 3D1LA 4K26A 4E31A 4UVHA 3HM0A 3ONFA 2VZ9A 4K4DA 4ZRMA 1H6CA 4BKRA 1B3RA 2OBYA 4II3A 1E3WB 5CDYA 4CM4B 2QRLA 1Y81A 1CF2O 3ANNA 4RLJA 3GAZA 5KVVA 1VJ0A 3HSKA 4AJPA 4QEDA 1C1XB 1IY8A 1V6AA 4YQYA 4TKLA 4HZNA 2NSDA 2JD1A 3L07A 4OH1A 2DVMA 3KLPX 4MKRA 4DQVA 2PFGA 4BV9A 1NASA 3KYCA 2J3IA 1VH5A 4WCFB 1Q4UA 3GG9A 4QO7A 3LDHA 1BWSA 3DZJA 2FSSA 4OOFA 4XGIA 3U5TA 4BNYA 4AJNA 3S2EA 1RPNA 2O50A 5ER6A 4KTTE 4XWYA 4P4LA 1MA0A 3MWEB 5FI5A 2UV8A 4JJIA 1IPFA 1E3JA 2CSUA 3DAGA 4UEJA 4AJOA 3H4VA 3JQFC 2HMVA 5JMPA 3OFSA 4BOYA 5ILOA 3A4VA 4BNXA 4YVFA 2V1OA 2JJYA 2V65A 3HZZA 4BVAA 5CEJA 2AG5A 1SEVA 2HQ1A 2Y1EA 3KX8A 2Q46A 2GZ3A 3DFZA 3FF4A 3DR3A 4XYLA 1ULSA 2P9GA 2X1HA 1R4MB 1ZXBA 3QY3A 4PCVA 5SZYA 1VL6A 3RJ5A 3OSUA 3Q2KA
chains in the Genus database with same CATH superfamily
4BCBA 1JA9A 4A6DA 2ZZKA 2MYTA 5H0IA 2FXVA 5TQJA 4HNGA 3CIOA 4Z49A 1SD5A 1D03A 1RM0A 5EVJA 4C22A 2JRCA 5JSHA 2HF8A 5A2GA 2HSGA 1XKTA 4YXWD 3K09A 5HKKA 3ERCA 4NFYA 1C9KA 2EF1A 1YGYA 1RWMA 1Y5LA 1MAVA 3KKPA 3TW0A 5G1NA 4IDAA 1W1WA 2NWQA 3EAQA 3K9WA 4N5NA 2BFWA 4J7CA 2VDLB 4RZIA 3U9SA 4WV3A 4ND5A 3E4DA 1UOOA 1X13A 4FNGA 1ODKA 1U6KA 4OK6A 3OIUA 4GR5A 1GQRA 1JDUA 4FX2A 4JBGA 1W8DA 1WKVA 5CHEA 3P7MA 1L5QA 3B52X 1M73E 3EOBI 2AMYA 4L50A 3T12A 1TRKA 2AD5A 3KL2A 2H0RA 2H3EA 1UXKA 3UO8B 1S2DA 2EKLA 4P7GA 4PPFA 1W48A 2WTUA 3HUDA 4JJKA 1QHHA 5KREA 4LXTA 3CVOA 2O8EA 2BUAA 5F21A 1W44A 4ND3A 3KXKA 4OMUA 1SXQA 1P7VA 3LHSA 3RSGA 3FHOA 2C5SA 1WXDA 4B3TB 1CRQA 4PX2A 2H8KA 2JGJA 2RHGB 2QU8A 5A6BA 3ADIA 1PEDA 4CM1A 3AP1A 4MIOA 4TV9A 4NCNA 3GX1A 1YRHA 1HDEA 2HSJA 4XW2A 4JEMA 1VSVA 1SCDA 3OWOA 3D6XA 2W2KB 1R1DA 4Z0NA 2J67A 2GLMA 3DBVO 3LG2A 5K0GA 1XVLA 2G72A 5BWMA 4MVJP 1Q5PA 3UKOA 3LP5A 4CMIB 2PMDA 4BQIA 1EP1B 1EJ6A 3DV2A 1QRAA 1RNLA 4O0LA 4RU1A 2VQEB 1B0ZA 1N5DA 1DXHA 4XIJA 1FNCA 2A35A 4MW5A 2IV2X 2AZDA 4AY6A 1KIAA 2O59A 2DQSA 1R5JA 2A30A 4P4GA 3UAYA 1ZN2A 1V37A 4GI5A 1XJ0A 3DE1X 1T36A 1Z16A 2P4SA 2CWDA 3LLHA 2HUNA 1J1ZA 1FRNA 3WBFA 3QJGA 3IEKA 5J59A 2WIJA 1RXIA 1NSFA 1UBNA 2DFDA 2XEMA 3RBZA 3K0BA 4H6PA 1HQYE 5IJ0A 1WMSA 3RVQA 3HY4A 3LWDA 1BVYF 2ZIWB 3PCXA 1CNMA 4UUPA 5D3MB 1GZUA 1RABA 1P47A 3CZCA 5C8YA 2KMLA 3O4VA 1IUNA 1T5DX 1ENZA 2VLBA 4XCXA 3MWEA 1IOWA 4S05A 3TF5A 3HCWA 4YXWA 3UMMA 2NVWA 2YNMC 2B5WA 3E3LA 2D59A 4C3VA 3GJSA 3A06A 1GYQA 5CNKA 2WWWA 1CQIB 5I4BA 1PDWA 3DKVA 4C0KA 6CHYA 3TZHA 3FAZA 2O3RA 3AKEA 3V1UA 3QX3A 3OJ0A 4L95C 3OHSX 3AVYA 4A7PA 3SF0A 2HB6A 2MT9A 5EJ9A 4KODA 1MOSA 5KNDD 3FY4A 3ES9A 5CLJA 3GJZA 2YL2A 4ZCSA 1MAWA 2IP1A 4OQQA 3ODPA 4DUGD 4CR6A 4QGAA 1ZCFA 4DV1B 3JVEA 3EMBA 4TN1A 1U1CA 3JPYA 3LI2A 5M7EA 2JHGA 3TXXA 3D54D 4YDHB 1E96A 3A6ZA 1N5RA 3OQMA 1A77A 4K3VA 3RF7A 1CZKA 2HZBA 5HUHA 1H0HA 4HTFA 4LX0A 4OXKA 4IJVA 1BZYA 2ZJBA 1E6EA 2DQYA 1L4MA 4IQ8A 3KPYA 5D7NA 3O4JA 1XJ5A 4AE7A 4FBGA 1ZRHA 1FU7A 3LKBA 3CVVA 1RM4A 1RQNA 1WHNA 1PWZA 1OOEA 1YAJA 4L9AA 4RV5A 1T9DA 1YHYA 3RYCB 2FVYA 4UVEA 3RT9A 4ARAA 2FEAA 2V1UA 5I7OA 4G89A 5FHRA 2QTBA 2EOIA 1CJCA 3A9CA 1Z5PA 3NUGA 3DNFA 3H4MA 2UVDA 2VCEA 1GPBA 5KWJA 4ATNA 1QGUA 5AW1A 3W2EA 1U1FA 3KWLA 4MS4B 4J75A 2AW5A 2I3DA 3KQOA 2ZRBA 2PZEA 1MTZA 4RHYA 5DTRA 3KXLA 1Z13A 2NO9A 2PLWA 4HDNA 2EOSA 3OF2A 2HK6A 3ZJ4A 3FB1A 1HYQA 1USIA 2PQMA 4S1NA 4QXAA 4EI2A 4QRIA 3ESRA 2DT8A 2ONJA 4PC6A 4Z0HO 1EFVB 2F43A 4M6WA 1AN0A 3TUZC 2ODRD 4AG5A 4CG0A 5D85A 3DAPA 2QN6A 4O63O 2VK4A 1S1CA 3PUHA 1VRCA 3IP6A 2ZVQX 2YTQA 3GGJA 5B4UA 3UIEA 4MUFA 3GWGA 3K9GA 3B20A 3IC5A 1QQBA 3QVTA 3SU8A 2CSHA 1T2NA 4D97A 3U4IA 1NXTA 4JB8A 1RAGA 2ZJAA 1FW6A 4ARBA 2ZATA 3A2MA 4BEBA 3NT5A 4C89A 3DAHA 2Q4EA 2XBUA 4KN6A 4OYHA 1TQ4A 5IULC 1QG4A 3HCAA 1E0DA 1U0BB 1U98A 1JR2A 3EEQA 4Q3DA 1GPJA 4Y6GB 3AKYA 3EWIA 3K30A 2I34A 4PM4A 3JQAD 2O5VA 1OAAA 4PCAA 1PV4A 4IICA 5L6LB 4MRPA 5KNDA 4PYKA 2YRXA 3EISA 1PT6A 2HPHA 3GXOA 4CI9A 4DUGA 2QL5A 3O8DA 1FRQA 4ZOLA 3NOXA 3UB3A 4BN0A 1XMQB 3T3EA 1T5OA 1OFUA 3KM0A 4OYLA 2FMIA 1JPNA 2BGGA 2N1MA 1PJAA 1SVNA 4ZWNA 4HH3C 1JAYA 2YVQA 3AUFA 1EI9A 1PJLA 4PC3A 3OJXA 3ZHVA 5DP1A 2IS4A 2O8NA 1X1CA 5AM4A 4B73A 5B2ZA 4Z9BA 1P2UA 4N6NA 1CYEA 4II2A 3HBNA 2X76A 2J9FB 1JAXA 3EJ6A 1ZK2A 1SVKA 1TJ5A 4UQOA 4WZBB 2E5LB 2G9VA 1PK8A 1W49A 3ANYB 2AW3A 1WPRA 4ORDA 1R0WA 4YV0A 4V2IA 4AM8A 4NV1A 4MITA 3WFZA 4MW2A 1E2BA 4N6OA 4X84A 3L43A 2E4AA 1QIIA 4B4VA 2VJMB 3D6UA 1D6NA 3JVIA 1MR3F 1EHIA 2WFLA 2D8AA 1UDAA 1EAYA 2PRJA 3GELA 3WAGA 3ZK7A 2P8SA 4O08A 1LSUA 2F4NA 3SEFA 1XRNA 3UM9A 4F3NA 2QSJA 2A2ZA 4GKKE 4ASUA 4J91A 4BNGA 3MUNA 3ZX5A 4QVIA 3L7OA 5TQ0A 5DTEA 4JN6B 4WVLA 3R3WA 3TQFA 3LDUA 1PRYA 4F5YA 3RRXA 1IY2A 4JLUA 2AUTA 5DLDA 3EXAA 3X1KA 1CZRA 1UDBA 2YTIA 4NXMB 3JTEA 3MJVA 3C70A 2VQFE 4L5NC 5DYIA 2HCBA 2BJVA 3G8YA 3QEAZ 2EDAA 3AUUA 2FG5A 3CPEA 3HQ4O 2QR3A 1TECE 3PR1A 4IDOA 4A0GA 4O1IA 2UUAB 3RT7A 2IYSA 4H1VA 4K7JA 4KE7A 3ZPXA 2ZZNA 3TQHA 1GSAA 2JIDA 1R4MA 1F6BA 1EWVA 1HNWB 2Y4OA 4FQ8A 4UOQA 4YCDA 4ZO8A 1T1SA 4JT4A 3K1TA 2OCIA 4GZNC 4RA9B 4M9SA 3R75A 3S2SA 1V9SA 3MTDA 4L57A 4TLEA 4HDRA 1JDPA 1SRQA 5AM2A 3JQAA 3FFXA 4WN3A 3ZDXB 2C88A 3MJSA 4YCAA 3M4JA 3U4DA 4KYTA 3OKCA 2F4VE 1ZSVA 4N3CA 1L1QA 2IKQA 2C5GA 4N6GA 5FEMA 3LT0A 2CV0A 1RWPA 1EKZA 5KB3A 3LZ6A 1DBRA 3P9SA 4EX6A 4HQ6A 5AI5A 5TXGA 2BTEA 1ATZA 4A23A 4C01A 3F1LA 5HCIA 5EMLA 2HM7A 2QMHA 4BJ3A 1YJXA 3JV7A 1PT5A 1QGED 4URZR 5SYNA 3KKKA 1QQ5A 1PSWA 3BK1A 4HN9A 5AJUA 2VWGA 4P3OA 3WLRA 1ISIA 3BH0A 3TOZA 4UNQA 1OXXK 4DLKA 3I1IA 3Q72A 1B0UA 2IU0A 2ZJOA 1ADYA 4Y9DA 5I8ZA 1SH8A 1VLHA 2H4FA 4EMSA 2XZTA 2DXIA 3WGYA 2B92A 2JGFA 5CJPA 5B1DA 3N0TA 2IT1A 4ZTUB 2OBBA 3ZBTA 4NWIA 2EX1A 2F9FA 2GNPA 1CDDA 1Z39A 4JBYA 2XUDA 2XDWA 3EGOA 4HB3A 3UWPA 3MCUA 4D8XA 3STTA 1GU7A 3ND8A 3QTLA 1SH7A 3QVSA 3S1AA 1GTJ1 2RHRA 1AJEA 3WYEA 4REMA 2GBFA 5FOQA 4CIYA 1OT3A 1GWNA 3AR5A 1N2GA 1UKVY 3M3PA 2OZVA 3HXQA 3QX8A 3IDOA 3GP5A 3PRHA 4F8YA 5CFZA 3HXPA 3VDRA 4UQPA 5ULLA 3UG7A 5B7NA 3REOA 4E5NA 4EEXA 4RTPA 5C35A 1K68A 2ATEA 1S9HA 3ZZMA 4EYSA 3DR5A 3ZDBA 4EHNA 2XUIA 1LLUA 2FX2A 3KFLA 3VR2D 2JVKA 4B79A 2WQZA 4KV9A 1IJBA 5AFSA 1NLZA 1XZJA 2HKIA 5FPSA 4Q9JA 1FMFA 1XELA 2OPHA 1P4RA 5AKYA 2EZ6A 1S2OA 3NAMA 4CTNA 3FLEA 1UMCB 6LDHA 2QY6A 3WYAA 4HSGA 2EM5A 1JFVA 1QYVA 2O9JA 3NTQA 1KDVA 2F1HA 1QIKA 1DQYA 3EUAA 1JG6A 1E2MA 4CR8A 1D3AA 2OBXA 4JS0A 4U5QA 4RM2A 2X2PA 3CNLA 1KJ8A 4DWWA 3NEYA 3JTMA 2CTDA 4LE0A 4FMPA 1MQ9A 4KC0A 3VZPA 3CA8A 4EGSA 1RYEA 3HDHA 2IUUA 3IMKA 5JDIA 3EG9A 3SXPA 4HDOB 3BJIC 1T43A 3S99A 1QZUA 2O1SA 3A6KA 4RK5A 2JCGA 2DBRA 2C3PA 3TCKA 1LPPA 2JNWA 3LVBA 1S8FA 1DAFA 1GZ7A 4PO3X 3RBVA 2TECE 4RM3A 1XCPA 1A76A 4KNVA 4B0CA 3W05A 5A9SA 1ZVJA 3E7WA 3VX4A 3C6MA 4QPCA 3CW9A 2PGLA 3ER6A 3O90A 2YOGA 4XOIA 1LUAA 1V4VA 1P9LA 3FMPB 3M6AA 4V3BA 4BGEA 4IIDA 1V95A 4HN4B 1F5NA 1GGFA 1G20B 5K6TA 4LI0A 3QMMA 3WFIA 3L92A 3KC2A 3K2BA 3FHJA 3MS4A 3B1ZA 5CFRA 1N9GB 3B9RA 1ESZA 2SCUA 3OU6A 5CX1A 3O8CA 1K8RA 2AX3A 4D8WA 1EX9A 1H6DA 4G1CA 3I2GA 4BO6A 4CEIB 4AMVA 1Q7BA 3GEEA 3G68A 2OHGA 2ODAA 3W6UA 4DQUA 2IZ7A 1HRKA 4PSAA 3U26A 1XDZA 4JI5E 2BE9A 3KSBC 1T4NA 4J90A 2RJ3A 8OHMA 4TLCA 1YJAA 1KMMA 1WRJA 1Z73A 1PV1A 1N9ZA 2PANA 3IUEA 4TRRA 4D9MA 4OHUA 4FKMA 5JC1A 4ZEMA 2HYDA 2QTGA 5DM60 2NA2A 1E8NA 4HNAA 4DVJA 5EFZA 1LBSA 2CBZA 4IOJA 4D6YA 2WHRA 3UBTA 2P6RA 3FWYA 4N0DA 3OQPA 3HGQA 1AMOA 5EHNA 3CKKA 3VR2A 4PLFA 3GJRA 2BGWA 2QRGA 1BYUA 3EF3A 2QN9A 3BMXA 2B7CA 3E9RA 4M9UA 1IM5A 1D1SA 4H17A 4GXQA 5B57C 2WHPA 1ZLYA 1A9ZA 4QDOA 4RK0A 2MSLA 4MICA 3IOMA 4PTYA 1XZDA 1HE1C 3DBRA 3WGZA 1M6VA 3SJCA 7REQA 1HV8A 3QRWA 5I7FA 1FUYB 4NARA 1JAZA 3FYTA 2FV8A 3A1UA 3ZIUA 3B12A 4Y6PA 1R9JA 1H85A 3F6YA 1YE3A 1FSZA 2QXUA 2VHTA 2VZEA 1U11A 4YRAA 4JKOA 1T0BA 3H2SA 1RPZA 3M2TA 4QD8A 2J0UB 2XR1A 4PBRA 5HRCA 2ZRDA 2EERA 5IVKA 2NN3C 2EGHA 5AVRA 1SPBS 2YJNA 4Z2YA 4R2AA 4HWOA 2W6MA 1J1YA 1GDDA 3OMLA 1MKBA 4EJFA 4MVJF 1L7RA 4P0TA 1CC1S 1Z34A 4KQ6A 1QDEA 4DMRA 1M34E 1MB4A 5DGDA 4JP1A 2LVBA 4YBZA 2EP3A 4RY9A 1R9MA 5B55A 1C30B 4YWHA 3QYJA 2OPBA 4YREA 2AHRA 1ZKMA 4MZQA 1P6QA 4B4OA 2PBZA 1JR4A 5BSTA 1X1SA 2GZDA 2ZCUA 3BE4A 3DUWA 3NBFA 1WP4A 1ZI8A 1FVXA 5CVVA 4DG8A 5ITZB 2ZE6A 5AUQA 1YOBA 3KT8A 2QMUA 1I2BA 1Y6GA 2V58A 5JATA 3B6MA 1T36B 3WHLA 1UT6A 3UOAB 4IKEA 2BB8A 3QXGA 3IHLA 5JHHB 5JD5A 2GDJA 1ZPDA 2O7QA 1E9RA 5KTPA 4W8GA 4ZRMA 3T52A 4X65B 5CDYA 4OFWA 4JBWA 1VL1A 4YQYA 2GM4A 4KE6A 1EXWA 3EWAA 1L7PA 4CI0B 1KXJA 5C8YB 4EAAA 2ZLBA 2P6PA 2IHKA 4QWWA 1RBZA 1PBTA 3MWEB 1IPFA 4PCLA 1B00A 4BOYA 1OYOA 1JDBC 3DR3A 2NW6A 2C95A 4XYLA 1RSZA 2X1HA 2D1FA 1L5KA 3O26A 1V5FA 2OAP1 1ZUNA 5GVRA 5G0UA 4CM8A 3QE9Y 3ACBA 1SZJG 1ADBA 1QR6A 3TG8A 3WHPA 4LX8A 4L22A 1DOZA 4BQFA 2IYZA 3Q8MA 5FADA 4X64E 4PWYA 2XBLA 3KLMX 3EWSA 3O1LA 4FSXA 3ADJA 5JAQA 1U0HC 2DHEA 3GLFE 5U1PA 4CLEA 1PGJA 3HR4A 1GGJA 1FFEA 1IFXA 1NQUA 1XNGA 5KAPA 3REGA 3LWNA 3U1BA 1BA3A 3OZIA 1RYHA 3WISA 1KQ3A 2ZWPA 1SFEA 4C3ZA 1JIJA 3HUFA 4RF2A 4M7RA 5DHPA 4BNNA 2IS2A 5F23A 4ZV3A 4M1KA 4L0QA 4QD7A 1PJ3A 3ZE8A 4LBZA 16PKA 2VOEA 2WG0A 1IVNA 4UC0A 2RDMA 3B85A 1W5AA 2JRLA 4L0CA 3ESYA 2ZTHA 4TT8A 2BCEA 2CKDA 1B15A 1XPUA 2QYOA 3K6KA 3BZUA 1HNZB 4EX7A 4WTOA 3WMFA 2PS9A 3FZGA 2R48A 3H0CA 1PU2A 3QI7A 3TE6A 3D7KA 3R5JA 2EBUA 2ERCA 4XDGA 3I3SR 5K3AA 3L0SA 3FLBA 1F51E 4MX8A 2EXXA 1NVBA 1PFQA 1ZGCA 3EZFA 4MMXB 4BUCA 4P86A 4G4SP 2V0GA 1OFUX 5H9VA 3BFXA 1GSOA 4DBZA 2G77B 2ID7A 3QW4B 4DYDA 5FTMA 5KBYA 3EOZA 4XVRA 5ENVA 2FFHA 4EGFA 3LBHA 3NI2A 4HDNB 1US8A 3NHJA 3HJCA 2GBLC 3P2KA 3FRJA 3B2NA 4ADSG 1YUMA 1C3LA 1KEKA 4DC1A 3LO8A 1H9CA 1IN5A 3WGQA 2XJ9A 4M6WB 1F2IG 3E29A 2IHZA 2PFSA 4U7FA 2JGDA 5IAJA 2IE0A 2RCYA 3OKFA 2HRQA 4WDQA 3LSYA 1TZKA 1FDIA 4L8NA 4MGZR 1TK9A 3E3AA 3URMA 3IE1A 3G89A 2IC5A 5F9HA 3FPEA 2BGNA 3OZSA 1RQ2A 4CTOA 2Q4DA 3K3PA 2REXB 4RF5A 1FLVA 3BMNA 3I64A 1PL6A 3JZDA 4XD2A 2X4IA 4D42A 1KEEB 2CLCX 3UC5A 4FCVA 4R2DA 1DQNA 3LBIA 3T06B 3UT0A 2O4CA 3IPXA 4OHWA 5C4MA 4AJHA 2QVLA 2V03A 1UDCA 2UYQA 1Y6JA 4PC2A 3G85A 3NHUA 3PPVA 4HLNA 4IMIB 1Y48E 2GPWA 4BFTA 3NWJA 5CMLA 5AK0A 3B7JA 1N3LA 4QEZA 2VHUA 2V5AA 1FRZA 10MHA 1X3LA 3WYGA 5IYZA 1GY8A 1QLJA 3SF8A 2Z57A 4EJSC 3K70C 1E7MA 4ZOLB 2JGMA 4XVCA 1FNDA 3I32A 4INZA 2YTEA 1K1EA 1YQ9A 2NZUG 2VT7A 4LWQA 1S8AA 4D5GA 1KJIA 2RGNA 4PFKA 4WKGA 1YKSA 3DOJA 3QKIA 2FEWB 2I3BA 1I4WA 2IX9A 4PINA 5G02A 4RYLA 1E4EB 2O8FB 4JLAA 4FCCA 5THKA 1AHNA 1CP3A 1N25A 1ITZA 5GZ1A 5DN9A 3T4UA 1NVGA 3BFPA 1SA0B 4KMOA 5KWEA 2Q1XA 5DGXA 3GQBA 4BTLA 4NI5A 4QJBA 2ZWAA 3LFUA 5K0TA 5A4AA 4H7EA 2FUKA 3KB6A 1GQEA 5E7MA 3SM3A 3CHYA 4H0CA 1VQ1A 5CFQA 4ZP1A 4XUCA 3V2UA 4LZJA 4DLBA 4F71A 2YYAA 1C0IA 3M6UA 3QFFA 4F6LA 1N6LA 2P7HA 4BDTA 2QX8A 5A4FS 2A5DA 1DO8A 4WADA 3N6RA 4JKYA 3DDZX 2SKDA 2DWUA 4EI9A 2AI1A 2W2XA 1PI3A 2CLOB 3T1VA 4WKNA 1AK1A 2GYWA 5EE9A 3K1JA 4I5DA 4OJMX 4OXYA 1LDYA 5D86A 1W59A 1X0XA 1VLLA 1RQLA 2YWDA 1TU0A 3GMSA 1FDSA 4CMGA 4FGWA 4V1CB 2O5UA 4PRLA 2OC9A 4H7JA 2HO4A 2OFFA 3HZRA 3HBJA 3PYXA 3T3HA 5JPCA 5A4JA 3QM1A 1IN4A 4M22A 1CHDA 4D44A 1FDUA 2HZ7A 1R88A 4BQOA 2HMYB 1NXQA 3AHHA 2CC2A 3E1KA 3RWOA 4CRWB 2X77A 3FSJX 2PIMA 5ISMA 4AP6A 4KPFC 1JT2A 3A9UA 1M0WA 1Q22A 1DC5A 2VH2A 1SK9A 3ETCA 3I9V1 4DN6A 3RC1A 2W2PA 1Z29A 5LA6B 4E5UA 1UJ4A 1CUSA 1OGIA 2DGDA 4OMFG 1DOHA 5BN1A 3NIWA 4WCDA 2QN3A 3C6YA 4RV2B 5HQ3A 3IJPA 1RKXA 2I9IA 1X9HA 1QS0B 1VL8A 3O83A 5MFPA 2PTGA 4Q48A 4OOEA 2O2IA 3QVLA 5C31A 5EO4A 3CURA 4FGZA 5DLQC 2O2SA 4J76A 5KVQA 3O8QB 1LRJA 1NP6A 1XMXA 3NC1C 3OZXA 2NXNA 3ISJA 5SICE 4OHPA 4MCAA 3BBGA 3P2EA 5F4ZA 1G2PA 2XYQA 1IL0A 3KQLA 2VZ8A 4A36A 3NW9A 3ONVA 1Z63A 4F93B 2XVZA 1RBQA 5J23A 1ILEA 1NG9A 1YSAC 3FPCA 5FV7A 4QYIA 2GA8A 2H51A 3X44A 4ZAVA 4TMKA 3GP8A 4X8HA 3EXIA 2VYND 2ZBQA 3HGTA 1QGZA 2XMCA 2A7QA 2DY1A 4YBVA 1Y4DE 3U13A 2QMEA 1JJAA 2QLTA 2IY9A 1IQUA 3W9SA 4BFSA 2BF7A 4GI7A 4HH0A 1PKEA 1EPUA 3DBIA 1YC5A 3PXGA 4DRXA 5CT9A 2V7UA 4RKQA 4PYOA 1KEZA 1IVYA 3H1EA 1P45A 2PYZA 3INGA 2DLKA 4F9TA 2RGYA 3SC3A 3IR3A 2VEDA 3LS2A 3D6AA 3F2VA 4LBVA 5I9TA 3JYHA 1YVEI 3VHRA 2M9MA 2WM3A 3PQ6A 1VHTA 4NZMA 2WU8A 2QAIA 4HATA 3ABOB 5CFOA 5I7RA 4LE2A 5IRCD 3H8SA 4MKHA 1JFFB 3T9AA 3AF5A 2V96A 4JJ7A 4C7OA 3FPBA 1KEVA 4O1MA 4FNMA 5JJCA 5LA6F 1G2OA 4MIKA 1VH9A 1I32A 1KO7A 2XOEA 3ZK9A 3DCJA 1Q2XA 2VRBA 5DBIA 4HQKA 3C6BA 2VT3A 3M1YA 3R6GA 3ISTA 3IAS1 3VO1A 1CG6A 5FQNA 1VPWA 3KQSA 3JYLA 3LOQA 4N8DA 2WF6A 2LVHA 1A4UA 4KPYA 4YJ3A 5H4GA 1YCHA 1EWQA 4ID9A 2JVAA 1ZC3A 1HE4A 3QXCA 1Q3HA 3ZDFA 3AETB 1B6RA 3W8EA 1WXWA 1PJ2A 1GNQA 4J16A 2BZGA 5IZCA 2DLCX 4XDZA 2EZ4A 3CRZA 3MD0A 4LC9A 1SU4A 4MRNA 4CM4A 5JBQA 2PU5A 5DMHA 4RS3A 4O2BA 2VJCA 1N3IA 2OA0A 4RL4A 4O8CA 3MMZA 5EIHA 1ESMA 1QQ7A 2O8VA 4YAKA 3BXZA 4LWPA 2O57A 2I87A 2VRCD 1WCXA 3MK31 4NECA 4C7MA 4WPGA 5F2EA 3TMYA 1ULTA 3G5TA 4MULA 1KVUA 2PDAA 1XDBA 3FROA 4O4JB 5JZ9A 5CPBA 1U5AA 3AT1A 3M3HA 1V8OA 4D79A 1JJVA 5AE1A 1WB9A 4M83A 4RCZA 3GLHE 3E1EA 3SDSA 3LK7A 1VSTA 2AKAB 1CX9B 2YHBA 3D4OA 5A9SB 3HSSA 1UBRS 2J3EA 4EG0A 3H65A 3TPCA 1YDEA 2VYNA 3WLPA 3CLSC 4EY6A 1QTNA 4QPDA 4AN0A 5M3BA 5DZSA 4FU0A 4E88A 4MR8A 4HR7A 3H1FA 3FJ1A 4UPDA 3KYJB 1N2CB 1PG2A 3LRXA 5AXCA 4LXIA 1XQYA 4M0KA 2NTNA 2AWNA 2V98A 5LZ8A 3PFWO 3Q7TA 2CB0A 4TPKA 4KH1A 2VSXA 2K7FA 2FN3A 3QUCA 3U37A 2ADFA 3KBBA 5ICMA 4PFQA 1COWD 2HFKA 4EG1A 5CX1B 2DF8A 1Q7GA 4IXNA 3KS9A 4MWZA 3T7CA 3F71A 3EBPA 3T61A 1FQKA 1T9HA 4OHCA 3DUFA 1UH5A 3HWWA 4PY2A 2J0EA 1A8SA 5I7WA 5FR1A 4M9XA 1S9DA 1KKLA 2ZS8A 4PSVA 1XMSA 2FJUA 5BY2A 2FPPB 4A8TA 3RO7A 1DFGA 3R5TA 5L7YA 4XTCS 2C9OA 1LLDA 4R0NA 2ZKLA 2W4IA 1O03A 4AYWA 3QFCA 1XP5A 4ZOAA 3NHAA 3WLNA 2VJQA 2DH6A 1G42A 5BV7A 4GPD1 3WKEA 5TMBA 1K7FB 1RJGA 2PUJA 4BBYA 4JAVC 4B35A 4D8TA 2A9JA 3GT3A 1NYTA 3WMEA 2OHXA 3GBSA 1D6JA 4GS5A 4O4JF 1CTQA 4S2EA 4NOKA 4I7EA 5ELXA 4PZPA 2ZDGA 4LN1A 2EGIA 1WIWA 1L4GA 4G5GA 1WUJS 2GUGA 3K8QA 1YR8A 1YC2A 4QULA 1RWNA 3AO0B 3M4YA 1M6VB 4F1KA 2W7TA 3PGA1 3ESIA 3V8VA 2HJVA 1LKZA 4BB9A 1FDWA 3BWDD 4EARA 1WUTA 4D02A 3TQRA 1YACA 2VKTA 4M20A 4E15A 4EWLA 2YXBA 4F4FA 2VRCA 4DIBA 1JTFA 1QRRA 4DY6A 4BP8A 3ZNPA 4HG2A 3TBFA 3LCMA 1RQGA 4Z9YA 2ZCJA 2JEZA 3HKDB 1V7PC 4ZQEA 1A4RA 2ZSUA 1AURA 2V6IA 4EENA 2IEZA 3DPSA 2R7AA 3HZHA 3ZE9A 1CBUA 3WRXC 2QNBA 5EGNA 5A2QC 1JQ5A 4KN5A 2JGIA 3FYHA 2JGRA 2JLBA 4ECEA 1R8YA 2W2TA 4PYMA 1OXTA 3D8NA 4GKJB 4XCVA 2O3UA 5SZIA 2HWUA 1ZBTA 3BERA 2VJKA 1L4NA 2COKA 4HMPA 2G08A 3VAZA 1I3KA 2UDPA 2EHJA 1UKBA 4D5EA 4YV7A 2A9FA 4YRRA 1FVOA 3HA2A 3UJ7A 1DI2A 2RB4A 4MR7B 2IYVA 3CVJA 3WL3A 4V3CA 5JFGA 2XCIA 1SZPA 1COWA 4UU8A 5LLSA 3X1XA 3KQUA 4JI0B 5CH3A 3F3MA 1XZMA 3FTPA 2XKJE 3ZDYB 2WSIA 3I23A 1RCUA 3QOYA 3R3YA 4FFBA 4GXRA 1U3FA 3NEAA 4R9UC 3TAXA 2HNKA 2INGX 1MJGM 4H3KB 1Q1ZA 2Y92A 3BJEA 4A27A 1YS1X 5LBIA 1YBVA 4MEAA 2ZDQA 5JCPA 2NGRA 3JD0A 2YY5A 3QKRB 1RYNA 4ZPXA 2KBFA 3KG9A 1AH2A 5ALWA 4G65A 2Y0EA 1PD1A 2WIBA 1KBQA 5C51B 3L8EA 4YAUA 1GPMA 4FYMA 1KYWA 4F97A 1F2TA 5KOIA 1VG9B 3CRQA 2H1CA 1JI0A 3WK5A 2BR4A 4DSAA 1JH9A 4XB6B 3OJCA 2ORIA 3W2IA 3UN1A 2E6UX 3CJRA 3KOUA 3QVKA 3V32A 3W2FA 3GCWA 1RKBA 2Q7DA 3NTRA 2OCPA 1CUYA 2A0XA 3LY5A 4Y1RA 2QSUA 4W78A 3CMMA 1K98A 5I8PA 4F6NA 1VG0B 1PNVA 4FYPA 2G0NA 1IEVA 4TZ6A 3UJNA 3TRIA 2ISSD 3OH8A 4WFJA 1C7QA 5IDWA 2R5WA 4OBWA 3UFBA 1QHNA 3LY8A 4B43A 4C5AA 3E5NA 1JDJA 1M2FA 1YMUA 3ZYCA 1ZS9A 1JMVA 1UQRA 1QU6A 3UGQA 3ZDDA 2Q1UA 5C80A 3NVKI 3JQGB 4Y1EA 1VJGA 4F2DA 3I5AA 5B6PA 4XPIB 1RKVA 4RELA 2D0DA 1COZA 1KK1A 1B76A 2VHEA 5I3CA 1NV9A 1POXA 2WM8A 1IN6A 3QMPA 4OXIA 2O5RA 3L40A 4L8VA 1VLJA 2VDWA 2KX7A 1RMTA 1RYYA 3RFVA 4UXIA 4ZK2A 1EBUA 3WZ2A 2EM4A 3TLMA 3Q85A 3HDJA 1EUZA 2ZJYA 4JI4E 1AGPA 4RKWA 3H6KA 3FYSA 4R2WA 1GXSA 2XXBA 2BUCA 1DARA 2QW8A 4GVXA 1UFVA 1NC3A 1XA3A 1RJWA 2JOXA 4ETWA 1PTJC 3FSRA 3PA6A 2Q5LA 3ZWXA 3R5XA 1V2GA 2WAAA 2DAPA 3VR0A 4TS3A 1T38A 1IN7A 3O7MA 4RXUA 4QNRA 1M8FA 1HURA 3UUEA 2GMWA 1YCGA 2OO7A 2OV4A 2R6R1 1WXHA 4P4UA 3V2IA 1H93A 4CF6A 1ANKA 4U3JB 2UYHA 4KK4A 3DE5X 1IEQA 1OA0A 1Z45A 1HFJA 1E58A 4DLPA 1U0FA 3W2HA 2YOHA 4KKVA 5EXPA 4JT8A 3VPBA 3BSFA 4CT4B 4KO3S 4K4AA 4KMMA 2EFDB 4NHRA 4PVDA 1TXGA 3HHEA 1APBA 4LKOA 1XYGA 4L16A 5JVDA 2JFZA 1JU4A 5EA2A 1XZAA 4JT9A 3RS2A 3TR5A 4U5XA 3DV0A 2CLKB 1EHCA 2OCLA 4K9LA 4A92A 3TIIA 2Q4RA 5CIWA 4MARA 3KJNA 4LU9A 4QO7A 2PUWA 3N7TA 2Y1LA 4BRSA 4XGIA 2C2BA 2BFFB 3WB1A 3HSYA 2B9VA 3H4VA 5JMPA 1O5TA 1UQUA 2JBAA 2PWBA 2V65A 5LP6A 5FNVA 3IB3A 4IHAA 3SXUA 4WQMA 1DP4A 4A5SA 2OBLA 2LNDA 1E98A 1ECCA 4RAQA 1RYBA 2C2MA 5EQDA 5B3JC 2Z6QA 1J0XO 3VA7A 4HNRA 3PD7A 4DR6E 3W4JA 2QN1A 4QU9A 3K0HA 1FDVA 1HDIA 2PV0A 1K3FA 2G28A 1WQ4A 1UJNA 3TEMA 1EHYA 4PO9A 1TCUA 4I6GA 4Z4EA 2VSFA 4E2WA 2APJA 3SE7A 2WYVA 5HFNA 3GFQA 3DDNA 2PZJA 3V6MA 4JOCA 1WPGA 4BX9A 3QG1A 4UM9B 3P32A 4OSPA 4H59A 5CCDA 4UUOA 1K9VF 4BQPA 2NUAA 4OJTA 4BZPA 5KVSA 4QDKA 4WUTA 5GJBA 2DPGA 1N7IA 2CUTA 2A0KA 3D0KA 1PX2A 1H6AA 3VKFA 2YRHA 1Q3TA 2HGZA 5LQKA 3KR2A 1WETA 1Z4LA 4KX3A 2R6AA 4KBGA 4DSUA 4FJ1A 2ZW9A 5J4LA 2OQIA 2QRPA 2JFGA 1I7DA 4R2MA 3ONDA 1IULA 1OAOA 2PA3A 3DMTC 1RHRA 1BE8A 2FA9A 1EX1A 5HS4A 1JNYA 1LZKA 2M98A 2HA6A 1T9GR 5DTQA 4F9FA 3CU5A 3RV3A 3PHIA 1L9KA 3SJAA 1SQ5A 1WY5A 4TTRA 4JWTA 4E08A 3WGVA 4DPLA 4TXJA 1NATA 4CKBB 2VP4A 5K45A 2XYVA 2YY7A 2VTVA 2F1RA 3E58A 3NP7A 2ZUTA 1JT9A 2W6ZA 1E8MA 5CBPA 5EMJA 5FTLA 1E3LA 2HXSA 1PAUA 3FMOB 3Q8LA 2HC9A 3RFFA 4QAQA 2GD6A 1TVKA 1HNXE 4LG1A 5KOJA 4ZTBA 1RTKA 2ERXA 4Z86A 2TMKA 4ENRA 4L6CA 1RWVA 3G2MA 1NBMD 4OX9B 3OX1A 1QDUA 3RFTA 3EQ7A 1XCJA 1C1YA 3L7IA 3L7YA 3GLUA 4I1OA 4DV7E 1DX4A 3JQ6A 1K8XB 2EIXA 4CM3A 4M9VC 3D3WB 2O8DA 2EISA 4LJ9A 1A98A 1ZWKA 5HQ3B 1N57A 4YAIA 1JE1A 1PFWA 4WKPA 4P4TA 1OWOA 5HF6A 3O47A 1L1EA 4YONB 4YUZA 1A8UA 4ZYZA 1FSSA 5DNVA 3DMDA 2PGOA 3KQQA 3CX6A 4CF5A 2ATXA 3I4LA 1D9XA 2RSLA 4EHBA 4A0HA 3ZGVA 2Q62A 1W88B 3PB3A 3U7IA 2ZGVA 2PL9A 3ZN2A 4EJ0A 3SQNA 1I5EA 2MMCA 4LRTB 3WKCA 1UM8A 1SU8A 4W5RA 3O21A 1BIFA 3SEQA 1SVIA 3SIWA 3EXIB 5F3WB 5DYTA 2CJFA 3EJWA 3IEUA 2VPXA 3WGGA 4X62E 4CQLB 1U3CA 1P1KA 4WLNA 2GEJA 3M6IA 1FXSA 4PLWA 1JHRA 3OC6A 4X7MA 3TQOA 4EI7A 3GJ0A 3NBQA 3MWGA 3NFYA 1NU6A 1EZZA 3M6XA 4GOND 4PC1A 1EIZA 1E3TA 3SQDA 2J9RA 3JARA 2HLPA 4BO0A 5T6MA 4MHTA 3FCAA 3B6JA 1NW7A 1VFNA 3BCSA 2XUFA 4J9VA 1G0NA 2NSYA 4MEBA 1XRLA 2DKNA 1A3CA 1TZ2A 1DXQA 5J4YA 2QTTA 1ZR9A 1XK6A 3U7QB 1D4OA 1RZRD 3IHWA 4M8LA 2AQIA 3EX7C 3T1HE 2FN8A 4QBIA 5EP3A 4EO9A 5BRJA 2OCKA 2G80A 3OFVA 1S3FA 3AJ8A 1GKYA 5J1TB 1G18A 4BUJA 3CLRD 1VJ5A 4RA6A 4Y7DA 1X14A 4WY2A 3RBAA 3IILA 5JAIA 2IOFA 3ZV3A 1FK8A 5C0OE 1NR7A 4UBOA 3MCTA 1KERA 3DLPX 2WM9B 4B0BA 3QQPA