3OMLA

Structure of full-length peroxisomal multifunctional enzyme type 2 from drosophila melanogaster
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
585
structure length
532
Chain Sequence
LRYDGRVAVVTGAGAGLGREYALLFAERGAKVVVNAADIVVDEIRKAGGEAVADYNSVIDGAKVIEILVNNAGILRDRSLVKTSEQDWNLVNDVHLKGSFKCTQAAFPYMKKQNYGRIIMTSSNSGIYGNFGQVNYTAAKMGLIGLANTVAIEGARNNVLCNVIVPTEGILPDILFNELKPKLIAPVVAYLCHESCEDNGSYIESAAGWATKLHMVRGKGAVLRPSLDDPVTIEYVKDVWSNVTDMSKAKHLGAIAEASGTLLEVLEKLKEGGGDAIEDAFEFNSKELITYALGIGASVKNAKDMRFLYENDADFAAIPTFFVLPGLLLQMSTDKILHGEQYLEIVDDLPTSGTLLTNGKVFDVMDKGSGAVVVTNSESFDESGRLLVRNQSTTFIVGDPIAGVVPLQPAPNRQPDATVQYTTSEDQAALYRLSGDKNPLHIDPQMALLAGFKTPILHGLCTLGFSVRAVLAQFADNNPALFKAVKVRFSGPVIPGQTLRVDLWKQGTRINFRTVVVETGKEVISGAYVDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peroxisomal multifunctional enzyme type 2 from the fruitfly: dehydrogenase and hydratase act as separate entities, as revealed by structure and kinetics.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase, hydrolase
molecule keywords Peroxisomal Multifunctional Enzyme Type 2, CG3415
total genus 154
structure length 532
sequence length 585
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
A PF01575 MaoC_dehydratas MaoC like domain
A PF13452 MaoC_dehydrat_N N-terminal half of MaoC dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.129.10 Alpha Beta Roll Thiol Ester Dehydrase; Chain A Hotdog Thioesterase 3omlA03
3.30.160.260 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3omlA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3omlA01
1VE9A 3I9JA 2VNSA 1SCUA 3ZW8A 1Q6WA 2AQKA 2R6JA 3HNPA 4AJ4A 3RCBA 3DWFA 4HZNA 4MOBA 5DZSA 4BNGA 3K8ZA 3H9QA 1EQ2A 2UUPA 5F1KA 4KDEA 4N54A 2QIOA 4TMFA 3LC2O 2NLOA 1VC2A 4O5OA 5F21A 5TT0A 3WYEA 3K5PA 5DCWA 1JKIA 4W7IA 3Q1LA 4JP3A 4YBVA 1MGOA 2EP7A 4BO2A 1P45A 5BNFA 1BMDA 1LLUA 1E7RA 1LEHA 3GMSA 4GAKA 5EMHA 1PGJA 4OXKA 4D0SA 1LSJA 1NX6A 3ASVA 1P1FA 4PVDA 3FSRA 4BNLA 4CM7A 1OBFO 4TRMA 4NCPA 1B15A 3ETGA 4I9NA 2FPGA 1BG6A 3GN2A 3KYCA 2XPCA 4XQEA 2GGSA 3SJUA 1WW8A 1NNUA 3NGXA 2OKHA 2C29D 3SLGA 4BNKA 1GEEA 3NEPX 4YTEA 1ZK4A 3C7DB 2UVDA 4DIOA 1MC4A 2XAAA 4IDGA 4QTZA 3WIDA 1VH5A 4MVJM 4CLXA 2HQ1A 3PJDA 2FWMX 5SZUA 1ZCJA 2DFVA 3EXZA 2DQ4A 4XB2A 4MTUA 4L4XA 4EJMA 3GK3A 1BWSA 2GCGA 3EC7A 4RO0A 4FC6A 3EZLA 4R01A 2EP5A 2GN8A 1XSEA 4J9VA 4U5QA 1PL8A 1A4IA 4DQUA 1MG5A 1C1XA 1KEUA 1N2SA 5JC1A 5DULA 1JLLA 1PJ4A 3VH2A 2V1OA 4FDAA 2X9NA 3DAFA 5A05A 1GEGA 2JFHA 2Y1CA 4KDFA 5H83A 1ZMOA 2D8AA 4U6QA 1QG6A 1QYXA 4NU6A 2NTNA 1N92A 3BZUA 4A7PA 1BXGB 4W82A 3LBEA 4U7WA 4Z9YA 1ZSYA 5A3VA 1YQDA 3E8XA 1ZJYA 1YB4A 2VYVD 4YJFA 5JFOA 3C1TA 1B8PA 1KC3A 3LF1A 3RC9A 3C85A 1E1NA 4EUEA 1E7SA 4X54A 1HL3A 2D2IA 2W4QA 3VPSA 3CXRA 1YBAA 2IZ1A 3O8QA 4Z9XA 1VL8A 1J4AA 4RLSA 3NTQA 4IXTA 1CIVA 4XR4A 1HRDA 4GLLA 1JKFA 3AUTA 4MKZA 2X5KO 3LT0A 3R35A 1V8BA 1N8KA 4W9NC 2JHGA 3IMFA 1Y7UA 1NASA 3ZHXA 2FP4A 1ULSA 4WKGA 1QMGA 1HDOA 5CDUA 4OKNA 4TRJA 2VZ8A 4NK4A 5CDGA 3PK0A 2OV9A 4CMEC 2AA3A 3K2BA 2YHUA 4IDCA 3KVOA 4CM6A 3HHPA 3PVZA 4RLTA 1KVTA 5KKAA 3W8FA 3S8MA 4PRKA 3FRJA 1QLHA 4PLFA 3ON5A 5CEFA 2NVWA 3VZQA 4ND3A 2J3JA 2O3TA 1P1HA 2VOJA 2ZB7A 4J1TA 4P4GA 1OFGA 2PR2A 2BF7A 1WM6A 5IN5A 4IIUA 5KNLA 4FC7A 5KKCA 5COBA 1FDUA 1UH5A 2NM0A 3AY3A 3Q0EA 4A10A 3PJFA 3DFZA 4A12A 1H2BA 1PR9A 4A0ZA 1EDZA 1ZEJA 3GT0A 3NTOA 1OI7A 3OFSA 3AOEC 2C7GA 1EVZA 3HE3A 1VL0A 4OM8A 3TOZA 3VPHA 2PD6A 5DOVA 4CLEA 1DIGA 4CJXA 3BMQB 2JAPA 4DLBA 4JNKA 1CQIA 1HF3A 1PIWA 3DOCA 2X6TA 2NVBA 3WTBA 3ZHBA 3KX8A 2VT3A 3DR3A 5JMPA 3LQFA 2J3HA 4Q3BA 1PS8A 1G0OA 1KS9A 5JYDA 4AJ2A 4RLJB 2C59A 4GBJA 4DQVA 3FNFA 1L1FA 3KVUA 4ZV3A 4IGFA 3WYBA 5ICMA 3VC7A 3FHLA 2Y0DA 3AU8A 1H6DA 1I5RA 1MKBA 4OO3A 4H4GA 2AQIA 2GPTA 3IUSA 3A9WA 5BQFA 2NADA 2I65A 1PEDA 4MIYA 5FF9A 1AXEA 1TBUA 1ZW1A 2D5CA 1EVYA 1E6EA 4YJGB 1JTVA 3H5AA 2ZTUA 5IDWA 3HFSA 4BO7A 1RM4A 4KP7A 3GAZA 2XOXA 3ZHYA 4XRGA 1PQWA 4CODB 5BYUA 1BXZA 4IENA 1F12A 1Q0HA 3ZWNA 5SZZA 4GKBA 1PGOA 4FFNA 4K26A 4UUMA 1Z6ZA 2EF1A 3F1LA 4R9RA 4MVJE 1B8VA 3S1LA 1HSZA 1XU9A 3INGA 2QYTA 1PN2A 2EWMA 4J0EA 1ZH8A 5G0TA 1NFQA 4II2A 4E31A 1XQ6A 4QO8A 1O94A 2O3UA 3EYWA 4J9UE 3ABIA 1EBUA 3T4EA 3U4IA 1YBMA 5CPBA 2W2LD 4HXYA 1TLTA 4XEHA 3NDRA 3A1NA 1Y9AA 1NWHA 3H9UA 1HYGA 4CM9D 2B3MA 3SC4A 1R6DA 5TSDA 3ANLA 4RLTB 3ZU5A 1GU7A 2QRJA 3ONDA 3ZWCA 4RVFA 1ZEMA 4B79A 4IDFA 5KJFA 4QO7A 4RZHA 4XB1A 1KOLA 2OP0A 2NU8A 4BO8A 3MWDB 4I5EA 3PQEA 2B83A 1A9ZA 2GZ3A 2O4UX 1GADO 1ZNQO 3E48A 4YEDA 5JNLA 4HY3A 1DXYA 4DLLA 3ZWWA 3TDKA 4P38A 3ZV4A 1UP7A 4EZBA 3HDUA 4GGPA 4EJ0A 4BGVA 4TRRA 4R1NA 2VZ0A 3L07A 1GUYA 3V2HA 1EUDA 1W4ZA 1KVSA 2R00C 4Z9FA 1NP3A 4JBHA 3AZ8A 2VHZA 4D7AA 5TF4A 2NACA 3DHEA 2JKVA 1SB9A 3E9MA 3UKOA 1T2FA 5EO4A 4LW8A 1U2DA 2NQ8A 5EINA 3PQFA 4WLVA 3FBGA 3GC6A 3AM4A 4CL8A 3QY3A 2DVMA 2QZZA 1LRKA 3Q3CA 2A92A 3UAGA 4O59O 5ITVA 4WLEA 5IAAA 1WMAA 2GASA 3RFTA 3P2RA 2DUUA 4CLRB 1TT5A 3OH8A 4D44A 1QYVA 2C54A 2GZ1A 5L9AA 5AYVA 3F4LA 1FF9A 1A7KA 4EYEA 1HT0A 2PD4A 1T4BA 4B8ZA 4K4BA 3UHAA 5JS6A 3B1JA 1HE4A 4ALLA 2VRCD 4K02A 4NIMA 1EVJA 2Q4EA 4ZA2A 3RAJA 4A03A 5KIAA 3V5NA 2P9CA 1Q7GA 3W1VA 4IZHA 2E4AA 3JQAB 2AMFA 4EGFA 3RWBA 1GYRA 3QWFA 3BTUA 4KMSA 5HWFA 1VRWA 4CPDA 1VJ1A 3DONA 4UULA 5ENDA 1Q0QA 3H65A 3H4VA 2PZHA 1Z45A 4D41A 3VZSA 2EIHA 2BHLA 1DAOA 4M86A 1Y81A 3KVIA 3HB4X 3H9JA 4PN3A 4I8XA 3BIOA 4ZQBA 5ICSA 3F46A 2V6MA 1SB8A 1DFIA 1E3EA 5DDIP 5G0WA 5G0VA 1BDMA 3WBBA 1FK8A 3I1JA 5G4LA 4RVUA 4CUKA 4EUHA 2HAEA 3WLEA 1S5UA 3IQDB 4GKVA 1HLDA 3GN1A 4I4JA 3VH3A 1OMOA 1C1DB 2IEBA 5IZCA 1IHYA 3OJLA 3VPGA 4AG3A 3V2UA 1U4OA 3AJRA 3LLVA 1E5QA 3NTRA 1K89A 4YAKA 4Q3AA 3R36A 4BO0A 5J23A 2DBVO 3WGZA 4Y6PA 1T25A 4I5DA 1HE3A 3D5QA 3P5SA 4IJUA 4J1SA 3H5RA 5MGBA 4AE8A 5AXDA 5JAMA 3AI2A 3ROMA 3F47A 4YWJA 1HLPA 3G0OA 1C1XB 1VLLA 1UZMA 4G81A 2PZMA 3GAFA 3S2EA 5CG2A 8LDHA 4XCVA 3ITDA 4RDHA 1VL6A 3L6EA 5A5FA 1E6WA 2Q2VA 1UP4A 1H6AA 5FI5A 3PTZA 5JCJD 5B4TA 1C1DA 4B0IA 4OSOA 4R3NA 3NYWA 4J1NA 1C0LA 5IN4A 1X15A 3JD0A 3CF8A 1DC6A 4MOCA 4Z3DA 5G0UA 1Q1NA 1C0IA 4IGEA 4XKJA 4PRLA 4NG5A 4RGBA 4Q39A 3ZWYA 1X1TA 3BMNA 1Y5RA 2HMSA 1K3TA 3E18A 4D3SA 2EERA 2H63A 3RUIA 1HYHA 3VDQA 2I99A 3IIEA 3QVXA 2FSSA 1JVBA 1NXQA 3JQ7A 5A3JA 3CMMA 4XYLA 2DC1A 2GLPA 1RJWA 4R3WA 4OIMA 1VSUA 1NAIA 3F5OA 3G17A 3G1TA 3WFJA 3JQ6A 1MKAA 4B0BA 5JMWA 1ZK3A 4R51A 1SBKA 2XF8A 2RH4A 3F5SA 4K4DA 5JCXA 2QQ5A 2O3QA 1RM0A 2AEMA 3VTFA 3GF4A 3NGLA 2PNFA 5T02A 3JD4A 3HQ4O 3RASA 4IINA 3WX0A 3RIHA 5MDHA 2YV1A 1QORA 1R12A 4D45A 1I30A 5JO9A 3Q9UA 4CV2A 3L77A 3DMYA 2B69A 3R37A 3R3JA 4WEQA 2YYYA 3JYQA 1PZEA 1N7HA 3I6QA 3O26A 5BSGA 2XEMA 1R0KA 3D3WA 2AEFA 4HP8A 3OA0A 4FN4A 5L95A 1NWCA 2PGDA 4BMVA 4DMMA 4KTVE 4Q3DA 4R69A 5THKA 1ENPA 4B0CA 1UAGA 3KXDA 2WD7B 1IZ9A 4GH5A 4MINA 5EERA 4Z3KA 3LBBA 3AM5A 3DTYA 2YHIB 2XFLA 3KVZA 1H9BA 3E03A 3F4BA 1SZJG 2F3XA 3KSDO 3OICA 3TZ6A 1GQYA 1WAMA 2NWQA 1GCUA 2P5YA 3B7JA 4UAGA 1I32A 3CE6A 3FPCA 3MZ0A 1OC2A 5I7FA 2O3SA 3UCFA 5BR7A 1A5ZA 2IYPA 1KIFA 2DSLA 4G5HA 1FDWA 1UXJA 3ICPA 3OF2A 3SC6A 4GX1A 4NBVA 3ETEA 2O5UA 1V35A 4AJEA 4PLTA 5AXBA 3KEQA 1B14A 1HDZA 5K6AA 4URFA 1E92A 1D7OA 1Y8QA 1DC5A 2HRZA 2OORA 1KY4A 4NI5A 2G0TA 3SX2A 3VVBA 4KUGA 1WPQA 3FI9A 1XGKA 4GQAA 3L6DA 2HDHA 2YJZA 1R16A 4GGOA 4PLZA 1YE3A 3ETDA 4E5YA 4QDAA 2H9IA 1BDBA 4FOSA 4MOWA 4FOOA 3TRIA 3AZAA 2RAFA 3VH1A 3LU1A 3PDUA 4MO2A 5KCZA 3PEFA 1H0KA 1ZMTA 2CY0A 3DZBA 4RPGA 1Z73A 1A72A 1NVMB 3QWHA 4HNGA 1FDVA 1W0CA 4A0SA 3JYNA 3KYCB 2POQX 3WGGA 1J49A 1GV0A 1B8UA 3JQ9A 3WG9A 3UVEA 1MFZA 3R87A 2HK7A 3KZVA 3LT1A 1DRVA 1VKOA 2ZJ0A 5DP1A 5DN9A 4IJKA 4L0QA 4ND1A 3NUGA 3P2SA 1NPYA 5HS6A 4QD9A 3NWZA 4JP2A 4OL9A 1D1SA 1LX6A 1RPNA 5K0ZA 4YDRA 4DLAA 3VTZA 1DFGA 4UUPA 1PJQA 2D59A 2NNLD 5DCYA 4RV2A 3I3OA 3VKVA 4S1VA 1KEWA 3JYLA 3BMQA 3PYXA 4XA8A 4E3ZA 4J2HA 3KUXA 3ZNNA 3H9EO 5CEJA 3LYLA 2G5CA 4R5MA 4FR5A 5JY1A 1EUZA 1YVEI 3JSAA 4FSHA 4LMRA 3ROQA 2NSDA 4ITUA 5DT9A 4ID9A 3STHA 4UVDA 4CMEA 3H3FA 1Y1PA 4F6CA 2EGHA 1ZXLA 4TKMA 3LLSA 4Z0PA 2FRDA 2QG4A 3TNLA 3GEDA 5A1TA 4IIVA 4PLHA 2WEKA 3NAQA 1J1YA 2IDZA 5A06A 2VOEA 4ZQHA 3PYMA 2V6GA 4FBGA 5BSFA 1ML3A 4BNXA 2AE2A 3Q6IA 1IULA 3D6XA 1PR3A 1YJQA 3I83A 4J7XA 4MVJH 2EKLA 3CPSA 3QSGA 4QEDA 4L73A 4ESOA 1VPDA 4IUYA 1WLVA 1YOVB 1T1RA 4K4AA 3E6AA 4WNBB 1B0AA 5L51A 4TZTA 3MJVA 1P77A 5EQFA 3GDOA 4BNTA 1IXLA 4GX2A 4BO1A 2Q2QA 4J1QA 1JA9A 1MC5A 2QYSA 1NFRA 3QRWA 4ALIA 5HZ4A 4E33A 3IP3A 4NJOA 1EFKA 2ZTMA 4CV1A 3D4NA 1ULUA 1DIBA 3WJ7A 1OZAA 4RPJA 4YR9A 4HV4A 4OAQA 3OHSX 4NFSA 4I45A 1SO8A 4NBWA 1E3WA 3WGYA 4CR7A 4HADA 5BNIA 3U9LA 1DC3A 3I6IA 4NR0A 4CM5A 2B37A 3WMWA 4B8WA 3GUCA 3PYLA 4J4TA 4WCFB 3KUVA 3U3XA 3WGQA 4B7CA 4B3IA 4CMKA 2ESSA 3QA9A 4HFJA 3FTNA 5CPFA 3ZNOA 3NX4A 4S3MA 3EUWA 4MZQA 4YT8A 2WSBA 5DBGA 3KG8A 2D3TA 4J4HA 5LDHA 1WZEA 3R3AA 1MXFA 2W98A 2GSDA 2HLPA 4RL6A 3RD5A 1I3MA 4AFNA 2FZWA 3ZWBA 4EI2A 3ENNA 2O48X 2PKQO 4QD8A 2D5AA 1Y8RA 2QWZA 2HCTA 3F6YA 4MVJI 3OM9A 4U0KA 4CQMA 1VH9A 1PZGA 1GFSA 3KW1A 3E1KA 4RLHA 1LLCA 3UICA 2HMTA 4DMLA 2WYWA 1J5PA 4NH4A 3U4DA 3ZV3A 4BNIA 1DDOA 4PFJA 4KEHA 1PJCA 2IYOA 4ILKA 4YJFB 1NHGA 3RQSA 2VWPA 4HWKA 3DKZA 3SVTA 3OIFA 3MJTA 1GPDG 1I10A 4A2CA 4DRYA 1VKNA 3AI1A 4CR6A 3GOHA 3CH6A 1J0XO 1E5LA 2YUTA 1QSGA 3LVFO 3IP1A 2YQ5A 4MVJP 2VN8A 3JQFA 1GYPA 1R66A 4CUZA 4HFRA 5BUXA 3K9QO 1U1IA 4RZIA 5U1PA 1PX0A 1Q4TA 1PTJA 3W6UA 4WOJA 1C0PA 4J49A 3ENKA 3E5RA 1YDWA 1W73A 1YQGA 3DXFA 1YQXA 3TQHA 4OSPA 4XYBA 1H9AA 3WMXA 4AJLA 3C24A 1P9LA 4CM9A 1PJSA 3DHNA 2AW5A 2UDPA 1DOHA 1E3JA 3QHAA 4KQWA 5G2OA 3LWGA 5IDYA 1GCOA 5EGKA 4PLGA 4XQGA 3H8VA 4LGVA 4GAHA 1BW9B 1UDBA 2BGLA 4FD3A 5DP2A 4JCOA 3QW2A 1FMCA 4UREA 2YZ7A 3VZPA 4FB5A 2BKAA 4C4OA 4NJMA 4OKIA 3R3CA 5T8KA 2JD0A 5EGJA 1ID1A 4JXKA 4R41A 2GN6A 5HMBA 1F14A 1NM5A 2F00A 3B6ZA 2D4AA 2J3KA 3F9IA 3BMCB 3ROKA 1KC1A 3LW3A 3GVIA 4H3VA 4P4NA 1S6YA 3PHIA 3W8EA 1HZJA 1WLUA 1MUUA 4I83A 4HZPA 2ZYDA 3ONEA 4YJGA 5KOIA 5F6RA 4U0JA 4CLRA 1A4UA 3VHRA 1A7AA 2PA3A 4OOEA 3PPIA 3I9KA 2C2YA 3ZWXA 3D3EA 4K28A 2VHXA 1NFFA 2DPGA 2Z1NA 1O8CA 3DZIA 3DZJA 1YOCA 2JL1A 5A03A 4EEZA 1LO9A 3R3SA 1UXIA 5JY6A 2HUNA 2Y1OA 3SJ7A 5COAA 4M87A 5FFFA 5JBIA 2NTJA 1QV7A 3PRJA 1GTMA 3BNVA 3EVNA 4YJHB 5A02A 3BJKA 1NPTO 1V9LA 1QKIA 3JQGA 4WCFA 3KH8A 1E1LA 1LQTA 3QJ5A 5AXCA 2NU6A 1ZKMA 2J5KA 4CMIB 4ND5A 4PLCA 1Q2XA 1T1SA 2J5RA 2PK3A 2FPIA 4WLFA 1ONPA 2X58A 3P2YA 5CAEA 5KVSA 3U09A 4IZIA 4QSMA 2HK9A 2ZKLA 1LSSA 4PG4A 1M76A 2EG9A 1UP6A 3RBZA 1XHLA 3ZNPA 1T2AA 2FR8A 4N7RA 4M8SA 3DP0A 4Y6RA 4YA6A 5LDGA 1DHRA 5JE8A 5CDTA 1PSDA 3HB5X 4RV2B 4KWIA 1P1JA 4J7UA 1GAEO 1SOWA 2Q99A 3BA1A 4DBZA 4EJ6A 5TIIA 1ARZA 2WD7A 2OZPA 4BKPA 3W4JA 1ZSNA 2LDBA 2HMWA 1PSUA 1IB6A 1ONNA 4J0FA 3KYDA 4RLWB 2W8ZA 4H7PA 2GDZA 4GX5A 1K2WA 3H6KA 4M1QA 1QRRA 1F8FA 1K5HA 2H4UA 2BD0A 3SLKA 3UFXA 2O23A 3OEWA 5A5EA 1VJ0A 4J3FA 3K67A 5A04A 1XELA 4YVFA 1Z7BA 3R3DA 4J43A 5DCUA 2W2KA 5C7IO 4ZRFA 2NUAA 2G17A 3M1AA 3OIDA 3V2GA 1UXGA 3Q2IA 1U5CA 4PZCA 5I8ZA 2EXXA 5FEUA 3INTA 3GVXA 3BMCA 2RCYA 5EO2A 4GVXA 3BHMA 2P9EA 1ISMA 4G65A 4UVHA 3RUCA 2AQHA 3CINA 1F06A 3TF5A 5KVCA 5B4VA 3WB9A 1VI8A 1P74A 4XIYA 1GY8A 1ZK0A 4MVJA 4DXHA 1C3VA 5JDIC 4KZPA 1S7CA 3GR6A 1HKUA 2NTVA 4WNBA 3I52A 1X7GA 3TL2A 4M49A 1Z74A 1QLJA 1VM6A 4XWYA 4O0LA 5JDCC 4OOFA 2E48A 1K6IA 3EW7A 2QZ9A 4HUJA 4CM8A 4BNJA 2X4GA 4M20A 2DUWA 1PQUA 3JQAD 1VSVA 4BNNA 3P2OA 3QWAA 2Y93A 5C37A 5JYEA 4FFRA 1I3NA 4NQZA 3H2ZA 4E2YA 4E32A 4R4JA 1GYQA 3KHPA 1PQPA 3NKLA 1UXHA 4E4YA 3LC1O 2ZK7A 4OXNA 5F3RA 2DBZA 1EK6A 5DBFA 4ZD6A 2Y66A 4IMRA 3GPDG 1PU2A 4K6FA 4A73A 5GZ6A 5TC4A 3T7CA 2ZQZA 4BNYA 1VI2A 3QE3A 2CVOA 3I9NA 2DTXA 3SBOA 1XQ1A 2C07A 3UH1A 5IDQA 4OJNA 4YBZA 2A35A 4YAEA 2CZCA 2Q3EA 4L74A 2GO1A 2YHIA 4UUOA 1LDEA 2XXBA 4ONEA 5DIOA 4E3EA 4J6FA 1X13A 4TQGA 4W9NA 2HMVA 4BO6A 4R1SA 1LRJA 3D7LA 1FXSA 1UDAA 2CF6A 3HDYA 5EIOA 2VUSA 1Z82A 1MA0A 4JIGA 1N1EA 4RF3A 1ISFA 4W4TA 4DYVA 5FWNA 4M89A 2ZYAA 1YKFA 2IXBA 1XLTA 4IPTA 2V6FA 2P9GA 4RVGA 2I5PO 4YRAA 4BNMA 2HSDA 1MFPA 3GG2A 3DMTC 3QP9A 3WR5A 4Y9DA 2WD8A 1I33A 1X7HA 4XGNA 3AFMA 3I4CA 4TKLA 4XGIA 2VQ3A 4BO4A 5I8WA 4BV8A 5EGLA 5L45A 3WTCA 1R4NA 3PJGA 3EK2A 3ITKA 3S55A 3D0OA 3OQBA 3CZRA 1U9JA 2NQTA 1ZO8A 4NHEA 5B37A 1MXHA 4FS3A 4E30A 3MJSA 4XDYA 1E1MA 4XY5A 3Q11A 4RJTA 3GEKA 3HMJG 4YAJA 1ADBA 1SOVA 3CKYA 2O2SA 1E3SA 2BFPA 4I08A 1W8DA 3WGIA 4OQZA 3JQDA 2Q49A 3JTMA 5KJ6A 2GD1O 4B7XA 3WGHA 1I2BA 2DM6A 2IODA 3WLFA 4DBVO 3C7CB 4FFMA 4FFUA 2CMDA 2RHRA 3ST7A 4RLUB 3DBLB 4AICA 1LO8A 5EJ2A 4JBGA 2V6BA 1EBFA 4Q3NA 5H81A 1NYTA 2J6IA 1VJTA 5JAQA 4PG7A 3GNTA 2CFCA 1KY5A 1U8XX 3RU7A 1E3WB 3AW9A 1YL5A 4PG5A 1PJ3A 3WFIA 3H9GA 1U3UA 1V3VA 4Q9NA 4GMGA 2VRBA 3DOJA 2X0RA 4L8VA 2QQ2A 1DJNA 2PKRA 3TZCA 3AZ9A 1HZZA 3IUPA 5KL9A 5C7OO 2OUIA 3OSUA 1F17A 3T7EA 5JDIA 2J3IA 3E29A 4ALMA 1P0FA 1DLJA 4L9RA 4ND4A 1BSVA 3E5MA 3HDHA 3C1AA 1OC4A 3BTSA 5IJZA 1BGVA 4UVEA 4BOYA 4CLOB 3ZWMA 2IZZA 3AU9A 4LSMA 4KOAA 3LMBA 2I66A 1Q4UA 3E8PA 2AEJA 4K49A 1PZHA 3NJ8A 3TSCA 1JW9B 4RVSA 2Q2WA 2FZEA 3GHHA 3V1TC 3CMCO 3X2EA 3ZGYA 4F46A 3NT4A 4GSLA 3WNQA 4BQPA 3DC2A 4GLOA 4CUJA 3QVTA 1EE9A 3S4KA 2WM3A 4PGFA 4YRDA 3K92A 3WGOA 1QV6A 2Y0CA 4J4BA 3TWOA 1I2ZA 3FR8A 1UR5A 1UUFA 3O9ZA 2YY7A 4IQ0A 3TPCA 4E6PA 3ZWPA 2X7HA 1N5DA 4JJFA 2O50A 2CD9A 7MDHA 2WWRA 5G0SA 1LO7A 1U4SA 4OQYA 1KEPA 3FNGA 4BO5A 3MJ4A 3HM0A 3NDIA 2JFGA 4IQ8A 5B12A 1LLDA 3ASUA 1EVIA 2G82A 3FPLA 3C7AA 1ISHA 3OMLA 3M2PA 3SEFA 3PXXA 3DBRA 5IXSA 4CV3A 2BI8A 2I3GA 2OIWA 1D3AA 2VT2A 2PZKA 2C5EA 1IPFA 4JN6B 3DMTA 4DPKA 4WJZA 4YJDA 1JQBA 5TQVA 3FTPA 4G2NA 9LDTA 1PZFA 5L7WA 2FS2A 4ALJA 3CK1A 3WQQA 1NPDA 5IDXA 1Q7CA 5B4UA 3MWEB 4RPLA 5C5IA 1XIVA 2V7PA 3PDJA 3U5TA 5SZVA 3NT2A 2QW8A 4R1TA 3M1LA 4YAGA 3AY7A 2P5UA 4D42A 2JD2A 4OYRA 3GEGA 3N74A 4LCJA 2PLAA 2Z95A 1U7TA 1F8GA 3L0DA 1L7DA 4XJSA 3TZQA 5CEEA 3ED0A 2JJYA 1PWXA 5BT9A 1A27A 1DPGA 3P19A 1O95A 4A5OA 4BB6A 2X8LA 3JQBC 1DIHA 3DL2A 1YB5A 1C14A 4WUVA 5IXYA 3LC7O 2BFOA 2F0XA 1V3TA 1Y5MA 1ZK1A 3IC5A 4GPD1 2PIMA 1U1ZA 3U62A 4J7CA 3RUHA 3FN4A 3NDJA 4L76A 3WICA 4O63O 3KHUA 3FWZA 1N7GA 3OJEA 5KTKA 4E12A 1K6JA 1DRWA 1CJCA 3W4IA 1WNTA 4BL5A 5BSEA 5IF3A 3WDSA 1Q4SA 2Q1WA 3ORFA 1I01A 2RIRA 2VKZG 3AOEA 1IUKA 1Y6JA 3MOGA 4DGSA 1XCBA 4ZICA 2PH3A 1JN0A 3WWYA 4BMSA 3UUWA 2X0NA 1Y7TA 3LT2A 1RKXA 5I9NA 2VTEA 3IJRA 3VH4A 4WASA 1LDBA 4PLYA 5EQDA 2Z1MA 4BIIA 1Q0LA 2ET6A 4CMBA 4ZQEA 2NV6A 1X14A 4XQ9A 5TJ9A 5EN4A 1JWBB 1DBVO 1TVEA 1R4NB 4RCVA 1HXHA 2FMUA 3B20A 2UAGA 3CZMA 5AOVA 1ZZEA 4FJ1A 3RSHA 1L7EA 4NBRA 1ZFNA 4BKQA 3PHJA 3GVCA 1R0SA 2ZB3A 5TT1A 4B4VA 3R3FA 4CMAA 1MLDA 4DUPA 4MIEA 4EBFA 2WMDA 2O6TA 1S9CA 1B16A 4OMUA 3Q2KA 1BXGA 5CDYA 1JAXA 4Z0TA 5L4SA 3R34A 2ILTA 4B4OA 3DZFA 2VTDA 4PG6A 4YPOA 2Y68A 4BS9A 4CLHA 1H5QA 3JQCA 5C7LO 1EZ4A 3TEAA 3FD8A 2C20A 2JCYA 2OP1A 3IKVA 3RUEA 4F45A 4YT2A 1SC0A 2I6TA 4N18A 3RKUA 1XWFA 1RYEA 2PD3A 4MKXA 4GL4A 3JQBA 1ZK2A 3QVOA 4FFLA 1MG0A 4IDEA 1MV8A 2GLVA 2B5VA 2I67A 2OBYA 3KUWA 4YB8A 4GVLA 1P0CA 4WLNA 1Q7BA 1PJTA 5DNAA 2YQ4A 4NNJA 1EEHA 1NQ5A 4C7JA 4DVJA 5CDSA 2AQ8A 4IDDA 3GH3A 4BUCA 3RU9A 3GRPA 2Q1TA 1IZ0A 3HADA 4R9SA 4XY6A 3GRKA 5SZYA 5JO0A 3JQEA 3AWDA 3PFWO 2P2SA 4IBOA 1LTHR 2WE8A 2FR0A 5T57A 3HN7A 1B2LA 3JQ8A 3QY9A 3KETA 1E6UA 1G6KA 1NAHA 3ADOA 4GWKA 1DSSG 4CL3A 1CF2O 3VOSA 1WP4A 5FYDA 4E21A 3ZWAA 2AV9A 1TI7A 3RROA 4WNIA 2ZYGA 1I3LA 2I76A 4BGEA 2BELA 2PGJA 4E2XA 1SNYA 1YS4A 3BMOA 4Z0HO 4BGIA 2Q45A 2UYYA 1X0XA 4WCFC 4BO3A 1EDOA 2CWZA 3QOOA 3AZBA 2HRBA 3U49A 1QXSA 2DTEA 2WDZA 2X5JO 3GLQA 3IL2A 1TEHA 5G4KA 2EJVA 3GVHA 5U4QA 2PFGA 4LVUA 3HWRA 4DPMA 3NRCA 4KQXA 5I7SA 4AJIA 3R32A 1U2GA 3KSZO 1LBEA 5T8KC 2OOSA 3OETA 1PS9A 5TGDA 1CEQA 2PKQP 5ADHA 2EISA 3ZHZA 3VAZA 2DT5A 4CMHA 2Y1GA 3I5MA 4IDBA 4DC1A 3ADPA 2E6UX 3C1OA 4K6CA 3PWZA 1NTOA 3GY0A 3OEYA 3E9NA 1SEVA 1I3KA 4JJIA 4J90A 2JHFA 4PG8A 3JQAA 5KJCA 4GX0A 3GDGA 5CP8A 5H82A 4XX0A 1XR3A 5A9TA 1AUPA 4B8UA 3JQ8B 3CIFA 1CETA 3UXYA 2FPPA 1I2CA 3GUYA 2ZATA 5HD6A 1IY8A 2Q4BA 3OECA 4ORDA 1T4DA 3K6JA 2OHXA 1DO8A 3PLRA 3PGXA 2NU7A 2DU8A 1GZ6A 3EDMA 4Y67A 3PFFA 2C82A 4C7KA 1HDCA 2O7QA 3V8BA 3VPXA 4B7UA 5GZ3A 1T26A 3PI7A 3DOYA 2UV8G 1Y8RB 4CMIA 4E0BA 3DP1A 3K31A 4BNWA 4BKOA 4YCAA 2OAFA 2CDCA 2PRXA 5JLAA 3WQSB 3G79A 3A28A 1LC3A 3BHIA 3ZV6A 4UEKA 3V1UA 1PS0A 4UEOA 2JCXA 3KM0A 1LLQA 2GRAA 4BHTA 4LN1A 3DZGA 3WWZA 4ZN6A 5DBIA 3IJPA 1XEAA 3GEMA 1PWZA 2O4CA 2VYNA 4DC0A 4GSKA 4LRTB 5COQA 1YBVA 1BVUA 3WJAA 1M67A 3RBVA 4XGKA 3KTDA 1RM3A 3JQFC 5L7TA 4CMGA 5I9MA 3PZRA 4W7HA 4DREA 5ER6A 3ZDFA 4NPCA 4F6LA 2PZJA 1TB4A 3VDRA 3VZRA 3ZU3A 3DBRB 2OXIA 4CLOA 4MDHA 3L4BC 1E1KA 2RH8A 3GQVA 2EW2A 2CUKA 1O9BA 3O8QB 4QX6A 1V3UA 4R1UA 1RM5A 2O2YA 5T6BA 1P33A 4Y6SA 5KJEA 3PGJA 3S2IA 3FBTA 1CRWG 4TRNA 4Y8VA 1HDYA 1BW9A 1SC6A 4RMMA 2YFHA 1YOVA 2IXAA 5CHEA 3LZ7A 2JFFA 4TZKA 4CM1A 3TFQA 3K96A 2O7SA 4GI2A 4R16A 4BNVA 4EW6A 3C8MA 5EP5A 8ADHA 3UGKA 3P3IA 4DIBA 1W6UA 3MEQA 1GQ2A 3WXBA 3W6ZA 2PV7A 3FNHA 5AXAA 5ILGA 4ZW0A 1DHTA 1BXKA 3I9LA 4K00A 4K1LA 2BFMA 3JQ9C 3KV8A 2ZQYA 1E7YA 1P31A 4EEXA 5T07A 1DAPA 4Z6KA 4E5PA 2OKIA 1P1KA 4Y98A 2CVQA 3T4XA 5JDCA 4ZHSA 3R6DA 5TNXA 2E82A 4DWVA 3KYDB 4CM4A 3ZWVA 3LK7A 3KO8A 3QVWA 2CY9A 2R2GA 3BAZA 2VRCA 2VWQA 1ENZA 3WBFA 1E7QA 1H6BA 2Y0EA 2PGLA 2ZTLA 1X7DA 5CFZA 4ALNA 1JKJA 2A9FA 3CTMA 2ZCUA 4PZDA 4B3JA 4I5FA 3D5TA 2BFAA 3PQDA 3L6OO 5IZ4A 4OOBA 4UEJA 4DTIA 1CQJA 1UZNA 1F0YA 1I0ZA 3E9QA 3O03A 4YT4A 1NVGA 1LSOA 2PZLA 4RQTA 1XYGA 3DO5A 1ISJA 3RJ5A 1PGQA 1B3RA 5A9SB 3LF2A 3LZ6A 1LDGA 2WTBA 4BNFA 2JD1A 3HSKA 3FR7A 3ZZNA 1NQTA 4NFHA 4CL6A 2Y1EA 2YFQA 4XD2A 1PJBA 3F1KA 1IQ6A 4IJWA 4KWHA 4P8RA 5GY7A 3GZNA 1X1EA 3U0BA 5IFLA 3ZNQA 4QQRA 2DLDA 3MCVA 1LA2A 4N5MA 1NR1A 3AFNA 5BNTA 2WJPA 2F1KA 1H2HA 3PIDA 7ADHA 4PCVA 1Z75A 3ZU4A 4TVOA 1XU7A 2DBQA 2Y99A 3GGOA 1E3IA 1ZKIA 1HTBA 4LVCA 2X86A 1GD1O 4RQUA 4XZ3A 2ZCVA 3G3EA 3P2QA 1FJHA 2B4RO 1T2DA 4OGWA 4CMCA 2D1YA 3F1TA 4ZRMA 4BNUA 4AJJA 2FSVA 2OMEA 2LDXA 4K4CA 1KEVA 3A4VA 2BLLA 4FQ8A 5GMOA 3JYOA 2VNAA 3IAHA 1YJ8A 4XDZA 5BUYA 2FHSA 2TMDA 5L40A 4IM7A 1HEUA 2AHRA 3KYBA 2F41A 3PHHA 1YDEA 4WCDA 3H5NA 3QWBA 1UXKA 3NV9A 4CQMD 5HRUA 4GMFA 4P4LA 2AG5A 3OJ0A 4KUEA 2CNBA 4CQLB 3GHYA 3WGTA 3DOOA 4E2ZA 5TX7A 3BMOB 2GN9A 2WE7A 2H5LA 1DFHA 1JDJA 3M6IA 4D43A 1G1AA 2NVUB 5F1PA 4RVDA 5JCJA 4YACA 4BV9A 4MP8A 3ZCXA 2G76A 3RUAA 4WPGA 3UF0A 4NBUA 3RFXA 5K9ZA 3L4SO 5U9CA 2BGKA 2NUJA 4U8GA 1GPJA 2H6EA 2C2XA 2R00A 4PVCA 3DAGA 1CDOA 2JAHA 1UDCA 4KTTE 5I9LA 1UZLA 2ZB4A 1WWKA 3RBXA 3IKTA 3ZV5A 1NBOA 5BUWA 1YB1A 2Y1FA 3ZH2A 1GL3A 5JPIA 1LDMA 1YXMA 5ER9A 4A27A 1M6WA 1P3DA 2VUUA 4RPKA 3B1KA 1R37A 3DDNA 3HN2A 4BB5A 4HZOA 2OGUA 1TT5B 3U4HA 5FI3A 5ILOA 5F5LA 1O0SA 3DP3A 1E0DA 1DJQA 3MTJA 3P7MA 2Y67A 3ANNA 4ZRNA 5K6AC 4FGSA 1E3LA 4FIZA 1IYZA 4JROA 4N5LA 4BKUA 2IRWA 3H3JA 4BQRA 4DQXA 1HE2A 1LXCA 1M2WA 3CEAA 1LQUA 4IY1A 4ZQFA 1YONA 3R0IA 1JAYA 1G0NA 2J5QA 4MVJF 3HZZA 1EK5A 2Q2BA 2FN7A 3GNQA 4BGUA 5JC8A 4RLUA 2QX7A 3DBLA 4AVYA 3FNEA 4TVBA 1B3BA 1NQAO 2IE0A 4AL4A 3P3FA 1V0JA 3S2GA 5KVQA 3GGPA 3R1IA 5B1YA 4HBGA 3GNSA 1RWBA 4IXWA 2CDAA 3WSWA 2EV9A 1TA4A 1EFLA 1AXGA 1PJ2A 3BMNB 4HKTA 4PZEA 2VYND 4GAEA 3JCZA 4QXMA 3ONFA 4TSKA 3L9WA 1JVSA 3QWIA 3WEWA 1EE2A 1U3WA 2EW8A 1GUZA 5BSHA 2SCUA 4CM3A 4J16A 1AHIA 1FDTA 2FOIA 2FY8A 4CV0A 1KBZA 1MX3A 4ZJBA 1JWAB 2OL4A 3DBHA 4RLJA 5ES3A 3WSVA 2QHXA 1YH3A 3H2SA 1U5AA 1B26A 3AOGA 3X2FA 3O38A 4WGGA 1NR7A 2UV8A 4MKRA 1ENYA 2QRLA 3DZKA 2AE1A 3DBVO 1BHSA 3UW3A 1HETA 3SPSA 2EHDA 2VZ9A 4FFOA 4RVHA 1LRLA 1I36A 1MB4A 1SPXA 1XKQA 1T2EA 9LDBA 3A14A 2C2IA 2J8ZA 2OFPA 1H94A 5THQA 4E2WA 2DBRA 1LC0A 1YRLA 3FCOA 1DIRA 5HA5A 3SXPA 4CMJA 3L9XA 4H15A 3TL3A 2OWNA 1GZ4A 2W90A 4UVIA 1U3TA 1EQUA 4I9UA 3M2TA 4E13A 5L4NA 2DPHA 3OA2A 5L7YA 4MVJG 5HM8A 3EGOA 2Y1DA 1U7HA 2CYEA 4WK6A 5KWEA 4I82A 3QVSA 3L4BA 3GFGA 3GVPA 4A0YA 4CM4B 2B36A 3KV3O 4W78A 3IS3A 4XYMA 4RV9A 2B5WA 3K73O 4OH1A 2RHCA 3CSDA 4DYDA 1D8AA 3Q9NA 1O5IA 5IZCC 2W2LA 3H7AA 2YW9A 3KEOA 4EITA 1HYEA 3DTTA 3BTVA 5HBRA 1AE1A 3K30A 1N9GA 2VHWA 4FFPA 4L75A 3QQPA 4AJHA 4PLPA 4AJOA 1OAAA 5JAIA 3EVTA 2YV2A 2OO5A 1IE3A 1PGPA 3JD3A 3OQ1A 1XDWA 4LCEA 1LSUA 4BO9A 4NBTA 1TT7A 2VWGA 4IS2A 3GFBA 4HFNA 4XRRA 1KVQA 1C0KA 2YDYA 1OOEA 3EZYA 4AJ1A 4D46A 3CUKA 3RI3A 1LJ8A 1XG5A 4JGBA 4LRSB 5TRTA 1WLYA 5T06A 2HX5A 4RORA 4R54A 2HJRA 4JJGA 3RJ9A 4WECA 1ZJZA 1FDSA 4D0RA 1ZBQA 4A26A 4CLDA 2H1SA 2X23A 2HBOA 2RBEA 3IDSA 2W2KB 4FJ0A 1PL7A 1PN4A 2WYVA 3BHJA 2O3JA 3W4KA 2QRKA 3TN7A 2B6EA 2Z5LA 1P1IA 2VYVA 4WLUA 1YWGO 2X22A 4W78B 3D4OA 2E37A 3COSA 4U6SA 1DC4A 2GZ2A 4XQCA 3OP4A 3RUFA 3OIGA 5JXWA 2X1HA 5LCXA 1VPMA 1IHXA 2FR1A 2XXJA 3RC7A 1UAYA 1WVGA 1M66A 3AY6A 4NZ9A 3JQGB 3UCXA 3VPFA 4B3HA 1M6HA 4GWGA 2Q50A 3ZN2A 3GDFA 5CG1A 3DBHB 4M55A 4MIOA 5IG2A 5HS4A 2GUGA 1GUFA 2YV3A 2IEDA 5TS3A 2BI7A 4AE7A 1T24A 2YDXA 2ZIZA 4HFMA 3WOHA 4UUNA 2UUOA 1LU9A 3VVCA 4F3YA 2BRUA 3D1LA 5L4LA 3WS7A 1Z6BA 1B7GO 1NQOA 4BMNA 1N1GA 2Y05A 2AG8A 1AGNA 1ISIA 4ND2A 2B35A 3AM3A 2C0CA 4WLOA 3IOYA 3N58A 4I9HA 1QYWA 4YQZA 1JU9A 1YL6A 2PY6A 3EY4A 2EGJA 3HDQA 4RF2A 2G1UA 2C5AA 4FW8A 2O6BA 3B70A 1XA0A 3AUUA 2IZ0A 3F3SA 5ENVA 1M75A 4D3DA 3TOXA 4JQCA 4YQYA 3F5QA 4O1MA 1EMDA 3I4FA 4DL9A 3I9OA 5L53A 5CPGA 3KB6A 2HLJA 1V6AA 3NT5A 1YL7A 4A0XA 3AI3A 3OQ6A 2CDBA 3ICCA 2GLMA 1E77A 4CQMB 2HKIA 1A9YA 3DB2A 3HUDA 4IS3A 5ITWA 4Q3CA 1TXGA 1H6CA 3QV1A 2X9GA 5HWSA 5L3ZA 1U8FO 1YGYA 1ZUD1 4E5MA 5LC1A 4M54A 4AJKA 3KLMX 2VHVA 1WDLA 4HNHA 4J2OA 1UJMA 3AK4A 3UOGA 1BVRA 2Q46A 5DOZA 2HU2A 3PZBA 4N5NA 1PGNA 3IR3A 1QYDA 4YT5A 5KJ1A 1IPEA 4YRBA 2HMUA 4NMHA 1LNQA 4QFDA 1H93A 2VHYA 1CERA 4L4RA 1PL6A 3KRTA 1KYQA 2D0IA 3I23A 4OXYA 5TLSA 2PH5A 4RF4A 1I8TA 5HMCA 3ESIA 2EKPA 4J91A 5JW6A 2P68A 4I5GA 3KBOA 2GF6A 2EGGA 2PWZA 4KUHA 4MVJD 4BNZA 3V1YA 3C3XA 4NK5A 3WNVA 2Q1UA 4P22A 2GLXA 4XR9A 1DLIA 2B4QA 4XIJA 5KVVA 4JLWA 3A06A 4ZU3A 3WIEA 4B0JA 1ZHGA 3R3BA 4UVGA 3BTOA 3OBBA 4WOKA 3AUAA 4R5HA 3MJEA 5I7VA 1WDMA 2DAPA 2O6UA 1WZIA 3DOZA 1ZIDA 4PIVA 4MP6A 4QT0A 3D6LA 4MJLA 3JD2A 3TJRA 2AXQA 2ZTVA 3G49A 2BH9A 3UN1A 4I1IA 3RC1A 1DIAA 4BVAA 1E7MA 2I3AA 2ZJ1A 4ZJUA 2GVHA 3RKRA 2X0IA 2EJWA 3QLJA 3TZHA 1WMBA 2CF5A 3OJOA 3ZI0A 4CR8A 3DAPA 1O89A 3N7UA 4LMPA 4LSWA 2HJSA 1D4FA 1WN3A 3ZW9A 1R0LA 2CVZA 4ALKA 4B4UA 4QUKA 1R4MB 1LUAA 3DFUA 1NHWA 5EL0A 2GN4A 1QYCA 5HTOA 3GZNB 2C7VA 4XYGA 1ADFA 3PLNA 1T2CA 3WQRA 3INRA 4W6ZA 2OBNA 3KOUA 4YJHA 4FGWA 4LK3A 5DF1A 2WYUA 3RVDA 1SH8A 1NJKA 1GDHA 3EHEA 2Q1SA 1QP8A 1KETA 3Q62A 4AJPA 5C3MA 4BKRA 4YAIA 3D3WB 4ROSA 3DP2A 4IDAA 1GZ3A 3G1UA 4JBIA 2A94A 5JSFA 3RC2A 1J6UA 2P4HX 5EPOA 1ZSVA 2BGMA 1R15A 1IL0A 4DPLA 5G4KB 3S2FA 3UCEA 3ZWOA 4W99A 4D3FA 4E5NA 3O4RA 4QDBA 2PTGA 2BI0A 4BNHA 4O6VA 2X9VA 4JK3A 1T82A 2GR9A 3GGGA 4CQLA 4QECA 1P1RA 2A4KA 4FCCA 4HX5A 4RLWA 2CSUA 3ULKA 1KVRA 1C8UA 4LISA 1KERA 3EMKA 1ISGA 3ZU2A 3HDJA 3MOIA 2DFDA 3PJEA 4TROA 3E1EA 1Y8QB 1LI4A 3B1FA 2DTDA 3KX7A 1YO6A 4TWRA 4RPHA 3TZKA 6LDHA 4WEOA 4NDNE 1QR6A 4INAA 4YXFA 5GZ1A 5JAZA 2GLLA 3VKUA 1ADGA 1DB3A 3K2EA 1Y9EA 3PWSA 4OHUA 1I24A 4MP3A 3BXXA 1SMKA 1Z54A 2P91A 3I9MA 4DIFA 4EUFA 3AUSA 2GERA 4NFYA 4CM8B 4ZQGA 1HDGO 5F1OA 4B4WA 3KV7A 1MP0A 1D1TA 4E5KA 4DA9A 2FUJA 1HDRA 1DEHA 1SAYA 2ZB8A 3D04A 2P4QA 2VUTA 3PP8A 4IQGA 5A9SA 4IMPA 4K9DA 3B7KA 4D79A 5A4DA 3BYZA 2EGIA 1AN9A 1ZVMA 1EUCA 3JYPA 3WYCA 4EDFA 5A9RA 4FPXA 1BTOA 4MPDA 3GZ4A 3GG9A 3W8DA 3JV7A 4FQ9A 3HG7A 2O3RA 5EESA 2X0JA 4RDIA 2JCVA 1LDYA 1GR0A 1YLIA 2EKQA 1DRUA 1GQQA 1ZXBA 4JX8A 1CYDA 4QFCA 1ADCA 3JQ7B 4YYZA 3MTGA 1RYDA 4ZVVA 4QD7A 3LSYA 3GA0A 2NVUA 3D4PA 4Q3EA 5AQ1A 3HFGA 3HJAA 4ZRBA 3JD1A 1R4MA 3GPIA 3GMDA 3KSUA 2GNAA 3PWKA 4L4SA 3LDHA 4PLWA 1E7WA 3PHLA 1X0VA 2TMGA 1HSOA 1O6ZA 3FF4A 4FJ2A 3DQPA 4NJMB 1U3VA 5I7EA 1ORRA 4WNCA 4PLVA 1LDNA 3NJ4A 1AHHA 5T67A 3QIVA 2V65A 1Z7EA 1BRMA 1NVTA 2B4TO 3TFOA 3U4CA 3RFVA 2EEZA 3MJCA 3LT4A 4RF5A 1SBYA 3ANMA 3DHYA 4II3A 1ENOA 1BVQA 3PIIA 1N9GB 1CWUA 1HDXA 1P44A 5T5QA 3ROPA 1GV1A 1SEPA 4XJTA 5T64A 1HWYA 3CF9A 2HO5A 2DKNA 1K0UA 1ONOA 2HK8A 4XYEA 1IOLA 2X5OA 1PJLA 2B0JA 4AJNA 4R68A 3RUDA 2GF2A 2VCYA 3KLPX 4H16A 5TJHA 1KVUA 2VWHA 3OJFA 6ADHA 3DEYX 5F5NA 5AVOA 3DZHA 3PHGA 2GYYA 3D64A 1A71A 1WDKA 4IJVA 1K6XA 1WXDA 3EAGA 2BMAA 2I9PA 4ZGWA 4WE3A 4NU5A 2Q78A 2EGRA 3FWNA 2E49A 1HE5A 1U28A 3E82A 2NU9A 5DM5A 2W3XA
chains in the Genus database with same CATH superfamily
1BAPA 3I9JA 1IEQA 4XD7D 2YV4A 1Q6WA 5BVHB 5IKXA 4TLCA 1E2BA 3HRRA 3A1TA 2R6JA 2Y1KA 1JDSA 2O5RA 4BWGA 3CRMA 1KMNA 4BNGA 4JXZA 4LF7E 2UUPA 2V55B 1U3CA 3KWRA 3H13A 4G0MA 2JGFA 3B1WA 2QIOA 4KDEA 4N54A 4XX1A 2YFYA 3I6MA 4TMFA 3NI2A 5ECDA 3WYEA 2WT9A 3OPNA 3IEMA 2I4LA 5LQDA 4DM3A 4FUTA 3CLSC 4WSOA 1HEYA 2FX3A 1GLGA 1U0RA 2I4RA 5E9AA 4DC9A 4K40A 2WWWA 2WWHA 3GU3A 1ZR9A 4RK4A 5A6VA 1E7RA 4HLNA 1LEHA 3IAXA 4M9QA 1F8UA 4F56A 5F7JA 1XROA 1G4UR 1G21B 1NX6A 3ASVA 2RB4A 4XWAA 4LDNA 3TEJA 1H0RA 1RXVA 1V1RB 5EEGA 3B1ZA 3N1UA 2VTBA 1IN6A 1RRGA 2OYRA 4GR4A 1N33B 1AQIA 3AR2A 3OTOB 2IHKA 1BG6A 3R4CA 2HFJA 4Z1OA 2ZDQA 4XQEA 2W4MA 3WK5A 1NNUA 1K6EA 4U2FA 4B7AA 5TMDA 3OQJA 4CKCA 1L7PA 1OI2A 2ZI4A 3OZWA 4DIOA 4FHEA 1UKVY 2H65A 2ZXFA 3CZQA 3T7AA 1FJGE 4D74A 4UPEA 4EPYA 5FOQA 4Z4IA 5BR1A 4HNAA 4TXNA 2ZIGA 5J2TB 1ZCJA 1VDZA 3KJEA 4GNKA 3H9CA 4MTUA 2W4IA 1N33E 1LV7A 2L3JA 5CJJA 2VEDA 1GAQA 2ODEA 3GK3A 3EC7A 1FW8A 2F55A 1ZN8A 2ZT5A 4A0GA 2GN8A 4J9VA 1XSEA 3E53A 1OWLA 3HVHA 3NHMA 5C3UA 3SFTA 5DKFA 1MG5A 2PV0A 2WKPA 3HR4A 5JC1A 1E58A 3HKCA 4MWOA 2OILA 1VBKA 4MR7B 1GEGA 5H83A 1R74A 1Z16A 2WKSA 3HGMA 4U6QA 5DHTA 4ZZ3A 1QG6A 1QYXA 2Y1WA 4M1SA 4NU6A 1YR9A 3ZOKA 3OEHA 4A7PA 2DF8A 2YJTD 1ESMA 1Y3IA 3VNQA 2C4MA 4LF6B 1ZSYA 3TECE 1F2DA 3E8XA 2W11A 1EWVA 2WJ4A 3DGEC 2WFLA 3NBQA 4QUAA 1RRKA 4OJYA 4RJIA 4ZO4A 4Z54A 1KTIA 1C2YA 2H4ZA 3RC9A 1UBJS 3C85A 3CW8X 1KRWA 4G8BA 4C29A 3DEHA 2RJNA 1ZL0A 5SYAA 3M3DA 2FG6C 3KKQA 4EUEA 1E7SA 1OZFA 4JS0A 1YOBA 2HGSA 3TBKA 1F3OA 1HL3A 1M2KA 2ORYA 4LS3A 2W6OA 2I71A 5E3JA 1RZ3A 2QRNA 1T3ZA 3U3RA 4CEHB 3CZ9A 2I4NA 1AKUA 3O8QA 4YJ3A 3ODPA 4ARZA 1ZP6A 4WFJA 3G2OA 3NTQA 1AKEA 4IXTA 2JDID 3V1UA 1JKFA 4AC9A 1UWKA 3LT0A 4Y7DA 1SKAA 5I9BA 3SYNA 3ZV7A 1KI6B 1Y7UA 1NASA 3TJMA 5M7EA 1JEQA 1XCLA 1QMGA 2MSCB 1HDOA 4WKGA 2WWFA 4OKNA 3BXPA 4NK4A 1RKUA 1M2VA 3A6EA 1JA1A 4I3HA 4DCSA 3AG5A 3ENVA 2DY0A 1DNPA 1K92A 2AA3A 4JVMA 5AKHA 5NLLA 2FLVA 3O75A 3FDJA 5D3QA 4X9XA 3ER9A 4IJ6A 3IURA 5TMEA 2LCQA 3I2HA 5EWLB 5EY5B 2KPOA 3CRW1 1XLUA 1LGYA 4BFZA 1D7AA 1VDMA 1LVGA 3FRJA 2BBOA 2PZGA 3DO6A 3GCZA 4CETA 1O97C 5CEFA 3B6IA 4FX2A 1L5YA 1LBTA 1ZQ9A 3TRJA 2DUMA 1XZGA 1P1HA 4GKAA 4K1XA 2ZB7A 4H0CA 4J1TA 4P4GA 3GBVA 1W1WA 1T8WA 1F7VA 2QV0A 5IN5A 4NTZA 5KNBH 1I4TD 1FDUA 1UH5A 1Z6XA 3QEMA 4K0RA 2XSZD 4B3CA 3HA2A 4RHCA 3FM9A 3V48A 4A10A 3OQIB 4KR3A 1H2BA 2HC5A 1JZSA 4QLOA 4E70A 3DC7A 3GT0A 3NTOA 3SMQA 2YR0A 5FBWB 4V02A 3KQVA 3V7UA 4F91B 2C7GA 4AAYA 4MVWA 2YBDA 4ZYTA 1VJRA 3VPHA 3T0GA 1YYOA 1O87A 3NHAA 1Z1BA 3K8OE 1YDMA 4P6VF 4PHGA 4L3WA 4CJXA 2HXGA 2ZI7A 4F85A 4AF6A 3C1UA 3FUTA 4OHCA 3QVUA 3ZE1B 1OIWA 1MW9X 3UV3A 5CCXA 4ZEXA 3HXTA 3LQFA 4XX0B 4G5SA 5J4LA 4EI9A 2WJ3A 1KS9A 2EOIA 4AJ2A 5BT8A 1WBJB 3KAQA 5FPTA 2MSDB 1GL7A 2EM4A 1PWYE 2VA8A 4G0NA 3KVUA 4D99A 2F8MA 3WYBA 1C2TA 4Z5XA 3DCIA 4HEHA 5GJBA 2VJAA 2IZ6A 1AKTA 3EWSA 2Y0DA 3FHLA 4QDXA 5CJ2A 5AHKA 1P9WA 2GX6A 3TW6A 3W5UA 1JR6A 4H4GA 1A0OA 4KXXA 5LXTF 1MB3A 3IOEA 2K4MA 2R7NA 1IEVA 3EBLA 2H5EA 5KNBD 3I64A 2CYBA 3IUSA 1J9GA 2I65A 4MW0A 2IP1A 1YGPA 4MIYA 5FF9A 5FBQB 4I6GA 4P93A 1ZW1A 3NOVA 1KYIA 2D5CA 5H70A 3O4IA 4CFSA 4AM8A 3H5AA 1SKYE 1YT5A 3ZIAA 3OFJA 3B6EA 3GAZA 4KP7A 4W5HA 3ZHYA 3Q7PA 5BSVA 5JCPA 3SSAA 2OQIA 2WAOA 4XRGA 5JQGF 2J9XB 3OLYA 1BH6A 3F6CA 3IUMA 1BXZA 2MR6A 3PHBE 4OQMA 3HSYA 3Q5DA 2I33A 5SZZA 2WR8A 4UUMA 2CC2A 4TMZA 2OD2A 4NE7A 3QEJA 4OHVA 3A32A 3WFZA 1O0CA 1FTWA 1EXNA 1HSZA 2D06A 3IERA 1HQDA 1WS6A 3INGA 4TXHA 3ETCA 3GCXA 5G0TA 1M6YA 2YIVX 4ZVLA 1SG6A 3QI7A 4II2A 1XQ6A 3RYFA 4G07A 4TT3A 2LO3A 2PVCA 3OQVA 1EBUA 2QSJA 3BSWA 3AVUA 4HN2A 1YBMA 1M2OB 4L50A 4ZZIA 1QYIA 2ANCA 2W2LD 4R0NA 4RGVA 2UYOA 4YAFA 4OHWA 1GN8A 4XEHA 4PW0A 1E8NA 3VPAA 4E7PA 4RGQA 1GITA 1PLJA 2A78A 1NWHA 3H9UA 1HYGA 5BP2A 3EA0A 1I2MA 4NJEA 3SC4A 1R6DA 2VJBA 4GDFA 6AT1A 3ANLA 3QYFA 1UMCA 4C1BA 3AF6A 3T9DA 4JI0B 2HCBA 2QRJA 4GXTA 5FOUA 3SFVA 5AFSA 3NG1A 2K7FA 2QM3A 2LCFA 3NM5A 5KJFA 2LV2A 2UVPA 2EN8A 4RZHA 3L0OA 1MX1A 2OP0A 4BO8A 1X6HA 4GEGA 4I5EA 3IPAA 3BULA 5IJXA 1DC7A 3CR3C 5AI0A 3G9XA 3BQNB 4UBOA 1A9ZA 2EMWA 2GZ3A 1GADO 3ETLA 1ZUNB 1NF2A 4X8WA 1GZDA 5HGJA 3G8YA 4H1HA 1Q14A 2ZWOA 1SVKA 3W2GA 2QA5A 1J1IA 3T5CA 4CBVA 4P38A 3IKJA 4LXUA 4RIFA 5EIEA 1MR3F 4GGPA 2QTGA 3MTBA 1XZAA 5AC4A 3A3YA 2W2NA 3KYIB 4N1AA 2VZ0A 5JT1A 3L07A 1HQYE 4UFNA 2LVBA 3N6RA 4UUQA 5LA6F 4EYSA 1ECFA 2OWEA 4LY0A 5GJVC 3KUDA 3MS4A 3V3TA 5EMLA 4O29A 1ZNZA 3AZ8A 2ACVA 3L7LA 4KB5A 3ISJA 3Q8KA 2NACA 3SJCA 1MEYC 1DEAA 1K5GA 2WWVD 2H18A 3HBAA 3SGLA 1Q16A 4X24A 3EAQA 2EZ4A 1ODIA 3EQ6A 3HBMA 4KHPE 5EO4A 4ID3A 1MGTA 2CW5A 2YZTA 1EFCA 2FW7A 2JAOA 3HKDA 3PQFA 4RD6A 4WLVA 3ZGVA 1T4CA 3UV7A 2DVMA 3LYHA 3U7FB 2QZZA 1YIDA 4W5NA 1TN9A 1Z6YA 3MINA 2WF5A 3NZEA 4O59O 4EPWA 1SUAA 3T54A 3S2UA 1Z7GA 1JJAA 4FSXA 3P2RA 2DUUA 3BPSA 5F1KA 3M3PA 2OQ2A 1NW8A 1WJGA 4DLUA 5BNZA 3FZNA 1E1YA 5L9AA 1A7KA 3QFFA 5EIBC 2EJCA 4EYEA 1L4MA 2PD4A 5TGZA 1T4BA 4B8ZA 5DHRA 4K4BA 3KBBA 3SQMA 4YV7A 1HE4A 2XGGA 5DBEX 2ONYA 1EVJA 2Q4EA 2BFBB 3HCAA 4I2NA 4ZA2A 3RT1A 4X3PA 2P9CA 3Q3HA 3V5NA 5DM60 4MULA 4Q1AA 3GCDA 4IZHA 4B8YA 1GYRA 1EHYA 4OI0A 4CKBA 4M2LA 1BRTA 1ORTA 3H1TA 1B2RA 3BD6A 2PBZA 2WJAA 2NUBA 1QGUB 1ECGA 3V8RA 2VRDA 1RWVA 2Y71A 3H4VA 3NHFA 2GCPA 2PZHA 1SQ6A 3VZSA 1I4WA 2EIHA 2BHLA 2AFVA 1DUSA 2QLNA 4DMFA 1GA1A 1L0BA 1X1CA 2OCAA 3KVIA 3HB4X 4Z86A 1TYBE 5ICSA 4X97A 4TVSA 2IYQA 1ZVKA 3FETA 4HLUA 3C4JA 1GU0A 1W87A 1T9KA 5LNK1 1JJFA 1SB8A 1DFIA 1E3EA 1Z3CA 3COPA 3QF7A 4KR0A 1BDMA 4WX9A 5DDIP 5ERYA 1FK8A 5G4LA 5CA0A 3BORA 4F9BB 3QOXA 1K8ZB 3WLEA 1PZMA 1S5UA 1S3IA 5AJWA 3IQDB 4GKVA 4C0SA 4I4JA 3ETJA 2BJVA 3NBUA 1C1DB 3OOHA 4MPJA 4RCZA 5HKKD 1QS0B 2ZP1A 1U4OA 1NULA 2GDJA 3LW8A 4P5EA 5EJ8A 1QRUA 3WI7A 2Z5FA 4DTCA 3EARA 4YAKA 2HJWA 3S7TA 1F5NA 1BA2A 3OZXA 5J23A 2BVNA 3WGZA 2QBYB 4I5DA 3GIWA 2Q8QA 1DELA 1HE3A 1JQ5A 3AQ4A 3D5QA 3P5SA 4IJUA 4L5JA 4LHWA 2X4LA 5FLYA 5AXDA 3W2EA 2EM2A 3F47A 2VO1A 1COZA 1IBSA 2F2TA 4JKYA 1PNQA 2B8EA 3C2QA 4UDXX 1C1XB 4X8MA 2H17A 5EKUA 1KH2A 4WBNF 1YDGA 2G63A 3AIMA 4LXTA 3MERA 2V0CA 4LJ6A 3S29A 3TLBA 3E9RA 2FP3A 1IN4A 5AIBA 4PRYA 4CIYA 4FX5A 3TOVA 1E5XA 4XSGA 2FSPA 1KE2A 1NQXA 4W8GA 2VK8A 3WAJA 3L6EA 1OV4A 1P5JA 2V96A 3RYCB 3L7CA 2QRQA 1ZIPA 2JFZA 2XCOA 1J8FA 1JQJC 1C1DA 5GQSA 4NYIQ 1KF0A 5JNSA 1KBOA 1AH5A 1ZD9A 4AQDA 1UT5A 5DLYA 4H3SA 1Q92A 4HRXA 1YCGA 3CF8A 1TZMA 4KBGA 9ABPA 1U2EA 1UMDB 1C0IA 2VLIA 1CF9A 4FGUA 4IGEA 3IIKA 4XM2A 1V7PC 5F51A 1J8MF 4LBZA 3SG0A 4FK5C 4RGBA 3UWMA 1LBQA 1X1TA 4JIMA 1Y5RA 5IRCD 4D25A 2DRIA 3GBPA 3P9ZA 1EGAA 2EERA 2H63A 3VDQA 4E3WA 5CVEA 1VG0B 4M99A 2FSSA 2PCLA 3P0FA 4MQEA 3VHLB 1G19A 2V0NA 3AETA 4HVAA 3I5AA 1YHNA 1FMTA 1SU8A 2A86A 1P0PA 1VSUA 2RGCA 4DR2E 1NAIA 3F5OA 1CUFA 2R47A 3DDSA 1RXIA 3G17A 3G1TA 3I2KA 3F6BX 4LNAA 1L5VA 1T6XA 1MKAA 2WMOB 4M0DA 2QW0X 4QDZA 1GNVA 4R51A 1P18A 3Q0IA 1XDDA 1XZFA 2R6DA 3DPIA 2RH4A 3ZGZA 4BP9A 3J81C 5JCXA 1A8SA 1E96A 4GR9A 2NUTA 4BU1A 5E7JA 3O1LA 2AEMA 3BX1A 5TDHA 3GW8A 5FQOA 2OHOA 2ECQA 3GF4A 3GJQA 3NC4A 4X93A 1XB2A 2KM1A 3AERA 2G6BA 4PXYA 5HR5A 4K9SA 1J5XA 5JJBA 1IBKB 3RASA 5KWSA 4CF4A 1XTIA 3LFHA 3A10A 3RIHA 3TUIC 5CT5A 1ZOIA 2FV4B 1U8TA 4QLAA 1C3LA 4CV2A 4P83A 3G2QA 5BV7A 3ZHOA 3P9XA 2Y6UA 1F4LA 2YYYA 4FGLA 1KH3A 2OO7A 2QN8A 1Z25A 5JZOA 3CGWA 2YSOA 2OCGA 2QTFA 3KQSA 3DNPA 2XEMA 3BIXA 2W43A 4PCLA 3FMGA 1IIBA 4BZWA 4HVTA 4NHOA 2QM0A 4CT4B 4EFNA 1N3IA 1NWCA 1S96A 1UK7A 3VR5D 3CG4A 1RYHA 4LCBA 3E2PA 5THKA 5JS8A 4P7BA 2WD7B 2QVXX 5DTMA 1IZ9A 4AY3A 1U63A 4GH5A 3IAM6 3LK6A 4F2DA 1WULS 4Z3KA 3FLEA 3LBBA 1F6WA 3TQCA 3DTYA 1H9BA 3TVYA 2PKWA 2H1OA 1GKLA 1ZY2A 2F59A 3M3HA 2X0FA 4RKRA 3TZ6A 1NOJA 3PRKE 1SWWA 3B7JA 4UAGA 1POWA 3MZ0A 1KE1A 1TK9A 4MKIA 2O3SA 1O08A 4L08A 2PHZA 1XZ8A 2EG5A 2GCNA 2R9VA 1KIFA 3X2SA 3EGCA 3G9ZA 3REGA 2QD2A 4G5HA 3ZU6A 3FJYA 5F7XA 1P60A 5I7WA 1Z28A 3ICPA 3BXZA 1MH1A 4ZYEA 4FYKA 1Q57A 4NBVA 5D87A 2Q8NA 2XUFA 1DTSA 3ETEA 5JAOA 3A6JA 5LVAA 2P7IA 4LF4B 2IYWA 2ZRDA 4P80A 4YREA 1HZZC 1B14A 5L3VA 1OXTA 3BJIC 4FMBB 1D7OA 4DQDA 2HRZA 4PC6A 2F6RA 2XT6A 3SX2A 3SXJA 1XNQE 3VVBA 4KUGA 4TGLA 5BV0A 3OE5A 3FYHA 2HDHA 4GQAA 3TLJA 2YJZA 1R16A 2GF9A 4HZGA 3MWKA 4GGOA 3UEOA 1NUUA 1R7RA 4PLZA 5JEDA 3OEHD 4E5YA 1U7WA 2XB8A 3T4PA 2GO7A 3LM8A 5CT8A 1QNLA 4HGYA 2FEOA 4FOSA 1S4QA 5EXDA 1GM5A 4FOOA 1G20A 3ICEA 1YZUA 3A11A 4IF6A 4RIEA 5KQSA 4YHBA 1DOAA 1KK3A 3C3WA 4C21A 4Q7QA 1N3LA 1OHHA 1LLMC 3HCFA 4KZKA 2E1MA 2EKZA 2WF6A 3PEFA 4JUCA 5SZIA 1Z73A 1GCGA 4EY3A 1AAYA 1ORIA 4ITVA 2H2FA 2BM8A 4ND8A 4BN5A 3B82A 4HNGA 5LP6B 1EJ0A 2QN2A 2IPAB 4P4TA 3WGGA 3H17A 5BN1A 2FMTA 3WK7A 1B8UA 1H3FA 1S3SA 1MA3A 3LT1A 3UVEA 2HDOA 1WQ1R 4BBJA 1DRVA 2UZIR 7GPBA 3PLAE 1ODTC 1C4XA 1P7YA 1X1SA 1NBMA 2Y2UA 5DN9A 4L0QA 4MUHA 4D3XA 1NLMA 3PDCA 4MV4A 3P2SA 5HS6A 4PZYA 2P75A 2FCAA 4DWOA 1UBGA 3BB4A 2UXBE 1WXHA 1SC3A 1IVNA 2PIDA 4L9SA 2TECE 3VTZA 3TSYA 1QB7A 3DP9A 4CKBB 3E5HA 3MIIA 1PJQA 1Y6ZA 2NNLD 1ICIA 4O43A 3I3OA 3NGMA 3V46A 3VKVA 4S1VA 3X1JA 3BMQA 4XA8A 2Z2JA 2RGBA 5CTAA 3AHJA 3H9EO 5DWVA 1FUEA 2DH6A 1EUZA 1WUTA 4DIKA 1YVEI 1K8RA 3BSSA 4NXNB 4FSHA 1TF5A 4ADSG 3QEOA 4ITUA 4KV9A 1H85A 1PRYA 3IO5A 3STHA 3U1BA 1AM4D 5A0VA 3H3FA 3ACCA 4R2SA 4FW9A 4OXXA 1EBBA 3F78A 4XUDA 3ZDXB 3K72B 6REQA 4KBYA 2ENHA 4G6ZA 4R05A 2FPRA 2VP9A 2EPOA 1RXUA 2O8EA 2ZRKA 2XODA 2QG4A 4Z0PA 1UPBA 5AKZA 3HU5A 1OXKB 4YRTA 4IIVA 5A1TA 4FDMA 3QE9Y 1BHQ1 3CEJA 3QE4A 5IVKA 5AKKA 2IDZA 2VOEA 4BVJA 2BFCB 4L5BA 2FEMA 4GYKA 1T9BA 1CLUA 1JIVA 3IXLA 3PYMA 3PQ7A 4EUKA 2OR3A 5M3BA 2JIQA 1PAUA 1Q0TA 1LPOA 3D6XA 2EWLA 1RKBA 1YJQA 2ZGVA 3I83A 1PKEA 2EKLA 3IA7A 4J7XA 1TU0A 4YNBA 1VPDA 3DW3X 4JAVC 3VYUB 5F23A 1XCPA 4P08A 4BVGA 3KIPA 1B0AA 5AHOA 4Q6BA 3TAUA 3RK1A 1ODSA 3F6SA 4GX2A 4RZUA 2Q2QA 3PQ5A 1JA9A 3I04M 3QPVA 3PC3A 4G26A 4MCIA 3PD0A 3GYBA 1W0KA 5DMXA 1TF6A 1WY5A 2MINA 1H0SA 3BXFA 4NJOA 4UDYX 2L33A 4NOLA 4BY9E 1VLVA 1ULUA 3D4NA 5JAPA 3L7MA 4ZAYA 1OZAA 2RONA 3GFRA 5ICFA 1FYXA 1W34A 2W2MA 3CSSA 4EABA 1FTQA 3UKDA 3JAKB 2QD1A 3OHSX 2CNDA 5DX1A 1SO8A 4NBWA 5D00A 1Q1QA 5EWMA 4B17A 4UZSA 3LYAA 3U9LA 2VDRB 3AUKA 2J6CA 4R3UC 4LF9E 3A25A 1L7AA 1FRZA 1GUBA 1IY1A 3LPAA 4WCFB 3WNDA 2ZSFA 2NAPA 1W5AA 2UYCA 4O3MA 1JR2A 3P4YA 4S3MA 3ZNOA 5K6RA 3ECRA 2B4YA 5CLGA 3HXMA 4HDCA 4YT8A 4CU2A 1A8IA 1NBIA 1KAHA 5LWHA 3KG8A 1MXFA 2VF4X 2W98A 2IWHA 5FPPA 3O8DA 1NJ8A 3KG9A 3RD5A 1Q12A 3S2ZA 3VYVA 3ZWBA 3QVVA 1UBOS 2H29A 2Q5HA 3WRWA 2PKQO 3MJRA 4QD8A 1CUVA 1EFPB 2D5AA 4HUTA 1ESEA 4MVJI 2XWSA 3T3GA 3A1EA 3TXXA 1XRLA 4MW1A 2DP4E 1VH9A 1PZGA 2N3GA 3K0FB 4KVGA 3E1KA 1MPTA 2R7AA 3TTUA 2HQOA 4BN0A 2HMTA 1ZRHA 4DMLA 4NH4A 5CIWA 5J2UA 2ASEA 3ME5A 4BNIA 4B73A 1DDOA 2IIQA 4D0LB 1I3CA 2ODTX 1H4SA 2OGWA 2D5LA 2R1UA 3RHFA 2X42A 1ECJA 3RQSA 1NHGA 1ZUIA 4AZTA 2N46A 2PLWA 1OKKA 1GPDG 3IMKA 1TZBA 1W75A 1UILA 1T5BA 3GOHA 1GCAA 4JBNA 1E5LA 4UDNA 2G0NA 2QTHA 3I72A 3LVFO 4AO7A 5KREA 4AZWA 2VN8A 2J41A 3JQFA 3CVVA 1GRQA 1KZGB 1R66A 2WQZA 1I4OA 1VIDA 4N12A 1J2JA 3CLTD 1BCSA 1VLHA 1PX0A 3PE3A 5A7FA 5IANA 3K9NA 1JBEA 1KJJA 5K3AA 2BSQA 1OQAA 2XWQA 3KXIA 3E5RA 1YDWA 3OMWA 4QQNA 3TQHA 5K8LA 1XZIA 1H9AA 4XYBA 2ZM6E 1G3RA 2H11A 2YRHA 3LPCA 1PJSA 3DHNA 4WFKA 4EG3A 2PL9A 1DOHA 5HTKA 3P9RA 4KQWA 3QIAA 4LJYA 1QG2A 5G2OA 5AVSA 4C5CA 3QX3A 1NQVA 2WNIA 4M1OA 2F9FA 5ULLA 3R5HA 5EGKA 1E3QA 4H7JA 3ND9A 4PLGA 2WT8A 2VDMB 4GAHA 1B0PA 1Q3TA 5BN5A 2B2CA 2OSBA 2H7CA 1FMCA 4JCOA 3VZPA 4E15A 4EPTA 4FB5A 4ZDIA 1X19A 3P9IA 5CFLA 1ZD1A 2BKAA 2YWCA 4KQ1A 4OKIA 4N3BA 2Q5IA 3OZGA 1DBIA 3BCRA 4JXKA 2WFLB 1F14A 5CNJA 2WWYA 5C31A 2F00A 4JI3E 3CVJA 3UJ7A 4UBNA 3ROKA 3GVIA 3OZVA 4LF5B 5TSEA 3DLBA 2WCC3 4Q15A 1GNLA 3FGZA 3KZCA 4BJ6A 1Y1TA 2ZYDA 1KEEB 4YJGA 1JE1A 1SUIA 5K7SA 3DE1X 2D0PB 2FB9A 3DVRX 3I42A 3VHRA 4QBKA 3IKLA 4E88A 1JNXX 4EX6A 2R751 5CFPA 2C2YA 3D3EA 3HLKA 2VHXA 4K28A 2Q4DA 5THXA 1NFFA 4JI6E 2FZLA 1VXOA 3FYUC 3IPLA 4EARA 2Z1NA 4DV7B 3D3NA 3BGHA 1RBMA 1LO9A 3JU3A 3R3SA 3RREA 5AKXA 4ARBA 5FTNA 5JY6A 2CFTA 4H7FA 2HUNA 4DR1B 3AB7A 3AIOA 1DGCA 1RJDA 4LNHA 1RD4A 1JFFA 2ONKA 3QXSA 3TZEA 2WTNA 4X6LA 1GTMA 1HOXA 1UOOA 3S4YA 2DZDA 4ETMA 3EEOA 1QKIA 3L1IA 1G291 3DLTA 1LQTA 1B69A 3TQIA 1XMPA 1I7NA 2J5KA 2NU6A 2VJPA 1ZUHA 5DSTA 4BFCA 1LVHA 3C5HA 1NA5A 1YB6A 2AK2A 4HD8A 4ND5A 5HXAA 3KKZA 2A9JA 3PKIA 3WLTA 4BLUA 2BEVB 4WLFA 1TAUA 2AJ8A 2P7HA 3OG9A 5CAEA 4MAAA 5KVSA 5KX5F 4DR1E 2EN6A 2AX4A 3A6KA 2XCLA 3EFOA 3GZTB 1PDVA 3IIJA 4IZIA 4QSMA 3FOZA 4YALA 2HLHA 3D0KA 4N7RA 4JLPA 5E3IA 1IWPB 1MCZA 2P11A 4M8SA 4ZYHA 3M9XA 4MLPA 5CK5A 4ERNA 4V0KA 4QYMA 5JWHA 1EFPA 3MT9A 5CCBA 1DHRA 2J30A 1SXIA 4KWIA 1EXVA 4PY2A 1GAEO 1ZRNA 3U7EB 1SOWA 3C7TA 3ZDZB 2ZUWA 4HAOA 1E1CB 1NXPA 4BKPA 3CIOA 2Q8UA 3W4JA 1ESNA 4FE3A 3W7VA 2OD9A 1ONNA 3KQKA 2FUG1 3KYDA 3N07A 2VTVA 4O2LA 4UM8B 2QMOA 1Z5ZA 1Z18A 1VB5A 5HNKA 1TQDA 4EYKA 3UFXA 1M34B 4PFKA 2JJ8A 2O23A 3OEWA 1JEAA 2VYFA 5A5EA 3OJWA 5AW8A 1EH5A 4J3FA 3K67A 4DWWA 1XELA 4M36A 1NX9A 1Z7BA 3RTDA 4B3XA 5HFAA 1QRDA 1COWA 5DCUA 3P45A 3QBEA 3WMGA 1YQEA 2FMFA 1UFKA 3BA6A 4D9HA 5I47A 1SD1A 3S81A 3VNUA 2RGYA 4PZCA 2H54A 3CNEA 3HKCB 3L1HA 1O0WA 3ZKAA 1QIIA 3BMCA 4LMAA 2EQAA 5EO2A 4WSGA 3U3JA 2P9EA 4ZWNA 2ATCA 3CVWA 3RUCA 4UU1A 2AQHA 2V97A 3CINA 1F06A 3A6LA 1U28C 5A1JA 4B6EA 4NAHA 3R5SA 3VYSB 5JDIC 3FMIA 4EGQA 4IMJB 3TZBA 3OY2A 4LFAE 3C6QA 1S7CA 3ABQB 4KZPA 4LNUB 2PJDA 2NABA 3STWA 1Z74A 1QLJA 1VCHA 2XHZA 1VM6A 3LGSA 3OT1A 2C2HA 3PXCX 1C9JA 4HXFB 4XWYA 4OOFA 4C4PA 5DNCA 4G1VA 4UD2A 4MHSA 1A2KC 4CKCB 1G8JA 2QZ9A 2ZIWB 2XCIA 3G2HA 4K88A 3VHXA 2CFOA 1ZD8A 5EEHA 1YACA 3VGPA 4BNJA 4M20A 4MA5A 4DLZA 1PQUA 3JAKA 1JJIA 3LI2A 1VSVA 4RA6B 3E27A 4HNUA 2Y93A 2BLNA 4BJHB 3G2KA 2DFKB 2IWRA 4E2YA 5C51B 3KTAA 4PS0A 1J1UA 3W9UA 1R6UA 4DLPA 4TXLA 1UXHA 5IM4F 4OXNA 4GP7A 1NVDA 2WTAA 4MS4A 5BYAA 4B46A 2A4MA 2GYUA 2XE7A 2CNKA 4S2UA 3TW8A 2OMKA 1N5MA 3GPDG 1WEHA 2DCUA 3VOTA 4A73A 1Z37A 1P5FA 2V7VA 2XAUA 1CS0A 4R3WA 1OGIA 3L7JA 2DR3A 5FL7A 1YV9A 3I9NA 2GHTA 3L6CA 1L6IA 2QE7A 5T41A 2BFCA 1C9MA 1JR4A 3EPKA 1G9TA 1XQ1A 2AOUB 1TTPB 2VJYA 4OJNA 2GEFA 4YAEA 3UHPA 1QF7A 1UBRS 1DI0A 1FQJA 1U5BA 4IFEA 2UU9B 1XKXA 1GTSA 2XXBA 3IJEB 2Z98A 4TM8A 1JHQA 3HMKA 4J6FA 4W9NA 4OL0A 4MA4A 2HEIA 2HU5A 2QGFA 3S2YA 5L3RA 3HDYA 1VI5A 1ULAA 3I30X 3FFAA 2VUSA 1IN7A 5EIOA 2QRGA 4AYTA 3AF4A 3IVMA 3VO2A 4HGQA 3TX6A 2H92A 4D9EA 5L8VA 1IBMB 4M89A 1ST2A 2IXBA 3LQ4A 4UUBA 2V6FA 4RVGA 5JBNA 4RJ2A 1TUBA 1RQNA 3ZK9A 4CCWA 1P8AA 2IU4A 3DMTC 4KHZA 3WR5A 3PS9A 3SIWA 3WDMA 1FQOA 3AFMA 1EI9A 3I4CA 4XGIA 2VQ3A 3LUFA 4TV8A 2MJLA 3NOQA 2DGCA 1AK9A 5L45A 3WTCA 1HMYA 4RNDB 2HY7A 3PJGA 1M7GA 5AI8A 4BFLA 2P2DA 4L9AA 3TMAA 3GRRA 3JAWA 1KI9A 3JTZA 3GFPA 3FROA 3V4ZA 1H2FA 4IJDA 2LIPA 1RAFA 2XJ9A 1ZO8A 2HF9A 1CNMA 5FTJA 4M0MA 4D9IA 1EVEA 2I34A 2EN3A 4MLCA 4US0R 4ZKDA 3MJSA 3Q8XB 3V1MA 4Z4GA 4PIPA 1NATA 3GEKA 3THXA 3WGIA 2O2SA 3IKMB 1GG5A 1V1JA 1AKQA 1TJ3A 1ZONA 3FKQA 4D9MA 2B2NA 3HSSA 1GPLA 1N2BA 2Q6OA 3LXMA 2Q49A 3RRYA 4BDTA 4D8YA 3S8YA 4KHPB 1AY0A 2GD1O 4MDYA 3EUFA 2CXXA 2GUWA 4IILA 4O2AB 1I2BA 2KOUA 4K05A 3WLFA 1X70A 4RHUA 4JC0A 4DBVO 1OD6A 2PGOA 3OU7A 3ORYA 3RYIA 4EUNA 5JMOA 4BVBA 1X7ZB 1K0FA 2RHRA 3ST7A 3DBLB 4XOUA 2EPCA 1LO8A 2WYOA 4X1YA 3AP1A 1RIFA 3ZLBA 3N2GA 4BCBA 5JZBA 3PUXA 3W5AA 1PK9A 1F7UA 5H81A 3R3XA 5AM4A 5AJYA 1U2PA 1VJTA 1HEIA 4TL6A 4PG7A 4Q1VA 2CFCA 4M0VA 3F3KA 2QKYA 3IUNA 2L2QA 1IONA 2CLSA 2EL4A 2Q2NA 1WXQA 3LKBA 3OF5A 1XNHA 5BW6B 1MB0A 1V3VA 3NCTA 4Q9NA 5H8WA 5CHYA 9ATCA 5KQGA 4WKBA 3UC5A 1N78A 2X0RA 1G6Q1 2QQ2A 2PKRA 4K46A 4L8VA 4UAVA 3VTKA 1MENA 1N32E 1E9SA 1JSRA 3EBOA 4JLNA 1GXSB 1E6KA 4YV0A 3W5CA 4NCNA 2XECA 1N3BA 2YZ2A 1F17A 1KDPA 1QQ7A 2EAUA 3LIIA 2GAFA 3E29A 3NEAA 2P2ZA 1YC5A 2GPBA 5HZKA 4L9RA 3NONA 4RXMA 3EL6A 1ZAAC 5JJCA 3E5MA 4JDUA 3C1AA 3UG7A 1C50A 1XPJA 4FU0A 5IJZA 1BGVA 2ICAA 4PYOA 4UVEA 4P86A 5ELXA 2ZJ2A 1YZGA 2ZYWX 2ONZA 2IPXA 5IWCA 2VXBA 1P7ZA 1UKYA 2I66A 3NCHA 2ZSKA 1IXKA 4K49A 4G84A 4HJRA 2M6SA 4MR8B 2H00A 4C43A 1W7AA 1WR8A 3MWDA 4RVSA 3FYSA 2Q2WA 4YMVA 1EESA 4F46A 2CE7A 3A3NA 4NCBA 3UMGA 1Z2CA 3ND7A 3OLVA 4RANA 4CCAA 3BGVA 1LZKA 4GRAA 1UDWA 1RXCA 5EKSA 1XZNA 4AX8A 2V6IA 3IE0A 1RPTA 1OW3B 5JSQA 5LZ2A 4FMDB 3FPJA 2PRSA 2JIMA 3BVPA 2BIFA 4Y6GB 5BMOA 1UR5A 3C3YA 3O9ZA 3BF8A 3TPCA 4E6PA 1W2GA 3ZWPA 1KQGA 3N70A 3SI7A 3ZK7A 5I5EA 2J9ZB 4JJFA 3MGKA 1LY1A 1M0SA 4DYHA 4LGYA 3MMZA 2VQFB 3I9FA 3FNGA 3U7QB 4OX9E 2BM0A 2H2DA 1U0OC 2IHJA 3ZXYA 4X85A 5FPKA 3FPLA 1EVIA 1JI0A 1X6FA 2FMXA 2G82A 5FI0B 1DBRA 5LMZA 2PT9A 4OHZA 4EL5A 3FKJA 1ZRSA 5JSKA 4BRZA 4F72A 1TCCA 4EHKA 4ICIA 1D3AA 2F64A 2VT2A 2XBLA 1INLA 1DG9A 1ILWA 1IPFA 1QC5A 1EX1A 1BCSB 3DMTA 2EM0A 4O4HA 5FHRA 4WJZA 3DKRA 2V6JA 1JQBA 2RGNC 3FTQA 4YJDA 4BQFA 3FTPA 2X40A 1EZZA 3OIYA 3NC1C 3REQB 4CZ2A 5LD2C 2FS2A 1GZ5A 4TYMA 2Y1XA 4URYR 3ABOB 1NPDA 3QNMA 4CNBA 3JU0A 1OYYA 1Z6QA 2AOXA 2GEJA 3MWEB 2E4WA 1PFWA 1XIVA 2V7PA 4HGZA 4QRHA 4RPLA 5C5IA 3VDXA 4R1TA 2QW8A 2RGXA 5IK2A 4YAGA 2OEPA 1WOMA 5DO9A 2P5UA 3WYNA 4CRWB 1G8KA 1ZR4A 4DR2B 1L7RA 4MX8A 2IS4A 4H59A 4R7GA 4DUYE 3N74A 2ID8A 2PLAA 4A8PA 1U7TA 1F8GA 4A5SA 4L27A 3ZBTA 1L7DA 4XJSA 1GARA 4K8RB 3ED0A 2DBYA 1DPGA 2J0UA 3MMPA 2EMLA 1FY2A 1ODLA 3OU6A 3OUZA 3Q8WA 4X1OA 5DH9A 4GICA 2C3MA 1M0TA 1O7JA 2V7BA 4BB6A 1YRQA 4FHDA 4A3SA 4KCGA 3UK3C 4DR6B 1ULBA 4IDOA 3IV6A 3UT0A 3HU2A 4Q4JA 1JR3D 3DXYA 4JD5A 2F0XA 1V3TA 1Y5MA 1JG2A 1SVUA 1ZK1A 2HGZA 4FNOA 4GPD1 3RV4A 3WICA 3FN4A 2OBXA 3NDJA 4FBMA 4XM1A 2UUBB 2GD6A 2NO1A 4JJZA 4DUGA 5D3MB 3QLUC 3OPXA 1Q3KA 4L3VA 4JNCA 1ZDMA 1YRBA 4ZOLB 4MTLA 2FW0A 4CFZA 5IYZA 1DRWA 3W4IA 3ZIDA 5FWYB 4N4RB 5IF3A 5BSEA 3MJHA 3H6GA 4KRGA 1Q4SA