3OMLA

Structure of full-length peroxisomal multifunctional enzyme type 2 from drosophila melanogaster
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
585
structure length
532
Chain Sequence
LRYDGRVAVVTGAGAGLGREYALLFAERGAKVVVNAADIVVDEIRKAGGEAVADYNSVIDGAKVIEILVNNAGILRDRSLVKTSEQDWNLVNDVHLKGSFKCTQAAFPYMKKQNYGRIIMTSSNSGIYGNFGQVNYTAAKMGLIGLANTVAIEGARNNVLCNVIVPTEGILPDILFNELKPKLIAPVVAYLCHESCEDNGSYIESAAGWATKLHMVRGKGAVLRPSLDDPVTIEYVKDVWSNVTDMSKAKHLGAIAEASGTLLEVLEKLKEGGGDAIEDAFEFNSKELITYALGIGASVKNAKDMRFLYENDADFAAIPTFFVLPGLLLQMSTDKILHGEQYLEIVDDLPTSGTLLTNGKVFDVMDKGSGAVVVTNSESFDESGRLLVRNQSTTFIVGDPIAGVVPLQPAPNRQPDATVQYTTSEDQAALYRLSGDKNPLHIDPQMALLAGFKTPILHGLCTLGFSVRAVLAQFADNNPALFKAVKVRFSGPVIPGQTLRVDLWKQGTRINFRTVVVETGKEVISGAYVDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxisomal Multifunctional Enzyme Type 2, CG3415
publication title Peroxisomal multifunctional enzyme type 2 from the fruitfly: dehydrogenase and hydratase act as separate entities, as revealed by structure and kinetics.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Oxidoreductase, hydrolase
total genus 154
structure length 532
sequence length 585
ec nomenclature ec 1.1.1.n12: (3R)-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
A PF01575 MaoC_dehydratas MaoC like domain
A PF13452 MaoC_dehydrat_N N-terminal half of MaoC dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.129.10 Alpha Beta Roll Thiol Ester Dehydrase; Chain A Hotdog Thioesterase 3omlA03
3.30.160.260 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 3omlA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3omlA01
2EF1A 5G0SA 2B83A 4MP3A 1RKXA 2ILTA 4GLLA 1DIBA 4YJHB 3P2YA 1ZSYA 2NSDA 2BFPA 2WD7B 4W7IA 1RPNA 1K89A 3JQFA 3W4KA 1IUKA 1DB3A 4HZNA 1JWBB 3P19A 3ON5A 5JCXA 3KVIA 2ZB8A 4J9VA 1HXHA 3KXDA 3SC6A 3JQ9C 4MP8A 4LN1A 4RF3A 1PL6A 1YVEI 4I5FA 1ZVMA 2I6TA 5IXYA 1BTOA 2D59A 3D1LA 3SBOA 4AVYA 3ETEA 2PR2A 1EFLA 3WR5A 1SBYA 2IDZA 2FP4A 1SNYA 4B4UA 1OI7A 4Z9YA 4G65A 3MJVA 4KDEA 3LQFA 4Z0TA 3U4DA 1BVUA 1NPDA 4RPKA 4W6ZA 3GEKA 5CDUA 5DNAA 4KWIA 4D46A 3FWZA 1HDRA 1VPMA 4GLOA 2O7QA 1VKOA 5JAMA 1XCBA 1U3WA 2OWNA 1ENZA 4I45A 2YQ4A 1IY8A 3WEWA 3ASUA 4WCDA 3OP4A 2IYOA 4O6VA 1Y9EA 2J6IA 1E6UA 1XU7A 1O9BA 3ZHZA 3B7JA 3LBBA 2VZ8A 3UFXA 1DLIA 3M1LA 3RCBA 1A9YA 2HAEA 2VWPA 1O8CA 2Q50A 3UH1A 4B4VA 1VPDA 3KEQA 1N8KA 2V6GA 4HNGA 2JFHA 1MG0A 3S2GA 4PG5A 5CFZA 2X58A 5IAAA 4E30A 3DOZA 4E5NA 4BNJA 1I3KA 4EUHA 3GGGA 2BFAA 3DP1A 4FFMA 2PY6A 4BO2A 4E5KA 5DP2A 1I3MA 2G0TA 2EJVA 2OP1A 4Y6PA 5IN5A 3OQ6A 3DL2A 3R3BA 3WTCA 4CQMD 3ZHYA 4E2XA 3FTPA 2B4TO 3GT0A 3Q9UA 2B37A 1LU9A 2NUJA 4Q39A 2PK3A 5AXDA 1EDOA 5L7TA 1X7GA 3FSRA 1J4AA 1EBUA 3D64A 1N1GA 3E5RA 4Q3BA 4C7JA 2UYYA 4Q3AA 3RUAA 2EGHA 2OL4A 1FDSA 3HQ4O 4CM8B 2O50A 2VT2A 1IXLA 4J16A 4P8RA 3O9ZA 3WGHA 2VHVA 2Z95A 3ZU4A 5T07A 2E4AA 4OKNA 4YPOA 4FOOA 4O63O 2CMDA 3LW3A 3Q2IA 5A9TA 4I08A 5ADHA 4WEOA 3R3AA 2OGUA 3GFBA 1KEVA 1CQIA 2Y99A 3JQFC 4MJLA 1LO9A 2GDZA 2Q1UA 2DFDA 5KJ6A 1GYPA 3AOEC 2V6FA 4GVXA 3C1AA 3G0OA 2GSDA 5DF1A 3QVOA 4JK3A 4XA8A 1EUDA 5KIAA 3WGGA 1YB4A 4CJXA 3GHYA 3AUTA 4QECA 3LT2A 2VHXA 3GPIA 3GVCA 2B0JA 4D3FA 2JAPA 1XHLA 4R1UA 1X1TA 2HMWA 4OXYA 2I76A 3M6IA 3PTZA 4TRRA 1HTBA 2PD3A 1MX3A 4LMRA 3AY7A 1I2BA 1R15A 3TZ6A 2P91A 4DL9A 4MVJF 1WZEA 1T4BA 2O7SA 1T2FA 1F12A 2X8LA 4DYVA 5HTOA 1HZJA 5AYVA 3WSVA 4WPGA 1NVGA 2WEKA 3NX4A 4RZIA 4KMSA 3QWIA 5DOVA 3JQBA 1PS0A 2WSBA 5U1PA 4B3HA 3DR3A 3L9WA 3R34A 5JMWA 2V6MA 5EL0A 3AUAA 3I9JA 3RFTA 1T2AA 1GZ3A 4QSMA 3R37A 1QKIA 2GUGA 5TLSA 2F41A 5JC1A 5DBFA 3WDSA 4IM7A 4XWYA 2X86A 4FGSA 2AG5A 1JN0A 4TRNA 1SPXA 1P0FA 3PXXA 1QG6A 1HE4A 1GV1A 3JQ8A 2CVZA 2PGDA 4J7XA 4MIYA 4XQEA 1HDGO 1XIVA 1OC2A 4F6LA 3UKOA 3ONEA 9LDBA 4BMVA 5HMBA 1GAEO 4PLWA 1VL6A 4OQZA 4GAKA 3AW9A 1PR3A 2ZTUA 4K02A 3DHNA 2VUUA 1GTMA 3JTMA 1ZO8A 2OO5A 1F14A 3UCFA 1Y8QB 4EDFA 2D3TA 1HYGA 4A27A 1F17A 1J5PA 2JD0A 4EW6A 3ENKA 2NVWA 4IJKA 2IXAA 2GF6A 5EP5A 3AM4A 3FWNA 1PQPA 3RC7A 4E12A 3VPHA 4DWVA 2H1SA 1XGKA 3QWBA 1Z6BA 3ED0A 5JO9A 3L4SO 4MOCA 4JJFA 3I9OA 4JNKA 4WUVA 2QZ9A 1Z73A 3LLVA 4XCVA 2QZZA 3V1TC 4AJJA 2FSVA 1UDBA 1LRLA 1ZK1A 3KSZO 3B7KA 2IODA 4HNHA 3DP3A 1XR3A 3PGJA 4J2OA 1SH8A 4R9RA 3MJEA 4RLWA 3Q6IA 2FN7A 3ZN2A 1V3VA 3VH1A 4NPCA 3U49A 4IS2A 3BIOA 2PRXA 4BKUA 5CDYA 3WQQA 3AU8A 3KVOA 4FS3A 5ER6A 4AJEA 1MXHA 2W8ZA 4I9NA 3OF2A 3HDYA 5KKAA 2YW9A 1E6WA 1T2CA 1U1ZA 1TLTA 2Y0CA 3OFSA 4YAIA 2O23A 4R01A 4MVJG 1PL8A 5JY1A 4U0JA 3JQCA 3HDUA 2WYWA 4H15A 2PZHA 3PLNA 3DBLB 2WYUA 2PTGA 2YJZA 1SOVA 2PD4A 4CUZA 4F6CA 1SEPA 1N2SA 5JBIA 3FR8A 5HA5A 2QHXA 4NU6A 3L4BA 2HJRA 1PJLA 1E3LA 1GCOA 2VTEA 4JBHA 4WEQA 4ALIA 1PEDA 4BNVA 4XJSA 1Z82A 3F4LA 1JVSA 1TT5B 3UF0A 4DA9A 3WNVA 1G1AA 1OFGA 1SC6A 3VKUA 1JQBA 4R5HA 3H9EO 4YJGA 5JAQA 1GYRA 1A9ZA 1I0ZA 3NEPX 4I83A 2OV9A 3PJGA 1S6YA 2B5VA 2X7HA 2RHRA 1AUPA 4AJKA 3E5MA 2VNAA 3PPIA 1VLLA 3RROA 1D8AA 1XQ6A 3BMNB 5L95A 3O4RA 3I9KA 1DFIA 5JCJD 4P38A 5CG1A 2BD0A 3ICPA 1HE2A 4PN3A 3CMCO 3DTTA 2BFOA 3IC5A 1LQUA 2OBYA 5GZ1A 1X7DA 2X0JA 3DMYA 3IJPA 3T7CA 2CY0A 5A9SB 3QVXA 1M76A 3U0BA 2OIWA 2X9NA 3HADA 3HUDA 1H0KA 4YYZA 3IP1A 4YEDA 4RMMA 2P4QA 1ONPA 4RV2A 3BTVA 4Z0HO 1UZLA 3AFMA 4DPLA 5GY7A 3ZWCA 2GASA 4M1QA 4MDHA 3WQRA 2GLLA 3P2SA 1H6AA 4WASA 5C37A 2BMAA 5AOVA 1B15A 2QRJA 2V65A 1VJTA 2VOEA 1R4MB 2CNBA 4DIOA 4E3ZA 2G1UA 5U4QA 4NZ9A 4YT4A 3FRJA 1VE9A 3WGIA 5EGLA 4XQGA 3QOOA 2AEJA 2X1HA 3LT0A 4PG8A 5IJZA 1CETA 2DBZA 4EITA 1A4IA 2RIRA 1WN3A 1P31A 3GVIA 2Y1DA 3CTMA 4IJUA 2XXBA 2FR8A 1LX6A 2F0XA 4XD2A 1LJ8A 4BNTA 5KKCA 5FI3A 2GLMA 2PIMA 3GLQA 4F46A 1BHSA 4MIOA 4EJMA 3EK2A 4O5OA 4WOKA 4B3IA 4WLOA 4PIVA 2LDBA 4IXWA 4CPDA 5A02A 3EGOA 2JCVA 3CH6A 1YL7A 3ANMA 3WS7A 3LZ7A 3FPLA 3TNLA 2YFHA 1PJ3A 3GNTA 4E31A 4GX5A 3OBBA 3PVZA 3C8MA 1P45A 4BNKA 1HT0A 4W78B 5KCZA 3W8FA 4MVJD 3JQGB 3OJLA 4RLTA 3AZAA 3G79A 1AXEA 4DPKA 4H16A 2YUTA 4TVOA 2ZB3A 1NPTO 3K6JA 2JKVA 4FFRA 3RJ9A 4BO8A 4ESOA 1M66A 3DZBA 4E2WA 1EUZA 2B69A 5T64A 1DIGA 1IQ6A 4C7KA 5DBIA 3FBTA 3MJ4A 2TMGA 4H3VA 4A0ZA 4FCCA 2XPCA 1PGPA 2GN9A 5LCXA 4IIVA 4J0FA 1FDTA 4CLOA 3LU1A 4CM7A 5B37A 2P5UA 1J1YA 5TIIA 2AE1A 1QYWA 3GG9A 4ONEA 3DBHA 1TB4A 5GZ6A 3RFVA 1KEUA 1ZSVA 2J3IA 1E1NA 4HUJA 2P9EA 4AJHA 4PLVA 2EJWA 4IUYA 2QWZA 3D4NA 1E7RA 2AV9A 1PGOA 3T4XA 1YB5A 1Y7TA 3ETDA 3RUIA 1WP4A 3GEGA 5HWSA 2VOJA 3AM5A 3LT1A 3TZHA 4II2A 3KVUA 3NWZA 5KTKA 3H5AA 4OMUA 1M67A 4ALNA 1OBFO 3GF4A 2HK9A 4NQZA 4J43A 4BO9A 4CV2A 1NVMB 3GC6A 2OFPA 3ZU2A 5I7SA 4NI5A 2GCGA 1ZCJA 2P9CA 1R66A 2WE8A 1VJ0A 2NU7A 4NBTA 5AQ1A 3BTUA 1A27A 2BELA 2JD1A 4CM4A 2FHSA 3OECA 3ANNA 2NTVA 3PYXA 3JSAA 1MGOA 1Q7CA 2OOSA 4BNMA 4J90A 3L0DA 4R3NA 3ZI0A 2J5RA 2CSUA 2WE7A 1DHRA 2A94A 5G4KA 3ZHXA 4WLVA 1Y8RA 1N9GB 4PG4A 3GY0A 2D5CA 3KSUA 4G5HA 4II3A 5ILOA 2Y0EA 1D1TA 3ZWAA 2ZTLA 3P2OA 5IZCC 3GEMA 1HLDA 2E37A 4RJTA 4FR5A 1EFKA 1ONNA 4QT0A 3SXPA 3DZGA 3PHJA 4Z3DA 3MJSA 4L0QA 3E18A 1IZ0A 4BHTA 2NM0A 3KYCA 1NQ5A 2OP0A 4JX8A 4KTVE 4JP2A 4OSOA 1C0PA 2FY8A 3ADPA 1ZZEA 1NAIA 3ZU5A 3HFSA 2A4KA 3S2IA 1ENYA 2VQ3A 1DAPA 3PIIA 4J0EA 4JLWA 4QO7A 1XYGA 2W98A 1V3TA 4IINA 2NLOA 4M87A 1EUCA 1FJHA 4IDEA 3T4EA 4BKQA 3OJEA 2YDXA 2X22A 4FPXA 3JD0A 3HG7A 1KETA 2A9FA 2X23A 1FF9A 4OSPA 1G6KA 4DIBA 5CEJA 3KV8A 4IQGA 3TDKA 1KERA 2O6TA 3GZNA 3WWYA 4R54A 4XQ9A 1EZ4A 2I3AA 3WYCA 3RJ5A 3QW2A 4BOYA 1ADFA 1U8XX 1C1DB 4PLGA 2GN6A 1FMCA 4YA6A 1E3JA 1AHHA 1VH9A 4MINA 4FSHA 3SJ7A 5JW6A 1N7HA 3WFJA 3Q1LA 3DOCA 3BA1A 2B5WA 8ADHA 1TEHA 3VDRA 4O1MA 2F1KA 4E33A 3S4KA 4GWGA 4R9SA 1EVIA 4FDAA 1F8FA 3TSCA 1MG5A 1DIHA 4CL3A 3AU9A 2NQ8A 4BNXA 3RUCA 3GR6A 1ZKIA 2HBOA 3JD4A 3PK0A 4MIEA 4P4NA 5HRUA 5C7OO 4U8GA 3O26A 1DC3A 1GADO 3K30A 2FR0A 3C1TA 3TFOA 3BJKA 2C54A 1I32A 3WYEA 2VRCD 1VKNA 4XGKA 2QRLA 2EKLA 1EE2A 4K4BA 1KEWA 4D41A 2JFFA 4F3YA 1UH5A 4NFYA 3BHMA 4XYEA 1KVUA 2FPIA 2YZ7A 1P9LA 3R3JA 1RYDA 1NWCA 4DMMA 4KP7A 2E82A 1EEHA 2X9GA 3IKVA 3QLJA 3ZWXA 4EJ0A 3WGOA 1MA0A 4NJMB 4NBWA 4D3DA 2CDCA 2VUTA 3OQBA 3F47A 5EMHA 3QWAA 4OOFA 4L75A 3OEYA 3U3XA 4MZQA 2CVOA 4R41A 3BMQA 3RVDA 1B0AA 2C7VA 4TMFA 1B3BA 3GMDA 4ZV3A 5U9CA 3D5TA 2FMUA 5T02A 3R87A 3FF4A 4RORA 5F21A 4OQYA 5JAZA 4PLTA 3R3SA 5IXSA 2EW2A 1BMDA 5ILGA 3PJEA 2ET6A 4R69A 1LSSA 4RPLA 1KY5A 4GMGA 3EVTA 3TFQA 4GGOA 3FN4A 3LF1A 2C82A 1HE5A 1SBKA 1GEEA 4AJNA 3DP0A 2BKAA 3DZIA 3GK3A 3JQEA 4CR6A 3LSYA 4QO8A 1HETA 1WMAA 3PHLA 3FPCA 4IQ8A 1BW9B 5T57A 4WKGA 3ROKA 1UJMA 4M89A 2AG8A 4IXTA 3VTZA 2XAAA 2PKQO 3HMJG 3ANLA 4K1LA 1DIAA 3QVSA 1B7GO 1T26A 3LT4A 2BLLA 3O03A 3ADOA 5JS6A 5KVSA 2GD1O 3BZUA 5A05A 2H4UA 1C0KA 4X54A 1PJSA 4LGVA 4YWJA 2UUOA 1V9LA 3GRKA 4ND1A 3F6YA 5FYDA 3B1KA 4FFOA 1PX0A 3DZJA 1QYCA 1NHWA 1BXGB 1GFSA 5L51A 5TJ9A 4CR8A 1N5DA 2ZYDA 5A9RA 1JU9A 5KNLA 4PG6A 5A04A 3WJAA 3ZWWA 5GZ3A 3NT5A 4XKJA 3V2UA 1NFFA 1OC4A 5T67A 4DLBA 3QSGA 3KUWA 1DRVA 1LDMA 3BXXA 4BKRA 1NQAO 1MP0A 1NX6A 1PN4A 1JDJA 1MLDA 1WMBA 1UAYA 4EEZA 4KOAA 4QXMA 5B1YA 2R6JA 3PWZA 2JL1A 3NTQA 3DOOA 4FJ1A 4TROA 2Q4EA 2VN8A 3GNQA 1M6HA 4ROSA 1K0UA 1PZHA 4R51A 3RASA 1IHYA 1L7EA 2J5QA 5I8WA 4MKZA 4BVAA 2B6EA 4XIYA 5TS3A 4ND2A 1B14A 1H6CA 3BMCA 1A5ZA 1BDBA 3HJAA 4ZQEA 2Q2WA 3DEYX 4B8ZA 3E8PA 4RPGA 1CJCA 3VZSA 3H9QA 2O4UX 1LLDA 3MOIA 3COSA 3AOEA 3HSKA 2P2SA 5FFFA 3HN2A 5F1PA 4RDHA 2Y67A 4NBVA 5BSGA 4R16A 1MKAA 1VI8A 2ZJ0A 3S1LA 1GEGA 1E1LA 1H6DA 3G49A 1QORA 4FC7A 1XA0A 1WXDA 3D0OA 5JFOA 4DXHA 4UREA 2EV9A 1R4NB 4BNHA 4U6SA 4AJIA 4PCVA 2GO1A 3RBXA 3TRIA 4YRDA 2CYEA 4M54A 4I4JA 4F45A 5AXCA 1DLJA 4BUCA 2NU8A 4R1SA 3K5PA 4CM6A 1QYXA 1PN2A 5A3VA 1AN9A 4DRYA 5ES3A 4FOSA 4BS9A 5KVVA 4E32A 1YQDA 3IL2A 5BSFA 2UVDA 3WSWA 1QRRA 3KEOA 4G81A 2Q2QA 4GVLA 2BGKA 5CPFA 4J4BA 1YWGO 4NJOA 2EGIA 5B4TA 5HMCA 1C1XB 4J6FA 5IDYA 4NDNE 4BB6A 1ZHGA 4U7WA 3ABIA 4OGWA 5F1KA 3B1JA 4E21A 1ZJZA 3B70A 3WBFA 1YOVA 3K67A 3BHJA 3DBRB 3LMBA 4HXYA 5SZYA 3Q2KA 4BO4A 1YQXA 3MZ0A 3EUWA 4QEDA 2HQ1A 3KBOA 2ZATA 3R3FA 3QE3A 3V2GA 3HE3A 5EGKA 4UUNA 1WDMA 4FBGA 2CF6A 2PGLA 1F0YA 1D7OA 4ZICA 3VZRA 4A10A 1DXYA 1T2DA 4HFMA 2YY7A 5BNIA 4IDDA 3U5TA 3IDSA 5L4LA 3E29A 1ENPA 2IZZA 3KM0A 4J1TA 4NBRA 4WGGA 1H9BA 1ID1A 4A26A 1I5RA 1B8UA 2X5JO 1GD1O 1PZEA 3BTOA 3DP2A 5BYUA 2DPGA 4JJGA 1TA4A 1I01A 3PQDA 2CUKA 4K4AA 3F1LA 3JQ7A 4R1TA 1YL6A 5C3MA 2VKZG 3C7AA 4TZTA 3SC4A 1EVZA 1YQGA 5AVOA 1CDOA 1UUFA 1LQTA 1Q4UA 1NASA 2CDBA 1MFZA 2GERA 2VWQA 4CV3A 2JJYA 3P2RA 3NDRA 3NKLA 1X7HA 1GR0A 4YT2A 5I9NA 1YO6A 3D7LA 1IYZA 4ZN6A 3HDHA 4XB2A 1XKQA 2O3JA 4PLCA 1GUZA 2RBEA 5FI5A 3RKRA 4BGIA 4M20A 1W4ZA 4WLEA 4YACA 5MDHA 3GAFA 3PDJA 3R6DA 2FS2A 4NMHA 3V1YA 1Y5MA 3UICA 3CF9A 2FPGA 2O3TA 3D6XA 4MKXA 1A72A 2QYTA 3WIDA 2HLJA 1ULSA 1YRLA 1Y5RA 4BO0A 1BG6A 1P3DA 4FJ0A 4NBUA 3DFUA 3CZRA 3DMTA 4GWKA 4WNBB 5EQFA 4B0IA 2BRUA 3GA0A 4BNYA 3KTDA 3GG2A 4CQLB 4JBGA 4K9DA 4RLJA 1PTJA 4EI2A 3VC7A 3A4VA 3C24A 3BMOA 3GNSA 4R1NA 1CWUA 4RPHA 4OHUA 1X15A 1P1IA 1E5QA 3PHHA 4ND3A 4YJDA 2R00C 2C59A 4KWHA 4HFJA 1I10A 4DC0A 5COBA 1OOEA 2GGSA 4WCFB 3CINA 2AW5A 1RM0A 4BMSA 3L6DA 2DFVA 3PFFA 5TJHA 1GL3A 2D0IA 1NXQA 1PS8A 3DFZA 1GDHA 4GKVA 4CM9A 1ADCA 2ZYAA 1PJCA 1PJQA 3H7AA 3QRWA 4UEJA 4CMIA 4BQPA 2A35A 1GV0A 3SX2A 2O2YA 3KYDA 4RPJA 3ZNNA 1DC6A 3NAQA 5ICMA 2G17A 1DHTA 3TWOA 2VRBA 1BXZA 4IIUA 3PZBA 1ARZA 4EGFA 2A92A 4L76A 1GU7A 3D3EA 3GDGA 1G0OA 4ZJBA 4LRSB 4Q3EA 1MB4A 1SAYA 4KQWA 1F8GA 4Z0PA 4RGBA 3HB4X 1O6ZA 4UULA 1E3WA 1N1EA 4KUGA 1ZK0A 3DAPA 2NVUA 4JROA 2O3QA 3SLKA 1NFRA 3CZMA 1UP4A 3JYNA 4C4OA 2O48X 2VZ9A 5IF3A 3WNQA 4B4WA 4TRMA 2NWQA 4DUPA 4XDYA 1DJNA 1HE3A 1R0LA 3DONA 4JCOA 2FSSA 5BUWA 1LSOA 2DUUA 3UCXA 2O5UA 3CEAA 1ZFNA 4B79A 4HV4A 2YHIB 4DLAA 4ITUA 4CQMB 1ADBA 2D2IA 3P2QA 2W2LA 2PZLA 1UXGA 4FFPA 2Z1MA 2Z5LA 4YJHA 4D44A 3AZ9A 1T24A 1Z7BA 1CF2O 4Y6SA 2WD7A 4YRAA 3A06A 4RLUB 4CMEC 4KUHA 5TNXA 4RCVA 1I24A 3D6LA 3N74A 1EMDA 4LMPA 5KOIA 4E5PA 3A14A 3LK7A 4QQRA 2O2SA 4J7UA 3EVNA 1LDGA 3ZCXA 3IAHA 5HD6A 1Q7BA 4B7XA 2VZ0A 4H7PA 1R0SA 3GFGA 4N5MA 3DMTC 3IMFA 1S9CA 1L1FA 4Y8VA 1ZK4A 2OKIA 2ZQYA 4A2CA 4OKIA 1YBVA 1I3LA 4NIMA 4RF5A 4TSKA 2H63A 2DPHA 3NT2A 1ZSNA 1LO8A 3K2BA 4RVHA 2P4HX 3KO8A 3TZKA 2XEMA 3H6KA 1XQ1A 3JD2A 4XIJA 2G76A 5DZSA 3GQVA 3JYOA 3B6ZA 3ORFA 5TGDA 4I82A 2RCYA 3UAGA 3RUDA 1ISMA 4L8VA 5EJ2A 4I1IA 4IDGA 1N7GA 4BQRA 5JE8A 1JKIA 1GCUA 4OAQA 1V8BA 3PLRA 3JQAD 2QIOA 3PFWO 3AZ8A 4JGBA 1NQTA 2EW8A 3INRA 2CFCA 4K26A 2FRDA 4QUKA 3ZGYA 2HMSA 3HN7A 4IDBA 4P4LA 2QRKA 3R3CA 1LRJA 4S1VA 1E1KA 1PJ2A 1Z45A 1P1JA 3HB5X 4O0LA 4BB5A 5EINA 1IB6A 2C07A 4RVUA 4KUEA 4OM8A 3G3EA 4QFCA 1PU2A 1TXGA 3GVXA 4AJPA 3CPSA 3FI9A 2B4RO 1GYQA 3W4IA 4YBZA 4CMHA 3F1KA 1Z7EA 5HBRA 3E1KA 2QQ5A 4RVDA 5EQDA 2PWZA 4BGUA 3H3JA 3L6OO 2X5OA 1K6IA 4DREA 4NFHA 3IOYA 5ITWA 3LZ6A 3C1OA 1C0LA 4B0CA 4CM8A 5HWFA 3OICA 1AE1A 1YLIA 4K00A 1PJTA 4GAHA 3BTSA 2NQTA 3GN1A 4J1SA 4CV0A 3ROMA 4CLXA 2IYPA 1PGJA 4GKBA 4B4OA 4ALJA 3S55A 4YAKA 4Y6RA 1CEQA 3DO5A 4KQXA 3ULKA 5IDXA 1YDWA 3WQSB 2QQ2A 3OIDA 3OJOA 2PH3A 2DC1A 3X2EA 4Y67A 2UV8A 1E92A 3ZH2A 2O3RA 1NNUA 2HUNA 4RZHA 4XYMA 5G2OA 3JD1A 3ZNPA 2GR9A 4BGVA 1P1KA 2PD6A 3OJFA 1MUUA 2PNFA 4RVFA 5IZCA 5JYEA 4RF2A 1BVQA 1K2WA 1ADGA 1R0KA 5I9MA 1MFPA 2AHRA 4E13A 1QR6A 1V6AA 3RU7A 1H6BA 3RAJA 2IE0A 4GL4A 5ER9A 1UDAA 5A3JA 3P3IA 1YL5A 5JNLA 2DM6A 2BF7A 1UXHA 4D7AA 1LDYA 1E6EA 1ZH8A 3I3OA 4YT5A 5SZVA 4A03A 1L7DA 3GPDG 5G0WA 4CQLA 4LVUA 2VTDA 3C85A 3FNGA 2HK7A 4LRTB 4J1QA 4A12A 4FFNA 4WLUA 4K49A 1SO8A 2PV7A 4IENA 3VVBA 1C14A 3SVTA 3NDJA 4XB1A 2Y0DA 3IIEA 4UVEA 1A4UA 2ZTVA 3JYQA 4YJFB 1U7TA 4UEOA 3AJRA 3R0IA 1UAGA 3QVTA 2EGGA 3STHA 3PHGA 4L4SA 2JFGA 4ZQHA 3GZ4A 4ZGWA 4N7RA 1BWSA 1PGNA 5TRTA 4Q3DA 3AI2A 2D4AA 3OH8A 4PGFA 1AGNA 5CAEA 2WTBA 3AUSA 3ZNOA 3EDMA 1ENOA 1PZGA 2E48A 4S3MA 4PLHA 3VOSA 4MOBA 3WB9A 3HDQA 1P1RA 4D3SA 4RVGA 3ST7A 3QVWA 3I9LA 5CPGA 1EQ2A 4GGPA 4HZOA 3KH8A 2DUWA 2AQ8A 2HCTA 4IY1A 4PZDA 3F9IA 3JQAB 2W90A 4KZPA 5LC1A 1FDUA 3DOYA 4ID9A 3WXBA 2C5EA 3PWKA 3X2FA 1VH5A 2ZK7A 3PZRA 5KVQA 1Y8QA 3Q9NA 3VPGA 1NVTA 4CLRB 4NG5A 5F3RA 4YQZA 4Z3KA 3H65A 1WPQA 1UZNA 4XZ3A 3VZPA 2PZKA 1JKJA 1RWBA 2W2KB 3OETA 3VAZA 4E5YA 4XQCA 3DZKA 3QIVA 1VC2A 3MTJA 4EJ6A 3A1NA 4XRGA 1YS4A 4MKRA 3JD3A 1NJKA 3MWEB 3EXZA 2OXIA 5TSDA 3JYPA 3FBGA 4RVSA 4DBZA 3FCOA 3NJ8A 3CK1A 1PSDA 2GZ1A 4B8WA 1PS9A 3TQHA 3ZW9A 5KVCA 3GUYA 1Q0HA 5JXWA 1B3RA 2POQX 2EGRA 2CWZA 2CVQA 1AXGA 3S2EA 1XG5A 2WDZA 2DTXA 2CD9A 5JY6A 2B35A 1RM3A 3DQPA 3DOJA 1U4OA 3QHAA 2J3KA 4EBFA 2VT3A 2ZIZA 4WE3A 4URFA 4L74A 2HDHA 1NM5A 4PLYA 4BO7A 3EW7A 2JHFA 2DLDA 1E7WA 3DBLA 4AICA 1ISIA 5DCWA 1ULUA 3PRJA 2ZYGA 1FDVA 4HBGA 5L7WA 1KVSA 2C2IA 1SEVA 2J3JA 4LSWA 5DT9A 3UGKA 1GQ2A 3CF8A 1TT5A 4WCFC 3ICCA 3PYLA 4NK4A 1O5IA 1P33A 2NUAA 1U4SA 5L4SA 1XEAA 2VCYA 3TL3A 5BR7A 3JQDA 4ALLA 3SEFA 1LLUA 3UXYA 5L9AA 2CDAA 1GZ6A 2EERA 3E82A 5ENVA 5H83A 4PVCA 3TN7A 2RAFA 4FFLA 3H8VA 3LBEA 4HX5A 5BUYA 2ZCVA 4CM9D 2NTNA 3JQ6A 4D79A 1DAOA 2Y1EA 4U6QA 3OIGA 3NV9A 1T1RA 2HSDA 1E0DA 1GQYA 1XWFA 1KS9A 1YBAA 2FR1A 3BMNA 4HP8A 3WICA 4BL5A 1YOCA 4GQAA 3GAZA 1IHXA 1LSUA 1UXJA 1V0JA 3MEQA 3KX8A 3PYMA 5IFLA 4FIZA 1C0IA 2YV1A 2D5AA 1IPFA 1LUAA 1I8TA 3HM0A 1H2BA 3BYZA 2NU9A 4BNUA 5HS6A 3WJ7A 4ZVVA 3KW1A 3M2PA 3KLPX 3NYWA 3ZWNA 5A9SA 2GN8A 5KJEA 1YH3A 1T82A 1CRWG 1TBUA 1U3VA 1DRWA 2DTEA 1MC4A 2PKQP 4UVDA 5A1TA 4N5LA 1LA2A 2DQ4A 1WNTA 2J8ZA 3H9GA 4MVJM 3WGTA 5JLAA 3QJ5A 1PGQA 2O6UA 4GBJA 4RLSA 5SZUA 1MV8A 4LSMA 3DZHA 1KOLA 1P0CA 2C2XA 3RBZA 5A03A 1R4MA 4YQYA 3Q11A 3ZWYA 3VDQA 7ADHA 3GGOA 4GX0A 4OXNA 3DZFA 5JSFA 1H2HA 4IJVA 4I5EA 5TT1A 1PQWA 4PZEA 4CLDA 2RH8A 1H94A 4YVFA 2EP5A 4K4DA 4E0BA 4ND4A 1PJBA 1WZIA 2B4QA 3QP9A 4J1NA 5T8KA 3TOZA 2C7GA 3FTNA 5TF4A 3GUCA 5JDIA 2Q1TA 1I30A 1F06A 1HF3A 3KB6A 3ESIA 3IS3A 4N18A 1XSEA 5L40A 4ZHSA 1G0NA 1TT7A 4ZQGA 5F1OA 4ZD6A 4CODB 3ZW8A 4K6FA 2PKRA 3DWFA 1W0CA 4W78A 4NH4A 1LRKA 2AA3A 3ZWVA 3JQGA 1RM5A 3KV7A 4H4GA 5CDSA 4ZJUA 3U4HA 4GI2A 2AXQA 3FD8A 5L45A 5C5IA 4DPMA 1YGYA 3I5MA 4WK6A 2DKNA 4BKOA 5IN4A 5ITVA 1JA9A 3UHAA 4MVJH 1YONA 5HZ4A 1PWZA 1CQJA 1X13A 3LVFO 1PR9A 1YJQA 4GX1A 4LVCA 3S8MA 3ZWOA 1O94A 1NP3A 5DDIP 4CMAA 3QY9A 1ZMOA 4QTZA 3KUVA 1P74A 1QYVA 3TF5A 1NHGA 1U5CA 4YRBA 2QX7A 4A0YA 1HDZA 1KVQA 3A28A 3F1TA 2YQ5A 1T2EA 4BMNA 4W99A 1ZK2A 5GMOA 4R5MA 4A5OA 4FQ8A 3AUUA 3F5OA 2WJPA 4BNLA 1DPGA 3WYBA 2ZQZA 4UUOA 1MKBA 3I83A 3WFIA 3V1UA 2YV3A 3OJ0A 3I9MA 1HSOA 2XF8A 3T7EA 3L6EA 4NU5A 2BHLA 2GRAA 3IR3A 3OHSX 5IDWA 2Z1NA 2EP7A 1NPYA 4RL6A 3JQ8B 2VWGA 2WMDA 4TKMA 4W9NA 2G5CA 1LEHA 3GOHA 3OSUA 3IUPA 3WLEA 3WOHA 4DVJA 2XOXA 2BH9A 3DTYA 3IUSA 4YXFA 5G0TA 3TZCA 5KJFA 3I4FA 1UDCA 4XYGA 1I2CA 1ISJA 1Q0QA 4B7CA 3ZNQA 1ONOA 2VUSA 5JAIA 1DBVO 4YCAA 3RC1A 5I8ZA 2GLXA 3EC7A 2NVBA 5CDTA 1DRUA 1NTOA 3WX0A 5CP8A 3KOUA 3TJRA 1KY4A 3LLSA 1VI2A 1M2WA 3H2SA 5DCYA 1N9GA 2BGLA 3HFGA 2FOIA 4E4YA 4INAA 5T8KC 3KUXA 5B12A 5JDIC 1IULA 1E1MA 4P22A 5DIOA 1YJ8A 4J4HA 4XR4A 1V3UA 3TPCA 4IDAA 4Q9NA 3MOGA 3VPXA 5THQA 3VPFA 2VWHA 1Q7GA 3PEFA 1EDZA 1HZZA 1TI7A 4BV9A 1ZEMA 4XGNA 1LDEA 4A0SA 3RC2A 1HDCA 3ZDFA 3CXRA 1VRWA 5B4UA 4RLWB 2FZWA 4ALKA 1WAMA 5HM8A 1QYDA 1Z74A 3UW3A 5K0ZA 2O6BA 1JLLA 1OZAA 3DKZA 3DB2A 5TC4A 1I33A 2DAPA 1ZXBA 2GYYA 2W4QA 3F3SA 4MP6A 3INTA 5L53A 3D4PA 2R00A 2DTDA 3EHEA 1B2LA 1JWAB 4AL4A 3MJCA 2GN4A 1XU9A 1DIRA 4BNIA 1IOLA 1GUYA 2ZCUA 1YDEA 2I3GA 4BNZA 3D3WB 4MVJA 2Y1GA 4Z6KA 1P1HA 4DGSA 4MVJP 3DXFA 2Y1OA 3I23A 2GVHA 1Q4SA 1K5HA 4IZIA 3WMWA 4BO5A 1HDOA 1C1DA 4FFUA 2C2YA 4I9HA 2GF2A 5KJ1A 3WLFA 1U8FO 4AJ1A 3FR7A 4DQXA 3PI7A 2ZB4A 3HDJA 1Q4TA 1NYTA 4TKLA 2J3HA 4I9UA 5C7IO 1KVTA 3IQDB 2I5PO 4YJGB 5EIOA 2UUPA 5L3ZA 3JYLA 4L4RA 3K2EA 1SOWA 2PA3A 3KVZA 1I36A 1X1EA 1XELA 2YFQA 2DVMA 3MWDB 4IPTA 3EZYA 3WGYA 2HKIA 1WLUA 4OJNA 1S5UA 2AQHA 1SB9A 2JHGA 3I4CA 4W9NC 4J9UE 4RDIA 1EK5A 5G0UA 5IG2A 3W4JA 4Z9XA 3W8EA 4LW8A 2F00A 1KIFA 3KX7A 1DFGA 4XEHA 1IL0A 1NR1A 1WLVA 1PSUA 1C3VA 4L4XA 4WNIA 4NK5A 5CEEA 1YB1A 4KDFA 5HS4A 3D5QA 2ZJ1A 1B8PA 4HKTA 4NFSA 2EHDA 3UUWA 4CMEA 3ZWBA 2EIHA 1XDWA 1JAXA 2X9VA 4YDRA 1FDWA 2HRBA 1FXSA 1KBZA 4PFJA 1UP7A 4U0KA 1JVBA 3V8BA 2IEBA 3ENNA 4RV2B 4NJMA 4QD9A 3P3FA 3E8XA 4CLEA 1SB8A 1X14A 3U4CA 4D43A 3AFNA 3RSHA 4M55A 3VHRA 2I99A 4FQ9A 4B8UA 2DT5A 1NFQA 3ZZNA 1KC3A 4QD7A 1ISHA 1OMOA 1R16A 3VTFA 1X0XA 5IDQA 1BXKA 4FGWA 3E9MA 3K92A 4GAEA 3E9QA 2Y93A 2GLPA 1GPDG 2NTJA 4OXKA 4YT8A 3F5SA 2B3MA 5COAA 2IZ1A 3GGPA 3DHYA 2FUJA 1MC5A 3P5SA 4GX2A 2V7PA 2P9GA 5EESA 2IZ0A 1D1SA 2Q4BA 3KETA 3LF2A 1DO8A 3U62A 2VYVA 3GVHA 3GVPA 5TX7A 2IEDA 4N5NA 4LCEA 3IKTA 3WBBA 5CEFA 1BW9A 3ITKA 2GPTA 2R2GA 3G1TA 3NTOA 3UN1A 3EY4A 4O59O 4K28A 3OA0A 5G4LA 1ZMTA 3DAGA 1PL7A 3TOXA 5IZ4A 4RLTB 2LDXA 1LSJA 1JAYA 1K3TA 4WNCA 1WLYA 2AMFA 3VKVA 3ZHBA 1YE3A 5H82A 2BFMA 3CSDA 2O3SA 3GH3A 4PLPA 4XY5A 4JP3A 3IJRA 4E2YA 3KZVA 3ITDA 3GMSA 4NNJA 4YR9A 1BXGA 1GZ4A 4CMGA 1QLJA 1VL8A 1UR5A 3I6QA 3PJDA 2IXBA 4IDFA 3E6AA 3OM9A 5K6AA 3QWHA 4DBVO 3GRPA 2OBNA 1GUFA 3R36A 2EG9A 4CLOB 5EN4A 1CERA 2BGMA 5EO2A 4J3FA 3NTRA 5JMPA 1ZW1A 2GNAA 4W4TA 4XYLA 3ONDA 4ILKA 3DBHB 2W3XA 3SLGA 5A06A 3BAZA 4D0RA 3RD5A 2AEFA 5KL9A 1AHIA 4PVDA 5KJCA 4JIGA 5I7VA 3HZZA 2HRZA 3V5NA 1ZJYA 4LISA 5J23A 4R68A 2J5KA 3GDFA 2HU2A 4J7CA 1K6JA 2PZJA 3RC9A 3ROQA 2C20A 3O38A 3O8QB 4ZA2A 5A5EA 3I9NA 1O0SA 4RQUA 4IQ0A 5L7YA 3TZQA 1JW9B 1B26A 5BNTA 5CG2A 3W6UA 2PZMA 1PWXA 2ZKLA 5TT0A 2VRCA 1PQUA 3AY6A 2HK8A 3DDNA 4MTUA 2QW8A 4E3EA 2X0NA 1R4NA 2VHWA 3EAGA 4CM4B 2VYNA 2OKHA 4IMPA 4JQCA 3LWGA 4J2HA 3K96A 3OEWA 1VSUA 3FNEA 4BO6A 4A7PA 1WWKA 3CIFA 2O4CA 3KYBA 2OUIA 3HHPA 1LDBA 1QMGA 4PG7A 2WM3A 3RI3A 4NCPA 5G4KB 4CM5A 1E77A 4OOBA 1Y8RB 2NACA 5BUXA 3NJ4A 3W1VA 1VSVA 3EMKA 1J0XO 1LTHR 3F5QA 3ONFA 1SCUA 3U9LA 5EO4A 3E9NA 3QWFA 4WLNA 1C1XA 1PZFA 4U5QA 2H5LA 5DP1A 4CUKA 3PDUA 4E6PA 4XYBA 5BSEA 4HFNA 2YHUA 5AXBA 4RV9A 5DOZA 5KWEA 3KYCB 4QFDA 1Y81A 3DBRA 3D3WA 4D45A 5T06A 1M6WA 9LDTA 3D4OA 2Y1CA 2EWMA 3R35A 3LYLA 4ALMA 2B36A 4CMCA 2NV6A 3M2TA 3CE6A 1QXSA 2CZCA 1U3TA 1O95A 3JQBC 3TL2A 4AJ4A 1R12A 1S7CA 2YV2A 4HY3A 4BO1A 1LXCA 4EZBA 1PIWA 2WD8A 2F3XA 1FK8A 1E3EA 3RIHA 4DLLA 3DAFA 4MVJE 1IPEA 3MJTA 1U1IA 3GZNB 3PIDA 4OOEA 2I66A 2GZ2A 3PQFA 2RH4A 4LK3A 5K6AC 1H9AA 2BI0A 1Q1NA 1DDOA 1C8UA 1CIVA 2WYVA 3RUFA 4IS3A 3VVCA 4W82A 6ADHA 3PWSA 4OYRA 3N7UA 5CPBA 3D04A 4XJTA 1OAAA 3VH2A 4L73A 2PH5A 1EVYA 1HEUA 4YAGA 1LI4A 1LLCA 4WECA 3V2HA 3FNHA 5TQVA 4QX6A 4ZU3A 3H4VA 4FN4A 4PRLA 2G82A 2DU8A 5F5LA 1ISGA 3ZV5A 4B7UA 1DC5A 1SMKA 4GPD1 4K6CA 3RBVA 3H5RA 2FPPA 1HSZA 4UAGA 4IGFA 4UEKA 4AJOA 4BV8A 4HADA 4OIMA 1U7HA 1KC1A 3GDOA 3LC2O 4JXKA 2HO5A 4K4CA 1E3SA 5SZZA 2OAFA 4ZRMA 5I9LA 1HYHA 4WNBA 4N54A 4AE8A 4D0SA 1EBFA 1WW8A 3KV3O 4YTEA 4IGEA 1NWHA 3PP8A 4HWKA 3R1IA 2DBVO 1HLPA 5FEUA 4GSLA 3G17A 3Q62A 1W73A 4DYDA 4ZQBA 2X6TA 4CV1A 1GPJA 3WMXA 3AZBA 1W8DA 2IRWA 1QP8A 3VZQA 3MTGA 3R3DA 3I6IA 4WCFA 3S2FA 4B3JA 3FNFA 4I8XA 4Q3NA 3BMQB 3QY3A 1DFHA 4Q3CA 1D4FA 2X5KO 4XDZA 4Z9FA 4DQVA 3KRTA 4L9RA 4ZW0A 4WJZA 1R6DA 3F46A 4JBIA 1EQUA 3ZV3A 3ZV6A 3Q3CA 4Y98A 1HDXA 2VNSA 3U4IA 3N58A 2EXXA 1SC0A 1BDMA 3L4BC 2BI7A 3EYWA 1Q0LA 1NQOA 3K73O 3DBVO 4RLHA 1T4DA 4J4TA 2AQKA 2PFGA 4P4GA 4YAJA 2I65A 3E1EA 4GMFA 1HRDA 3SPSA 4CMKA 2D1YA 3INGA 4TQGA 1E7MA 2Y05A 4MO2A 4CMJA 2I67A 2AQIA 3CKYA 2Q2VA 3EZLA 2EGJA 4EYEA 2I9PA 3JCZA 4BNNA 2ZTMA 3RU9A 2SCUA 2Q46A 2Q3EA 1QV7A 1SZJG 2GZ3A 2H6EA 1I3NA 1U2GA 4XY6A 1LBEA 1Z75A 1WVGA 2HLPA 3HNPA 3I1JA 3KSDO 4EUEA 4RO0A 1JTVA 3I52A 3M1AA 3AK4A 5L4NA 3Q0EA 1GQQA 4PLZA 2P68A 4QDBA 3VH4A 2C5AA 3PQEA 2YHIA 1LNQA 3RQSA 4CQMA 4D42A 3RFXA 2AE2A 3NGLA 3OIFA 4BIIA 5FF9A 3OQ1A 1DC4A 2X0RA 3E03A 4J49A 2VHYA 1LC3A 4GH5A 4RQTA 1LO7A 4DIFA 1LLQA 3RKUA 4FD3A 4B0BA 3H2ZA 4RLUA 3LC1O 4IJWA 4M8SA 4NR0A 2OHXA 1HWYA 1Q2XA 1QV6A 4WLFA 3O8QA 8LDHA 5LDHA 3H5NA 4CUJA 4YAEA 1TVEA 1BRMA 2VHZA 1RYEA 4MPDA 4BO3A 5BSHA 1QSGA 2JCXA 1EK6A 1ZK3A 3L9XA 4MVJI 4YBVA 1T1SA 2YYYA 4NHEA 2Q1SA 4M49A 2NNLD 3NDIA 2EKQA 1J49A 1HKUA 6LDHA 2X4GA 1WM6A 1BVRA 3VH3A 1LDNA 3BMCB 1N92A 3PGXA 5F5NA 5BQFA 4YB8A 5DCUA 2QYSA 4OL9A 3R32A 4R3WA 3KHPA 5FWNA 2Q2BA 4CM1A 5I7EA 1HDYA 2E49A 1E7SA 4J91A 5JDCA 4QDAA 5EPOA 2C29D 3RWBA 1H93A 1ZNQO 2RHCA 4BNGA 1P77A 2JCYA 3K8ZA 1IE3A 5THKA 4ZRBA 3CUKA 4A73A 2VYVD 5H81A 4OH1A 1ORRA 1Z54A 1IZ9A 4G2NA 3B20A 4ND5A 1UXIA 1EVJA 3AWDA 3C7DB 3KLMX 4TZKA 3JV7A 2H9IA 4XGIA 5EERA 1D3AA 5G0VA 4UVGA 2C0CA 1YXMA 1NR7A 2Y66A 1E7YA 2JAHA 3BHIA 3K9QO 1ISFA 1YKFA 2TMDA 2BI8A 1I2ZA 3FHLA 3GHHA 3QQPA 4HZPA 3HWRA 4KTTE 4W7HA 3AOGA 2GLVA 4IMRA 4IBOA 5CHEA 3GEDA 1YOVB 3PHIA 2DBQA 4XRRA 3UVEA 3C7CB 4UVHA 1UXKA 3SJUA 4E2ZA 4E5MA 3DC2A 1A71A 3LC7O 2PGJA 3MCVA 5C7LO 4AJ2A 3WTBA 2UDPA 2XXJA 1K6XA 4EEXA 4DQUA 3L07A 2Q49A 3WWZA 5B4VA 1DEHA 5T6BA 2UAGA 2W2LD 2HMTA 3C3XA 3NUGA 4CMBA 5MGBA 4KEHA 3LDHA 3DHEA 1A7AA 3KHUA 1V35A 2UV8G 1RJWA 4TVBA 4IZHA 5A4DA 1J6UA 1T25A 3IP3A 4ZRNA 5JPIA 5AXAA 3WGZA 3ZWPA 1DJQA 3JQ7B 4RF4A 4IDCA 2FZEA 2HJSA 1WDKA 3NT4A 1DSSG 2NADA 1DOHA 3L77A 4XX0A 3QA9A 3WGQA 5DBGA 4R4JA 4LCJA 1B16A 2P5YA 1E3IA 2X0IA 4HFRA 4AG3A 1Z6ZA 3B1FA 3CMMA 1PJ4A 2XFLA 3UCEA 1Y1PA 2Y68A 1U9JA 3TEAA 4QD8A 1ZEJA 4M86A 3ROPA 1QLHA 4CL8A 1ZUD1 1UZMA 2VYND 2Y1FA 5LDGA 3BNVA 2ZB7A 4FJ2A 1E5LA 1U2DA 1WDLA 1U3UA 3K31A 4BNFA 1A7KA 1MXFA 3ETGA 5BT9A 3JQ9A 5JDCC 1ZXLA 4TRJA 4OO3A 1Y7UA 4UVIA 5A5FA 3VPSA 4JN6B 4BKPA 5JC8A 3UOGA 1ML3A 1P44A 2DBRA 2D8AA 1YBMA 2YDYA 3H9JA 2NU6A 5ENDA 1NAHA 4YJFA 4AFNA 1H5QA 1Y9AA 2WWRA 1W6UA 1M75A 1XLTA 3F4BA 3OMLA 4JJIA 4FB5A 4FC6A 1B8VA 4UUPA 3U09A 2CY9A 2AEMA 4DMLA 5JO0A 2DSLA 2FWMX 4RLJB 4DC1A 4PZCA 3G1UA 4A0XA 1E7QA 1X0VA 5COQA 2Q78A 5I7FA 2PLAA 2EKPA 3BMOB 1ZBQA 4FW8A 1GY8A 3WIEA 1U28A 1BGVA 4ZQFA 1ZIDA 1P1FA 5DN9A 4CR7A 2Q45A 3ASVA 3ZU3A 4DTIA 2O3UA 4CLHA 2EISA 2HMVA 3JQAA 4GSKA 1CYDA 2Q99A 4EUFA 3WG9A 2JD2A 1Q6WA 3H9UA 1O89A 4ZRFA 4B0JA 3RUEA 5JYDA 1LC0A 1U5AA 4Y9DA 1HYEA 3AI1A 5CDGA 4CM3A 5F6RA 4CMIB 4WOJA 3ZV4A 3PJFA 2HX5A 1KVRA 1KEPA 3KYDB 2OMEA 1NBOA 5T5QA 4MOWA 3AM3A 4CLRA 1RM4A 3E48A 3QV1A 1BSVA 4I5DA 4TWRA 1JKFA 1Y6JA 5JCJA 3H3FA 3NGXA 2EEZA 3W8DA 2V1OA 2QG4A 5DULA 4BNWA 4CL6A 2OORA 1VM6A 4AE7A 4UUMA 2W2KA 3W6ZA 4AJLA 4I5GA 4ORDA 3AI3A 1R37A 3NRCA 2V6BA 4PRKA 5BNFA 4BGEA 3ZWMA 4PLFA 5ICSA 4XR9A 1ZKMA 3RUHA 1E3WB 3AY3A 2HMUA 2E6UX 3P7MA 2NVUB 5EGJA 1VJ1A 1KYQA 1EE9A 3KG8A 5DM5A 1HL3A 7MDHA 3A9WA 1VL0A 3GN2A 2ESSA 1UP6A 2OZPA 5K9ZA 2Q1WA 2CF5A 3OA2A
chains in the Genus database with same CATH superfamily
1OAOA 3LX4A 4DKXA 3IV7A 1T8SA 2NXCA 4IDQA 4N3BA 3D7MA 4QOEA 3W4KA 2BTQA 3A3PA 3RVRA 4OHBA 1UOOA 1IZ7A 3QU7A 4P2GA 3WR5A 1CDZA 4L9SA 3TLYA 1YR7A 3GEKA 1INLA 1VPMA 2O7QA 4LVOA 5TXGA 1XCBA 1W2HA 1IY8A 4V24A 3PEYA 3ADDA 1XU7A 4YP6A 4JASB 1DLIA 3WV4A 4AZ0B 3FYCA 2HF9A 4KX3A 2JFHA 2GD0A 2HJJA 4E5NA 1L7QA 4IZ6A 3F9CA 1QHNA 3DP1A 4FFMA 4QATA 3E22B 2G0TA 4BFXA 3LSTA 1SQ0A 5IN5A 2XXAA 1A5BB 2FW6A 3KFXA 3U7RA 3MCWA 1C7EA 4AUMA 1TAHA 3I04M 4UUQA 2E4AA 2JGNA 4WEOA 4C88A 4ZI3A 1KEVA 2E18A 2ZXEA 1BOFA 4EHBA 4ENRA 3PPVA 2AJDA 4N47A 1IEXA 1GN9A 3FKJA 2B8EA 3WLLA 1UWVA 3C3MA 3FSGA 3RS5A 4OXYA 4JBNA 3AY7A 3LKDA 3C3YA 1BA2A 4E46A 3TKYA 1WZEA 2WIFA 3EG9A 5JQGA 1FYDA 3L9WA 2JIQA 2RMKA 1F6BA 4HLUA 2OYRA 2NSJA 1DQ3A 5K01A 1MJGA 4DS3A 1HLGA 3IE0A 1P0FA 2I54A 3T34A 1HE4A 3BEDA 1XIVA 2JIDA 2R1VA 4DV6E 2IH4A 2LBSB 4HBZA 4FB4A 1IG0A 1JHDA 2D3TA 1J5PA 3ENKA 3B6JA 2O59A 4DLYA 2H57A 4J29A 3W9BA 4QYXA 3N8IA 4ZEMA 1XMJA 3GV0A 1JHZA 4G8DA 4A8HA 1PFKA 5AKLA 3R0XA 3AU8A 2NMVA 1J8MF 4QUJA 3OE4A 2NV0A 1L3IA 1P4SA 3ICQB 3HK2A 2WBUA 1P3Y1 5JY1A 1F2UB 3T95A 3SZGA 1SOVA 4WXEA 4CKXA 2IELA 1SEPA 4DR4E 2I3DA 4CIXA 4YY3B 3KSRA 2UYQA 2VSYA 3CEPB 1AS2A 3UJBA 1A9ZA 1VBMA 1V8ZA 4LQDA 5B3KA 2B5VA 2X7HA 2HW8A 3MWDA 3CH4B 2GBCA 4J6EA 4LI3X 1GR1A 1TADA 4JXJA 3MTIA 5DBOA 4IF6A 4KXVA 4PN3A 3CSUA 3GBPA 3AEYA 3BSSA 4IFTA 2LCQA 3HUDA 2P4QA 4RV2A 1UZLA 3OPYA 3LV8A 3P2SA 4I4IA 2VDOB 2BBSA 2Q2OA 4GZ3A 2RGUA 4XSHA 1VE9A 2JFYA 4XQGA 3ZD9A 1SXHA 4EA8A 5KKCA 4RK6A 4H08A 2BC9A 1N2OA 1PJ3A 5KCZA 3W8FA 4RLTA 3G79A 4DPKA 1XKTA 2ZB3A 3PCRB 3K6JA 2JKVA 3LO5A 4AY2A 5CXXA 2M1ZA 2B69A 4XGRA 1OYOA 3OIWA 2GN9A 2QIPA 3ADKA 5AI5A 5B37A 3WMGA 3PUVA 3ZQJA 3T4UA 2V7UA 3HDVA 2A5LA 4DMKA 1KEUA 3EZNA 3W3AA 1C7IA 2QWZA 2GN1A 3IMKA 3O83A 2XDWA 2XUFA 1M67A 2BEWB 3KTAA 2WWYA 3KKZA 5GQSA 3BTUA 4KR7A 5J2UB 3EZFA 2D9HA 3K1AB 1Q7CA 3TB6A 4FMDF 3GD5A 2B7BA 2FR8C 4PG4A 2IPMA 521PA 4G2TA 1MDFA 4U02A 3J7Yp 3FPGA 2CUZA 1OI2A 4RABA 3HFSA 4QO7A 1HT2E 1Z39A 2W98A 4C1BA 2NLOA 1EUCA 4DCNA 4DYHA 4IDEA 2YDXA 4H3SA 3HG7A 4P54A 4YQFA 1F1JA 4NE2A 1Z5VA 1FP2A 1EZ4A 4M9UA 3S8EA 4B85A 2GN6A 1AHHA 4N82A 3WFJA 1XMOE 4D6YA 1EJ6A 2XZLA 2ERCA 3KJXA 3BIWA 3S4KA 1N0UA 4F2GA 3GJ4A 4MV7A 3GR6A 3PK0A 5HM6A 5LNK6 2B3TB 2FR0A 4H3HB 1TZJA 3E0QA 3WYEA 2IDKA 1DKMA 2EPNA 3REFA 1NVKA 4YX9A 1QQAA 4ZQCB 4D8UA 4M0CA 3D54D 1WZCA 2RAPA 1SC1A 1X3SA 3LKZA 1AMNA 1YS6A 3VNAA 5I9SA 3U3XA 5IHPA 3PXUA 1YZLA 3Q3JB 4EFMA 1B3BA 4ZV3A 2XB9A 2V9CA 3AUZA 2FEWB 2VHUA 4JEUA 3QYAA 3V6LA 1TMGE 1GRCA 1OLUB 4JITA 3TFQA 2X8JB 4N39A 1GU0A 3IP8A 2EMKA 1OFUX 3T12A 1E2NA 4IXTA 4XVCA 3QVSA 4QGGA 2EBHX 5KVSA 1JIUA 1NQXA 4EGAA 5LLQA 3H83A 3ZLBA 4FFOA 1D6MA 1QYCA 7REQA 2VSFA 5KNLA 1RWKA 1AH5A 2EJTA 4X62B 4YMTA 3GW8A 4U7DA 4PHGA 5JZ9A 1F51E 2REQB 3TPFA 3OPMA 2V97A 5TS3A 5DE3A 1W4AA 3KQUA 1CJCA 2XADA 5AO9A 3O74A 4NOMA 1H6DA 1JQJC 3O4VA 4F7WA 3CVYA 4AUNA 4F5WA 5A4IS 5DYNA 4IG4A 5AFSA 2CB0A 5A3VA 4DRYA 2VDQB 3D7KA 2A88A 2JEYA 4O25A 5CLQA 1KAOA 1HNWB 4J4BA 1JI3A 1STUA 5HMCA 2QNIA 1ZJZA 3DBRB 1JFFA 3G2LA 1IM8A 4BLTA 2XUPA 1UJ4A 4MNTA 5JBQA 5TMBA 2Q5FA 2WPDD 5L4LA 1ZN8A 1ZGBA 4D4KA 4V0SA 1SHKA 1YRYE 1JZSA 5EZ6B 4W1QA 1NTRA 3MIZA 3F1LA 3NAGA 1UMBB 4I55B 4TZTA 3LBIA 2QXTA 4NENB 4DIEA 3RFFA 5ITZB 2NPFA 1ULBA 4DCGA 1XZ8A 1L5NA 4ZN6A 3K1ZA 4BGIA 2O3JA 3RKRA 5K4GA 5EXEA 4CQJA 2NAFA 2QYTA 1JR6A 3LCVB 5JFTA 5H3HA 1V11A 2ILVA 5KL4A 1M8PA 5BWMA 1B0UA 3GA0A 1RHKA 3VR5D 3WLQA 4OV6B 4KZKA 4YAOA 4ND3A 1E5QA 3OQPA 4LN9A 1RABA 3B6EA 4KE8A 2WJ6A 2AW5A 1K6EA 2OILA 3K9LA 1SCIA 3UO8B 2D0IA 3G8BA 4OKSA 2XQGA 3AJDA 4RPJA 2YIVX 1DC6A 4KAAA 4D99A 1DHTA 2VRBA 2ZAYA 2W2OA 3GDGA 4B09A 2W6PA 4IEIA 4W5JA 1KZ4A 1XA3A 4RD1A 5CT6A 1I7NA 4EGQA 1Q0SA 2OT3B 3LW7A 2NV2B 2CXOA 3UCXA 1CUZA 2J3QA 1ADBA 1VE3A 3Q5DA 4LJ6A 2G71A 2MSNA 1M1NA 1TF5A 3LBHA 4LMPA 3BJMA 3CC8A 2NUPA 5HD6A 3GCDA 2R25B 3C2QA 1UC8A 4AMGA 4TYYA 1UJ6A 3CNNA 4AXXA 5IKMA 2QQEA 1BJKA 2KBEA 1N5JA 5DEOA 2JYAA 5EJ2A 1Z83A 1N6NA 5F2KA 4OAQA 1DZIA 4HEA6 3I5YA 2OCXA 4K3UA 5CTAA 5JTTA 4IDBA 4ZVPA 5FWXB 2F1OA 2YV5A 1LB1B 4O0LA 4NCXA 3DXXA 5EJGA 3V4FA 5ECWA 4ZAVA 4Z7NB 2BZGA 3R7DA 4ZCPA 3LZ6A 1ZN7A 1R5JA 4IOLA 3RF6A 1BX3A 1A9PA 1PFYA 3NRJA 3AVTA 4KJZA 5A6JA 3KJIA 2R8XA 3MTDA 2UV8A 1XMXA 2KM1A 1YZGA 4MLZA 3IAUA 1L9XA 1RKBA 2ZRGA 5IZCA 3INYA 1QYIA 1PE0A 5DXAA 2PBRA 2HZBA 1F3OA 1UDAA 1QVAA 3O8BA 5CYOA 1ZIYA 3ZZMA 2YY6A 5BR4A 2NT3A 2JFGA 1LVHA 1KYIA 8ABPA 1QBGA 2RAUA 5K0BA 1E69A 3AIMA 2GJ9A 4PZDA 4TSRA 3JQAB 5DHFA 3OAAD 5LC1A 1YZTA 4EG6A 2L3JA 4Y2UA 4MV6A 3EHDA 3L1JA 3VPGA 1YHZA 4CE6A 2AEEA 2PZKA 5KYWB 1JFRA 2IPAB 1GSAA 4DBZA 1PS9A 5KQPA 1B3RA 2CD9A 4RBNA 3K0KA 5LWHA 1NQWA 4PC6A 5G3ZA 2ZUSA 4MCIA 1U9YA 1PZNA 3DH0A 4N0DA 4BHCA 3VPBA 4NK4A 2ZEJA 2CDAA 2PQ0A 4INJA 4QTYA 4WXDA 1RQNA 5CLJA 3U4QB 4AK9A 5AM5A 1LSUA 4GS5A 4FIZA 4Q6BA 1C0IA 2PXHA 4BP3A 4NMMA 4PGAA 4UAVA 3G6WA 3ZWNA 2DCUA 4WZBE 1YH3A 3MTAA 4FKBA 1ZWLA 2J8ZA 3G5UA 4MVJM 2AR9A 3E9DA 1G9TA 3CX4A 3DZHA 4G8BA 2B98A 4ECEA 2O20A 2BM9A 4OXNA 4K0KB 2GXQA 4NXNE 1SBTA 2ACVA 2I7DA 3FTNA 1HF3A 2EFGA 4FINA 3WHPA 4ZD6A 1RPJA 5IUKC 1OH5A 2FSPA 3H0KA 2AXQA 2G63A 4WK6A 3ZH9B 2XUIA 1CQJA 2EVWX 1Y6QA 5CW1A 1D8TA 1ZRNA 4YCNA 2QX7A 3QEJA 1S8AA 1PHPA 1DPGA 4FU0A 4AN4A 1MKBA 3TLKA 4WKCA 3DW3X 5JSHA 3W3ZB 2BHLA 3MCTA 5ALKA 2Z1NA 3U3RA 1ECPA 4Z1MA 2DMYA 4JI5E 2P6MA 1G21A 2A1UB 3SOPA 4S12A 5ELXA 1VHQA 3F97A 2QORA 2JA2A 1UBDC 3Q7PA 4FYHA 4Z4GA 1Z36A 2VJKA 2D1RA 1Y37A 3VPXA 2Q9UA 2AR0A 1QH1B 2QEQA 3RBAA 3K0HA 1HI9A 1M34A 1QPGA 1DQRA 2DTDA 2CN1A 3JRNA 5DI3B 1A4RA 1YDEA 3JATA 4NEGA 4BO5A 4AROA 1C1DA 2QJFA 3RSQA 5KJ1A 3KR0A 3PI7A 1CK4A 1IPHA 3UJHA 4QNMA 1U11A 1I36A 4D02A 1XDGA 4W9NC 3NBFA 4MKIA 3WBKA 3D5QA 3HGMA 4BATA 1JAXA 2X2FA 1V8PA 1EB9A 1FDWA 3C1UA 2BFBB 3O75A 5FP0A 4IIFA 5EMLA 2IEBA 4U2EA 1JJFA 1DP4A 5GV7A 1XF9A 5JVDF 1BXKA 3H2JA 3GD7A 3D6VA 2GLPA 4ZHQA 1ZJJA 3AF1A 1VTKA 2ODRC 3GMTA 4W5RA 1J9ZA 2IZ0A 1PDOA 4XE5A 5A6KA 4RIHA 1R8QA 1FYVA 1M7GA 3ZHBA 2HO4A 3OZ7A 3GBSA 3GH3A 2VZLA 4RETA 2WF9A 5KQRA 1RBYA 2VNJA 3DMRA 3I6QA 4HZGA 4EY8A 4LF8B 3QWHA 2GLUA 4N49A 3R36A 4HDSB 5EO2A 6NULA 2W3XA 3KNZA 2EX4A 4UDNA 3JARA 4C04A 2OV3A 4RK7A 2ZYVX 4AN0A 4XVQA 4M83A 5FJIA 3TGLA 3DCIA 3DT8A 3VYUB 4J16C 2XRZA 2AJBA 2CJFA 1WY7A 1N36B 3O6VA 1IAQA 1FXWA 4B3FX 2YVUA 1VSUA 3CIFA 4FVTA 5HQ3A 1T4CB 3X1YA 4UBOA 4O1HA 1T6XA 2RGDA 2YIDA 2BGJA 2GXSA 1OW3B 3WA6A 4S0ZA 5ALWA 1M6WA 2QUAA 5DFAA 2CXXA 4L9WA 1E2LA 4OBXA 1JA1A 4DMHA 3LLHA 4Y18A 3EZ2A 1G5QA 3IPXA 5AUOB 4HY3A 4ISBA 1YZUA 3PNYA 3HPRA 3T5AA 3LMKA 4CIAA 2HHJA 3B7GA 4RKQA 3CZ5A 1T4OA 2WYVA 5FQOA 3PPWA 4R4UA 4M8IA 3CVVA 1N34B 4LBZA 3SDBA 3PUYA 4MGHA 2PMWB 3C48A 4RH8A 1QH8A 4XASA 2X77A 4R1PA 2GK6A 4GC9A 2I6UA 4JI2E 4TYWA 5LB4A 5E6RB 1C3JA 4IR7A 2F1RA 3JVDA 4W7SA 5F98A 2FFQA 4JI6E 1JIXA 2ZVDA 2OZLA 4L9RA 4O2AA 3F46A 3O8CA 1RWNA 2R85A 2OCGA 2WRZA 4FFVA 3DBVO 2ZBQA 1IK4A 4D5EA 4K87A 3ELYA 1ZVKA 3WO0A 5E6UA 1JEYB 5CCXA 1OXVA 1OB2A 3LFHA 3WL5A 2V98A 2H6EA 2JZCA 3CJQA 2C04A 1M33A 5DK6A 1BKDR 2PO7A 2EOYA 3EUFA 4YRCA 2XE6A 3L8EA 1HFJA 5AW0A 5AJTA 3FUXA 1J23A 3L8YA 3RKUA 1BMFD 5BOVA 2BLNA 3TLBA 4YAEA 2UZAA 1THMA 3T7KA 3IO5A 3ZDDA 1GFIA 4YBVA 4IXDA 1EHYA 3M3HA 5DCUA 2POCA 3R32A 1M1ZA 3KQWA 4RVOA 2F64A 2VPQA 4R0VA 3W90A 4YRZA 2GK7A 1WKVA 2GD2A 3CUKA 5I7HA 3QKSB 4ND5A 3VAAA 3S1AA 2B2NA 2WILA 4KE6A 1IBSA 5AM2A 2Y66A 1ISFA 5D3MA 1IY2A 2WM8A 1QQ6A 5M04A 4TS3A 4ZK2A 1RP1A 2CW5A 3ADJA 1P0QA 2R66A 1SRQA 2EFJA 2KB0A 3ZY3A 3JQ7B 4AX8A 4DLWA 2AUNA 3D0QA 1Z2PX 2ZRPA 4HFRA 3AFIA 1PJ4A 1UF9A 1U9JA 1X48A 1XZGA 3L7BA 3W2EA 1Q17A 1TCUA 3SAJA 2ZUTA 2I4RA 2GJKA 2ENAA 4P32A 1ZOOA 3W1WA 3E8SA 3C4VA 1Q20A 3SLRA 1Z16A 3HKBB 4QFBA 4YJFA 1Y9AA 2WWRA 3LKBA 3D6AA 3AGQA 3IIKA 3RT7A 2W00A 4BZQA 2MWMA 4B0OA 3RWMB 2O05A 3E4DA 2SECE 1FX0A 1MA3A 4CM3A 4A8TA 2EOSA 5JNVA 3H2KA 2O0LA 1BSVA 4HAOA 1JKFA 3LTEA 4ZT6A 3NRCA 3QPDA 2Q1XA 3ADCA 1R2QA 4KK4A 7MDHA 3NC1C 3C43A 4AKSA 5F52A 3R0JA 5EVCA 1ZLXA 1U90A 4EYQA 4PV7A 1R6AA 2WD7B 3OZGA 1AQJA 1K89A 1ZU4A 4UD2A 5T4EA 3JQ9C 4RJIA 4LN1A 2GS9A 2YICA 4OG2A 3GLVA 1MEYC 1BX1A 4YN3A 3NIWA 3ZVRA 4D46A 2YKGA 1GA1A 3WLIA 3TM5A 3AHIA 2AG0A 3PL5A 4OI0A 3HL0A 1E2MA 2J9XB 4LTYA 3PDIB 2EN7A 2D0OB 3CZPA 2PUDA 3STXA 4G1CA 4ABYA 3RRBA 4LHWA 3OCZA 1NXTA 4CKBA 4DRZA 3OAAA 3W5SA 4U9UA 1KL7A 3FFWA 3VNBA 4OI4A 3EMDA 3D64A 2YBDA 2UYYA 2PWPA 4OHKA 1PYDA 5T07A 3CRVA 4KRYA 3Q2IA 1EJBA 1CE8B 1V41E 2PL9A 1EX6A 5B57C 4ARIA 2XVXA 3HVJA 5KJ6A 1I7DA 1JE0A 4GVXA 4DCMA 2BDEA 5BMVF 3TLXA 4CJXA 3LT2A 4AN1A 3GAMA 4D3FA 2JAPA 2NZYA 4R1UA 4C0XA 1BB8A 3MXTA 4LMRA 3JRWA 2OGWA 1Y3DE 1MJ5A 4WPGA 1NY6A 4WJKB 1NIJA 3ZY2A 4E88A 1C41A 2CXPA 1FFEA 2RARA 1A2QA 1KDRA 3TNDA 1V7ZA 4PZAA 5CA1A 3OPVA 3SWWA 2AG5A 1JN0A 5HUJA 3GLSA 2HIHA 2WTUA 2OQVA 4ZJPA 4FEEA 5LJIA 1E9DA 4PLWA 3GLGE 1PR3A 1XRLA 1WCIB 3D3KA 3IOEA 3C4QA 2IUFA 2NVWA 3QH4A 2EW1A 4GRDA 4TV9A 2I2DA 1X1SA 1Z73A 1AJEA 5HK8A 4JUBA 1LRLA 4FEGA 3UJAA 5JRDS 5K0SA 4EB3A 3BL6A 2GYWA 3MJEA 1VHWA 1OBOA 1VZ2A 3L7CA 4LPSA 4R03A 3ZN2A 2BEVB 2O5EA 1H5UA 2ODPA 1GIAA 4R8SA 4O4IF 2VK4A 5EWMA 2LE0A 3OFSA 1AZLA 1OH6A 1GPYA 3B52X 1FXUA 2XECA 3DYVA 3DZDA 4XLLA 1KAEA 1CRLA 1Y34E 3T5BA 1NJ1A 3D81A 1AUPA 2RGBA 3MCAA 4AJKA 5FYQA 3IE2A 5T3UA 1DFIA 4XWOA 4M1TA 3ICPA 1JA0A 3H1BA 3LZCA 2OIWA 3HADA 3EOBI 1QQ5A 1WXHA 3ZLUA 3D6HA 1N2CB 4FHCA 2BMAA 3H5TA 4L5NC 3UJ6A 2AEJA 2CFIA 4GBED 2J85A 4P3XA 2A0UA 1GCGA 2G1PA 3IALA 1JHUA 4TWIA 4ZAFA 2PQ2A 1G8KA 3NRBA 3S28A 4BNKA 2YXNA 2PSHA 4KBFA 3U44B 2NO1A 3EIQA 1XZEA 2OM6A 2QM3A 4TLBA 2QVYX 5M34A 4O2BA 1T5TA 2YOFA 5ALEA 2YU8A 1Z2EA 3DBHA 5GZ6A 2P9EA 4AJHA 1KTVA 3OURA 2ECKA 2HFKA 3H11A 3VPDA 2FJPA 3H5AA 2IV7A 1OBFO 2RHWA 1QCZA 4ZANA 1ZCJA 2P9CA 5BSTA 2IKQA 4NG4A 4KE7A 3TQIA 2WE7A 1DHRA 1Y8RA 1N9GB 3KSUA 1O96A 3K0SA 1MPXA 2ZTLA 3DMNA 1TIPA 6YASA 1TZ2A 2WJJA 4ZI7F 1ONNA 2J6CA 2QMUA 2NM0A 1UBMS 3DEIA 2ZJ7A 4BJ5A 3S0JA 3BF7A 3SBDA 1ENYA 4RV5A 1V3TA 4JLVA 5EIWA 1CUSA 2ZIEA 3OWOA 3T7AA 3Q12A 1G8SA 4Q16A 4REOA 1PHRA 4GZLA 1FUEA 3FFTA 8ADHA 2MYPA 1NN0A 2RGEA 1F8FA 3TSCA 2R7LA 1TQHA 1VHTA 1TYCA 2P0EA 4MIEA 2AJCA 4FYWA 1UEXC 5C8YB 3DMPA 1YZYA 2VRCD 4PE5B 5C1DA 4AKHA 4JC5A 1EP9A 2FPIA 4D5GA 2YZ7A 3R3JA 4G9EA 4TMWA 2WP0A 1D2AA 1A96A 1MA0A 4HC4A 1P7ZA 3NALA 3LQKA 2GF0A 3OEYA 2FP3A 3RVDA 3BMQA 1C29B 3CW2A 3D5TA 2C9OA 1O3YA 4MUFA 1JJ7A 3N2ZB 2Z58A 2JDID 2Z83A 1WMAA 2QW1A 3FPCA 2N1MA 3CLSD 2PKQO 4BVGA 3RW9A 1PR2A 2D1SA 1B7GO 4GECA 2WIAA 2ODTX 5FYDA 2MSEB 3B1KA 1NHWA 1BXGB 1N5DA 1YC5A 4LHXA 4DHEA 1UAYA 2WKSA 4TTAA 4NHRA 1LTQA 2E4UA 1PZHA 3LPAA 5I8WA 1L5HB 1U0RA 3DEYX 4JX9A 3KE8A 2NO5A 2CLCX 5F33A 4YRJA 2P2SA 4HDNA 1OXUA 5JSZB 3HA2A 4BNHA 4HLCA 1C9JA 4NP6A 1BU5A 3TB4A 1Y1LA 4LBVA 3K5PA 4GNRA 2HC9A 1B4DA 1QRRA 3MLEA 2VPTA 6AT1A 4JI4B 1K4MA 1EZ1A 1YDMA 7GPBA 5I4CA 4DJ5X 2PH7A 3EFBA 1J8VA 3P0FA 1ST3A 1I2DA 5ISMA 3U4AA 2H48A 5HW0A 5BYUA 4L4YA 3Q40A 2EM8A 1ZAKA 1CDOA 1UUFA 1M7HA 1E0AA 1HG1A 3IEPA 1BMFA 2OSVA 3B13B 1G4HA 3WB1A 3WK6A 1M2KA 4D9BA 1VCHA 3MAGA 4WSGA 3CF9A 4LAFA 1SUPA 3A25A 1W59A 4P4SB 3WLRA 4FJ0A 4MK4A 3LDUA 4JBGA 1B0PA 1CR1A 3GUHA 2BZ1A 1DG3A 3OKPA 3ZDRA 4N0MA 3S99A 4TTJA 3V1MA 4UEJA 2C97A 4X0EA 4OU5A 3KYDA 5BY2A 2V8BA 4CF7A 4CI0B 1FCJA 4OM7A 4W1RA 3TMAA 1DDIA 4EYGA 4HQFA 1ZK0A 3DAPA 2NVUA 4QDUA 4PYRA 2O48X 4UHJA 1A98A 1A9QA 4OY3A 4DLAA 4XUDA 4ZZ0A 3O0DA 3WGLA 4CDRA 1XPOA 3PTLA 1SXQA 3I2GA 2RGNA 4DR1E 3TIIA 4E5PA 4RYDA 1KR5A 1G21E 3IAHA 2XX3A 5FULA 1TU4A 2Z8YM 2J7JA 1VP3A 4A2CA 1GZ7A 1YK0A 2ORIA 3NT2A 5DXFA 1LO8A 1CUFA 4KXYA 3GQVA 5TGDA 3RUDA 1ISMA 4MKFA 1JQDA 4KLZA 1IXYA 1SHTX 1JKIA 2RBKA 4BLUA 5IS2A 1PL0A 1M34E 3FTCA 2Q07A 1IZ8A 1MEJA 2IYNA 4BB5A 5EINA 2ATXA 4NZZA 4NC9A 4RULA 1CUDA 2B4RO 5EJMA 2DWUA 5BT8A 4MO9A 1ISSA 5AKKA 3PQ4A 4DREA 4ZYLA 1OR8A 3HKCA 4QWWA 1MD9A 3JZIA 3C1OA 4Q21A 2RGGA 2VR1A 3ROMA 4CLXA 3LY7A 2OLJA 3UAZA 2HM7A 3BWVA 3DO5A 4QXQA 2PWAA 3O2JA 1E63A 2QTNA 5ALFA 2I7CA 4WACA 4MHTA 1KJWA 4ZTZB 1K7FB 2ZBRA 2YJ4A 1NVBA 2I78A 3CM0A 3GRCA 3F74A 3IIEA 1EDDA 1NA5A 3R0IA 4EUSA 2EGGA 5E4FA 2EMAA 3D7RA 1TCBA 2Q4DA 3I9LA 3P27A 3AEKB 5DK4A 1BOOA 5E7IA 1XBTA 1WBDA 5EIFA 1O8BA 5ALHA 4ADSG 4DR6E 4LXHA 3H65A 4CL0A 4YV1A 2W2KB 1FFXB 3QX8A 3JD3A 3MWEB 2OXIA 1ZYUA 4G8CA 4FLFA 1PSDA 2EGRA 1XG5A 1Q11A 2XYGA 3DOJA 2G7HA 4Z9BA 3ZU6A 2JIMA 2P0YA 1OVGA 1XVUA 4C20A 2V7WA 4PCLA 3RVQA 3V4LA 4BO7A 2VEOA 3BUSA 3M6LA 4JI3E 5C35A 2G25A 1OTHA 4BIMA 2C2IA 5ERXA 1GQ2A 2K2WA 4B1FA 4OGLA 3JQDA 3QPAA 4Q9IA 1L7BA 2IU6A 1XRPA 1E1QD 2BFEA 2JBWA 3UFXB 2EM0A 2DR3A 1RCTE 3HCWA 2N3GA 1OAKA 3M2PA 4MQLA 5KJEA 4DM7A 1ZCAA 1UT5A 1RVV1 2QAGA 5JNRA 3MD9A 4MQEA 2ZIWB 4RLSA 3K5WA 5JPDA 4DQDA 4C3OB 1P0CA 5A03A 1C8KA 3DZFA 4V0ME 4DJEC 2NIPA 2NXJA 1FS6A 2B4QA 4MRMA 5ANRB 4CG0A 4INOA 1F06A 4DARA 2WF8A 1CS0A 4CU2A 4YC7A 4K6FA 3IR6A 1XV5A 2AA3A 2C83A 4QXPA 1JHVA 4DIMA 4GI2A 3W6NA 3D0KA 2BBWA 1R50A 4IOKA 1GM5A 3D59A 5AHWA 4V0OA 1R18A 4JIMA 3N0VA 5B7NA 1CPYA 1CZUA 3KKPA 1AC5A 1Y1RA 1E4YA 1KZGB 3L6EA 4KR9A 4M1OA 4MLCA 1OFUA 5A0FA 4MGIR 4M6WB 4ZVKA 1S2NA 4COOA 3M89A 2G36A 3MWFA 1ECGA 1KY4A 3H2SA 4QBIA 3SS7X 1EJ0A 2FW7A 4DXDA 1ZUNA 1LBTA 3CLUC 2VWHA 1EDZA 2EN2A 2X1LA 4ALKA 4GWLA 2INGX 2IYUA 3DB2A 2UZ0A 5DNYB 3CEJA 2IIQA 2FKNA 2VQ6A 2EJ4A 1MB3A 4UDXX 5FWAA 3MIIA 2WR8A 3N0TA 4V02A 1S89A 2H51A 4BLQA 2HLDD 5EHXA 1M2EA 3KZKA 3HDJA 2DFPA 4I9UA 1D9ZA 4PICA 3KVZA 1XQYA 2ZRFA 3TIXB 4IPTA 1VKJA 4EA6A 2HKIA 3EVDA 3ZQKA 4RDIA 5GM2A 1HDEA 1M5UA 5FQNA 3VZCA 2KMLA 1PSUA 4L4XA 1ZICA 4F1WA 3IVRA 3VZDA 1E2IA 3IAFA 2SBTA 4D43A 4FK8A 2DH6A 2Q2NA 5DTJA 1V39A 5IAJA 4RH0A 4QD7A 2XA1A 3EWIA 5KOHA 1Z4PX 3K9HA 2CXTA 3GGPA 3DHYA 1S02A 3KJZA 3E15A 3BBLA 2HSGA 4B7ZA 2FF7A 3ITKA 4ZO6A 5FPHA 3M1YA 4IDPA 4WNCA 5IKEA 1FVHA 3DV2A 4R7GA 5TV2A 4BRWA 1SCJA 3CONA 4E2YA 3GJ8A 4NNJA 3GMSA 2YC4C 2PANA 5DRYA 2L2NA 4PU0A 3CVUA 4BQSA 2A0WA 1ZW1A 4YLEA 4XYLA 4IUDS 3LHFA 3SLGA 4D0RA 2AEFA 4C4AA 2ELYA 1IMJA 3P71T 2J5KA 4J7CA 1RTTA 2J5XA 3ORYA 2MC6A 1J5EE 3AW8A 1G5IA 4WIAA 5CYFA 2FOXA 3TZQA 5BN5A 2QTHA 2K6GA 1VPTA 2VRCA 2EJUA 2X0NA 5E8JA 2OKHA 3LWGA 2NO0A 3ET5A 2PS9A 4MW4A 1QK3A 1WOMA 4NCPA 2JI9A 1SUAA 4P31A 3EMKA 3AR8A 1U3CA 5AW6A 3U9LA 1C1XA 1CY6A 2PUGA 1W5AA 5KWEA 4YAUA 5HK9A 5ETJA 5FL7A 3P0EA 2B36A 1JB9A 2JDIA 4BMXA 3VGJA 2A0KA 1GL7A 1R12A 5J4VA 2WD8A 1U81A 3DAFA 5HJEA 1U3DA 3PIDA 4NDAA 2Q8QA 1GKUB 1H9AA 1YU6A 3ACDA 1NBME 3VVCA 3WLTA 4OYRA 4U2DA 1BBOA 4Z1MD 2NPOA 1VBNA 4LOLA 5ADZA 3HCBA 3KX2A 4AKGA 4M9SA 4PO1A 2C2GA 1Z5NA 1KU0A 2QZ4A 5I9LA 4ZMSA 3ZK8A 1WW8A 1CBUA 3BD6A 3Q62A 2BISA 1F1BA 2J3LA 1W75A 2I22A 4KQ1A 4LMBA 5D01A 3ETJA 5BN4A 3ZV3A 1E2UA 1BDMA 2CKDA 3HVIA 1SPBS 1X39A 3TDMA 3GLIA 2AZXA 1HRDA 3SPSA 3RJZA 2LV2A 3WRXC 1C8VB 2CC2A 4RK4A 1R9NA 4AIRA 2ID8A 3WZMA 2VBGA 3RYCA 1XTQA 1U0FA 2IV3A 1PZMA 2XMBA 1RC0A 1DXHA 4EF6A 1HMPA 4RL4A 3Q3VA 2RD2A 5K6TA 4CTOA 4FD3A 2FCRA 1WF3A 3IUEA 3HM2A 5F7ZA 5BSHA 2ROQA 4MVJI 1RQLA 3PFHA 3T5TA 1FNBA 1M2VB 1L8XA 2Q2BA 2DY0A 2GM3A 5DN6A 2C29D 1O9HA 3QA3E 4AIIA 2J7KA 4BLPA 4X71A 3QV2A 1M0SA 1NJSA 1GKIA 2PYDA 4DR2E 1Z54A 4KQKA 3IUMA 1K0FA 3R5FA 4P0PB 4TLMB 3FYHA 4EHDA 4JYZA 2P5TB 2BI8A 1I2ZA 3R5XA 5ALIA 1RKUA 3OZWA 5KYUB 4DQUA 4MWTA 1WSWA 4OX9B 1I3OA 4LXGA 3GGSA 5IDVA 1VLZA 4IZHA 3ZWPA 1A50B 1TAUA 2L82A 4RJKA 2AVNA 2IHR1 1WSDA 2Y68A 4Q9JA 5TQ0B 3MT0A 1U8YA 4ZIRB 1QTIA 3TTYA 3BNVA 1QP0A 4N3GA 4X7PA 2YN0A 1EHCA 4OO3A 3G68A 5LXTF 4JN6B 5CX1B 2FZKA 1X8KA 3TG2A 3ADGA 3HB9A 1NL3A 4RLJB 2EKZA 2GYVA 4KO2S 4TUYB 1V8OA 3BMOB 3UPTA 1GY8A 3OZXA 3EJ6A 3VC1A 4GQIA 4G86A 4EUFA 1G8JA 1YRHA 3GT4A 2IGTA 1F7VA 3GLGA 1FPQA 1NQUA 3PKIA 4CLRA 4I5DA 1E2GA 4IQFA 3KB1A 4CL6A 2CHQA 1EAYA 4J0DA 2IEGA 3IR5A 3P9NA 5ICSA 5E7MA 3SIXA 3U40A 4DJDC 4GMXA 4JB2A 3P7MA 3URKA 3ELDA 1Z6TA 4H3KB 1KJJA 3I2IA 1EE9A 5DM5A 3GN2A 2PU5A 1HE8B 4CF6A 3E9YA 3PC8A 3LUBA 1HR0B 1ZSYA 1M6EX 1RJ9A 3HXPA 4X60A 4ZOLA 4OUDB 3HVKA 1PAUA 5ALPA 1JK1A 3L7NA 4XVUA 1D2NA 1WUTA 4I5FA 4S1OA 4BLVA 1T0JB 1BTOA 3QZUA 4Q0MA 4LFCE 1CY2A 3KWJA 1OFIA 4Z9YA 4G65A 4W6ZA 3KPWA 3SMQA 2C8VA 1V6CA 1ENZA 3ICVA 2O2ZA 2CMHA 3DTVB 1BQEA 2V6GA 1XMVA 3PUXA 2W58A 4ZVSA 3EODA 1L4MA 4ACBA 4HRXA 5BVGA 3TGPA 1TZMA 4E5KA 2WD9A 4Y6PA 5JCOA 1R5OA 3QXHA 4J07A 2Y71A 1JEQB 2HSEA 2O0KA 4Q3AA 4AUKA 3GRYA 4WZAB 1TQDA 3FCUB 4FBLA 1P0MA 5TE9A 4NCIA 3KT3A 3FZGA 3S68A 3THXA 1EUDA 4HEHA 4KO4S 2I13A 4LXIA 1EGMB 3M6IA 3PTZA 2NO9A 1HTBA 3G5TA 3F73A 4LF7E 2O7SA 1F12A 2X8LA 1NW9B 4V3BA 1RMYA 4RZIA 3ZTWA 1U8UA 1OLXB 1GRRA 3R34A 1E58A 3W9UA 1BE0A 2J31A 1E1QA 1XDSA 3WDSA 4Y9TA 3JQ8A 4J7XA 5KTPA 3G2HA 4X65B 4BMZA 9LDBA 4BMVA 1VL6A 1XRJA 4YXWA 4GAKA 4FEAA 1COWD 5C31A 2WKQA 2AK3A 1V7PC 2OE2A 2UXCE 1X1CA 3RC7A 4EMSA 3DDCA 1XGKA 1Z6BA 2FG7C 4MOCA 1MRSA 2GZRA 1Z33A 4AJJA 4J0HA 1GSHA 2JATA 2W4MA 1XZIA 2JIBA 4BXOB 3Q6IA 4ZT3A 3AHGA 1SFEA 2WNSA 3BIOA 4BKUA 5DWVA 4D1YA 2FGJA 3C3DA 1DKRA 1U1ZA 1ORTA 3ZEAA 1V7QA 3OWHA 2OG2A 1RLJA 3PLNA 4QPCA 2RHJA 2PTGA 1TAQA 1NDQA 3HVUA 2C31A 1XZQA 5TEWA 2CBZA 2YWDA 3H9EO 1DKUA 3PJGA 3TEFA 1TVCA 1WXRA 2C42A 3IBSA 4RDXA 5BWCA 4QUGA 1IIRA 5A9SB 3U0BA 2X9NA 1H0KA 1NN3A 1ZIPA 2PJZA 4GOND 3TKLA 3BTVA 4WFTA 4NY1A 1E1CA 3DWGA 3UQZA 3WQRA 3IERA 1J5XA 4DIOA 4YT4A 2ZUBA 2XYPA 4HAYA 2Q3BA 1ZVQA 1N4AA 5JZOA 2B5OA 3IE1A 3JXEA 4IICA 1VE6A 3MBKA 3GNTA 2OV1A 4ZCTA 1JSRA 2EPZA 3OCCA 1L5MA 4DV3B 5AKHA 4ATNA 2C96A 3BZBA 4K9OA 3WIBA 1NBMD 5KHAA 5T64A 4U7JA 4DMIA 2NUTA 1TMOA 1D5WA 2HLDA 2P6UA 4TZ0A 4E4TA 5CGZA 4GOMD 4FUQA 2F1HA 2OMKA 3OCUA 1ZSVA 1E1NA 3TW0A 2EJWA 2PH1A 3BG5A 3KVUA 2O19A 4OUKX 2E5LE 1G59A 5CBPB 4BC7A 2OCDA 3OX4A 4NBTA 2R1UA 1ACJA 5K3CA 1LLFA 4DA4A 3D3QA 5DNWA 2ZIUB 4LG1A 4QGBA