3OMTA

Putative antitoxin component, chu_2935 protein, from xre family from prevotella buccae.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
68
structure length
68
Chain Sequence
TERKIFNRLKSVLAEKGKTNLWLTETLDKNKTTVSKWCTNDVQPSLETLFDIAEALNVDVRELIVSTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of putative antitoxin component, CHU_2935 protein, from Xre family from Prevotella buccae.
rcsb
source organism Cytophaga hutchinsonii
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
total genus 21
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3omtA00
2JVLA 1RZSA 2KPJA 1PERL 3GBFA 4X4BA 3BDNA 1POUA 2PE5A 4FN3A 3UFDA 2KEKA 1ZPQA 1RZRA 1ZZ7A 1WIZA 1ZZ8A 2LYLA 3S8QA 1RZRD 2LCVA 1AU7A 1UXDA 2B5AA 2GRMA 2OR1L 3RZZA 2PUFA 2XIUA 1RPEL 1ZVVA 4YG4A 4J1XA 2AW6A 1DW9A 3LISA 1ZZ9A 4I6RA 3HZIB 4JCYA 1ZAYA 4F8DA 1X57A 1WETA 1JFTA 3KZ3A 3U3WA 2PUEA 2IV1A 3BD1A 3LFPA 4GQMA 4I6UA 4PU8A 3R1FA 2ICPA 3G5GA 4FBIA 3JXDL 3EUSA 1L1MA 4PU7A 1GT0C 4X4IA 1ADRA 3OP9A 3SCGA 2EWTA 2LYQA 1E3OC 2H8RA 3F6WA 1BDIA 3FYAA 1QQAA 2PIJA 1DWKA 3QWGA 4J1WA 4MCTA 4JQDA 4IA8A 3IVPA 3B7HA 1PNRA 3H5TA 3ZKCA 2O49A 1BDHA 2PUBA 1IC8A 4YARA 1LMB3 2IUOA 3SCHA 1OSLA 2AXVA 3L1PA 2BNNA 2R63A 2BJCA 2IVBA 2KZ8A 4X4FA 3OQMA 1HF0A 1QP4A 3PXPA 3MLFA 2PUGA 2CSFA 2EF8A 3FYMA 3G7DA 2GZUA 1QP0A 2MEZA 2XI8A 5A7LA 4GHJA 4X4HA 1JFSA 2MQKA 2FJRA 2IU7A 3QYXA 2XSDC 1LCCA 3CROL 1PRVA 2XCJA 3VK0A 2LYPA 2AUWA 2KEJA 4Z5DA 1QQBA 4O8BA 4Z58A 3CECA 2WIUB 4Z5HA 1XWRA 2LYRA 2LYJA 1LCDA 2HSGA 1WH6A 3O9XA 1UTXA 3TRBA 2PUCA 2IVGA 1YSEA 4YG7B 1JH9A 4Z59A 1CJGA 1CQTA 1ZZ6A 2JCGA 1VPWA 3ZHIA 1UXCA 2BNOA 1ZUGA 2GRLA 2IVQA 3QF3A 3BS3A 1NEQA 4Y42A 4I6TA 1NERA 2KEIA 1R69A 2CROA 1Y7YA 4OB4A 2O4AA 3QQ6A 4X4CA 1Y9QA 4PU4C 1JWLA 4I8TA 2AXZA 1S7EA 2LYKA 2WUSR 3OQOA 2ICTA 3F52A 2BNMA 4X4GA 1LQCA 3GN5B 4IVZA 4IWRA 4NDWA 3KJXA 4JCXA 4YBAA 3KXAA 3ZHMA 2A6CA 2L49A 2O38A 2XJ3A 4PU3C 3OQNA 2EBYA 2OFYA 3SCFA 3JXBC 2PUDA 3F51A 1X2LA 4X4EA 3CLCA 1B0NA 4X4DA 1OCTC 3GN5A 2D5VA 3JXCL 2AWIA 1PRAA 2HINA 2LYSA 3D1NI 4YG1A 1QP7A 1EFAA 4Z5CA 1QPZA 2R1JL 1ZZCA 1WH8A 3DNVB 1LLIA 1O4XA 1R63A 1ZZBA 3OMTA 1RIOA 1SQ8A 3FMYA 4MCXA 5K98B 2L8NA 2PPXA 1ZS4A 2PUAA 2AXUA 1PRUA
chains in the Genus database with same CATH superfamily
1RZSA 1PERL 4OBMA 4ER7A 4FN3A 1UXDA 2GRMA 2OR1L 2PUFA 1ZVVA 4I6RA 4JCYA 1WETA 2PUEA 3U3WA 2IV1A 3BD1A 4FBIA 3R1FA 4ER6A 2H8RA 3QOWA 3F6WA 2PIJA 1DWKA 4MCTA 4JQDA 3GZDC 2PUBA 2AXVA 3NXHA 2LLWA 2IVBA 2BJCA 3OQMA 3MLFA 2CSFA 3FYMA 4GHJA 2FJRA 2XSDC 3CROL 1PRVA 3ZPXA 2KEJA 3CECA 3A9ZA 4Z5HA 1WH6A 1UTXA 4Z59A 3QOXA 2VEOA 1ZUGA 2IVQA 2HCNA 4Y42A 5DRTA 1NERA 2KEIA 2O4AA 3QQ6A 1Y9QA 1S7EA 4X4GA 3A9XA 3M9LA 4EZIA 4YBAA 3LQXA 4PU3C 2EBYA 2OFYA 2PUDA 4X4EA 1X2LA 3CLCA 1B0NA 2LNMA 5DT2A 3GN5A 1OCTC 1PRAA 3D1NI 4YG1A 1QP7A 5JUWA 1WH8A 1LLIA 1ZZBA 3FMYA 4EQZA 2PUAA 4DE9A 4Q2JA 3OWQA 2JVLA 2KPJA 4X4BA 3BDNA 3UFDA 5DTMA 1ZZ7A 1RZRD 1ZZ8A 2LCVA 2B5AA 2PXVA 4J1XA 2PXBA 3HZIB 3KZ3A 4PU8A 3G0TA 3QWGA 4J1WA 2PXDA 2PXKA 1PNRA 4YARA 3SCHA 3L1PA 2V3CC 2R63A 4X4FA 1QP4A 2MXDA 4EKGA 2PUGA 2LLVA 2J7UA 1QP0A 3R09A 4X4HA 1JFSA 2MQKA 1LCCA 2AUWA 4Z5DA 4Z58A 2WIUB 4DE8A 3O9XA 3TRBA 2J7WA 3ZHIA 1UXCA 2GRLA 3QF3A 3BS3A 1NEQA 1R69A 1NW3A 2FFHA 2WUSR 3F52A 5DTRA 4IVZA 4EKIA 3KJXA 1U2ZA 3OQNA 2L49A 2XJ3A 2XXAA 3JXBC 3F51A 4X4DA 2PXFA 4Z5CA 3MEJA 1QPZA 1O4XA 5K98B 4MCXA 3GZCA 2PPXA 2AXZA 3TFLA 1POUA 2PE5A 2KEKA 1RZRA 5DTQA 1WIZA 2LYLA 1AU7A 4YG4A 2AW6A 3PE5A 1ZAYA 1JFTA 2PXQA 3LFPA 4GQMA 4I6UA 3JXDL 3G5GA 1L1MA 3EUSA 4PU7A 4X4IA 2HFZA 3OP9A 2LYQA 1E3OC 3GUUA 4IA8A 5GAHi 3VWSA 2O49A 1BDHA 2YBDA 3TELA 1QB2A 2KZ8A 3PXPA 2EF8A 2MEZA 2XI8A 5A7LA 2XCJA 3VK0A 4WVLA 1XWRA 2LYRA 2LYJA 1LCDA 2PXPA 4YG7B 1CJGA 1ZZ6A 1VPWA 1Y7YA 4OB4A 1JWLA 4I8TA 4EK9A 3QFIA 3OQOA 1LQCA 4JCXA 3ZHMA 2M4HA 2A6CA 2O38A 2XXPA 3GZDA 2D5VA 2ODRD 1EFAA 2R1JL 1ZZCA 3DNVB 1RIOA 2L8NA 1ZS4A 2PXUA 3KL4A 3GBFA 1QZXA 2PXEA 1ZPQA 3S8QA 3RZZA 2XIUA 1RPEL 1DW9A 3LISA 1ZZ9A 5GAGi 4F8DA 1X57A 2ICPA 1ADRA 1GT0C 2XXQA 3TEPA 3SCGA 2EWTA 2JQEA 1BDIA 3FYAA 4ER0A 1QQAA 3IVPA 3B7HA 3H5TA 3ZKCA 1IC8A 1LMB3 2IUOA 3UWPA 1OSLA 5DRYA 2BNNA 4ER3A 1HF0A 3G7DA 2GZUA 2HCSA 3SX0A 2IU7A 3QYXA 3SR4A 3NROA 2LYPA 1QQBA 3NZLA 4O8BA 4ER5A 2HSGA 2L1PA 1DULA 5DSXA 2PUCA 2PXTA 2IVGA 1YSEA 1JH9A 1CQTA 2JCGA 2BNOA 3NDBB 4I6TA 3A9YA 2PXLA 2CROA 4X4CA 4PU4C 2LYKA 2ICTA 3ME5A 3OKZA 4HRAA 2BNMA 3GN5B 4IWRA 4NDWA 1MFQC 3KXAA 3SCFA 1HQ1A 3JXCL 2AWIA 2HINA 2LYSA 3DM5A 1R63A 3OMTA 1SQ8A 2AXUA 1PRUA
chains in the Genus database with same CATH topology
2JVLA 1RZSA 2KPJA 1PERL 3GBFA 4X4BA 3BDNA 1POUA 2PE5A 4FN3A 3UFDA 2KEKA 1ZPQA 1RZRA 1ZZ7A 1WIZA 1ZZ8A 2LYLA 3S8QA 1RZRD 2LCVA 1AU7A 1UXDA 2B5AA 2GRMA 2OR1L 3RZZA 2PUFA 2XIUA 1RPEL 1ZVVA 4YG4A 4J1XA 2AW6A 1DW9A 3LISA 1ZZ9A 4I6RA 3HZIB 4JCYA 1ZAYA 4F8DA 1X57A 1WETA 1JFTA 3KZ3A 3U3WA 2PUEA 2IV1A 3BD1A 3LFPA 4GQMA 4I6UA 4PU8A 3R1FA 2ICPA 3G5GA 4FBIA 3JXDL 3EUSA 1L1MA 4PU7A 1GT0C 4X4IA 1ADRA 3OP9A 3SCGA 2EWTA 2LYQA 1E3OC 2H8RA 3F6WA 1BDIA 3FYAA 1QQAA 2PIJA 1DWKA 3QWGA 4J1WA 4MCTA 4JQDA 4IA8A 3IVPA 3B7HA 1PNRA 3H5TA 3ZKCA 2O49A 1BDHA 2PUBA 1IC8A 4YARA 1LMB3 2IUOA 3SCHA 1OSLA 2AXVA 3L1PA 2BNNA 2R63A 2BJCA 2IVBA 2KZ8A 4X4FA 3OQMA 1HF0A 1QP4A 3PXPA 3MLFA 2PUGA 2CSFA 2EF8A 3FYMA 3G7DA 2GZUA 1QP0A 2MEZA 2XI8A 5A7LA 4GHJA 4X4HA 1JFSA 2MQKA 2FJRA 2IU7A 3QYXA 2XSDC 1LCCA 3CROL 1PRVA 2XCJA 3VK0A 2LYPA 2AUWA 2KEJA 4Z5DA 1QQBA 4O8BA 4Z58A 3CECA 2WIUB 4Z5HA 1XWRA 2LYRA 2LYJA 1LCDA 2HSGA 1WH6A 3O9XA 1UTXA 3TRBA 2PUCA 2IVGA 1YSEA 4YG7B 1JH9A 4Z59A 1CJGA 1CQTA 1ZZ6A 2JCGA 1VPWA 3ZHIA 1UXCA 2BNOA 1ZUGA 2GRLA 2IVQA 3QF3A 3BS3A 1NEQA 4Y42A 4I6TA 1NERA 2KEIA 1R69A 2CROA 1Y7YA 4OB4A 2O4AA 3QQ6A 4X4CA 1Y9QA 4PU4C 1JWLA 4I8TA 2AXZA 1S7EA 2LYKA 2WUSR 3OQOA 2ICTA 3F52A 2BNMA 4X4GA 1LQCA 3GN5B 4IVZA 4IWRA 4NDWA 3KJXA 4JCXA 4YBAA 3KXAA 3ZHMA 2A6CA 2L49A 2O38A 2XJ3A 4PU3C 3OQNA 2EBYA 2OFYA 3SCFA 3JXBC 2PUDA 3F51A 1X2LA 4X4EA 3CLCA 1B0NA 4X4DA 1OCTC 3GN5A 2D5VA 3JXCL 2AWIA 1PRAA 2HINA 2LYSA 3D1NI 4YG1A 1QP7A 1EFAA 4Z5CA 1QPZA 2R1JL 1ZZCA 1WH8A 3DNVB 1LLIA 1O4XA 1R63A 1ZZBA 3OMTA 1RIOA 1SQ8A 3FMYA 4MCXA 5K98B 2L8NA 2PPXA 1ZS4A 2PUAA 2AXUA 1PRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JVL A;  1RZS A;  2KPJ A;  1PER L;  3GBF A;  4X4B A;  3BDN A;  1POU A;  2PE5 A;  4FN3 A;  3UFD A;  2KEK A;  1ZPQ A;  1RZR A;  1ZZ7 A;  1WIZ A;  1ZZ8 A;  2LYL A;  3S8Q A;  1RZR D;  2LCV A;  1AU7 A;  1UXD A;  2B5A A;  2GRM A;  2OR1 L;  3RZZ A;  2PUF A;  2XIU A;  1RPE L;  1ZVV A;  4YG4 A;  4J1X A;  2AW6 A;  1DW9 A;  3LIS A;  1ZZ9 A;  4I6R A;  3HZI B;  4JCY A;  1ZAY A;  4F8D A;  1X57 A;  1WET A;  1JFT A;  3KZ3 A;  3U3W A;  2PUE A;  2IV1 A;  3BD1 A;  3LFP A;  4GQM A;  4I6U A;  4PU8 A;  3R1F A;  2ICP A;  3G5G A;  4FBI A;  3JXD L;  3EUS A;  1L1M A;  4PU7 A;  1GT0 C;  4X4I A;  1ADR A;  3OP9 A;  3SCG A;  2EWT A;  2LYQ A;  1E3O C;  2H8R A;  3F6W A;  1BDI A;  3FYA A;  1QQA A;  2PIJ A;  1DWK A;  3QWG A;  4J1W A;  4MCT A;  4JQD A;  4IA8 A;  3IVP A;  3B7H A;  1PNR A;  3H5T A;  3ZKC A;  2O49 A;  1BDH A;  2PUB A;  1IC8 A;  4YAR A;  1LMB 3;  2IUO A;  3SCH A;  1OSL A;  2AXV A;  3L1P A;  2BNN A;  2R63 A;  2BJC A;  2IVB A;  2KZ8 A;  4X4F A;  3OQM A;  1HF0 A;  1QP4 A;  3PXP A;  3MLF A;  2PUG A;  2CSF A;  2EF8 A;  3FYM A;  3G7D A;  2GZU A;  1QP0 A;  2MEZ A;  2XI8 A;  5A7L A;  4GHJ A;  4X4H A;  1JFS A;  2MQK A;  2FJR A;  2IU7 A;  3QYX A;  2XSD C;  1LCC A;  3CRO L;  1PRV A;  2XCJ A;  3VK0 A;  2LYP A;  2AUW A;  2KEJ A;  4Z5D A;  1QQB A;  4O8B A;  4Z58 A;  3CEC A;  2WIU B;  4Z5H A;  1XWR A;  2LYR A;  2LYJ A;  1LCD A;  2HSG A;  1WH6 A;  3O9X A;  1UTX A;  3TRB A;  2PUC A;  2IVG A;  1YSE A;  4YG7 B;  1JH9 A;  4Z59 A;  1CJG A;  1CQT A;  1ZZ6 A;  2JCG A;  1VPW A;  3ZHI A;  1UXC A;  2BNO A;  1ZUG A;  2GRL A;  2IVQ A;  3QF3 A;  3BS3 A;  1NEQ A;  4Y42 A;  4I6T A;  1NER A;  2KEI A;  1R69 A;  2CRO A;  1Y7Y A;  4OB4 A;  2O4A A;  3QQ6 A;  4X4C A;  1Y9Q A;  4PU4 C;  1JWL A;  4I8T A;  2AXZ A;  1S7E A;  2LYK A;  2WUS R;  3OQO A;  2ICT A;  3F52 A;  2BNM A;  4X4G A;  1LQC A;  3GN5 B;  4IVZ A;  4IWR A;  4NDW A;  3KJX A;  4JCX A;  4YBA A;  3KXA A;  3ZHM A;  2A6C A;  2L49 A;  2O38 A;  2XJ3 A;  4PU3 C;  3OQN A;  2EBY A;  2OFY A;  3SCF A;  3JXB C;  2PUD A;  3F51 A;  1X2L A;  4X4E A;  3CLC A;  1B0N A;  4X4D A;  1OCT C;  3GN5 A;  2D5V A;  3JXC L;  2AWI A;  1PRA A;  2HIN A;  2LYS A;  3D1N I;  4YG1 A;  1QP7 A;  1EFA A;  4Z5C A;  1QPZ A;  2R1J L;  1ZZC A;  1WH8 A;  3DNV B;  1LLI A;  1O4X A;  1R63 A;  1ZZB A;  3OMT A;  1RIO A;  1SQ8 A;  3FMY A;  4MCX A;  5K98 B;  2L8N A;  2PPX A;  1ZS4 A;  2PUA A;  2AXU A;  1PRU A; 
#chains in the Genus database with same CATH topology
 1RZS A;  1PER L;  4OBM A;  4ER7 A;  4FN3 A;  1UXD A;  2GRM A;  2OR1 L;  2PUF A;  1ZVV A;  4I6R A;  4JCY A;  1WET A;  2PUE A;  3U3W A;  2IV1 A;  3BD1 A;  4FBI A;  3R1F A;  4ER6 A;  2H8R A;  3QOW A;  3F6W A;  2PIJ A;  1DWK A;  4MCT A;  4JQD A;  3GZD C;  2PUB A;  2AXV A;  3NXH A;  2LLW A;  2IVB A;  2BJC A;  3OQM A;  3MLF A;  2CSF A;  3FYM A;  4GHJ A;  2FJR A;  2XSD C;  3CRO L;  1PRV A;  3ZPX A;  2KEJ A;  3CEC A;  3A9Z A;  4Z5H A;  1WH6 A;  1UTX A;  4Z59 A;  3QOX A;  2VEO A;  1ZUG A;  2IVQ A;  2HCN A;  4Y42 A;  5DRT A;  1NER A;  2KEI A;  2O4A A;  3QQ6 A;  1Y9Q A;  1S7E A;  4X4G A;  3A9X A;  3M9L A;  4EZI A;  4YBA A;  3LQX A;  4PU3 C;  2EBY A;  2OFY A;  2PUD A;  4X4E A;  1X2L A;  3CLC A;  1B0N A;  2LNM A;  5DT2 A;  3GN5 A;  1OCT C;  1PRA A;  3D1N I;  4YG1 A;  1QP7 A;  5JUW A;  1WH8 A;  1LLI A;  1ZZB A;  3FMY A;  4EQZ A;  2PUA A;  4DE9 A;  4Q2J A;  3OWQ A;  2JVL A;  2KPJ A;  4X4B A;  3BDN A;  3UFD A;  5DTM A;  1ZZ7 A;  1RZR D;  1ZZ8 A;  2LCV A;  2B5A A;  2PXV A;  4J1X A;  2PXB A;  3HZI B;  3KZ3 A;  4PU8 A;  3G0T A;  3QWG A;  4J1W A;  2PXD A;  2PXK A;  1PNR A;  4YAR A;  3SCH A;  3L1P A;  2V3C C;  2R63 A;  4X4F A;  1QP4 A;  2MXD A;  4EKG A;  2PUG A;  2LLV A;  2J7U A;  1QP0 A;  3R09 A;  4X4H A;  1JFS A;  2MQK A;  1LCC A;  2AUW A;  4Z5D A;  4Z58 A;  2WIU B;  4DE8 A;  3O9X A;  3TRB A;  2J7W A;  3ZHI A;  1UXC A;  2GRL A;  3QF3 A;  3BS3 A;  1NEQ A;  1R69 A;  1NW3 A;  2FFH A;  2WUS R;  3F52 A;  5DTR A;  4IVZ A;  4EKI A;  3KJX A;  1U2Z A;  3OQN A;  2L49 A;  2XJ3 A;  2XXA A;  3JXB C;  3F51 A;  4X4D A;  2PXF A;  4Z5C A;  3MEJ A;  1QPZ A;  1O4X A;  5K98 B;  4MCX A;  3GZC A;  2PPX A;  2AXZ A;  3TFL A;  1POU A;  2PE5 A;  2KEK A;  1RZR A;  5DTQ A;  1WIZ A;  2LYL A;  1AU7 A;  4YG4 A;  2AW6 A;  3PE5 A;  1ZAY A;  1JFT A;  2PXQ A;  3LFP A;  4GQM A;  4I6U A;  3JXD L;  3G5G A;  1L1M A;  3EUS A;  4PU7 A;  4X4I A;  2HFZ A;  3OP9 A;  2LYQ A;  1E3O C;  3GUU A;  4IA8 A;  5GAH i;  3VWS A;  2O49 A;  1BDH A;  2YBD A;  3TEL A;  1QB2 A;  2KZ8 A;  3PXP A;  2EF8 A;  2MEZ A;  2XI8 A;  5A7L A;  2XCJ A;  3VK0 A;  4WVL A;  1XWR A;  2LYR A;  2LYJ A;  1LCD A;  2PXP A;  4YG7 B;  1CJG A;  1ZZ6 A;  1VPW A;  1Y7Y A;  4OB4 A;  1JWL A;  4I8T A;  4EK9 A;  3QFI A;  3OQO A;  1LQC A;  4JCX A;  3ZHM A;  2M4H A;  2A6C A;  2O38 A;  2XXP A;  3GZD A;  2D5V A;  2ODR D;  1EFA A;  2R1J L;  1ZZC A;  3DNV B;  1RIO A;  2L8N A;  1ZS4 A;  2PXU A;  3KL4 A;  3GBF A;  1QZX A;  2PXE A;  1ZPQ A;  3S8Q A;  3RZZ A;  2XIU A;  1RPE L;  1DW9 A;  3LIS A;  1ZZ9 A;  5GAG i;  4F8D A;  1X57 A;  2ICP A;  1ADR A;  1GT0 C;  2XXQ A;  3TEP A;  3SCG A;  2EWT A;  2JQE A;  1BDI A;  3FYA A;  4ER0 A;  1QQA A;  3IVP A;  3B7H A;  3H5T A;  3ZKC A;  1IC8 A;  1LMB 3;  2IUO A;  3UWP A;  1OSL A;  5DRY A;  2BNN A;  4ER3 A;  1HF0 A;  3G7D A;  2GZU A;  2HCS A;  3SX0 A;  2IU7 A;  3QYX A;  3SR4 A;  3NRO A;  2LYP A;  1QQB A;  3NZL A;  4O8B A;  4ER5 A;  2HSG A;  2L1P A;  1DUL A;  5DSX A;  2PUC A;  2PXT A;  2IVG A;  1YSE A;  1JH9 A;  1CQT A;  2JCG A;  2BNO A;  3NDB B;  4I6T A;  3A9Y A;  2PXL A;  2CRO A;  4X4C A;  4PU4 C;  2LYK A;  2ICT A;  3ME5 A;  3OKZ A;  4HRA A;  2BNM A;  3GN5 B;  4IWR A;  4NDW A;  1MFQ C;  3KXA A;  3SCF A;  1HQ1 A;  3JXC L;  2AWI A;  2HIN A;  2LYS A;  3DM5 A;  1R63 A;  3OMT A;  1SQ8 A;  2AXU A;  1PRU A; 
#chains in the Genus database with same CATH homology
 2JVL A;  1RZS A;  2KPJ A;  1PER L;  3GBF A;  4X4B A;  3BDN A;  1POU A;  2PE5 A;  4FN3 A;  3UFD A;  2KEK A;  1ZPQ A;  1RZR A;  1ZZ7 A;  1WIZ A;  1ZZ8 A;  2LYL A;  3S8Q A;  1RZR D;  2LCV A;  1AU7 A;  1UXD A;  2B5A A;  2GRM A;  2OR1 L;  3RZZ A;  2PUF A;  2XIU A;  1RPE L;  1ZVV A;  4YG4 A;  4J1X A;  2AW6 A;  1DW9 A;  3LIS A;  1ZZ9 A;  4I6R A;  3HZI B;  4JCY A;  1ZAY A;  4F8D A;  1X57 A;  1WET A;  1JFT A;  3KZ3 A;  3U3W A;  2PUE A;  2IV1 A;  3BD1 A;  3LFP A;  4GQM A;  4I6U A;  4PU8 A;  3R1F A;  2ICP A;  3G5G A;  4FBI A;  3JXD L;  3EUS A;  1L1M A;  4PU7 A;  1GT0 C;  4X4I A;  1ADR A;  3OP9 A;  3SCG A;  2EWT A;  2LYQ A;  1E3O C;  2H8R A;  3F6W A;  1BDI A;  3FYA A;  1QQA A;  2PIJ A;  1DWK A;  3QWG A;  4J1W A;  4MCT A;  4JQD A;  4IA8 A;  3IVP A;  3B7H A;  1PNR A;  3H5T A;  3ZKC A;  2O49 A;  1BDH A;  2PUB A;  1IC8 A;  4YAR A;  1LMB 3;  2IUO A;  3SCH A;  1OSL A;  2AXV A;  3L1P A;  2BNN A;  2R63 A;  2BJC A;  2IVB A;  2KZ8 A;  4X4F A;  3OQM A;  1HF0 A;  1QP4 A;  3PXP A;  3MLF A;  2PUG A;  2CSF A;  2EF8 A;  3FYM A;  3G7D A;  2GZU A;  1QP0 A;  2MEZ A;  2XI8 A;  5A7L A;  4GHJ A;  4X4H A;  1JFS A;  2MQK A;  2FJR A;  2IU7 A;  3QYX A;  2XSD C;  1LCC A;  3CRO L;  1PRV A;  2XCJ A;  3VK0 A;  2LYP A;  2AUW A;  2KEJ A;  4Z5D A;  1QQB A;  4O8B A;  4Z58 A;  3CEC A;  2WIU B;  4Z5H A;  1XWR A;  2LYR A;  2LYJ A;  1LCD A;  2HSG A;  1WH6 A;  3O9X A;  1UTX A;  3TRB A;  2PUC A;  2IVG A;  1YSE A;  4YG7 B;  1JH9 A;  4Z59 A;  1CJG A;  1CQT A;  1ZZ6 A;  2JCG A;  1VPW A;  3ZHI A;  1UXC A;  2BNO A;  1ZUG A;  2GRL A;  2IVQ A;  3QF3 A;  3BS3 A;  1NEQ A;  4Y42 A;  4I6T A;  1NER A;  2KEI A;  1R69 A;  2CRO A;  1Y7Y A;  4OB4 A;  2O4A A;  3QQ6 A;  4X4C A;  1Y9Q A;  4PU4 C;  1JWL A;  4I8T A;  2AXZ A;  1S7E A;  2LYK A;  2WUS R;  3OQO A;  2ICT A;  3F52 A;  2BNM A;  4X4G A;  1LQC A;  3GN5 B;  4IVZ A;  4IWR A;  4NDW A;  3KJX A;  4JCX A;  4YBA A;  3KXA A;  3ZHM A;  2A6C A;  2L49 A;  2O38 A;  2XJ3 A;  4PU3 C;  3OQN A;  2EBY A;  2OFY A;  3SCF A;  3JXB C;  2PUD A;  3F51 A;  1X2L A;  4X4E A;  3CLC A;  1B0N A;  4X4D A;  1OCT C;  3GN5 A;  2D5V A;  3JXC L;  2AWI A;  1PRA A;  2HIN A;  2LYS A;  3D1N I;  4YG1 A;  1QP7 A;  1EFA A;  4Z5C A;  1QPZ A;  2R1J L;  1ZZC A;  1WH8 A;  3DNV B;  1LLI A;  1O4X A;  1R63 A;  1ZZB A;  3OMT A;  1RIO A;  1SQ8 A;  3FMY A;  4MCX A;  5K98 B;  2L8N A;  2PPX A;  1ZS4 A;  2PUA A;  2AXU A;  1PRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...