3ON1A

The structure of a protein with unknown function from bacillus halodurans c
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
b'EAKWLSLLGLAARARQLLTGEEQVVKAVQNGQVTLVILSSDAGIHTKKKLLDKCGSYQIPVKVVGNRQMLGRAIGKHERVVIGVKDAGFSRKLAALIDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH2414 protein
molecule tags Structural genomics, unknown function
source organism Bacillus halodurans
publication title The structure of a protein with unknown function from Bacillus halodurans C
rcsb
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3on1A00
2OHWA 2QEXF 2QA4F 3JCMM 2KTUA 3I55F 3IR9A 1YITF 1VQ7F 1PXWA 1VQ6F 3NVIB 1KQSF 3OBYA 1QVGF 3VI6A 1E7KA 3NVKE 3J7AR 3HJWC 2FC3A 1NJIH 3E20B 2JNBA 3CCQF 5GANK 3OW2F 1KD1H 1VQ5F 3NK6A 1YJNF 4BY9D 4NUTA 5GIPC 3NK7A 1W2BF 3CPWF 3LWPC 3JAMM 3G71F 1YJWF 2OZBA 1VQ8F 3SIUA 1IPAA 3G4SF 1Q82H 1RA4A 2CZWA 3CCUF 1VQPF 3ON1A 3CCEF 5GINC 3CC7F 1VQNF 1VQKF 1W41A 1RLGA 3VMFB 3O85A 3J80M 1X7PA 5FLXM 1W42A 1X7OA 1DT9A 2LBXA 1Q7YH 3J81M 1T0KB 1QVFF 1X52A 1S72F 3V7QA 3CCRF 1CK2A 1VQMF 2AIFA 1Q81H 3FFMA 1M90H 1K8AH 2KTVA 2OTJF 3CMEF 3RA6A 5GAPK 5FJ4C 2WALA 1XBIA 3AGKA 4X3LA 1H7MA 4LCKA 1VQ4F 3G6EF 5IT9M 3N4ZA 1ZWZA 4X3MA 5DCVA 2ALEA 3LWVC 5EO3A 3NMUC 3RA5A 1YJ9F 1GO1A 3LFOA 3PAFA 3PLAC 3SIVA 2LBWA 3CPQA 2HVYD 3N4YA 2OTLF 3CC4F 1YI2F 1N8RH 5GIOC 2VGNA 5A2QM 3E1YA 1YHQF 1GZ0A 1M1KH 3LWOC 1SDSA 1JJ2F 3OBWA 4TZZA 3GYQA 1Q86H 3CCJF 3LWRC 2KG4A 1K73H 2QI2A 3CCLF 1YIJF 3CG6A 1NMUB 3CD6F 2BO1A 5G4VC 1VQ9F 1K9MH 3CCVF 5EWRA 2VGMA 3CMAF 1KC8H 1VQLF 3V7EA 3CC2F 1W3EX 3CCMF 3HAXD 3CXCF 1VQOF 3WXMB 3LWQC 5G4UC 1W40A 3MCAB 3CCSF 4C4WC 2I6DA 4BW0B 3I56F 1CN7A 1GO0A
chains in the Genus database with same CATH superfamily
4XCQA 3GHZA 4O2BA 4BT7A 3S0HA 3MBMA 4BVTA 3JATA 1TUBB 1UI9A 5JCOC 4B62A 2CWJA 2NMUA 3JVHA 3OONA 5GANK 2VAWA 4BT6A 4DRXA 2Z1EA 3MDOA 5JCOA 3HKBA 3F0FA 1W5AA 1FSZA 3IMPA 1YGYA 4IIJA 1JFFB 3JAKB 3LWPC 3P0ZA 1FNKA 2I6RA 4YJ3A 3G71F 1VQ8F 5KMGB 2OZBA 3SIUA 1Z5VA 3HKEB 3GTZA 3E22B 3ON1A 4ZK7A 5GINC 3CC7F 4BVSA 3VYTC 3S02A 2H8CA 4LNUB 2GVIA 4NQ3A 2P6YA 2R751 5IJ0B 3V3TA 5FLXM 4E6EA 5CB4B 1KNJA 1Q7YH 1Z5WA 4ZOLA 4ZHVA 3D54A 4O4IA 3VTIC 3CCRF 5LP6C 1Q81H 5EB0A 3FFMA 2VAPA 4O4HB 3WPXA 3HWUA 3RYCB 4EB6A 2PHNA 4I4TA 5CA1B 3C9TA 5C8YA 1VQ4F 2GLZA 3KJJA 2VXYA 3RA5A 5HY1A 3JAWB 3VO8A 1FFXB 3CPQA 5GONB 2HVYD 4O2AB 3N4YA 3CC4F 3UT5B 2BTOA 3E1YA 4ZHQA 4I50A 1TVKA 3T80A 3K12A 1VHAA 2CVLA 1R1MA 5JQGB 1Q86H 3LWRC 1K73H 1QU9A 3C8LA 4X1KA 1W581 3U0OA 5G4VC 3WJPA 1K9MH 4O4JB 5EZYA 5EWRA 4O4LA 5ITZB 2CSLA 5EAZA 1VQOF 3WXMB 2DYYA 4C82A 4C4WC 1TUBA 1OFUA 5LP6A 3I56F 1GO0A 2CW4A 2OHWA 1H48A 2HX0A 3N2GA 4FFBA 2RHHA 3JCMM 4IHJB 2R6R1 1QVGF 2AIZP 3HKDB 3VI6A 4X20A 4B45A 3J7AR 4HNAB 3HKCB 5HP7A 3HJWC 3E20B 3CCQF 1U43A 5HY4A 1W59A 1JFFA 5IYZB 2DT4A 3JAKA 3LYBA 1U40A 3JASA 1IV1A 2HP0B 3IKFA 3NK7A 4ZHWA 3KHNA 5KMGA 1JD1A 5AVMA 4B46A 3HTNA 1U3PA 4G4XA 2LCAA 2RB9A 4BVQA 1IPAA 1RA4A 3IKEA 2EWCA 1H47A 1COMA 3FD5A 3VMFB 3O85A 4C8EA 5BMVA 3ZO8A 3N2KA 3M84A 4U39A 3ESJA 1X7PA 4WBNB 4TUYA 5B8FA 3RYCA 4TV8B 4X1YB 1YQNA 5KX5B 2V9YA 5CA0B 3FPIA 5IJ9A 1CK2A 2AIFA 1JY8A 5JVDA 5HP8A 4ZI7B 5C8YB 4NWOB 2KTVA 4C81A 2CHTA 3RA6A 1W57A 5EIBC 3CMEF 1UFYA 3KIZA 2GZLA 3FD6A 3AGKA 2QTPA 3ZOPA 2MQEA 3JALB 5GONA 4F6RB 1ZWZA 2ALEA 5EIBD 5LOVA 3B6NA 3Q8HA 2FGYA 5LA6B 1YJ9F 4EI8A 4I50B 4DXDA 4BT4A 4C8IA 2ZAUA 2VGNA 1SA0B 2ZOVA 3HKBB 2OTMA 1OAPA 3MCQA 1FNJA 4YJ2A 2HS0A 4O4JA 1XHOA 2QI2A 3CD6F 2RHJA 3K0TA 3VCZA 3EORA 3JARB 2HS3A 4LNUA 3HAXD 3VIUA 3N2GB 3C9RA 4TV9A 1RLUA 1PF5A 1NQ3A 3RYIA 2Q1YA 3ZP4A 2HP3A 2RHLA 3P10A 1YITF 1VQ6F 3VOAA 1VQ7F 1PXWA 3P4EA 3NVIB 5J2TB 1KQSF 4O4HA 1QAHA 3NVKE 5FNVA 1IV4A 5IYZA 2K1SA 3VOBA 2FC3A 4M8IA 1KD1H 2JNBA 5CA1A 2HP0A 4X1IA 1GX1A 3MQWA 5LXTA 3NK6A 5MN4A 2UYNB 1YJNF 4BY9D 4NUTA 3C9UA 1FFXA 2UYPA 5EYPA 1RQ2A 3DDNA 3TD3A 1SZQA 3CB2A 5J2UB 3S03A 5BMVB 3UT5A 3KE1A 3N2KB 1W5EA 4C8GA 3G4SF 1Q82H 1U3LA 2CZWA 3CCUF 3LMEA 3CCEF 1VQNF 1DBFA 1W41A 2B33A 1RLGA 1ODEA 2HRYA 3VYUC 2BTQB 3FBAA 4TV8A 4X1YA 3RYFB 5KX5A 4BT5A 5IJ9B 3F6MA 1W42A 1DT9A 3WGMA 4ZI7A 4O4LB 1XRGA 4R40B 2RHOA 1W5BA 4O2BB 1S72F 3F0GA 2VAMA 3IEWA 4PWTA 5MN6A 1K8AH 3S06A 2Z1FA 3JALA 2OTJF 5GAPK 4FFBB 2HRUA 3QUWA 5LOVB 2WALA 4X3LA 2L26A 4IHJA 4LCKA 3TD5A 3HKDA 5IT9M 3G6EF 3N4ZA 4DRXB 2N48A 4X3MA 5DCVA 4HNAA 5EO3A 3NMUC 1SA0A 1X25A 1GO1A 3PLAC 1T0AA 3WJQA 3SIVA 2LBWA 5EB1B 4YJ2B 4IIJB 4ERHA 2AMTA 3QTYA 1YI2F 5A2QM 2YYEA 5HXZA 2UYKA 1GZ0A 1QD9A 3IEQA 3TD4A 1YHQF 2BTUA 3HKEA 3ELCA 3ZP7A 3LWOC 1JJ2F 4I55B 2Q1XA 5JH7B 2HQSC 2KG4A 3WPWA 5MN5A 1IV3A 3CG6A 4U3JA 2Z01A 3L7QA 2VGMA 1VQLF 1KC8H 3V7EA 3DC2A 4O4IB 3CC2F 3CCMF 1RQ7A 3RYHB 3RE3A 3F0EA 3CYPB 3MCAB 4WBNA 2I6DA 3VYSC 3WJRA 3I7TA 4BW0B 4BVRA 2CHSA 2H6LA 5LYJB 1ONIA 2QEXF 5HXUA 4EB6B 3S0WA 2ZVZA 4I4TB 2QA4F 4RQOA 2KTUA 5JVDB 3IR9A 2Z1TA 3I55F 3WGKA 4X1IB 3OBYA 3S0YA 3CYQA 1E7KA 2UYNA 1NJIH 4B5CA 4G4YA 3OW2F 3JATB 3JAWA 1VQ5F 4F6RA 4EI7A 5J2UA 4KWEA 5GIPC 5LA6A 3LDTA 2PMPA 1W2BF 1TVKB 4G4WA 1W55A 3CPWF 2LBTA 3JAMM 1YJWF 2W8BC 3RYFA 2IQQA 3KJKA 1JN1A 3V4DA 1VQPF 3I3FA 1VQKF 2Z1UA 3D01A 3C9SA 5EZYB 5HWEA 4YJ3B 2G9IA 3J80M 2UYJA 5ITZA 2KGWA 3E22A 2F9ZC 3QHDA 3JARA 1X7OA 2LBXA 3J81M 4G4ZA 5LP6B 1T0KB 2ZF8A 1QVFF 1VQVA 1Q8RA 1X52A 3V7QA 3WGLA 4TV9B 2IAFA 5IJ0A 5HY0A 1VQMF 1M90H 5CB4A 3R0PA 3M4SA 4ZOLB 3RYIB 1W5FA 4X20B 4BT3A 5FJ4C 3HKCA 1XBIA 3K14A 2ZVYA 1H7MA 5J2TA 5FNVB 1VH8A 2YXZA 3LWVC 4EI9A 4G88A 3ERNA 3BYQA 2ZODA 3JASB 1XV2A 2HS4A 3LFOA 3F0DA 3PAFA 5LXTB 3K2XA 5HY2A 4I55A 2OTLF 5JH7A 2H8EA 1N8RH 2UZHA 5GIOC 1IV2A 5EYPB 1M1KH 1SDSA 4U3JB 3OBWA 4O2AA 4TZZA 3GYQA 1KNKA 3CCJF 4RHAA 4ZHQB 3CCLF 1YIJF 3RYHA 4BT2A 1NMUB 4G4VA 2BO1A 1VQ9F 3CCVF 1CLIA 3D00A 5JQGA 2IG8A 4TUYB 5LYJA 3CMAF 1W3EX 4X1KB 3M1XA 3CXCF 1VK3A 3WGNA 3WGJA 5CA0A 1W40A 3LWQC 3CCSF 5G4UC 4ZHYB 1J7HA 1CN7A
chains in the Genus database with same CATH topology
4XCQA 2OHWA 2QEXF 5HXUA 2QA4F 3JCMM 2KTUA 4BVTA 3IR9A 3I55F 1YITF 1PXWA 1VQ7F 1VQ6F 3NVIB 1KQSF 3OBYA 1QVGF 3VI6A 1E7KA 3NVKE 3J7AR 3HJWC 2FC3A 1NJIH 3E20B 2JNBA 3CCQF 5GANK 3OW2F 1KD1H 1VQ5F 3NK6A 5HY4A 4EI7A 1YJNF 4BY9D 4NUTA 5GIPC 3NK7A 1W2BF 3CPWF 3LWPC 4BVQA 3JAMM 3G71F 1YJWF 2OZBA 1VQ8F 3SIUA 1IPAA 3G4SF 1Q82H 1RA4A 2CZWA 3CCUF 1VQPF 3ON1A 3CCEF 5GINC 3CC7F 4BVSA 1VQNF 1VQKF 1W41A 1RLGA 3VMFB 3O85A 5HWEA 4NQ3A 3J80M 2F9ZC 1X7PA 5FLXM 1W42A 3V3TA 1X7OA 1DT9A 2LBXA 1Q7YH 3J81M 1T0KB 1QVFF 1X52A 1S72F 3V7QA 3CCRF 1CK2A 5HY0A 1VQMF 2AIFA 1Q81H 3FFMA 1M90H 1K8AH 2KTVA 2OTJF 3CMEF 3RA6A 5GAPK 5FJ4C 2WALA 1XBIA 3AGKA 4X3LA 1H7MA 4LCKA 1VQ4F 2GLZA 3G6EF 5IT9M 3N4ZA 1ZWZA 4X3MA 5DCVA 2ALEA 4EI9A 3LWVC 5EO3A 3NMUC 3RA5A 5HY1A 2FGYA 1YJ9F 4EI8A 1GO1A 3LFOA 3PAFA 3PLAC 3SIVA 2LBWA 3CPQA 5HY2A 2HVYD 3N4YA 2OTLF 3CC4F 1YI2F 1N8RH 2VGNA 5GIOC 5A2QM 5HXZA 3E1YA 1YHQF 1GZ0A 1M1KH 3LWOC 1SDSA 1JJ2F 3OBWA 4TZZA 3GYQA 1Q86H 3CCJF 3LWRC 2KG4A 1K73H 2QI2A 3CCLF 1YIJF 3CG6A 1NMUB 3CD6F 2BO1A 5G4VC 1VQ9F 1K9MH 3CCVF 3D00A 5EWRA 2VGMA 3CMAF 1KC8H 1VQLF 3V7EA 3CC2F 1W3EX 3CCMF 3HAXD 3CXCF 1VQOF 3WXMB 3LWQC 5G4UC 1W40A 3MCAB 3CCSF 4C4WC 2I6DA 4BW0B 4BVRA 3I56F 1CN7A 1GO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OHW A;  2QEX F;  2QA4 F;  3JCM M;  2KTU A;  3I55 F;  3IR9 A;  1YIT F;  1VQ7 F;  1PXW A;  1VQ6 F;  3NVI B;  1KQS F;  3OBY A;  1QVG F;  3VI6 A;  1E7K A;  3NVK E;  3J7A R;  3HJW C;  2FC3 A;  1NJI H;  3E20 B;  2JNB A;  3CCQ F;  5GAN K;  3OW2 F;  1KD1 H;  1VQ5 F;  3NK6 A;  1YJN F;  4BY9 D;  4NUT A;  5GIP C;  3NK7 A;  1W2B F;  3CPW F;  3LWP C;  3JAM M;  3G71 F;  1YJW F;  2OZB A;  1VQ8 F;  3SIU A;  1IPA A;  3G4S F;  1Q82 H;  1RA4 A;  2CZW A;  3CCU F;  1VQP F;  3ON1 A;  3CCE F;  5GIN C;  3CC7 F;  1VQN F;  1VQK F;  1W41 A;  1RLG A;  3VMF B;  3O85 A;  3J80 M;  1X7P A;  5FLX M;  1W42 A;  1X7O A;  1DT9 A;  2LBX A;  1Q7Y H;  3J81 M;  1T0K B;  1QVF F;  1X52 A;  1S72 F;  3V7Q A;  3CCR F;  1CK2 A;  1VQM F;  2AIF A;  1Q81 H;  3FFM A;  1M90 H;  1K8A H;  2KTV A;  2OTJ F;  3CME F;  3RA6 A;  5GAP K;  5FJ4 C;  2WAL A;  1XBI A;  3AGK A;  4X3L A;  1H7M A;  4LCK A;  1VQ4 F;  3G6E F;  5IT9 M;  3N4Z A;  1ZWZ A;  4X3M A;  5DCV A;  2ALE A;  3LWV C;  5EO3 A;  3NMU C;  3RA5 A;  1YJ9 F;  1GO1 A;  3LFO A;  3PAF A;  3PLA C;  3SIV A;  2LBW A;  3CPQ A;  2HVY D;  3N4Y A;  2OTL F;  3CC4 F;  1YI2 F;  1N8R H;  5GIO C;  2VGN A;  5A2Q M;  3E1Y A;  1YHQ F;  1GZ0 A;  1M1K H;  3LWO C;  1SDS A;  1JJ2 F;  3OBW A;  4TZZ A;  3GYQ A;  1Q86 H;  3CCJ F;  3LWR C;  2KG4 A;  1K73 H;  2QI2 A;  3CCL F;  1YIJ F;  3CG6 A;  1NMU B;  3CD6 F;  2BO1 A;  5G4V C;  1VQ9 F;  1K9M H;  3CCV F;  5EWR A;  2VGM A;  3CMA F;  1KC8 H;  1VQL F;  3V7E A;  3CC2 F;  1W3E X;  3CCM F;  3HAX D;  3CXC F;  1VQO F;  3WXM B;  3LWQ C;  5G4U C;  1W40 A;  3MCA B;  3CCS F;  4C4W C;  2I6D A;  4BW0 B;  3I56 F;  1CN7 A;  1GO0 A; 
#chains in the Genus database with same CATH topology
 4XCQ A;  3GHZ A;  4O2B A;  4BT7 A;  3S0H A;  3MBM A;  4BVT A;  3JAT A;  1TUB B;  1UI9 A;  5JCO C;  4B62 A;  2CWJ A;  2NMU A;  3JVH A;  3OON A;  5GAN K;  2VAW A;  4BT6 A;  4DRX A;  2Z1E A;  3MDO A;  5JCO A;  3HKB A;  3F0F A;  1W5A A;  1FSZ A;  3IMP A;  1YGY A;  4IIJ A;  1JFF B;  3JAK B;  3LWP C;  3P0Z A;  1FNK A;  2I6R A;  4YJ3 A;  3G71 F;  1VQ8 F;  5KMG B;  2OZB A;  3SIU A;  1Z5V A;  3HKE B;  3GTZ A;  3E22 B;  3ON1 A;  4ZK7 A;  5GIN C;  3CC7 F;  4BVS A;  3VYT C;  3S02 A;  2H8C A;  4LNU B;  2GVI A;  4NQ3 A;  2P6Y A;  2R75 1;  5IJ0 B;  3V3T A;  5FLX M;  4E6E A;  5CB4 B;  1KNJ A;  1Q7Y H;  1Z5W A;  4ZOL A;  4ZHV A;  3D54 A;  4O4I A;  3VTI C;  3CCR F;  5LP6 C;  1Q81 H;  5EB0 A;  3FFM A;  2VAP A;  4O4H B;  3WPX A;  3HWU A;  3RYC B;  4EB6 A;  2PHN A;  4I4T A;  5CA1 B;  3C9T A;  5C8Y A;  1VQ4 F;  2GLZ A;  3KJJ A;  2VXY A;  3RA5 A;  5HY1 A;  3JAW B;  3VO8 A;  1FFX B;  3CPQ A;  5GON B;  2HVY D;  4O2A B;  3N4Y A;  3CC4 F;  3UT5 B;  2BTO A;  3E1Y A;  4ZHQ A;  4I50 A;  1TVK A;  3T80 A;  3K12 A;  1VHA A;  2CVL A;  1R1M A;  5JQG B;  1Q86 H;  3LWR C;  1K73 H;  1QU9 A;  3C8L A;  4X1K A;  1W58 1;  3U0O A;  5G4V C;  3WJP A;  1K9M H;  4O4J B;  5EZY A;  5EWR A;  4O4L A;  5ITZ B;  2CSL A;  5EAZ A;  1VQO F;  3WXM B;  2DYY A;  4C82 A;  4C4W C;  1TUB A;  1OFU A;  5LP6 A;  3I56 F;  1GO0 A;  2CW4 A;  2OHW A;  1H48 A;  2HX0 A;  3N2G A;  4FFB A;  2RHH A;  3JCM M;  4IHJ B;  2R6R 1;  1QVG F;  2AIZ P;  3HKD B;  3VI6 A;  4X20 A;  4B45 A;  3J7A R;  4HNA B;  3HKC B;  5HP7 A;  3HJW C;  3E20 B;  3CCQ F;  1U43 A;  5HY4 A;  1W59 A;  1JFF A;  5IYZ B;  2DT4 A;  3JAK A;  3LYB A;  1U40 A;  3JAS A;  1IV1 A;  2HP0 B;  3IKF A;  3NK7 A;  4ZHW A;  3KHN A;  5KMG A;  1JD1 A;  5AVM A;  4B46 A;  3HTN A;  1U3P A;  4G4X A;  2LCA A;  2RB9 A;  4BVQ A;  1IPA A;  1RA4 A;  3IKE A;  2EWC A;  1H47 A;  1COM A;  3FD5 A;  3VMF B;  3O85 A;  4C8E A;  5BMV A;  3ZO8 A;  3N2K A;  3M84 A;  4U39 A;  3ESJ A;  1X7P A;  4WBN B;  4TUY A;  5B8F A;  3RYC A;  4TV8 B;  4X1Y B;  1YQN A;  5KX5 B;  2V9Y A;  5CA0 B;  3FPI A;  5IJ9 A;  1CK2 A;  2AIF A;  1JY8 A;  5JVD A;  5HP8 A;  4ZI7 B;  5C8Y B;  4NWO B;  2KTV A;  4C81 A;  2CHT A;  3RA6 A;  1W57 A;  5EIB C;  3CME F;  1UFY A;  3KIZ A;  2GZL A;  3FD6 A;  3AGK A;  2QTP A;  3ZOP A;  2MQE A;  3JAL B;  5GON A;  4F6R B;  1ZWZ A;  2ALE A;  5EIB D;  5LOV A;  3B6N A;  3Q8H A;  2FGY A;  5LA6 B;  1YJ9 F;  4EI8 A;  4I50 B;  4DXD A;  4BT4 A;  4C8I A;  2ZAU A;  2VGN A;  1SA0 B;  2ZOV A;  3HKB B;  2OTM A;  1OAP A;  3MCQ A;  1FNJ A;  4YJ2 A;  2HS0 A;  4O4J A;  1XHO A;  2QI2 A;  3CD6 F;  2RHJ A;  3K0T A;  3VCZ A;  3EOR A;  3JAR B;  2HS3 A;  4LNU A;  3HAX D;  3VIU A;  3N2G B;  3C9R A;  4TV9 A;  1RLU A;  1PF5 A;  1NQ3 A;  3RYI A;  2Q1Y A;  3ZP4 A;  2HP3 A;  2RHL A;  3P10 A;  1YIT F;  1VQ6 F;  3VOA A;  1VQ7 F;  1PXW A;  3P4E A;  3NVI B;  5J2T B;  1KQS F;  4O4H A;  1QAH A;  3NVK E;  5FNV A;  1IV4 A;  5IYZ A;  2K1S A;  3VOB A;  2FC3 A;  4M8I A;  1KD1 H;  2JNB A;  5CA1 A;  2HP0 A;  4X1I A;  1GX1 A;  3MQW A;  5LXT A;  3NK6 A;  5MN4 A;  2UYN B;  1YJN F;  4BY9 D;  4NUT A;  3C9U A;  1FFX A;  2UYP A;  5EYP A;  1RQ2 A;  3DDN A;  3TD3 A;  1SZQ A;  3CB2 A;  5J2U B;  3S03 A;  5BMV B;  3UT5 A;  3KE1 A;  3N2K B;  1W5E A;  4C8G A;  3G4S F;  1Q82 H;  1U3L A;  2CZW A;  3CCU F;  3LME A;  3CCE F;  1VQN F;  1DBF A;  1W41 A;  2B33 A;  1RLG A;  1ODE A;  2HRY A;  3VYU C;  2BTQ B;  3FBA A;  4TV8 A;  4X1Y A;  3RYF B;  5KX5 A;  4BT5 A;  5IJ9 B;  3F6M A;  1W42 A;  1DT9 A;  3WGM A;  4ZI7 A;  4O4L B;  1XRG A;  4R40 B;  2RHO A;  1W5B A;  4O2B B;  1S72 F;  3F0G A;  2VAM A;  3IEW A;  4PWT A;  5MN6 A;  1K8A H;  3S06 A;  2Z1F A;  3JAL A;  2OTJ F;  5GAP K;  4FFB B;  2HRU A;  3QUW A;  5LOV B;  2WAL A;  4X3L A;  2L26 A;  4IHJ A;  4LCK A;  3TD5 A;  3HKD A;  5IT9 M;  3G6E F;  3N4Z A;  4DRX B;  2N48 A;  4X3M A;  5DCV A;  4HNA A;  5EO3 A;  3NMU C;  1SA0 A;  1X25 A;  1GO1 A;  3PLA C;  1T0A A;  3WJQ A;  3SIV A;  2LBW A;  5EB1 B;  4YJ2 B;  4IIJ B;  4ERH A;  2AMT A;  3QTY A;  1YI2 F;  5A2Q M;  2YYE A;  5HXZ A;  2UYK A;  1GZ0 A;  1QD9 A;  3IEQ A;  3TD4 A;  1YHQ F;  2BTU A;  3HKE A;  3ELC A;  3ZP7 A;  3LWO C;  1JJ2 F;  4I55 B;  2Q1X A;  5JH7 B;  2HQS C;  2KG4 A;  3WPW A;  5MN5 A;  1IV3 A;  3CG6 A;  4U3J A;  2Z01 A;  3L7Q A;  2VGM A;  1VQL F;  1KC8 H;  3V7E A;  3DC2 A;  4O4I B;  3CC2 F;  3CCM F;  1RQ7 A;  3RYH B;  3RE3 A;  3F0E A;  3CYP B;  3MCA B;  4WBN A;  2I6D A;  3VYS C;  3WJR A;  3I7T A;  4BW0 B;  4BVR A;  2CHS A;  2H6L A;  5LYJ B;  1ONI A;  2QEX F;  5HXU A;  4EB6 B;  3S0W A;  2ZVZ A;  4I4T B;  2QA4 F;  4RQO A;  2KTU A;  5JVD B;  3IR9 A;  2Z1T A;  3I55 F;  3WGK A;  4X1I B;  3OBY A;  3S0Y A;  3CYQ A;  1E7K A;  2UYN A;  1NJI H;  4B5C A;  4G4Y A;  3OW2 F;  3JAT B;  3JAW A;  1VQ5 F;  4F6R A;  4EI7 A;  5J2U A;  4KWE A;  5GIP C;  5LA6 A;  3LDT A;  2PMP A;  1W2B F;  1TVK B;  4G4W A;  1W55 A;  3CPW F;  2LBT A;  3JAM M;  1YJW F;  2W8B C;  3RYF A;  2IQQ A;  3KJK A;  1JN1 A;  3V4D A;  1VQP F;  3I3F A;  1VQK F;  2Z1U A;  3D01 A;  3C9S A;  5EZY B;  5HWE A;  4YJ3 B;  2G9I A;  3J80 M;  2UYJ A;  5ITZ A;  2KGW A;  3E22 A;  2F9Z C;  3QHD A;  3JAR A;  1X7O A;  2LBX A;  3J81 M;  4G4Z A;  5LP6 B;  1T0K B;  2ZF8 A;  1QVF F;  1VQV A;  1Q8R A;  1X52 A;  3V7Q A;  3WGL A;  4TV9 B;  2IAF A;  5IJ0 A;  5HY0 A;  1VQM F;  1M90 H;  5CB4 A;  3R0P A;  3M4S A;  4ZOL B;  3RYI B;  1W5F A;  4X20 B;  4BT3 A;  5FJ4 C;  3HKC A;  1XBI A;  3K14 A;  2ZVY A;  1H7M A;  5J2T A;  5FNV B;  1VH8 A;  2YXZ A;  3LWV C;  4EI9 A;  4G88 A;  3ERN A;  3BYQ A;  2ZOD A;  3JAS B;  1XV2 A;  2HS4 A;  3LFO A;  3F0D A;  3PAF A;  5LXT B;  3K2X A;  5HY2 A;  4I55 A;  2OTL F;  5JH7 A;  2H8E A;  1N8R H;  2UZH A;  5GIO C;  1IV2 A;  5EYP B;  1M1K H;  1SDS A;  4U3J B;  3OBW A;  4O2A A;  4TZZ A;  3GYQ A;  1KNK A;  3CCJ F;  4RHA A;  4ZHQ B;  3CCL F;  1YIJ F;  3RYH A;  4BT2 A;  1NMU B;  4G4V A;  2BO1 A;  1VQ9 F;  3CCV F;  1CLI A;  3D00 A;  5JQG A;  2IG8 A;  4TUY B;  5LYJ A;  3CMA F;  1W3E X;  4X1K B;  3M1X A;  3CXC F;  1VK3 A;  3WGN A;  3WGJ A;  5CA0 A;  1W40 A;  3LWQ C;  3CCS F;  5G4U C;  4ZHY B;  1J7H A;  1CN7 A; 
#chains in the Genus database with same CATH homology
 4XCQ A;  2OHW A;  2QEX F;  5HXU A;  2QA4 F;  3JCM M;  2KTU A;  4BVT A;  3IR9 A;  3I55 F;  1YIT F;  1PXW A;  1VQ7 F;  1VQ6 F;  3NVI B;  1KQS F;  3OBY A;  1QVG F;  3VI6 A;  1E7K A;  3NVK E;  3J7A R;  3HJW C;  2FC3 A;  1NJI H;  3E20 B;  2JNB A;  3CCQ F;  5GAN K;  3OW2 F;  1KD1 H;  1VQ5 F;  3NK6 A;  5HY4 A;  4EI7 A;  1YJN F;  4BY9 D;  4NUT A;  5GIP C;  3NK7 A;  1W2B F;  3CPW F;  3LWP C;  4BVQ A;  3JAM M;  3G71 F;  1YJW F;  2OZB A;  1VQ8 F;  3SIU A;  1IPA A;  3G4S F;  1Q82 H;  1RA4 A;  2CZW A;  3CCU F;  1VQP F;  3ON1 A;  3CCE F;  5GIN C;  3CC7 F;  4BVS A;  1VQN F;  1VQK F;  1W41 A;  1RLG A;  3VMF B;  3O85 A;  5HWE A;  4NQ3 A;  3J80 M;  2F9Z C;  1X7P A;  5FLX M;  1W42 A;  3V3T A;  1X7O A;  1DT9 A;  2LBX A;  1Q7Y H;  3J81 M;  1T0K B;  1QVF F;  1X52 A;  1S72 F;  3V7Q A;  3CCR F;  1CK2 A;  5HY0 A;  1VQM F;  2AIF A;  1Q81 H;  3FFM A;  1M90 H;  1K8A H;  2KTV A;  2OTJ F;  3CME F;  3RA6 A;  5GAP K;  5FJ4 C;  2WAL A;  1XBI A;  3AGK A;  4X3L A;  1H7M A;  4LCK A;  1VQ4 F;  2GLZ A;  3G6E F;  5IT9 M;  3N4Z A;  1ZWZ A;  4X3M A;  5DCV A;  2ALE A;  4EI9 A;  3LWV C;  5EO3 A;  3NMU C;  3RA5 A;  5HY1 A;  2FGY A;  1YJ9 F;  4EI8 A;  1GO1 A;  3LFO A;  3PAF A;  3PLA C;  3SIV A;  2LBW A;  3CPQ A;  5HY2 A;  2HVY D;  3N4Y A;  2OTL F;  3CC4 F;  1YI2 F;  1N8R H;  2VGN A;  5GIO C;  5A2Q M;  5HXZ A;  3E1Y A;  1YHQ F;  1GZ0 A;  1M1K H;  3LWO C;  1SDS A;  1JJ2 F;  3OBW A;  4TZZ A;  3GYQ A;  1Q86 H;  3CCJ F;  3LWR C;  2KG4 A;  1K73 H;  2QI2 A;  3CCL F;  1YIJ F;  3CG6 A;  1NMU B;  3CD6 F;  2BO1 A;  5G4V C;  1VQ9 F;  1K9M H;  3CCV F;  3D00 A;  5EWR A;  2VGM A;  3CMA F;  1KC8 H;  1VQL F;  3V7E A;  3CC2 F;  1W3E X;  3CCM F;  3HAX D;  3CXC F;  1VQO F;  3WXM B;  3LWQ C;  5G4U C;  1W40 A;  3MCA B;  3CCS F;  4C4W C;  2I6D A;  4BW0 B;  4BVR A;  3I56 F;  1CN7 A;  1GO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...