3ON1A

The structure of a protein with unknown function from bacillus halodurans c
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
EAKWLSLLGLAARARQLLTGEEQVVKAVQNGQVTLVILSSDAGIHTKKKLLDKCGSYQIPVKVVGNRQMLGRAIGKHERVVIGVKDAGFSRKLAALIDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH2414 protein
publication title The structure of a protein with unknown function from Bacillus halodurans C
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3on1A00
3N4YA 1CK2A 3VMFB 3NVIB 2BO1A 5GIOC 3WXMB 1RLGA 5G4VC 3CC2F 1W42A 2I6DA 3LWPC 1Q82H 1YI2F 1S72F 3OBWA 1YJ9F 2OTLF 1VQNF 1VQ9F 3GYQA 3I55F 3RA6A 1VQ8F 3SIUA 3N4ZA 3LWQC 2QA4F 3CCVF 2OTJF 3HAXD 1QVGF 3PLAC 1RA4A 1H7MA 2QEXF 1K9MH 3CXCF 1PXWA 1DT9A 2ALEA 1Q7YH 5IT9M 2KTUA 1IPAA 3E20B 1Q86H 2KTVA 3CD6F 5GAPK 2KG4A 4LCKA 3O85A 5GANK 3CCQF 5GIPC 2LBXA 3LWRC 1VQKF 3SIVA 5A2QM 1YITF 3CCUF 3CCLF 5EWRA 3LWOC 1VQPF 3OW2F 3MCAB 1YHQF 3CC7F 1VQMF 1JJ2F 1X52A 4X3MA 3CCJF 1GO1A 5DCVA 2WALA 3J81M 2CZWA 2VGNA 1GO0A 3E1YA 1NJIH 4C4WC 3NK6A 3CMAF 5FLXM 3JAMM 1VQOF 3V7EA 4X3LA 3IR9A 1XBIA 3G71F 1T0KB 1W40A 3J80M 3NMUC 2VGMA 1YIJF 1VQ4F 2QI2A 3CCEF 1YJNF 1VQ5F 4NUTA 3G4SF 3CMEF 3CPWF 1KC8H 3LFOA 1CN7A 4BW0B 1W41A 3PAFA 3CG6A 1KD1H 1KQSF 1X7OA 2OHWA 1M90H 2LBWA 3I56F 3CCSF 2HVYD 1NMUB 5G4UC 1X7PA 3FFMA 3CC4F 1VQ6F 1SDSA 1QVFF 3LWVC 2OZBA 1Q81H 3NK7A 3G6EF 5EO3A 4BY9D 1W3EX 5GINC 1W2BF 3CCMF 2JNBA 3VI6A 1N8RH 1K73H 1K8AH 3NVKE 3AGKA 1M1KH 1VQLF 3J7AR 4TZZA 1ZWZA 1VQ7F 1E7KA 3JCMM 3OBYA 3RA5A 3V7QA 3HJWC 5FJ4C 3CCRF 2FC3A 3CPQA 3ON1A 1GZ0A 1YJWF 2AIFA
chains in the Genus database with same CATH superfamily
3WGLA 3WGKA 2VAWA 5ITZA 4YJ2A 1YQNA 5MN4A 2DYYA 2I6DA 4O4IB 5HWEA 2Q1XA 2PHNA 3HKDA 1S72F 1H48A 4X1YA 2OTLF 2UYKA 1VQ9F 5CA1A 5IJ0B 3KE1A 4BT2A 3SIUA 5JCOA 3UT5A 3VYSC 1QVGF 3IKFA 4G4YA 1QAHA 1UI9A 2K1SA 1DT9A 3OONA 4G88A 5IT9M 3RYFB 3E20B 4C82A 3F0EA 3CD6F 5GAPK 3JAWB 4ZI7A 3WGJA 1U43A 5LP6C 2LCAA 5CB4A 4IIJA 3SIVA 4I4TA 5LA6B 3Q8HA 4ZHQB 3JASA 5LYJB 4O2AB 2H6LA 4HNAB 4B62A 3OW2F 5CA0B 1W55A 3CC7F 1R1MA 3TD3A 2CHTA 1JJ2F 3HWUA 3VYUC 4O4HA 2VGNA 3HKBB 3P10A 4C8IA 4O2BB 3RYCA 5J2TB 4C4WC 3CMAF 1IV1A 3M84A 3JAMM 5LP6B 1SA0A 2NMUA 1IV3A 3G71F 1W40A 1XHOA 1DBFA 2VGMA 4B46A 1JFFA 1RQ7A 2QI2A 1YIJF 4C8GA 1RQ2A 4NUTA 3CPWF 1KC8H 5BMVA 2ZVZA 4YJ3A 4C81A 3FBAA 2FGYA 2HP0A 2CW4A 3CG6A 1KQSF 4DRXA 3CCSF 1VHAA 2ZOVA 2UZHA 3CC4F 1W57A 3LWVC 3FPIA 2OZBA 4G4WA 3HKCA 3G6EF 5FNVA 3ZOPA 5JVDA 5GINC 3RYHA 1Q8RA 2F9ZC 4NWOB 3N2KB 4O4JA 2N48A 3WPWA 4X1KB 4U3JA 1FSZA 3TD4A 1VQLF 3J7AR 3QTYA 3D00A 2G9IA 1RLUA 3HKEB 3RA5A 3V7QA 2RB9A 2R751 3VO8A 5IJ9B 2GLZA 3CPQA 2H8CA 4C8EA 4G4XA 1T0AA 3JATB 4BVSA 2AIFA 3NVIB 2UYNA 3B6NA 1YGYA 1Z5VA 1W5FA 3E22A 1H47A 2BTQB 2R6R1 4EI7A 3U0OA 1W42A 4B45A 4I50A 5KMGB 4TUYA 1TVKB 1YI2F 4BT6A 3IMPA 5GONB 3RA6A 1IV4A 1VQ8F 3N4ZA 4B5CA 3CB2A 3LWQC 3CCVF 4XCQA 5KX5A 3C9UA 1RA4A 2Q1YA 1H7MA 2IQQA 4F6RA 1K9MH 2HP3A 5EB1B 2ALEA 4TV9B 2KTUA 2L26A 1Q86H 3RYIA 3F0DA 3O85A 3F6MA 3LWRC 1IV2A 4EB6A 1KNKA 3LMEA 1YITF 3CCUF 1FFXA 5EWRA 3JAKB 2Z1FA 3GTZA 4ZK7A 2DT4A 4I55B 4ZOLB 5LXTB 5EB0A 1X52A 4X3MA 5EIBC 2WALA 3K2XA 3ELCA 1GO0A 4X1IA 3ESJA 5EZYB 5FLXM 4RHAA 5IJ0A 4DXDA 3WJPA 1VQOF 3V7EA 5MN5A 5IYZB 3IR9A 5MN6A 1JY8A 1XBIA 3IEQA 3NMUC 1YJNF 2EWCA 1VQ5F 2VAPA 3CMEF 2PMPA 2CSLA 3M4SA 3RYFA 3FD5A 5JH7B 4BW0B 1W41A 3PAFA 3JAWA 3KIZA 4ERHA 1KD1H 1X7OA 2GVIA 2OHWA 1M90H 1FNKA 2AIZP 3HTNA 3DDNA 3ZO8A 1X7PA 4E6EA 1VQ6F 4TV8B 2YXZA 2B33A 4ZHQA 4HNAA 1TUBB 5CA0A 5EO3A 4BY9D 1W3EX 3WGNA 2ZVYA 3L7QA 2VXYA 2JNBA 1N8RH 3S06A 1NQ3A 2KGWA 1SA0B 1QU9A 3AGKA 1M1KH 5EIBD 3HKBA 4O2BA 1JFFB 3N2GB 5LP6A 4BT7A 1QD9A 3ON1A 3S03A 3WPXA 3VCZA 5BMVB 1CK2A 1PF5A 2CHSA 2BO1A 5HY4A 3V3TA 3WXMB 4X20B 1ONIA 5LOVA 3CC2F 4EI9A 4IHJB 2H8EA 4WBNB 3OBWA 1VQNF 3I55F 2IG8A 2HRYA 3C9TA 2QA4F 3HAXD 5C8YB 5HP7A 2BTOA 5HXZA 2QEXF 4BT3A 1PXWA 1OAPA 3M1XA 3N2KA 3TD5A 2KTVA 2KG4A 3BYQA 3P0ZA 3GHZA 5GANK 3VTIC 4LNUB 3I7TA 2QTPA 5JQGB 3JARB 3JALB 5IJ9A 3CCLF 1VQPF 3JATA 4O4LA 2VAMA 5J2UA 1JD1A 5EYPB 1UFYA 1GO1A 2HS0A 3CYPB 1U3LA 4ZHWA 2CZWA 5KMGA 1JN1A 1TVKA 1FNJA 4FFBB 5JCOC 3NK6A 4EI8A 4F6RB 4X3LA 1VQVA 2GZLA 3J80M 5ITZB 2Z1TA 1SZQA 4YJ2B 4G4VA 3G4SF 3MDOA 5HY0A 3LFOA 4TV9A 4R40B 2MQEA 2HRUA 3HKDB 3D01A 4X1YB 3QHDA 5CA1B 2LBWA 3I56F 2HVYD 1NMUB 3VOAA 3UT5B 1Z5WA 3FFMA 1QVFF 1J7HA 4O4IA 2AMTA 3NK7A 3S0YA 2ZF8A 2RHJA 3JAKA 5HY2A 3VYTC 2RHLA 4ZHYB 4I55A 4ZOLA 5LXTA 4X1IB 4NQ3A 1K73H 1K8AH 1CLIA 4BT4A 3C9SA 4M8IA 4ZI7B 5HY1A 1ZWZA 1VQ7F 1E7KA 2UYPA 5CB4B 3HJWC 5FJ4C 3IEWA 4IIJB 5EZYA 4I4TB 2HQSC 3JASB 2FC3A 1COMA 1VK3A 2I6RA 3QUWA 1GZ0A 5IYZA 3R0PA 3N4YA 3MBMA 3MQWA 3VMFB 5GIOC 5LA6A 3S02A 5LYJA 3DC2A 4O2AA 3FD6A 1RLGA 5G4VC 2LBTA 5HXUA 1KNJA 4O4HB 3LWPC 1XRGA 5JH7A 1Q82H 4ZHVA 3RYCB 5EAZA 3CYQA 3VIUA 1YJ9F 3JVHA 3GYQA 2HX0A 3C9RA 4TV8A 2HS4A 5J2TA 2OTJF 1XV2A 1TUBA 4BVQA 5AVMA 3PLAC 3LYBA 2IAFA 3CXCF 1GX1A 2OTMA 2Z01A 1Q7YH 1IPAA 4YJ3B 2ZODA 3C8LA 2Z1EA 1W5AA 3RE3A 4LCKA 2HP0B 4DRXB 3CCQF 2CVLA 5GIPC 2LBXA 3P4EA 1VQKF 3KJJA 3V4DA 3N2GA 5B8FA 5A2QM 3LWOC 3MCQA 5LOVB 3HKCB 5FNVB 3MCAB 1YHQF 3S0HA 5HP8A 5JVDB 1VQMF 3RYHB 1ODEA 4X20A 4O4JB 2CWJA 3CCJF 2RHOA 3D54A 3WGMA 5DCVA 1W5EA 3J81M 4IHJA 4U3JB 3E1YA 4WBNA 3T80A 3S0WA 1NJIH 4BVRA 1VH8A 3I3FA 4X1KA 2Z1UA 3K12A 3HKEA 1T0KB 1X25A 3F0GA 4G4ZA 1VQ4F 3K14A 5C8YA 3CCEF 2UYNB 4KWEA 3E22B 4PWTA 4I50B 1CN7A 1W581 4TUYB 2ZAUA 4LNUA 4O4LB 2YYEA 2BTUA 5J2UB 5G4UC 5JQGA 3ZP4A 3ZP7A 1SDSA 3JARA 1W5BA 4BVTA 3JALA 1Q81H 5KX5B 2W8BC 2UYJA 3WJQA 3KJKA 5GONA 1W2BF 2V9YA 3CCMF 3VI6A 3ERNA 4RQOA 3LDTA 5EYPA 1U40A 3K0TA 3EORA 3KHNA 3RYIB 3NVKE 4TZZA 2RHHA 1OFUA 1W59A 4FFBA 3JCMM 3OBYA 4EB6B 3F0FA 4U39A 2P6YA 4BT5A 3CCRF 1FFXB 2HS3A 1U3PA 3WJRA 3IKEA 3VOBA 1YJWF
chains in the Genus database with same CATH topology
3N4YA 1CK2A 3VMFB 3NVIB 2BO1A 5HY4A 3V3TA 5GIOC 3WXMB 1RLGA 5G4VC 3CC2F 4EI9A 4EI7A 5HXUA 1W42A 2I6DA 3LWPC 1YJWF 1Q82H 5HWEA 1YI2F 1S72F 3OBWA 1YJ9F 2OTLF 1VQNF 1VQ9F 3GYQA 3I55F 3RA6A 1VQ8F 3SIUA 3N4ZA 3LWQC 2QA4F 3CCVF 2OTJF 3HAXD 4XCQA 4BVQA 1QVGF 3PLAC 1RA4A 5HXZA 1H7MA 2QEXF 1K9MH 3CXCF 1PXWA 1DT9A 2ALEA 1Q7YH 5IT9M 2KTUA 1IPAA 3E20B 1Q86H 2KTVA 3CD6F 5GAPK 2KG4A 4LCKA 3O85A 5GANK 3CCQF 5GIPC 2LBXA 3LWRC 1VQKF 3SIVA 5A2QM 1YITF 3CCUF 3CCLF 5EWRA 3LWOC 1VQPF 3OW2F 3MCAB 1YHQF 3CC7F 1VQMF 1JJ2F 1X52A 4X3MA 3CCJF 1GO1A 5DCVA 2WALA 3J81M 2CZWA 2VGNA 1GO0A 3E1YA 1NJIH 4C4WC 4BVRA 3NK6A 3CMAF 5FLXM 3JAMM 4EI8A 1VQOF 3V7EA 4X3LA 3IR9A 1XBIA 3G71F 1T0KB 1W40A 3J80M 3NMUC 2VGMA 1YIJF 1VQ4F 2QI2A 3CCEF 1YJNF 1VQ5F 4NUTA 3G4SF 3CMEF 3CPWF 5HY0A 1KC8H 3LFOA 1CN7A 4BW0B 1W41A 2FGYA 3PAFA 3CG6A 1KD1H 1KQSF 1X7OA 2OHWA 1M90H 2LBWA 3I56F 3CCSF 2HVYD 1NMUB 5G4UC 1X7PA 3FFMA 3CC4F 1VQ6F 1SDSA 1QVFF 3LWVC 4BVTA 2OZBA 1Q81H 3NK7A 3G6EF 5EO3A 4BY9D 5HY2A 1W3EX 5GINC 1W2BF 3CCMF 2JNBA 3VI6A 2F9ZC 1N8RH 4NQ3A 1K73H 1K8AH 3NVKE 3AGKA 1M1KH 1VQLF 3J7AR 4TZZA 5HY1A 1ZWZA 3D00A 1VQ7F 1E7KA 3JCMM 3OBYA 3RA5A 3V7QA 3HJWC 5FJ4C 3CCRF 2FC3A 2GLZA 3CPQA 3ON1A 1GZ0A 4BVSA 2AIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4Y A;  1CK2 A;  3VMF B;  3NVI B;  2BO1 A;  5GIO C;  3WXM B;  1RLG A;  5G4V C;  3CC2 F;  1W42 A;  2I6D A;  3LWP C;  1Q82 H;  1YI2 F;  1S72 F;  3OBW A;  1YJ9 F;  2OTL F;  1VQN F;  1VQ9 F;  3GYQ A;  3I55 F;  3RA6 A;  1VQ8 F;  3SIU A;  3N4Z A;  3LWQ C;  2QA4 F;  3CCV F;  2OTJ F;  3HAX D;  1QVG F;  3PLA C;  1RA4 A;  1H7M A;  2QEX F;  1K9M H;  3CXC F;  1PXW A;  1DT9 A;  2ALE A;  1Q7Y H;  5IT9 M;  2KTU A;  1IPA A;  3E20 B;  1Q86 H;  2KTV A;  3CD6 F;  5GAP K;  2KG4 A;  4LCK A;  3O85 A;  5GAN K;  3CCQ F;  5GIP C;  2LBX A;  3LWR C;  1VQK F;  3SIV A;  5A2Q M;  1YIT F;  3CCU F;  3CCL F;  5EWR A;  3LWO C;  1VQP F;  3OW2 F;  3MCA B;  1YHQ F;  3CC7 F;  1VQM F;  1JJ2 F;  1X52 A;  4X3M A;  3CCJ F;  1GO1 A;  5DCV A;  2WAL A;  3J81 M;  2CZW A;  2VGN A;  1GO0 A;  3E1Y A;  1NJI H;  4C4W C;  3NK6 A;  3CMA F;  5FLX M;  3JAM M;  1VQO F;  3V7E A;  4X3L A;  3IR9 A;  1XBI A;  3G71 F;  1T0K B;  1W40 A;  3J80 M;  3NMU C;  2VGM A;  1YIJ F;  1VQ4 F;  2QI2 A;  3CCE F;  1YJN F;  1VQ5 F;  4NUT A;  3G4S F;  3CME F;  3CPW F;  1KC8 H;  3LFO A;  1CN7 A;  4BW0 B;  1W41 A;  3PAF A;  3CG6 A;  1KD1 H;  1KQS F;  1X7O A;  2OHW A;  1M90 H;  2LBW A;  3I56 F;  3CCS F;  2HVY D;  1NMU B;  5G4U C;  1X7P A;  3FFM A;  3CC4 F;  1VQ6 F;  1SDS A;  1QVF F;  3LWV C;  2OZB A;  1Q81 H;  3NK7 A;  3G6E F;  5EO3 A;  4BY9 D;  1W3E X;  5GIN C;  1W2B F;  3CCM F;  2JNB A;  3VI6 A;  1N8R H;  1K73 H;  1K8A H;  3NVK E;  3AGK A;  1M1K H;  1VQL F;  3J7A R;  4TZZ A;  1ZWZ A;  1VQ7 F;  1E7K A;  3JCM M;  3OBY A;  3RA5 A;  3V7Q A;  3HJW C;  5FJ4 C;  3CCR F;  2FC3 A;  3CPQ A;  3ON1 A;  1GZ0 A;  1YJW F;  2AIF A; 
#chains in the Genus database with same CATH topology
 3WGL A;  3WGK A;  2VAW A;  5ITZ A;  4YJ2 A;  1YQN A;  5MN4 A;  2DYY A;  2I6D A;  4O4I B;  5HWE A;  2Q1X A;  2PHN A;  3HKD A;  1S72 F;  1H48 A;  4X1Y A;  2OTL F;  2UYK A;  1VQ9 F;  5CA1 A;  5IJ0 B;  3KE1 A;  4BT2 A;  3SIU A;  5JCO A;  3UT5 A;  3VYS C;  1QVG F;  3IKF A;  4G4Y A;  1QAH A;  1UI9 A;  2K1S A;  1DT9 A;  3OON A;  4G88 A;  5IT9 M;  3RYF B;  3E20 B;  4C82 A;  3F0E A;  3CD6 F;  5GAP K;  3JAW B;  4ZI7 A;  3WGJ A;  1U43 A;  5LP6 C;  2LCA A;  5CB4 A;  4IIJ A;  3SIV A;  4I4T A;  5LA6 B;  3Q8H A;  4ZHQ B;  3JAS A;  5LYJ B;  4O2A B;  2H6L A;  4HNA B;  4B62 A;  3OW2 F;  5CA0 B;  1W55 A;  3CC7 F;  1R1M A;  3TD3 A;  2CHT A;  1JJ2 F;  3HWU A;  3VYU C;  4O4H A;  2VGN A;  3HKB B;  3P10 A;  4C8I A;  4O2B B;  3RYC A;  5J2T B;  4C4W C;  3CMA F;  1IV1 A;  3M84 A;  3JAM M;  5LP6 B;  1SA0 A;  2NMU A;  1IV3 A;  3G71 F;  1W40 A;  1XHO A;  1DBF A;  2VGM A;  4B46 A;  1JFF A;  1RQ7 A;  2QI2 A;  1YIJ F;  4C8G A;  1RQ2 A;  4NUT A;  3CPW F;  1KC8 H;  5BMV A;  2ZVZ A;  4YJ3 A;  4C81 A;  3FBA A;  2FGY A;  2HP0 A;  2CW4 A;  3CG6 A;  1KQS F;  4DRX A;  3CCS F;  1VHA A;  2ZOV A;  2UZH A;  3CC4 F;  1W57 A;  3LWV C;  3FPI A;  2OZB A;  4G4W A;  3HKC A;  3G6E F;  5FNV A;  3ZOP A;  5JVD A;  5GIN C;  3RYH A;  1Q8R A;  2F9Z C;  4NWO B;  3N2K B;  4O4J A;  2N48 A;  3WPW A;  4X1K B;  4U3J A;  1FSZ A;  3TD4 A;  1VQL F;  3J7A R;  3QTY A;  3D00 A;  2G9I A;  1RLU A;  3HKE B;  3RA5 A;  3V7Q A;  2RB9 A;  2R75 1;  3VO8 A;  5IJ9 B;  2GLZ A;  3CPQ A;  2H8C A;  4C8E A;  4G4X A;  1T0A A;  3JAT B;  4BVS A;  2AIF A;  3NVI B;  2UYN A;  3B6N A;  1YGY A;  1Z5V A;  1W5F A;  3E22 A;  1H47 A;  2BTQ B;  2R6R 1;  4EI7 A;  3U0O A;  1W42 A;  4B45 A;  4I50 A;  5KMG B;  4TUY A;  1TVK B;  1YI2 F;  4BT6 A;  3IMP A;  5GON B;  3RA6 A;  1IV4 A;  1VQ8 F;  3N4Z A;  4B5C A;  3CB2 A;  3LWQ C;  3CCV F;  4XCQ A;  5KX5 A;  3C9U A;  1RA4 A;  2Q1Y A;  1H7M A;  2IQQ A;  4F6R A;  1K9M H;  2HP3 A;  5EB1 B;  2ALE A;  4TV9 B;  2KTU A;  2L26 A;  1Q86 H;  3RYI A;  3F0D A;  3O85 A;  3F6M A;  3LWR C;  1IV2 A;  4EB6 A;  1KNK A;  3LME A;  1YIT F;  3CCU F;  1FFX A;  5EWR A;  3JAK B;  2Z1F A;  3GTZ A;  4ZK7 A;  2DT4 A;  4I55 B;  4ZOL B;  5LXT B;  5EB0 A;  1X52 A;  4X3M A;  5EIB C;  2WAL A;  3K2X A;  3ELC A;  1GO0 A;  4X1I A;  3ESJ A;  5EZY B;  5FLX M;  4RHA A;  5IJ0 A;  4DXD A;  3WJP A;  1VQO F;  3V7E A;  5MN5 A;  5IYZ B;  3IR9 A;  5MN6 A;  1JY8 A;  1XBI A;  3IEQ A;  3NMU C;  1YJN F;  2EWC A;  1VQ5 F;  2VAP A;  3CME F;  2PMP A;  2CSL A;  3M4S A;  3RYF A;  3FD5 A;  5JH7 B;  4BW0 B;  1W41 A;  3PAF A;  3JAW A;  3KIZ A;  4ERH A;  1KD1 H;  1X7O A;  2GVI A;  2OHW A;  1M90 H;  1FNK A;  2AIZ P;  3HTN A;  3DDN A;  3ZO8 A;  1X7P A;  4E6E A;  1VQ6 F;  4TV8 B;  2YXZ A;  2B33 A;  4ZHQ A;  4HNA A;  1TUB B;  5CA0 A;  5EO3 A;  4BY9 D;  1W3E X;  3WGN A;  2ZVY A;  3L7Q A;  2VXY A;  2JNB A;  1N8R H;  3S06 A;  1NQ3 A;  2KGW A;  1SA0 B;  1QU9 A;  3AGK A;  1M1K H;  5EIB D;  3HKB A;  4O2B A;  1JFF B;  3N2G B;  5LP6 A;  4BT7 A;  1QD9 A;  3ON1 A;  3S03 A;  3WPX A;  3VCZ A;  5BMV B;  1CK2 A;  1PF5 A;  2CHS A;  2BO1 A;  5HY4 A;  3V3T A;  3WXM B;  4X20 B;  1ONI A;  5LOV A;  3CC2 F;  4EI9 A;  4IHJ B;  2H8E A;  4WBN B;  3OBW A;  1VQN F;  3I55 F;  2IG8 A;  2HRY A;  3C9T A;  2QA4 F;  3HAX D;  5C8Y B;  5HP7 A;  2BTO A;  5HXZ A;  2QEX F;  4BT3 A;  1PXW A;  1OAP A;  3M1X A;  3N2K A;  3TD5 A;  2KTV A;  2KG4 A;  3BYQ A;  3P0Z A;  3GHZ A;  5GAN K;  3VTI C;  4LNU B;  3I7T A;  2QTP A;  5JQG B;  3JAR B;  3JAL B;  5IJ9 A;  3CCL F;  1VQP F;  3JAT A;  4O4L A;  2VAM A;  5J2U A;  1JD1 A;  5EYP B;  1UFY A;  1GO1 A;  2HS0 A;  3CYP B;  1U3L A;  4ZHW A;  2CZW A;  5KMG A;  1JN1 A;  1TVK A;  1FNJ A;  4FFB B;  5JCO C;  3NK6 A;  4EI8 A;  4F6R B;  4X3L A;  1VQV A;  2GZL A;  3J80 M;  5ITZ B;  2Z1T A;  1SZQ A;  4YJ2 B;  4G4V A;  3G4S F;  3MDO A;  5HY0 A;  3LFO A;  4TV9 A;  4R40 B;  2MQE A;  2HRU A;  3HKD B;  3D01 A;  4X1Y B;  3QHD A;  5CA1 B;  2LBW A;  3I56 F;  2HVY D;  1NMU B;  3VOA A;  3UT5 B;  1Z5W A;  3FFM A;  1QVF F;  1J7H A;  4O4I A;  2AMT A;  3NK7 A;  3S0Y A;  2ZF8 A;  2RHJ A;  3JAK A;  5HY2 A;  3VYT C;  2RHL A;  4ZHY B;  4I55 A;  4ZOL A;  5LXT A;  4X1I B;  4NQ3 A;  1K73 H;  1K8A H;  1CLI A;  4BT4 A;  3C9S A;  4M8I A;  4ZI7 B;  5HY1 A;  1ZWZ A;  1VQ7 F;  1E7K A;  2UYP A;  5CB4 B;  3HJW C;  5FJ4 C;  3IEW A;  4IIJ B;  5EZY A;  4I4T B;  2HQS C;  3JAS B;  2FC3 A;  1COM A;  1VK3 A;  2I6R A;  3QUW A;  1GZ0 A;  5IYZ A;  3R0P A;  3N4Y A;  3MBM A;  3MQW A;  3VMF B;  5GIO C;  5LA6 A;  3S02 A;  5LYJ A;  3DC2 A;  4O2A A;  3FD6 A;  1RLG A;  5G4V C;  2LBT A;  5HXU A;  1KNJ A;  4O4H B;  3LWP C;  1XRG A;  5JH7 A;  1Q82 H;  4ZHV A;  3RYC B;  5EAZ A;  3CYQ A;  3VIU A;  1YJ9 F;  3JVH A;  3GYQ A;  2HX0 A;  3C9R A;  4TV8 A;  2HS4 A;  5J2T A;  2OTJ F;  1XV2 A;  1TUB A;  4BVQ A;  5AVM A;  3PLA C;  3LYB A;  2IAF A;  3CXC F;  1GX1 A;  2OTM A;  2Z01 A;  1Q7Y H;  1IPA A;  4YJ3 B;  2ZOD A;  3C8L A;  2Z1E A;  1W5A A;  3RE3 A;  4LCK A;  2HP0 B;  4DRX B;  3CCQ F;  2CVL A;  5GIP C;  2LBX A;  3P4E A;  1VQK F;  3KJJ A;  3V4D A;  3N2G A;  5B8F A;  5A2Q M;  3LWO C;  3MCQ A;  5LOV B;  3HKC B;  5FNV B;  3MCA B;  1YHQ F;  3S0H A;  5HP8 A;  5JVD B;  1VQM F;  3RYH B;  1ODE A;  4X20 A;  4O4J B;  2CWJ A;  3CCJ F;  2RHO A;  3D54 A;  3WGM A;  5DCV A;  1W5E A;  3J81 M;  4IHJ A;  4U3J B;  3E1Y A;  4WBN A;  3T80 A;  3S0W A;  1NJI H;  4BVR A;  1VH8 A;  3I3F A;  4X1K A;  2Z1U A;  3K12 A;  3HKE A;  1T0K B;  1X25 A;  3F0G A;  4G4Z A;  1VQ4 F;  3K14 A;  5C8Y A;  3CCE F;  2UYN B;  4KWE A;  3E22 B;  4PWT A;  4I50 B;  1CN7 A;  1W58 1;  4TUY B;  2ZAU A;  4LNU A;  4O4L B;  2YYE A;  2BTU A;  5J2U B;  5G4U C;  5JQG A;  3ZP4 A;  3ZP7 A;  1SDS A;  3JAR A;  1W5B A;  4BVT A;  3JAL A;  1Q81 H;  5KX5 B;  2W8B C;  2UYJ A;  3WJQ A;  3KJK A;  5GON A;  1W2B F;  2V9Y A;  3CCM F;  3VI6 A;  3ERN A;  4RQO A;  3LDT A;  5EYP A;  1U40 A;  3K0T A;  3EOR A;  3KHN A;  3RYI B;  3NVK E;  4TZZ A;  2RHH A;  1OFU A;  1W59 A;  4FFB A;  3JCM M;  3OBY A;  4EB6 B;  3F0F A;  4U39 A;  2P6Y A;  4BT5 A;  3CCR F;  1FFX B;  2HS3 A;  1U3P A;  3WJR A;  3IKE A;  3VOB A;  1YJW F; 
#chains in the Genus database with same CATH homology
 3N4Y A;  1CK2 A;  3VMF B;  3NVI B;  2BO1 A;  5HY4 A;  3V3T A;  5GIO C;  3WXM B;  1RLG A;  5G4V C;  3CC2 F;  4EI9 A;  4EI7 A;  5HXU A;  1W42 A;  2I6D A;  3LWP C;  1YJW F;  1Q82 H;  5HWE A;  1YI2 F;  1S72 F;  3OBW A;  1YJ9 F;  2OTL F;  1VQN F;  1VQ9 F;  3GYQ A;  3I55 F;  3RA6 A;  1VQ8 F;  3SIU A;  3N4Z A;  3LWQ C;  2QA4 F;  3CCV F;  2OTJ F;  3HAX D;  4XCQ A;  4BVQ A;  1QVG F;  3PLA C;  1RA4 A;  5HXZ A;  1H7M A;  2QEX F;  1K9M H;  3CXC F;  1PXW A;  1DT9 A;  2ALE A;  1Q7Y H;  5IT9 M;  2KTU A;  1IPA A;  3E20 B;  1Q86 H;  2KTV A;  3CD6 F;  5GAP K;  2KG4 A;  4LCK A;  3O85 A;  5GAN K;  3CCQ F;  5GIP C;  2LBX A;  3LWR C;  1VQK F;  3SIV A;  5A2Q M;  1YIT F;  3CCU F;  3CCL F;  5EWR A;  3LWO C;  1VQP F;  3OW2 F;  3MCA B;  1YHQ F;  3CC7 F;  1VQM F;  1JJ2 F;  1X52 A;  4X3M A;  3CCJ F;  1GO1 A;  5DCV A;  2WAL A;  3J81 M;  2CZW A;  2VGN A;  1GO0 A;  3E1Y A;  1NJI H;  4C4W C;  4BVR A;  3NK6 A;  3CMA F;  5FLX M;  3JAM M;  4EI8 A;  1VQO F;  3V7E A;  4X3L A;  3IR9 A;  1XBI A;  3G71 F;  1T0K B;  1W40 A;  3J80 M;  3NMU C;  2VGM A;  1YIJ F;  1VQ4 F;  2QI2 A;  3CCE F;  1YJN F;  1VQ5 F;  4NUT A;  3G4S F;  3CME F;  3CPW F;  5HY0 A;  1KC8 H;  3LFO A;  1CN7 A;  4BW0 B;  1W41 A;  2FGY A;  3PAF A;  3CG6 A;  1KD1 H;  1KQS F;  1X7O A;  2OHW A;  1M90 H;  2LBW A;  3I56 F;  3CCS F;  2HVY D;  1NMU B;  5G4U C;  1X7P A;  3FFM A;  3CC4 F;  1VQ6 F;  1SDS A;  1QVF F;  3LWV C;  4BVT A;  2OZB A;  1Q81 H;  3NK7 A;  3G6E F;  5EO3 A;  4BY9 D;  5HY2 A;  1W3E X;  5GIN C;  1W2B F;  3CCM F;  2JNB A;  3VI6 A;  2F9Z C;  1N8R H;  4NQ3 A;  1K73 H;  1K8A H;  3NVK E;  3AGK A;  1M1K H;  1VQL F;  3J7A R;  4TZZ A;  5HY1 A;  1ZWZ A;  3D00 A;  1VQ7 F;  1E7K A;  3JCM M;  3OBY A;  3RA5 A;  3V7Q A;  3HJW C;  5FJ4 C;  3CCR F;  2FC3 A;  2GLZ A;  3CPQ A;  3ON1 A;  1GZ0 A;  4BVS A;  2AIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...