3ON1A

The structure of a protein with unknown function from bacillus halodurans c
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
99
structure length
99
Chain Sequence
EAKWLSLLGLAARARQLLTGEEQVVKAVQNGQVTLVILSSDAGIHTKKKLLDKCGSYQIPVKVVGNRQMLGRAIGKHERVVIGVKDAGFSRKLAALIDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a protein with unknown function from Bacillus halodurans C
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
molecule keywords BH2414 protein
total genus 34
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3on1A00
1NJIH 2KTUA 5G4VC 1VQ7F 3CD6F 4BY9D 1X7OA 3JAMM 3VMFB 3CCLF 1M1KH 3SIUA 1X7PA 3HAXD 3OBYA 1VQ4F 4TZZA 3CCVF 5A2QM 1YJ9F 3GYQA 1VQPF 3LWVC 1X52A 3CC2F 1VQMF 1CN7A 1IPAA 3J81M 1K73H 2VGNA 3CCQF 2QI2A 3CCMF 1SDSA 1YJWF 1VQ6F 3CMEF 1YITF 3CG6A 1ZWZA 1RA4A 2QEXF 1GO1A 3E1YA 1Q7YH 1VQLF 3CCEF 3V7EA 3VI6A 1YJNF 1GZ0A 3CC4F 5GAPK 1QVGF 3LWRC 2ALEA 5GINC 1DT9A 3J80M 1KQSF 3CPQA 1H7MA 2QA4F 1Q82H 1QVFF 4LCKA 3G71F 2OTLF 3J7AR 3I56F 1E7KA 3I55F 2FC3A 1W40A 1T0KB 1W42A 3O85A 3PLAC 4NUTA 5G4UC 1Q86H 3WXMB 3MCAB 3E20B 3N4ZA 3NK7A 1YHQF 2JNBA 5FLXM 3SIVA 3JCMM 2CZWA 5GANK 1YI2F 3OW2F 3CCRF 1W2BF 2I6DA 5GIPC 2LBWA 5GIOC 3IR9A 3G6EF 2OHWA 1VQ8F 3NMUC 2HVYD 3CC7F 3CMAF 3OBWA 3ON1A 3RA5A 1S72F 1KD1H 1N8RH 3NVKE 3CCSF 2WALA 1K9MH 1VQ5F 2KTVA 3N4YA 2OTJF 3CCJF 5IT9M 1VQNF 1K8AH 1YIJF 5FJ4C 3LWQC 4C4WC 1GO0A 1XBIA 4X3MA 3G4SF 3CCUF 3HJWC 1W3EX 3PAFA 2OZBA 1VQKF 5DCVA 1VQOF 3FFMA 3LWPC 2LBXA 3RA6A 3CXCF 3NVIB 1W41A 3LWOC 2BO1A 3AGKA 3V7QA 3CPWF 4X3LA 5EO3A 3NK6A 1KC8H 2VGMA 2KG4A 1RLGA 1M90H 4BW0B 1PXWA 3LFOA 1Q81H 5EWRA 1NMUB 2AIFA 1CK2A 1JJ2F 1VQ9F
chains in the Genus database with same CATH superfamily
1NJIH 5G4VC 5HWEA 1VQ7F 4E6EA 2GZLA 5EB0A 4BVSA 1FNKA 2HRUA 5FNVB 4NQ3A 4U3JA 5EYPB 3LDTA 1VQ4F 3QTYA 3GYQA 2UYKA 5LYJA 4DRXA 1VQPF 1YQNA 4WBNB 2QTPA 3DC2A 3ZOPA 4B46A 5KMGB 3CCQF 3HKEA 1W55A 2VAMA 1QD9A 5LXTB 3CMEF 5J2UA 1COMA 2GLZA 4BT3A 1YITF 3CG6A 3P0ZA 4HNAA 3E1YA 5HY0A 1Q7YH 3I7TA 1GZ0A 3OONA 1T0AA 4ZHWA 5GINC 4KWEA 2RHJA 3M1XA 2HP3A 2HX0A 3UT5B 5HXUA 4BVQA 2QA4F 3JATA 1Q82H 1H47A 2UYNA 1QVFF 3V4DA 5BMVA 3K12A 1CLIA 4O4IA 2OTLF 2L26A 1TVKB 4FFBA 1FFXB 4G4VA 4BVTA 5JCOC 4NUTA 4XCQA 5G4UC 4O4JA 5LP6B 4YJ2A 4X1IB 3E20B 3MBMA 3CYPB 3SIVA 3HKDB 3K14A 3JCMM 4TUYB 4EI9A 1W5BA 2BTUA 3CCRF 1W2BF 2HQSC 2Z01A 5MN4A 2W8BC 3RYIB 5IYZB 5JQGB 3D54A 2LBWA 1YGYA 4BT2A 3F0DA 3KJJA 1H48A 3F0FA 5J2TB 3C9UA 3OBWA 4C8IA 2R751 3CCSF 3CYQA 2WALA 2H8EA 1R1MA 3BYQA 4X20A 3ZP7A 4ZI7A 2KTVA 3UT5A 1XV2A 4O4HB 2OTJF 2ZODA 5IT9M 1VQNF 4X1YB 3GTZA 5FJ4C 4TV8B 1GO0A 4ZK7A 1XBIA 2MQEA 2HS3A 4PWTA 3PAFA 1KNKA 3RYHB 3C9TA 3JASA 5JVDB 3ERNA 4B5CA 5J2TA 3RA6A 5MN6A 1W41A 3WGKA 4ZOLA 3CPWF 3AGKA 4X3LA 3N2GA 3WGNA 4IHJB 4B45A 5CA0A 3N2KA 1OAPA 3WGJA 4I50B 2ZAUA 1CK2A 3KIZA 5CB4A 2PMPA 1VQ9F 2YXZA 4BY9D 3JAWB 4YJ3A 3ESJA 2ZVYA 3CCLF 2HRYA 5EIBC 1X7PA 3CCVF 5EAZA 5A2QM 1YJ9F 2Z1TA 3VIUA 3LWVC 3IMPA 1RQ7A 4O2BA 1CN7A 1W5EA 3S0WA 5LOVA 1K73H 1VQVA 3K2XA 1GX1A 5GONA 4C8GA 3WJPA 4EB6B 1VQ6F 2ZVZA 3RYHA 1ZWZA 1RA4A 2YYEA 3C9RA 5ITZA 4R40B 4DRXB 5LA6A 1YJNF 1IV1A 5GAPK 1ODEA 2RHOA 2OTMA 3HKBA 1H7MA 3VOAA 4I50A 3JAKB 4G4WA 5LYJB 2CHTA 2IQQA 2HS0A 2FC3A 2PHNA 1T0KB 2R6R1 3O85A 4G4ZA 5KMGA 2HS4A 1VH8A 3VYSC 3RYCB 3WJRA 3MCAB 2AIZP 3FPIA 2Z1EA 5EZYA 3OW2F 1U3LA 4EI8A 5GIPC 3VYUC 2NMUA 4O4LA 1FFXA 3QHDA 4EB6A 3G6EF 3D00A 1VK3A 4BT7A 2VAWA 3ON1A 2UYNB 2AMTA 5LA6B 4ERHA 4C81A 3NVKE 1TVKA 5IYZA 5GONB 1FSZA 2Q1XA 1W59A 3KHNA 1YIJF 3LWQC 4C4WC 4X1IA 1X25A 3JARA 3G4SF 3CCUF 3HJWC 4DXDA 5DCVA 3VOBA 4TUYA 3VCZA 5JH7B 4ZHQA 1QAHA 1W5FA 2ZOVA 3V7QA 3LMEA 3RYFB 2Z1UA 5JQGA 2RHHA 1PXWA 2F9ZC 3LFOA 5FNVA 4F6RA 1Q81H 1NMUB 2Q1YA 1JJ2F 3E22B 2HP0A 5KX5B 4O2AA 2KTUA 4B62A 3MDOA 3S0YA 1SA0B 4U39A 1JY8A 1UFYA 4EI7A 3HKCB 3TD4A 3WGMA 3SIUA 3Q8HA 5CA0B 4TZZA 3U0OA 1NQ3A 4BT6A 1X52A 3IEWA 5HY1A 3CC2F 2UYPA 3EORA 2RHLA 5CB4B 1VQMF 2V9YA 1IPAA 2VGNA 3B6NA 2QI2A 1XHOA 3CCMF 3S06A 2HP0B 5KX5A 4X1KA 2CSLA 2QEXF 3N2GB 3MCQA 1VQLF 4C8EA 5MN5A 3MQWA 3VI6A 4HNAB 4RQOA 4O2BB 2KGWA 5J2UB 1QVGF 3DDNA 3LWRC 5B8FA 3FBAA 4BVRA 1Z5VA 3CPQA 2CWJA 5BMVB 3JARB 1IV3A 4F6RB 1OFUA 4LNUB 2CHSA 1J7HA 3G71F 5IJ9A 2VAPA 3J7AR 4ZHQB 3I56F 5C8YA 1W40A 4G88A 1W5AA 2P6YA 3CB2A 3HKCA 3RYFA 3WXMB 3NK7A 3N4ZA 3KE1A 3GHZA 2JNBA 4O4JB 1XRGA 1W581 2N48A 1PF5A 2CZWA 4G4XA 3JAKA 5ITZB 1TUBA 3C8LA 3IEQA 2I6DA 3HKDA 1Q8RA 3IR9A 4X1KB 3VYTC 4X20B 4ZHVA 2GVIA 4O4HA 3HTNA 2HVYD 3ZP4A 3F0GA 2BTQB 4ZI7B 3S02A 1S72F 1KD1H 1K9MH 4TV8A 2UZHA 3CCJF 1UI9A 5AVMA 3WGLA 2IG8A 3HWUA 3RYCA 4IHJA 1VQKF 4I4TA 3WJQA 4WBNA 5HXZA 1RLUA 2LBXA 3CXCF 3NVIB 5JVDA 4IIJA 1KC8H 2VGMA 3S0HA 1U3PA 2KG4A 4ZOLB 3WPXA 4I55B 1M90H 3IKEA 5EWRA 2EWCA 4TV9A 3C9SA 3CD6F 3N2KB 1X7OA 5HP8A 5LXTA 3JAMM 3VMFB 2DYYA 2Z1FA 3RE3A 4C82A 3L7QA 2K1SA 1M1KH 4BT5A 3JATB 4M8IA 2VXYA 3TD3A 3JAWA 3HAXD 1VHAA 3OBYA 3JALA 5HP7A 2DT4A 4IIJB 3F0EA 4O4IB 1KNJA 3S03A 5LOVB 2G9IA 1ONIA 5JH7A 3JVHA 2BTOA 3P4EA 2H8CA 3J81M 3IKFA 1DBFA 1SDSA 5LP6C 1YJWF 2RB9A 3FD5A 2FGYA 2H6LA 4TV9B 2LBTA 5HY2A 2UYJA 1GO1A 3ZO8A 3ELCA 5CA1B 3CCEF 3V7EA 3CC4F 3VTIC 3K0TA 4FFBB 2ALEA 1U40A 1DT9A 5JCOA 3J80M 1KQSF 3E22A 4I55A 1SA0A 4G4YA 4I4TB 2B33A 4LCKA 2CVLA 1RQ2A 3HKBB 1E7KA 2IAFA 3LYBA 3RYIA 3I55F 2ZF8A 5IJ0B 1W42A 3R0PA 1Z5WA 3PLAC 3V3TA 1Q86H 4RHAA 1JN1A 3VO8A 1YHQF 5FLXM 4LNUA 5GANK 3JASB 1YI2F 1IV2A 3M84A 5C8YB 5EZYB 5GIOC 4X1YA 2OHWA 1VQ8F 3P10A 3JALB 3HKEB 3NMUC 3TD5A 3CC7F 5EB1B 5CA1A 3CMAF 3RA5A 4O4LB 4YJ3B 1N8RH 2I6RA 1JFFA 1VQ5F 4ZHYB 1W57A 1QU9A 1JD1A 3N4YA 3D01A 5IJ9B 5EIBD 1FNJA 2LCAA 1K8AH 3FD6A 3KJKA 4BT4A 4NWOB 4X3MA 3QUWA 3F6MA 3I3FA 1W3EX 2OZBA 5HY4A 1VQOF 3FFMA 5IJ0A 4U3JB 5EYPA 1TUBB 3LWPC 3M4SA 1U43A 3LWOC 2BO1A 3WPWA 5EO3A 1JFFB 3NK6A 1RLGA 4YJ2B 5LP6A 2CW4A 4BW0B 4O2AB 1IV4A 1SZQA 2AIFA 3T80A
chains in the Genus database with same CATH topology
1NJIH 2KTUA 5G4VC 5HWEA 1VQ7F 3CD6F 4BY9D 4BVSA 1X7OA 3JAMM 3VMFB 4EI7A 3CCLF 1M1KH 4NQ3A 3SIUA 1X7PA 3HAXD 3OBYA 1VQ4F 4TZZA 3CCVF 5A2QM 1YJ9F 3GYQA 1VQPF 3LWVC 1X52A 5HY1A 3CC2F 1VQMF 1CN7A 1IPAA 3J81M 1K73H 2VGNA 3CCQF 2QI2A 3CCMF 1SDSA 1YJWF 2FGYA 1VQ6F 3CMEF 5HY2A 2GLZA 1YITF 3CG6A 1ZWZA 1RA4A 2QEXF 1GO1A 3E1YA 5HY0A 1Q7YH 1VQLF 3CCEF 3V7EA 3VI6A 1YJNF 1GZ0A 3CC4F 5GAPK 1QVGF 3LWRC 2ALEA 5GINC 1DT9A 3J80M 1KQSF 4BVRA 3CPQA 5HXUA 1H7MA 4BVQA 2QA4F 1Q82H 1QVFF 4LCKA 3G71F 2OTLF 3J7AR 3I56F 1E7KA 3I55F 2FC3A 1W40A 1T0KB 1W42A 3O85A 4BVTA 3PLAC 3V3TA 4NUTA 4XCQA 5G4UC 1Q86H 3WXMB 3MCAB 3E20B 3N4ZA 3NK7A 1YHQF 2JNBA 5FLXM 3SIVA 3JCMM 2CZWA 5GANK 4EI9A 1YI2F 3OW2F 3CCRF 1W2BF 2I6DA 4EI8A 5GIPC 2LBWA 5GIOC 3IR9A 3G6EF 2OHWA 1VQ8F 3D00A 3NMUC 2HVYD 3CC7F 3CMAF 3OBWA 3ON1A 3RA5A 1S72F 1KD1H 1N8RH 3NVKE 3CCSF 2WALA 1K9MH 1VQ5F 2KTVA 3N4YA 2OTJF 3CCJF 5IT9M 1VQNF 1K8AH 1YIJF 5FJ4C 3LWQC 4C4WC 1GO0A 1XBIA 4X3MA 3G4SF 3CCUF 3HJWC 1W3EX 3PAFA 2OZBA 1VQKF 5DCVA 5HY4A 1VQOF 5HXZA 3FFMA 3LWPC 2LBXA 3RA6A 3CXCF 3NVIB 1W41A 3LWOC 2BO1A 3AGKA 3V7QA 3CPWF 4X3LA 5EO3A 3NK6A 1KC8H 2VGMA 2KG4A 1RLGA 1M90H 4BW0B 1PXWA 2F9ZC 3LFOA 1Q81H 5EWRA 1NMUB 2AIFA 1CK2A 1JJ2F 1VQ9F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI H;  2KTU A;  5G4V C;  1VQ7 F;  3CD6 F;  4BY9 D;  1X7O A;  3JAM M;  3VMF B;  3CCL F;  1M1K H;  3SIU A;  1X7P A;  3HAX D;  3OBY A;  1VQ4 F;  4TZZ A;  3CCV F;  5A2Q M;  1YJ9 F;  3GYQ A;  1VQP F;  3LWV C;  1X52 A;  3CC2 F;  1VQM F;  1CN7 A;  1IPA A;  3J81 M;  1K73 H;  2VGN A;  3CCQ F;  2QI2 A;  3CCM F;  1SDS A;  1YJW F;  1VQ6 F;  3CME F;  1YIT F;  3CG6 A;  1ZWZ A;  1RA4 A;  2QEX F;  1GO1 A;  3E1Y A;  1Q7Y H;  1VQL F;  3CCE F;  3V7E A;  3VI6 A;  1YJN F;  1GZ0 A;  3CC4 F;  5GAP K;  1QVG F;  3LWR C;  2ALE A;  5GIN C;  1DT9 A;  3J80 M;  1KQS F;  3CPQ A;  1H7M A;  2QA4 F;  1Q82 H;  1QVF F;  4LCK A;  3G71 F;  2OTL F;  3J7A R;  3I56 F;  1E7K A;  3I55 F;  2FC3 A;  1W40 A;  1T0K B;  1W42 A;  3O85 A;  3PLA C;  4NUT A;  5G4U C;  1Q86 H;  3WXM B;  3MCA B;  3E20 B;  3N4Z A;  3NK7 A;  1YHQ F;  2JNB A;  5FLX M;  3SIV A;  3JCM M;  2CZW A;  5GAN K;  1YI2 F;  3OW2 F;  3CCR F;  1W2B F;  2I6D A;  5GIP C;  2LBW A;  5GIO C;  3IR9 A;  3G6E F;  2OHW A;  1VQ8 F;  3NMU C;  2HVY D;  3CC7 F;  3CMA F;  3OBW A;  3ON1 A;  3RA5 A;  1S72 F;  1KD1 H;  1N8R H;  3NVK E;  3CCS F;  2WAL A;  1K9M H;  1VQ5 F;  2KTV A;  3N4Y A;  2OTJ F;  3CCJ F;  5IT9 M;  1VQN F;  1K8A H;  1YIJ F;  5FJ4 C;  3LWQ C;  4C4W C;  1GO0 A;  1XBI A;  4X3M A;  3G4S F;  3CCU F;  3HJW C;  1W3E X;  3PAF A;  2OZB A;  1VQK F;  5DCV A;  1VQO F;  3FFM A;  3LWP C;  2LBX A;  3RA6 A;  3CXC F;  3NVI B;  1W41 A;  3LWO C;  2BO1 A;  3AGK A;  3V7Q A;  3CPW F;  4X3L A;  5EO3 A;  3NK6 A;  1KC8 H;  2VGM A;  2KG4 A;  1RLG A;  1M90 H;  4BW0 B;  1PXW A;  3LFO A;  1Q81 H;  5EWR A;  1NMU B;  2AIF A;  1CK2 A;  1JJ2 F;  1VQ9 F; 
#chains in the Genus database with same CATH topology
 1NJI H;  5G4V C;  5HWE A;  1VQ7 F;  4E6E A;  2GZL A;  5EB0 A;  4BVS A;  1FNK A;  2HRU A;  5FNV B;  4NQ3 A;  4U3J A;  5EYP B;  3LDT A;  1VQ4 F;  3QTY A;  3GYQ A;  2UYK A;  5LYJ A;  4DRX A;  1VQP F;  1YQN A;  4WBN B;  2QTP A;  3DC2 A;  3ZOP A;  4B46 A;  5KMG B;  3CCQ F;  3HKE A;  1W55 A;  2VAM A;  1QD9 A;  5LXT B;  3CME F;  5J2U A;  1COM A;  2GLZ A;  4BT3 A;  1YIT F;  3CG6 A;  3P0Z A;  4HNA A;  3E1Y A;  5HY0 A;  1Q7Y H;  3I7T A;  1GZ0 A;  3OON A;  1T0A A;  4ZHW A;  5GIN C;  4KWE A;  2RHJ A;  3M1X A;  2HP3 A;  2HX0 A;  3UT5 B;  5HXU A;  4BVQ A;  2QA4 F;  3JAT A;  1Q82 H;  1H47 A;  2UYN A;  1QVF F;  3V4D A;  5BMV A;  3K12 A;  1CLI A;  4O4I A;  2OTL F;  2L26 A;  1TVK B;  4FFB A;  1FFX B;  4G4V A;  4BVT A;  5JCO C;  4NUT A;  4XCQ A;  5G4U C;  4O4J A;  5LP6 B;  4YJ2 A;  4X1I B;  3E20 B;  3MBM A;  3CYP B;  3SIV A;  3HKD B;  3K14 A;  3JCM M;  4TUY B;  4EI9 A;  1W5B A;  2BTU A;  3CCR F;  1W2B F;  2HQS C;  2Z01 A;  5MN4 A;  2W8B C;  3RYI B;  5IYZ B;  5JQG B;  3D54 A;  2LBW A;  1YGY A;  4BT2 A;  3F0D A;  3KJJ A;  1H48 A;  3F0F A;  5J2T B;  3C9U A;  3OBW A;  4C8I A;  2R75 1;  3CCS F;  3CYQ A;  2WAL A;  2H8E A;  1R1M A;  3BYQ A;  4X20 A;  3ZP7 A;  4ZI7 A;  2KTV A;  3UT5 A;  1XV2 A;  4O4H B;  2OTJ F;  2ZOD A;  5IT9 M;  1VQN F;  4X1Y B;  3GTZ A;  5FJ4 C;  4TV8 B;  1GO0 A;  4ZK7 A;  1XBI A;  2MQE A;  2HS3 A;  4PWT A;  3PAF A;  1KNK A;  3RYH B;  3C9T A;  3JAS A;  5JVD B;  3ERN A;  4B5C A;  5J2T A;  3RA6 A;  5MN6 A;  1W41 A;  3WGK A;  4ZOL A;  3CPW F;  3AGK A;  4X3L A;  3N2G A;  3WGN A;  4IHJ B;  4B45 A;  5CA0 A;  3N2K A;  1OAP A;  3WGJ A;  4I50 B;  2ZAU A;  1CK2 A;  3KIZ A;  5CB4 A;  2PMP A;  1VQ9 F;  2YXZ A;  4BY9 D;  3JAW B;  4YJ3 A;  3ESJ A;  2ZVY A;  3CCL F;  2HRY A;  5EIB C;  1X7P A;  3CCV F;  5EAZ A;  5A2Q M;  1YJ9 F;  2Z1T A;  3VIU A;  3LWV C;  3IMP A;  1RQ7 A;  4O2B A;  1CN7 A;  1W5E A;  3S0W A;  5LOV A;  1K73 H;  1VQV A;  3K2X A;  1GX1 A;  5GON A;  4C8G A;  3WJP A;  4EB6 B;  1VQ6 F;  2ZVZ A;  3RYH A;  1ZWZ A;  1RA4 A;  2YYE A;  3C9R A;  5ITZ A;  4R40 B;  4DRX B;  5LA6 A;  1YJN F;  1IV1 A;  5GAP K;  1ODE A;  2RHO A;  2OTM A;  3HKB A;  1H7M A;  3VOA A;  4I50 A;  3JAK B;  4G4W A;  5LYJ B;  2CHT A;  2IQQ A;  2HS0 A;  2FC3 A;  2PHN A;  1T0K B;  2R6R 1;  3O85 A;  4G4Z A;  5KMG A;  2HS4 A;  1VH8 A;  3VYS C;  3RYC B;  3WJR A;  3MCA B;  2AIZ P;  3FPI A;  2Z1E A;  5EZY A;  3OW2 F;  1U3L A;  4EI8 A;  5GIP C;  3VYU C;  2NMU A;  4O4L A;  1FFX A;  3QHD A;  4EB6 A;  3G6E F;  3D00 A;  1VK3 A;  4BT7 A;  2VAW A;  3ON1 A;  2UYN B;  2AMT A;  5LA6 B;  4ERH A;  4C81 A;  3NVK E;  1TVK A;  5IYZ A;  5GON B;  1FSZ A;  2Q1X A;  1W59 A;  3KHN A;  1YIJ F;  3LWQ C;  4C4W C;  4X1I A;  1X25 A;  3JAR A;  3G4S F;  3CCU F;  3HJW C;  4DXD A;  5DCV A;  3VOB A;  4TUY A;  3VCZ A;  5JH7 B;  4ZHQ A;  1QAH A;  1W5F A;  2ZOV A;  3V7Q A;  3LME A;  3RYF B;  2Z1U A;  5JQG A;  2RHH A;  1PXW A;  2F9Z C;  3LFO A;  5FNV A;  4F6R A;  1Q81 H;  1NMU B;  2Q1Y A;  1JJ2 F;  3E22 B;  2HP0 A;  5KX5 B;  4O2A A;  2KTU A;  4B62 A;  3MDO A;  3S0Y A;  1SA0 B;  4U39 A;  1JY8 A;  1UFY A;  4EI7 A;  3HKC B;  3TD4 A;  3WGM A;  3SIU A;  3Q8H A;  5CA0 B;  4TZZ A;  3U0O A;  1NQ3 A;  4BT6 A;  1X52 A;  3IEW A;  5HY1 A;  3CC2 F;  2UYP A;  3EOR A;  2RHL A;  5CB4 B;  1VQM F;  2V9Y A;  1IPA A;  2VGN A;  3B6N A;  2QI2 A;  1XHO A;  3CCM F;  3S06 A;  2HP0 B;  5KX5 A;  4X1K A;  2CSL A;  2QEX F;  3N2G B;  3MCQ A;  1VQL F;  4C8E A;  5MN5 A;  3MQW A;  3VI6 A;  4HNA B;  4RQO A;  4O2B B;  2KGW A;  5J2U B;  1QVG F;  3DDN A;  3LWR C;  5B8F A;  3FBA A;  4BVR A;  1Z5V A;  3CPQ A;  2CWJ A;  5BMV B;  3JAR B;  1IV3 A;  4F6R B;  1OFU A;  4LNU B;  2CHS A;  1J7H A;  3G71 F;  5IJ9 A;  2VAP A;  3J7A R;  4ZHQ B;  3I56 F;  5C8Y A;  1W40 A;  4G88 A;  1W5A A;  2P6Y A;  3CB2 A;  3HKC A;  3RYF A;  3WXM B;  3NK7 A;  3N4Z A;  3KE1 A;  3GHZ A;  2JNB A;  4O4J B;  1XRG A;  1W58 1;  2N48 A;  1PF5 A;  2CZW A;  4G4X A;  3JAK A;  5ITZ B;  1TUB A;  3C8L A;  3IEQ A;  2I6D A;  3HKD A;  1Q8R A;  3IR9 A;  4X1K B;  3VYT C;  4X20 B;  4ZHV A;  2GVI A;  4O4H A;  3HTN A;  2HVY D;  3ZP4 A;  3F0G A;  2BTQ B;  4ZI7 B;  3S02 A;  1S72 F;  1KD1 H;  1K9M H;  4TV8 A;  2UZH A;  3CCJ F;  1UI9 A;  5AVM A;  3WGL A;  2IG8 A;  3HWU A;  3RYC A;  4IHJ A;  1VQK F;  4I4T A;  3WJQ A;  4WBN A;  5HXZ A;  1RLU A;  2LBX A;  3CXC F;  3NVI B;  5JVD A;  4IIJ A;  1KC8 H;  2VGM A;  3S0H A;  1U3P A;  2KG4 A;  4ZOL B;  3WPX A;  4I55 B;  1M90 H;  3IKE A;  5EWR A;  2EWC A;  4TV9 A;  3C9S A;  3CD6 F;  3N2K B;  1X7O A;  5HP8 A;  5LXT A;  3JAM M;  3VMF B;  2DYY A;  2Z1F A;  3RE3 A;  4C82 A;  3L7Q A;  2K1S A;  1M1K H;  4BT5 A;  3JAT B;  4M8I A;  2VXY A;  3TD3 A;  3JAW A;  3HAX D;  1VHA A;  3OBY A;  3JAL A;  5HP7 A;  2DT4 A;  4IIJ B;  3F0E A;  4O4I B;  1KNJ A;  3S03 A;  5LOV B;  2G9I A;  1ONI A;  5JH7 A;  3JVH A;  2BTO A;  3P4E A;  2H8C A;  3J81 M;  3IKF A;  1DBF A;  1SDS A;  5LP6 C;  1YJW F;  2RB9 A;  3FD5 A;  2FGY A;  2H6L A;  4TV9 B;  2LBT A;  5HY2 A;  2UYJ A;  1GO1 A;  3ZO8 A;  3ELC A;  5CA1 B;  3CCE F;  3V7E A;  3CC4 F;  3VTI C;  3K0T A;  4FFB B;  2ALE A;  1U40 A;  1DT9 A;  5JCO A;  3J80 M;  1KQS F;  3E22 A;  4I55 A;  1SA0 A;  4G4Y A;  4I4T B;  2B33 A;  4LCK A;  2CVL A;  1RQ2 A;  3HKB B;  1E7K A;  2IAF A;  3LYB A;  3RYI A;  3I55 F;  2ZF8 A;  5IJ0 B;  1W42 A;  3R0P A;  1Z5W A;  3PLA C;  3V3T A;  1Q86 H;  4RHA A;  1JN1 A;  3VO8 A;  1YHQ F;  5FLX M;  4LNU A;  5GAN K;  3JAS B;  1YI2 F;  1IV2 A;  3M84 A;  5C8Y B;  5EZY B;  5GIO C;  4X1Y A;  2OHW A;  1VQ8 F;  3P10 A;  3JAL B;  3HKE B;  3NMU C;  3TD5 A;  3CC7 F;  5EB1 B;  5CA1 A;  3CMA F;  3RA5 A;  4O4L B;  4YJ3 B;  1N8R H;  2I6R A;  1JFF A;  1VQ5 F;  4ZHY B;  1W57 A;  1QU9 A;  1JD1 A;  3N4Y A;  3D01 A;  5IJ9 B;  5EIB D;  1FNJ A;  2LCA A;  1K8A H;  3FD6 A;  3KJK A;  4BT4 A;  4NWO B;  4X3M A;  3QUW A;  3F6M A;  3I3F A;  1W3E X;  2OZB A;  5HY4 A;  1VQO F;  3FFM A;  5IJ0 A;  4U3J B;  5EYP A;  1TUB B;  3LWP C;  3M4S A;  1U43 A;  3LWO C;  2BO1 A;  3WPW A;  5EO3 A;  1JFF B;  3NK6 A;  1RLG A;  4YJ2 B;  5LP6 A;  2CW4 A;  4BW0 B;  4O2A B;  1IV4 A;  1SZQ A;  2AIF A;  3T80 A; 
#chains in the Genus database with same CATH homology
 1NJI H;  2KTU A;  5G4V C;  5HWE A;  1VQ7 F;  3CD6 F;  4BY9 D;  4BVS A;  1X7O A;  3JAM M;  3VMF B;  4EI7 A;  3CCL F;  1M1K H;  4NQ3 A;  3SIU A;  1X7P A;  3HAX D;  3OBY A;  1VQ4 F;  4TZZ A;  3CCV F;  5A2Q M;  1YJ9 F;  3GYQ A;  1VQP F;  3LWV C;  1X52 A;  5HY1 A;  3CC2 F;  1VQM F;  1CN7 A;  1IPA A;  3J81 M;  1K73 H;  2VGN A;  3CCQ F;  2QI2 A;  3CCM F;  1SDS A;  1YJW F;  2FGY A;  1VQ6 F;  3CME F;  5HY2 A;  2GLZ A;  1YIT F;  3CG6 A;  1ZWZ A;  1RA4 A;  2QEX F;  1GO1 A;  3E1Y A;  5HY0 A;  1Q7Y H;  1VQL F;  3CCE F;  3V7E A;  3VI6 A;  1YJN F;  1GZ0 A;  3CC4 F;  5GAP K;  1QVG F;  3LWR C;  2ALE A;  5GIN C;  1DT9 A;  3J80 M;  1KQS F;  4BVR A;  3CPQ A;  5HXU A;  1H7M A;  4BVQ A;  2QA4 F;  1Q82 H;  1QVF F;  4LCK A;  3G71 F;  2OTL F;  3J7A R;  3I56 F;  1E7K A;  3I55 F;  2FC3 A;  1W40 A;  1T0K B;  1W42 A;  3O85 A;  4BVT A;  3PLA C;  3V3T A;  4NUT A;  4XCQ A;  5G4U C;  1Q86 H;  3WXM B;  3MCA B;  3E20 B;  3N4Z A;  3NK7 A;  1YHQ F;  2JNB A;  5FLX M;  3SIV A;  3JCM M;  2CZW A;  5GAN K;  4EI9 A;  1YI2 F;  3OW2 F;  3CCR F;  1W2B F;  2I6D A;  4EI8 A;  5GIP C;  2LBW A;  5GIO C;  3IR9 A;  3G6E F;  2OHW A;  1VQ8 F;  3D00 A;  3NMU C;  2HVY D;  3CC7 F;  3CMA F;  3OBW A;  3ON1 A;  3RA5 A;  1S72 F;  1KD1 H;  1N8R H;  3NVK E;  3CCS F;  2WAL A;  1K9M H;  1VQ5 F;  2KTV A;  3N4Y A;  2OTJ F;  3CCJ F;  5IT9 M;  1VQN F;  1K8A H;  1YIJ F;  5FJ4 C;  3LWQ C;  4C4W C;  1GO0 A;  1XBI A;  4X3M A;  3G4S F;  3CCU F;  3HJW C;  1W3E X;  3PAF A;  2OZB A;  1VQK F;  5DCV A;  5HY4 A;  1VQO F;  5HXZ A;  3FFM A;  3LWP C;  2LBX A;  3RA6 A;  3CXC F;  3NVI B;  1W41 A;  3LWO C;  2BO1 A;  3AGK A;  3V7Q A;  3CPW F;  4X3L A;  5EO3 A;  3NK6 A;  1KC8 H;  2VGM A;  2KG4 A;  1RLG A;  1M90 H;  4BW0 B;  1PXW A;  2F9Z C;  3LFO A;  1Q81 H;  5EWR A;  1NMU B;  2AIF A;  1CK2 A;  1JJ2 F;  1VQ9 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...