3ON5A

Crystal structure of a xanthine dehydrogenase (bh1974) from bacillus halodurans at 2.80 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
336
structure length
336
Chain Sequence
MSDIELLETLAGTDQPRVMATIIHVEGSSYRKEGAMMLFQEDGTQVGLLSGGCLETDLTIKAQKVWQEQLPRTVVYDLSSEDDLSWGQGSGCNGTISVLLEPVDLKLRQHLKRVYDYLCAGKSVFHVKKLSTSGAVLEYAFILDESVYFGEWHSGHPVEWIRKIDENEEPLMFTHIYSPKERLIIFGAGPDVPPLVTFASNVGFYTVVTDWRPNQCEKHFFPDADEIIVDFPADFLRKFLIRPDDFVLIMTHHFQKDQEILHFLLEKELRYIGILGSKERTRRLLQNRKPPDHLYSPVGLSIDAQGPEEIAISIVAQLIQLIRSRKQASSPFSYLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH1974 protein
publication title Crystal structure of a xanthine dehydrogenase (BH1974) from Bacillus halodurans at 2.80 A resolution
rcsb
source organism Bacillus halodurans
molecule tags Oxidoreductase
total genus 88
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02625 XdhC_CoxI XdhC and CoxI family
A PF13478 XdhC_C XdhC Rossmann domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3on5A02
4WEQA 2O3QA 2NU6A 4S3MA 3F6YA 3NT2A 3EMKA 3CSDA 1ZSVA 2BF7A 2EG9A 4D0RA 4Z9YA 1MFZA 3BTOA 4ND5A 4Q3NA 4RORA 3WQRA 4YJDA 4YAIA 5JFOA 2IZ0A 3Q9NA 1DIAA 3W4KA 2Q46A 3RUCA 2YHIB 3KLPX 1JKFA 3V2GA 1EUCA 1D8AA 1ADFA 2Y1EA 2Q49A 1XQ1A 4GH5A 2P4HX 1P0CA 3RASA 5JY6A 1U9JA 1IL0A 5LDHA 4DMMA 4IS2A 4XDYA 4IJUA 2OOSA 4RF3A 3WFIA 4OH1A 5B4TA 1E7YA 2HMTA 3DAGA 1GTMA 1LLDA 4KMSA 5TJ9A 4K9DA 2PH3A 1Q2XA 1QP8A 2W2LA 4MPDA 5TRTA 4DQUA 1DFGA 4TRNA 3TZQA 4EITA 1CERA 3GFGA 1CIVA 3AM5A 4OSPA 3L0DA 4EYEA 2OHXA 2IZ1A 1ZUD1 2C29D 1JAYA 3O26A 1XHLA 4XQGA 3W8DA 4RVHA 1HYHA 5JYDA 3ENNA 1BRMA 1WW8A 1E5LA 1XWFA 4FFOA 4BVAA 4Z6KA 1P3DA 1R15A 4GQAA 2JKVA 1X0XA 3RUEA 4BHTA 3LC2O 3CEAA 3PQEA 1N9GA 3AUSA 5JDCC 1H9AA 1Z6ZA 3ZU5A 5L7TA 2DTDA 3OETA 3PHLA 2EF1A 3FN4A 3QV1A 1HEUA 3QY9A 3VAZA 2BRUA 1I2CA 2PY6A 1MV8A 3HHPA 4NHEA 1LEHA 4HADA 4O6VA 3VOSA 1YOVB 5CDTA 5COAA 3E6AA 5H81A 3NDRA 2XOXA 3VDRA 3OEYA 1GV0A 2VN8A 1B8VA 4CQMA 1PZGA 2I99A 4XYMA 1HE5A 2CZCA 1S6YA 1B26A 2NU9A 3D0OA 2HRZA 4KUGA 1SOVA 1ISHA 2Y1FA 4OYRA 4PRKA 1NVMB 3ZWMA 4Z3DA 1MG0A 3FNFA 5U1PA 2Q2VA 2JFGA 1U2DA 1PS9A 1XR3A 4UEJA 3B20A 2YQ4A 2VTDA 3ZWOA 1P44A 1SB9A 2H9IA 5JY1A 4R9RA 1EUDA 3WGTA 2BI8A 1PGOA 3JQ8B 2I9PA 2O3UA 4XQCA 3WYEA 2B0JA 3ZW8A 4CMAA 4FFPA 1VL6A 5A3JA 2I5PO 4R3NA 3D7LA 4E5YA 1MB4A 3T4EA 3GT0A 4MIEA 3LLSA 4AG3A 1YB1A 4K1LA 1PJBA 3HZZA 4PLWA 3AY7A 4GBJA 3JQGB 4PZCA 1FDWA 3WMXA 4K6FA 1E3JA 2FY8A 4NJOA 2P5YA 3KYDA 1O6ZA 1YBMA 2Q1TA 5DOZA 4P4LA 4TRJA 5JC8A 2B4TO 2HLPA 2B4RO 2NNLD 1E6WA 3ULKA 5ER9A 5JAIA 2WYVA 4YAKA 3NGXA 2HK8A 3R3JA 3H6KA 4D3FA 4CMEC 2RHRA 1Y8QB 2Y66A 1FDUA 4CR7A 2Q2WA 2W2LD 4EZBA 1BWSA 3GVPA 5C5IA 1Y8RA 1VRWA 4YRDA 3A9WA 1LDGA 2FR0A 4TVOA 1LI4A 1PJ4A 3AW9A 4OOFA 2Z95A 3CIFA 3CXRA 5HWSA 2ZKLA 4GVLA 1B7GO 1KY5A 3QHAA 2WYWA 1KIFA 1TVEA 1ISIA 1C1DA 3BHIA 2Y1OA 5KVSA 3DWFA 2Y1CA 5L3ZA 4W9NC 5JCJD 5DT9A 4I08A 4J7XA 2O4UX 1ZK2A 3DDNA 3NX4A 4YJHB 3DAFA 2W90A 4PG5A 1Q0QA 1YKFA 4U0KA 3VVCA 4XRGA 4BKRA 2J3KA 4PG8A 1NQAO 3K92A 1NQOA 1PJCA 3T7EA 3VPSA 4CM9A 4L8VA 2G82A 4DVJA 2NTNA 4YT5A 2Y67A 1SAYA 4OXYA 5G0WA 1SOWA 4E13A 2BFMA 2YY7A 4CQMD 3OQBA 4XJSA 1YJQA 1GUYA 4B7XA 1E77A 1W73A 4WCFB 3QWAA 4WGGA 3L4SO 4ZGWA 3DBHB 3FCOA 3FWZA 2FOIA 2ZB4A 5A9RA 1QLJA 4I5DA 4F6LA 4BV8A 1ZK1A 4D3SA 2W2KA 1DRUA 3NTQA 3MZ0A 4HUJA 3WB9A 3JQ9A 3NTRA 1BDBA 3RUAA 3AOEC 1TXGA 4EBFA 4IQ8A 3K5PA 3VZSA 2DPGA 1LBEA 2HRBA 5C37A 2GF2A 3WWYA 3QVXA 1HTBA 1AN9A 2AQ8A 4Y9DA 4QTZA 2NVWA 2I65A 4JCOA 3ZH2A 4IIUA 2VOEA 2XAAA 1LLQA 4RQUA 1A4IA 2J8ZA 4GX5A 3U4HA 3WX0A 3DZIA 4UULA 4AJLA 2DTXA 2JFFA 3D64A 1IPFA 4JGBA 1U28A 3ANMA 3HQ4O 4MKZA 4OOEA 5I9LA 1E3WB 3MCVA 4UEOA 3UFXA 3PQDA 1HZZA 4D43A 3LVFO 2PV7A 1YQDA 1UP4A 4HFRA 4C4OA 5KJEA 4DBZA 5G0SA 1XLTA 2Y0EA 4CMHA 1PJ2A 2NSDA 3IUPA 4FCCA 3HG7A 1NWCA 3GNSA 3QRWA 1LLUA 3K30A 4J4TA 4XQ9A 3ST7A 4J1SA 4PLYA 2O23A 2HJSA 1IY8A 3DBRB 4KOAA 3JTMA 4YT2A 2CMDA 4II2A 3IS3A 3NKLA 2CNBA 2D5AA 5CP8A 3E9QA 1WDLA 4B7CA 5G2OA 2J3JA 4J16A 4XX0A 3TFQA 4NK5A 1LC0A 4PGFA 1PR3A 1JTVA 4CM8A 2CF5A 4INAA 1SC6A 5DBGA 2OBYA 4CM9D 2GGSA 2RBEA 1P1HA 1WDMA 1ZSYA 4AJEA 1MP0A 3GZNA 3CINA 2YQ5A 2R2GA 3I4FA 2CF6A 3JQAA 4FGSA 4PG4A 3PI7A 4W7HA 3VTZA 5L51A 1I3NA 2EP5A 3A14A 2B83A 3KO8A 2C07A 3MWDB 3OMLA 3IUSA 1NHWA 3UXYA 3DC2A 5AVOA 3FNHA 4XKJA 2YYYA 4HY3A 4YDRA 1D3AA 4LN1A 4AICA 4TSKA 3ZV3A 3TL3A 4J0EA 1RM4A 4BKPA 3TDKA 2NQTA 4RLHA 2DFVA 4GKBA 3SJ7A 4LRTB 3PDUA 1SPXA 1SZJG 2GZ3A 4J4BA 5ENVA 4AJKA 1E3EA 4RDIA 1UXIA 3KEQA 3QA9A 4ZU3A 3S8MA 1I24A 3ZW9A 4IUYA 2YHUA 2YV3A 1HKUA 4KUEA 5IDQA 3O9ZA 1KY4A 3E18A 4AFNA 1QYVA 3UCEA 1T26A 4PCVA 3R6DA 2BKAA 1LC3A 2DUWA 3VZQA 1JQBA 4KTTE 5FYDA 2ZYGA 1K6JA 2C2YA 3BTVA 2PK3A 4F6CA 4W82A 5I7SA 3G1UA 1JW9B 2EEZA 2NTVA 1L7DA 4DREA 5A5EA 3L4BA 3KUXA 2ZB7A 5TGDA 1T4BA 2JHGA 3PVZA 1C3VA 1OC4A 4BNVA 3R3SA 4L9RA 1YDWA 4FR5A 4OSOA 4NI5A 2C7GA 4M54A 3WG9A 4JBHA 7ADHA 2TMDA 4JJGA 5L45A 2V7PA 4L75A 3D5QA 5KKAA 3ETEA 4L4RA 1TLTA 1EK5A 3PP8A 5BR7A 2PWZA 3UVEA 5GZ6A 1ADGA 3AUTA 2AEFA 1ONNA 2UDPA 3OSUA 1I30A 3VZRA 1IULA 2D4AA 4FW8A 4H3VA 1LXCA 2X0NA 4WKGA 1PU2A 1U3TA 1OZAA 4AJIA 3F4LA 4CL3A 2VYNA 3JD2A 2D5CA 1DHTA 4WASA 5ES3A 4DLLA 3EDMA 1ZVMA 1JDJA 1PQWA 3IP1A 4OAQA 1X15A 4PLTA 2ZCUA 5TS3A 3JQAD 5T67A 1E1KA 1MFPA 4QXMA 5B4UA 3ROQA 1SMKA 4BQRA 1Z74A 1YGYA 4PLHA 2FWMX 5FI3A 2HMWA 4CLRA 5GMOA 3DOJA 5CHEA 1DB3A 2YJZA 3JSAA 2X0RA 1ISGA 1IYZA 3Q2IA 4E5PA 3A06A 3QW2A 1EVJA 1TB4A 4UVGA 1IE3A 1QYCA 4YCAA 1CQIA 1ZSNA 2PKQP 5CG2A 1EQ2A 3GNTA 8LDHA 4P8RA 2VUUA 5CPFA 3RIHA 1R4NA 5EINA 4D0SA 2FRDA 1DIBA 1LLCA 4UREA 4ZD6A 3L9WA 2PNFA 4L73A 4AJPA 2DVMA 3WICA 4RZHA 1VJTA 1AXGA 5JMPA 3LU1A 2VTEA 1U3WA 3RFTA 1IOLA 4PZDA 1NX6A 3OEWA 4NG5A 4ND4A 2OGUA 3I9OA 3NRCA 4FFNA 2A92A 4QEDA 1WNTA 3UCXA 3LF2A 1PS8A 1IB6A 1R6DA 4Q3BA 3OHSX 4KWHA 3RVDA 3WQQA 2O3TA 5KKCA 4NU6A 3HADA 1DC6A 1Z7BA 1R66A 4U6SA 1WVGA 3G0OA 3LT1A 3PIDA 3IIEA 1P0FA 3UHAA 5KTKA 1R4MA 1KOLA 4U6QA 4J49A 3ZZNA 1DFIA 1PTJA 3RUDA 1N7HA 2X86A 2CD9A 5IXSA 2XXBA 1QV6A 1NP3A 4G65A 4WOKA 4ZQGA 1LUAA 5AXAA 3TNLA 4ZN6A 3KRTA 1NAHA 2DBVO 1HT0A 2YFHA 3QLJA 4FOOA 2J5KA 4NMHA 5CAEA 1NPTO 4GMGA 1X7GA 4BV9A 2ZCVA 2WD8A 1X0VA 4OKIA 4G5HA 5HTOA 3H9JA 1V9LA 3DBLA 2OUIA 4LCEA 4AJJA 3R0IA 2VYND 2BHLA 1LQUA 3ON5A 3D3WB 4ONEA 3PRJA 3F47A 1RM0A 3G1TA 3LC1O 3VVBA 3ZU4A 3I9NA 4OKNA 4XYGA 2GN6A 4HFMA 4RV9A 4DIOA 1W8DA 2GYYA 4CQLA 4RPJA 1T2FA 2IXAA 1EZ4A 5I8ZA 3U62A 4BO1A 2Y68A 1C0IA 4M55A 4NBRA 4YRAA 4GMFA 5F1PA 5AYVA 4Z0TA 4FC7A 5A05A 3TZ6A 4XB1A 1PJSA 1SEVA 4UVEA 1DBVO 1E3IA 3ZN2A 1YL7A 1CDOA 4BNZA 3WGIA 2PZJA 2C2XA 3JQ9C 4MINA 1ZEJA 1XDWA 2O3RA 4RF5A 4P4GA 3OA2A 4CODB 1YH3A 1I0ZA 3MJ4A 5A03A 3S1LA 1E7MA 1VKNA 2OBNA 2EKLA 3NUGA 2B35A 3DOCA 3OJFA 4DBVO 3DEYX 3PZBA 5EL0A 3PTZA 5HM8A 3ZHZA 1F8FA 3BMNB 3ADOA 1PZFA 1K6XA 4UUPA 3H2ZA 3ZWPA 2ZJ1A 4O63O 2H63A 4D46A 4PLFA 1SBYA 4F46A 3IP3A 1HSOA 5FF9A 3K73O 4NFSA 4DPLA 5MDHA 1RM5A 1PQPA 2VRCD 3GK3A 1FDTA 1GYRA 2PZLA 3GDOA 3RBXA 3K2BA 4R41A 5I7EA 1LDBA 3R1IA 2PR2A 4I5EA 1EDZA 1E1MA 5A04A 2ZIZA 1DRVA 4XQEA 2GERA 3H5AA 4IZHA 1YJ8A 1JKJA 4PVCA 2BD0A 4YJFA 2AG5A 3GC6A 3GZ4A 3V1UA 3ZI0A 2DLDA 3Q9UA 1UH5A 1HDRA 3I52A 3JQBA 3UKOA 3ZV5A 3GPIA 5JLAA 4URFA 1Z7EA 4ND1A 1CYDA 4RVGA 2D3TA 2E48A 4IDAA 3TZCA 5KNLA 3HDQA 4HNHA 4TZTA 9LDTA 3ZNQA 3F1LA 3OF2A 2NV6A 5THKA 4CM3A 2HK7A 3I9LA 5AXBA 2GRAA 4D42A 1B0AA 4OL9A 1JLLA 3WDSA 4RVFA 1M76A 1WP4A 2NU8A 4I9UA 2NVBA 1IHYA 4FDAA 4LMPA 3WFJA 1BXGB 1ENZA 4JQCA 1BTOA 1J49A 1PJTA 2QYSA 3HFGA 4YAGA 1DC5A 2Q99A 4CMCA 1LRLA 3PDJA 2BI7A 3U09A 3HWRA 2GDZA 1SNYA 1KS9A 2C5AA 3BXXA 5I7VA 4E2XA 6ADHA 5FEUA 5GZ1A 2BFOA 1OAAA 3BZUA 4IQ0A 4ROSA 1VC2A 3BMQA 3JQCA 2AE2A 1U3VA 4G81A 3SJUA 4BO5A 4FQ8A 3DMTA 3BMCB 4EUEA 2D8AA 2HU2A 2RHCA 2Q3EA 4DQVA 3ZWNA 2DBQA 4GL4A 3GR6A 4BNKA 3MJCA 3OIFA 4CMIB 2CSUA 3LLVA 1RJWA 1PSDA 4HP8A 3ZV6A 4F45A 3ZWCA 3QIVA 1JU9A 5AQ1A 1UXGA 3DMYA 3H9UA 2V6FA 3QSGA 4Y6RA 1TA4A 1PS0A 1UDAA 3MJTA 4WLFA 3FHLA 3GDGA 4BNXA 2VRBA 2I3GA 2EXXA 3K8ZA 3VH3A 3E82A 1QR6A 3GH3A 2VHWA 4P38A 5EIOA 1E7QA 4NJMB 2IXBA 1BXZA 1UXKA 1LX6A 3L4BC 2XXJA 5F1KA 2H1SA 3INRA 3WMWA 4UUNA 4CLOB 3PHGA 2PA3A 3AK4A 3F5SA 4J9VA 1PJQA 3RFXA 4BO8A 4FS3A 5JO9A 5T6BA 4YT8A 5BNTA 5HBRA 4QQRA 1B3RA 3GVIA 1X13A 4DA9A 1U4OA 2D59A 4R1UA 3TOZA 2VUTA 3C1AA 1N2SA 3ZNOA 4A2CA 1LDYA 3MOIA 4RPLA 4WOJA 4Q3AA 4IBOA 1GZ3A 3GUYA 4K6CA 1PGPA 2HO5A 1TT7A 3C1TA 4AJNA 2PLAA 5A9SB 5L7WA 1B3BA 1KVSA 3IC5A 3OM9A 4IM7A 5EMHA 1BG6A 1KETA 5U4QA 4ZVVA 1O95A 1NVTA 3OQ1A 2BGMA 3PHIA 1EFKA 3HDYA 5IN4A 4R69A 3VPHA 2RIRA 3KSDO 1GYPA 1ZXBA 1DAOA 2CDBA 1GFSA 2DAPA 3GEGA 2H5LA 5ITVA 4CM6A 3H9GA 2WSBA 3KYCB 1ZK0A 3Q1LA 1DIRA 4ZRNA 2RAFA 2F1KA 2VCYA 3GMSA 5KCZA 1AUPA 2O2SA 1PEDA 3W4JA 4DIFA 1E7RA 3CUKA 1XKQA 5JCJA 1MA0A 1N92A 4Q9NA 2I66A 4A26A 4OXKA 4TKMA 5IFLA 1KERA 2X23A 3PLRA 3RU9A 4D7AA 3C24A 4YAEA 3DZJA 5IDYA 3IKTA 3UF0A 4XR9A 4MVJP 2PFGA 4Q39A 2Z1NA 2NVUB 4Z0PA 4EUFA 3U3XA 1EK6A 2WD7B 1KVRA 4YA6A 5T57A 2C0CA 2OO5A 2AW5A 4E3ZA 3SLGA 3ONFA 5BNIA 3H2SA 3ZWBA 4WEOA 4GVXA 1TT5B 2V6GA 2YHIA 3HSKA 1Y1PA 1C14A 2Y93A 2FR8A 1QLHA 4E33A 4MVJI 5F3RA 3ZHXA 3LSYA 2QYTA 1KEVA 4QECA 1P1IA 2JD0A 4TRMA 1M6WA 5JPIA 1GD1O 3GMDA 1H6AA 1GDHA 1NR7A 1H2HA 1ARZA 4NDNE 3C8MA 1NBOA 1UXJA 3HE3A 3LK7A 3RUFA 1KEPA 3E03A 1G1AA 4A27A 2Q50A 3H3JA 4LGVA 3HN2A 3I5MA 1YQGA 4XIYA 3RUIA 1CRWG 2HDHA 2IEBA 4R1NA 4BIIA 1DPGA 4HX5A 2HK9A 1T2CA 1ZJYA 4MVJG 3GNQA 4N5LA 3P7MA 5FWNA 4ZQHA 5TX7A 4F3YA 5U9CA 3RC2A 3GA0A 5F5NA 3IAHA 1GEGA 2O3JA 1U5AA 2E49A 2GZ2A 2ZQZA 3C7DB 3E1KA 4YPOA 2CDCA 3IJRA 1JAXA 1VSVA 2QQ5A 3FR7A 4XWYA 2VNAA 5IJZA 1GQ2A 5IAAA 3GG2A 4R9SA 1YOVA 4XGNA 5DULA 4ZJUA 1DIGA 2FSVA 2X9GA 1EVIA 4O5OA 5T64A 3FBGA 4XIJA 4YRBA 2NQ8A 1GY8A 1TT5A 2UUOA 3GGPA 3PJDA 4YBZA 4BO4A 4WNCA 1DAPA 5EN4A 1GADO 2NADA 4WUVA 1XSEA 4W7IA 3LT2A 1ISFA 4GX2A 1A71A 2AHRA 1HRDA 3OFSA 4E2WA 2G5CA 1MUUA 1V35A 5CFZA 5IZCC 3TF5A 4M89A 3FWNA 3GVCA 2EP7A 4OJNA 1FJHA 3DOOA 5JXWA 1JVBA 3KBOA 1E0DA 1RM3A 2QZZA 2B5VA 3ZGYA 3Q2KA 5A1TA 2XF8A 3JQ8A 1WZEA 1Z45A 2WYUA 1LSSA 4XD2A 3TN7A 2LDXA 3STHA 5TQVA 5BSGA 1V3UA 3BHJA 3EVTA 2AG8A 3JQGA 1ZFNA 3FRJA 4ZA2A 5AXCA 1M67A 4BUCA 3RD5A 3CH6A 3EK2A 4X54A 3WNQA 2G1UA 3QWBA 3DBVO 3LC7O 1WXDA 2Q1WA 4J43A 5B4VA 3FI9A 4FBGA 4HBGA 4RO0A 4M1QA 4GI2A 4L0QA 4RVSA 2B36A 1Y8QA 4BB5A 1P1RA 1HWYA 1DXYA 4NFHA 3ZU3A 1LSOA 4HKTA 1PR9A 2EJWA 4GX0A 3ZHYA 4R16A 3D4PA 4E2ZA 1DLJA 1H2BA 2GUGA 3RBZA 4NZ9A 4DXHA 3CKYA 4KQXA 3GDFA 3PK0A 4RVDA 1DRWA 2FR1A 1HDZA 3VZPA 4E32A 2NU7A 3GG9A 2J5RA 2VNSA 3UUWA 3CPSA 3PQFA 4HXYA 4CMKA 5KJ6A 4FJ2A 1C0KA 4YJHA 4B4OA 5B12A 1ZJZA 3KVOA 4ESOA 5KVCA 3ROKA 1DJQA 1CETA 2C20A 3RWBA 4O59O 5JW6A 1IZ9A 4BO7A 5CPBA 2NACA 1O0SA 4ID9A 4WECA 1UR5A 3IMFA 4WLOA 2FZEA 5DBIA 4ALNA 2DUUA 4MVJA 1J5PA 3C7AA 2PZKA 4IDCA 4Z3KA 4HFJA 4ALLA 2C59A 4E12A 1D7OA 2FPGA 4YR9A 4KQWA 4YXFA 2DC1A 3RC9A 4I9NA 1RYEA 2O48X 1B16A 1I32A 4WCFA 3C85A 4KP7A 4WCDA 3DBHA 4CMGA 5K6AA 2PD4A 4NNJA 4ZQFA 4A5OA 1BVUA 3M6IA 3PHJA 4OHUA 2HJRA 4YB8A 2HMVA 2GCGA 4E5MA 3HDJA 1PIWA 3GN1A 5KJCA 1LU9A 1F06A 4NBVA 4IDGA 3DMTC 1BSVA 3HB5X 4MKRA 4YT4A 3DFUA 2YV1A 3OA0A 4JJIA 4BNMA 5A5FA 1BW9B 1LJ8A 3DZKA 3OJ0A 3VKUA 2B37A 1I3KA 3AI3A 3GF4A 4H16A 5AOVA 1V6AA 5ITWA 3S2FA 4NH4A 3DO5A 5G4KB 3A4VA 2VHXA 1H9BA 1PWXA 4ND3A 5H82A 2HUNA 4TKLA 5IF3A 3WBFA 3BHMA 4WLUA 3RROA 1IZ0A 1E3WA 4IXWA 3PJGA 5LCXA 1DSSG 3NYWA 2JCYA 1D1SA 4WK6A 4YACA 2Y99A 5T5QA 1GV1A 3UOGA 5BSHA 3H4VA 3DTYA 4FOSA 1V8BA 3WLEA 3JD3A 1RYDA 2HCTA 2JJYA 3TPCA 4TRRA 3WYBA 1GU7A 1I3MA 4EW6A 3VKVA 1H94A 2DKNA 3FD8A 2VZ8A 4RZIA 5LDGA 3DBRA 3SVTA 2PD3A 3EAGA 1Z73A 2DPHA 4OQYA 4BMSA 4IZIA 2Y0DA 2DBRA 2QIOA 2EGHA 3DTTA 3MJVA 1JA9A 1YBVA 4B4WA 2PH5A 3FNEA 3AOGA 3PPIA 3FBTA 2X5OA 3JCZA 2YDXA 4ZICA 4BO2A 3JQDA 1EE9A 2FP4A 3GRKA 1VE9A 3I9JA 4MVJD 3X2EA 3IKVA 3OP4A 1K5HA 3PJEA 3UGKA 4LMRA 2Y0CA 3ROPA 3C7CB 4J2OA 4LVUA 3EC7A 4LVCA 4E5NA 1GEEA 5BSEA 1M2WA 1G0OA 1LSJA 4OM8A 4NIMA 1I2BA 3KHUA 4B3IA 1U8XX 3FTPA 1N8KA 1JWBB 2VYVA 4M86A 1LDMA 4MDHA 2X9NA 1H0KA 2ILTA 3AY6A 3PEFA 4PLZA 4WJZA 3W1VA 1ZMOA 4BNUA 1J4AA 1HDXA 1DEHA 1HZJA 1Q7GA 1VSUA 3G17A 3JYOA 1E1NA 3K96A 4PG7A 1NR1A 4XRRA 5ILGA 4A03A 4FN4A 1Q7BA 3BIOA 3JQ6A 3PIIA 1QG6A 2VOJA 1SO8A 5DOVA 1ZKMA 2OORA 4CL8A 4J90A 3OIGA 1P31A 1KEWA 7MDHA 3L9XA 1DIHA 3ENKA 5TLSA 4EJ6A 3G79A 3BMOB 3E5RA 2NWQA 4RDHA 1WAMA 1Y9EA 4MVJH 4NBTA 1FMCA 5KJFA 1ZCJA 3ETGA 5I7FA 4ZQBA 4B4VA 2YV2A 1U5CA 3V5NA 2P9CA 1L1FA 3W8EA 3B1JA 3WNVA 1VLLA 1HYGA 1W0CA 1PJ3A 2OP1A 4CM7A 1WWKA 3V2UA 5JSFA 3S55A 1KBZA 4IS3A 4KWIA 4NR0A 3ZNPA 5C7LO 3ICCA 5CDYA 5L4NA 3OJLA 4IMPA 1HF3A 3VPXA 1A9ZA 1MC4A 1DDOA 2CVQA 5T8KA 1PWZA 4BNYA 4DLAA 4QFDA 1UDCA 1T1RA 3RBVA 1GYQA 1U7TA 2UVDA 2HMUA 3VPGA 3DR3A 5ADHA 3M1LA 2VRCA 1H6DA 1YRLA 3ASVA 3KXDA 4JP2A 3WSVA 2Q4BA 4U0JA 3LYLA 1I10A 4JNKA 2Q1UA 1Z75A 1UZMA 3U4CA 5DDIP 2VWQA 2IEDA 3NAQA 2PKQO 1YB5A 4XGIA 2ZTVA 2QX7A 1ISMA 2GZ1A 1MX3A 3MTGA 4NQZA 3P2YA 5JBIA 5G0TA 5IG2A 2UUPA 2DM6A 4O1MA 3WTCA 2GR9A 1OC2A 4GSLA 1KC1A 4XEHA 4XZ3A 2B4QA 2SCUA 1QYXA 4IDDA 3V1TC 4YJGB 3NEPX 3GFBA 3ZWYA 4CPDA 5I8WA 5C7IO 1NASA 3I9MA 4NU5A 2QZ9A 1VKOA 3FPLA 4KDEA 3AWDA 1HYEA 3PYXA 5C3MA 4Y98A 3HUDA 2ZTLA 5EQDA 1LRKA 4TROA 3RKUA 4E4YA 1XQ6A 5DCYA 2DFDA 5JE8A 1C0LA 1J0XO 2VYVD 2X1HA 4CM4B 1JN0A 3CE6A 3FSRA 3KSUA 1XU7A 2O2YA 2X22A 3AU8A 1QORA 3WGGA 1HDGO 4H7PA 2IYPA 3LZ6A 3PYMA 2VQ3A 1LTHR 4BKQA 3F1KA 3RJ9A 4I9HA 1CJCA 5ER6A 2E6UX 3S2EA 3L6DA 4DPMA 4TWRA 3O4RA 1UP7A 4GKVA 4R54A 3WTBA 3KYBA 4U8GA 1CQJA 4A73A 3BYZA 4WPGA 1B15A 4J6FA 4NPCA 3NT5A 2Q45A 4EJMA 5KJ1A 1FXSA 4B79A 3LT0A 3TSCA 1DC4A 2I6TA 4BGEA 3PZRA 4IPTA 4N7RA 3GEDA 1ULSA 4DQXA 3OBBA 3DHYA 4FJ0A 2JHFA 1GCOA 3KSZO 1T2AA 5GZ3A 1C1XB 5G4LA 3IL2A 4RCVA 2AQKA 2O50A 2R00A 3SEFA 2RH8A 1AE1A 1T4DA 3OJEA 4J7CA 3NJ8A 3EZYA 5JAZA 3N7UA 1ZNQO 1E7SA 1KVQA 4IGFA 1NNUA 2X0IA 3L07A 3TWOA 3TZKA 4AJ2A 5B1YA 1EBUA 3IJPA 1UZNA 3PWZA 3SBOA 3AM3A 4E31A 1TEHA 1NYTA 3PWSA 1ONOA 4W99A 1SCUA 4WE3A 5TF4A 4AJOA 4R51A 1HETA 3IQDB 5EQFA 5ICMA 1VJ1A 1X1EA 1YXMA 3JD1A 4IIVA 3DZGA 2AEJA 1DFHA 4IDBA 3UICA 3WGYA 4R1SA 3FR8A 4II3A 3QWFA 3ORFA 3EYWA 4MP8A 2QRKA 5FFFA 3D3WA 5TT0A 3QQPA 3WGOA 3E9MA 2RH4A 3K9QO 3VH1A 2J3HA 5TSDA 2QW8A 5DN9A 4Z9XA 3JYNA 4D79A 3QWHA 3E5MA 4WCFC 1NWHA 4DYDA 1WMAA 1Y5RA 3WGHA 1JVSA 4C7JA 4CMBA 1KVTA 4KTVE 3DZFA 4PLCA 1T24A 4LSWA 3UW3A 2X0JA 1ADBA 3D5TA 1DOHA 4JROA 1N7GA 3JD0A 3PFFA 3ABIA 1Y7TA 1ZW1A 1P9LA 1GPJA 3VPFA 1ZXLA 3Q3CA 4BB6A 5L40A 3EW7A 4R1TA 2DBZA 1EBFA 1R37A 3JQ7B 1V0JA 4FC6A 5L4SA 1N1GA 4CV0A 2G76A 4NFYA 4BQPA 4IJWA 3VC7A 4Y6PA 1NFQA 4RJTA 3ASUA 1L7EA 4I8XA 4J4HA 1ENOA 4UVHA 4Q3CA 1LDEA 3M1AA 3BMNA 4BNTA 2DTEA 1WDKA 4GLOA 4BO0A 1LQTA 5HS6A 1S7CA 1QSGA 5K0ZA 2FZWA 4FIZA 4E2YA 1NHGA 4EDFA 1BGVA 1VL0A 3UCFA 1YBAA 3INTA 3I6IA 1GZ4A 2HAEA 4B3JA 1R0KA 2I3AA 2HKIA 1UDBA 4DL9A 2JD1A 2B69A 3C3XA 2IZZA 2CFCA 1O94A 3KTDA 4FFMA 1E3LA 1YB4A 2P5UA 4QSMA 4C7KA 4DMLA 4PLVA 4YYZA 4M87A 4D45A 1ZIDA 4UUOA 1AHIA 1H6BA 1UZLA 2X6TA 4CV1A 5C7OO 2BGLA 3D4NA 3W6UA 2X8LA 3DQPA 2UYYA 4M8SA 3VDQA 2GN4A 1EFLA 1PL7A 1Y81A 5MGBA 2J5QA 3OJOA 2WWRA 2IYOA 1GZ6A 4OQZA 3GY0A 1ID1A 3FF4A 5A06A 1RKXA 4RGBA 4EEZA 4HV4A 1N9GB 2AA3A 4E6PA 4BO6A 2ZTMA 5JAMA 3EUWA 1BXGA 1XU9A 3PLNA 1M6HA 5A02A 3SXPA 3ZWVA 3QVWA 2UV8A 2C5EA 2ZATA 1RWBA 2VWPA 3H65A 2ZYAA 3NV9A 4BGUA 2VHVA 3GQVA 3ONDA 5HRUA 1HLDA 3BAZA 1A7KA 3S2GA 1G0NA 1ZK3A 1C0PA 4CQMB 4CJXA 3WS7A 5CDSA 3E8XA 2EIHA 4MP3A 1NPYA 1ORRA 3AU9A 3RKRA 5KOIA 1R12A 2E82A 2TMGA 1H6CA 3BMCA 4A7PA 2ET6A 1K89A 3ETDA 4ALKA 3ANLA 3JD4A 4MIYA 5TNXA 3KEOA 4CMIA 1EQUA 3LT4A 4RF2A 3JYPA 2IDZA 3U9LA 1E1LA 2LDBA 4GWGA 1YS4A 3NJ4A 3U0BA 4PLPA 3PXXA 1DJNA 4PRLA 3ZCXA 5COQA 4E5KA 4GLLA 2B5WA 1A7AA 4NJMA 1CEQA 2BELA 2Y1DA 4J1TA 3T4XA 4IQGA 2ZJ0A 4BNFA 3GGOA 4CLOA 4BNGA 2NTJA 3VH4A 1O8CA 3KM0A 4XDZA 2X9VA 3KYDB 1P1FA 3Q6IA 3QVSA 4M49A 1BXKA 4TQGA 4BNIA 4EI2A 4B7UA 3AI2A 3P2OA 5DP1A 5T8KC 2DU8A 2WEKA 4KUHA 1PZHA 3ADPA 4UEKA 3O03A 4PLGA 3SLKA 5A9SA 1Y8RB 2R6JA 3G3EA 1A72A 4BOYA 2E4AA 4DWVA 2P9GA 2UAGA 1F8GA 5TIIA 1N1EA 3M2TA 1CF2O 1EEHA 2V65A 5A4DA 4BO3A 1I2ZA 1C1DB 4RVUA 4XYEA 1YQXA 4DC1A 2C82A 3BTSA 5FI5A 1V3VA 5KWEA 4OXNA 2WTBA 4IINA 3TZHA 3KYCA 5EESA 5EPOA 4MOWA 1KC3A 1Q0LA 3H7AA 5LC1A 2IODA 5TJHA 4EGFA 5CDGA 3GHYA 2CVZA 1ENPA 3ZWAA 1LDNA 5JAQA 2PZMA 3QVTA 1QYDA 4AJ1A 1ZBQA 1NFFA 2AQIA 1PZEA 3ANNA 5IDXA 5BQFA 2JFHA 1OOEA 3M2PA 3U5TA 4G2NA 2IRWA 1SB8A 3K2EA 1NM5A 1XIVA 2NVUA 1Y5MA 3PJFA 1X1TA 1QMGA 1E6UA 2WD7A 4CV3A 4TZKA 1GL3A 3RFVA 1UUFA 3COSA 4IGEA 4YWJA 1YO6A 1LNQA 2JAPA 2W8ZA 1P1JA 1NQ5A 2W2KB 3HJAA 2CVOA 4PIVA 1YVEI 1G6KA 4OMUA 4Q3EA 1Y9AA 5A3VA 4AL4A 2W4QA 2X7HA 1T2EA 3JYQA 1GUZA 1AXEA 3MWEB 5DZSA 4AJ4A 4PZEA 3RI3A 2V6MA 1PGJA 4MIOA 1PL8A 1VPDA 1VJ0A 1A5ZA 2GO1A 1Q0HA 3L6OO 2EERA 2J6IA 4FPXA 2XPCA 2V6BA 2ZYDA 1BDMA 4J2HA 2I76A 4R01A 4WNIA 1K0UA 4XR4A 2OFPA 3QP9A 2ZTUA 1R0SA 1R0LA 1U8FO 3CZMA 1ADCA 3RAJA 2FPIA 4MJLA 3WOHA 4N5NA 3WWZA 2R00C 2GLXA 4WLVA 1YE3A 4IMRA 2BMAA 4IY1A 3WBBA 5BT9A 2EHDA 2PGJA 2WMDA 4JP3A 4DTIA 3GHHA 3TL2A 1HE3A 1QRRA 3CZRA 3JV7A 5JO0A 1R16A 4ZQEA 1EUZA 2D0IA 3CMCO 4MVJE 4UVDA 3JQFA 1HDYA 3B1KA 3VH2A 5JC1A 5L95A 3GUCA 2QRJA 3DB2A 3WLFA 4LISA 5IXYA 4DRYA 5CG1A 1MG5A 2EW8A 1P77A 3LDHA 3ZDFA 4FB5A 2X5KO 4QT0A 1YL6A 4D41A 3F46A 4E0BA 3L77A 4K26A 4J3FA 3GN2A 3JQBC 2JCXA 3O8QB 1Q1NA 3WJ7A 2VZ0A 3I1JA 5L7YA 1WPQA 2GN9A 4CM8B 1DHRA 3GEMA 4MO2A 4EUHA 4BNJA 4XGKA 3AUUA 4H15A 3F3SA 2P68A 3UH1A 1EE2A 3A1NA 2Y05A 3GZNB 4P4NA 4XB2A 3N58A 3ZHBA 4BNWA 2GSDA 3JQAB 4D3DA 1A27A 4UVIA 3RQSA 5CDUA 2GASA 5DCWA 2EW2A 3DFZA 2O3SA 5EJ2A 3GVHA 1U2GA 3WJAA 2BGKA 5CEJA 4N5MA 3RC1A 3GRPA 3ONEA 3HB4X 4Z9FA 1OI7A 3WIDA 2EWMA 4QX6A 3WGZA 1KEUA 5JCXA 1QKIA 2FMUA 3SX2A 4GSKA 1YONA 1GPDG 1E7WA 1X7HA 5DBFA 4ZHSA 1T1SA 3H3FA 3D1LA 1D1TA 1HE4A 1DC3A 5HS4A 1TI7A 5AXDA 3PWKA 1HL3A 1NAIA 3ZV4A 3DONA 4FJ1A 3U4IA 3FTNA 2HMSA 1NPDA 3I23A 4JBGA 4L4SA 4BMVA 3X2FA 1XELA 3H5NA 2NLOA 4IDFA 4OIMA 2YFQA 4U7WA 3K6JA 2ZQYA 1HE2A 3N74A 2DQ4A 3RJ5A 3BTUA 1B8UA 3D4OA 2JD2A 2X4GA 4RQTA 3PGJA 2W98A 2P2SA 3ITKA 1B8PA 3O8QA 1X7DA 3DZBA 4JIGA 1Q7CA 2YUTA 2D1YA 1F17A 1UP6A 1FF9A 1PL6A 4BO9A 3F5QA 2PTGA 4UAGA 3AFNA 2EKPA 3NT4A 1SEPA 2AE1A 1I3LA 4RPGA 1UAYA 5IN5A 3QE3A 1O9BA 3WSWA 4FFRA 4Y8VA 3JYLA 1M75A 4YEDA 1OMOA 1GAEO 2VWGA 2Z5LA 4LCJA 4A10A 3KV3O 5F5LA 3H9EO 3ITDA 3C1OA 3MJSA 1XEAA 1QYWA 4J7UA 1N5DA 3P19A 3W6ZA 4ND2A 3LQFA 5COBA 2H6EA 2CY0A 3RCBA 2VHZA 1YL5A 1UJMA 3WGQA 8ADHA 4A0SA 4AJHA 1XGKA 4CUJA 1MXFA 1MLDA 4S1VA 1P33A 3HN7A 1O89A 3PYLA 2AQHA 2C7VA 4NBUA 4QO7A 4XJTA 2FPPA 3IOYA 4J91A 2VT3A 3RSHA 4L4XA 1EMDA 5ENDA 2AEMA 3RC7A 1BMDA 1IUKA 1NTOA 1ONPA 2C54A 2NM0A 2O7QA 3OQ6A 4E30A 5JDIA 1P45A 4CUZA 5TT1A 2BLLA 3ICPA 2OMEA 4CLRB 5L4LA 1U7HA 3IDSA 5DP2A 3TJRA 4BMNA 4IJVA 1ZO8A 4IJKA 1BW9A 5KIAA 3AM4A 4RPKA 5IDWA 1LA2A 3F9IA 1E3SA 4J9UE 3WQSB 1KVUA 3OIDA 3O38A 1ZEMA 2OL4A 5G4KA 4DGSA 2DT5A 2WM3A 2A35A 4DUPA 2ZK7A 4GWKA 4OO3A 1W4ZA 1R4NB 1I5RA 4K28A 2Z1MA 4CLEA 5BNFA 1M66A 1XG5A 5JNLA 3H8VA 1A9YA 4ALMA 2F00A 1B2LA 4EEXA 3DHEA 4LSMA 3F4BA 5I9MA 4HWKA 2PD6A 1YWGO 4B8ZA 3GLQA 3QJ5A 2PKRA 5K9ZA 3QVOA 1EDOA 1DO8A 4YQYA 5ILOA 1HDOA 4KDFA 4WLNA 2IE0A 3VHRA 4CLXA 4BGVA 1IHXA 5L53A 2VUSA 3KZVA 1YDEA 5JS6A 2QG4A 1KYQA 5G0UA 1I33A 2BFPA 3DHNA 6LDHA 3CMMA 2GN8A 2A4KA 2X58A 3WXBA 4W4TA 1R4MB 3GOHA 2Q1SA 4KZPA 3INGA 1W6UA 2P4QA 2WJPA 2CUKA 4ITUA 2QRLA 3NDJA 1ZMTA 3QWIA 5JDCA 3NGLA 4JX8A 3HFSA 3H5RA 4PVDA 1RPNA 2AXQA 1NXQA 2GD1O 2EV9A 2GPTA 3DBLB 4LK3A 4CUKA 3FPCA 1GQYA 1B14A 1PX0A 2CDAA 2Q2QA 4GPD1 3LF1A 3HNPA 4MP6A 4R5HA 1IPEA 3W8FA 1K3TA 4CM1A 1X14A 4CQLB 5F21A 1ULUA 3AJRA 5A9TA 1QXSA 4D44A 2PGDA 3OICA 3RUHA 4XYLA 4R3WA 1FDVA 4BNHA 3B70A 4AVYA 4J0FA 3KETA 1T2DA 5F1OA 3TOXA 3WIEA 2P91A 3ROMA 3EGOA 1UAGA 3DL2A 3WR5A 1GR0A 4CV2A 1U1IA 1ZK4A 1NQTA 3BMOA 4W6ZA 4JXKA 3NTOA 5L9AA 2POQX 5EERA 3U49A 1F12A 4JLWA 4BKUA 1Y6JA 2EJVA 3U4DA 2YDYA 4YTEA 5H83A 3UAGA 4BS9A 1ZH8A 1T25A 4B4UA 1CWUA 1D4FA 5ICSA 4I5GA 4DLBA 2HSDA 1GQQA 3B1FA 4LRSB 4B3HA 4PG6A 1A4UA 1PGQA 2OZPA 3PHHA 4NK4A 3VTFA 4L76A 4CR6A 5I9NA 1PGNA 3E9NA 1P1KA 2G17A 3CTMA 4Y67A 2X5JO 3GAFA 1JWAB 2BFAA 4CMEA 5IZ4A 2YZ7A 4PFJA 1WLYA 2FN7A 4QFCA 4JBIA 4XCVA 4RL6A 1U3UA 2OXIA 1EVYA 3DZHA 4I5FA 3S2IA 4J1QA 2WDZA 4YJFB 1OBFO 2WE7A 4NBWA 3TRIA 2RCYA 2A94A 3JQFC 4BNLA 4JN6B 2BH9A 1AGNA 1I01A 1FDSA 3V2HA 4BKOA 1WMBA 4GX1A 4R68A 3GPDG 3MEQA 4W9NA 1LSUA 4Y6SA 4UUMA 4BGIA 5DCUA 4DPKA 5IZCA 4HNGA 1FK8A 1H93A 1VI2A 1BVRA 3Q0EA 1PJLA 1E6EA 1O5IA 4YJGA 1V3TA 2Y1GA 3AUAA 3GVXA 1U4SA 4CLDA 1XCBA 3KB6A 4MKXA 1MGOA 2PGLA 4FD3A 3EZLA 4Z0HO 4JK3A 2FHSA 3KLMX 1QV7A 2ZB8A 3MJEA 1ZZEA 2NUAA 2OP0A 4ALJA 4CM4A 4XA8A 3DXFA 1MXHA 5DF1A 4RPHA 5THQA 2Q4EA 4ALIA 4CLHA 3SC6A 1I36A 5HA5A 2O7SA 4N54A 4DYVA 3GGGA 3UN1A 5KVVA 2JL1A 3JQEA 4CR8A 1H5QA 3BMQB 3L6EA 1GCUA 1PQUA 5CEEA 3PGXA 1LRJA 4B8WA 2AMFA 1ML3A 4YAJA 3I6QA 1HSZA 3AOEA 2ZB3A 4IDEA 3MOGA 1GUFA 3V8BA 3TQHA 5JMWA 5K6AC 3FNGA 2P9EA 3EVNA 4YVFA 3BA1A 3SC4A 4TVBA 1DLIA 1NVGA 1Z82A 2D2IA 4QUKA 3TFOA 1BHSA 2J3IA 5TC4A 1JKIA 4CMJA 3WYCA 9LDBA 4R5MA 4N18A 3EHEA 3Q11A 1E5QA 4FSHA 1C1XA 1UXHA 1EVZA 3B6ZA 4L74A 1WZIA 4TMFA 1HLPA 3AY3A 3A28A 2FSSA 4GAEA 4I1IA 2E37A 4LW8A 5DNAA 2I67A 4CM5A 3G49A 2VHYA 3HDHA 4GGPA 1E92A 2YW9A 3GAZA 5G0VA 1VM6A 3P5SA 4XYBA 2JCVA 3AI1A 3ZU2A 5J23A 4R4JA 4BNNA 2VZ9A 3T7CA 3K31A 4BL5A 3I83A 3RU7A 4O0LA 1J6UA 4FFLA 4HFNA 1VL8A 3OECA 4IXTA 4RF4A 1HXHA 3KOUA 5CEFA 4FGWA 4J1NA 2WE8A 3H9QA 3W4IA 3D3EA 3MTJA 2GNAA 5B37A 3ZNNA 3DAPA 5BSFA 4GGOA 3OH8A 2EGGA 2HQ1A 4PN3A 4ZRMA 5KVQA 1HDCA 3ZWWA 1XYGA 3I4CA 2QHXA 3NDIA 3ZWXA 3AFMA 3I9KA 3E48A 1P74A 3I3OA 4E21A 1I8TA 4Q3DA 1F14A 4DC0A 1ENYA 4EJ0A 4WLEA 3EY4A 3V1YA 4DIBA 4ILKA 4YQZA 4P22A 2O4CA 4MVJM 2A9FA 2JAHA 1K6IA 2G0TA 4MVJF 1ISJA 1NFRA 1K2WA 3PFWO 5GY7A 4U5QA 2VT2A 2EKQA 5JDIC 4JJFA 1MC5A 1AHHA 1XA0A 4OGWA 4QO8A 5JYEA 2VWHA 4RLSA 1OFGA 3JQ7A 1F0YA
chains in the Genus database with same CATH superfamily
3HVJA 1F9EA 3HY3A 3EDCA 3AHFA 4L1KA 2CV0A 3UK2A 2BR4A 3CSDA 3JARB 3IPLA 4ZYVA 3LPNA 4LXIA 2P4EA 4PCLA 4Z9YA 5I6DA 5KUTA 3CVVA 4Q3NA 2G1PA 2ZWOA 1AO0A 1DINA 5A4DA 5LUAA 1H69A 3Q9NA 5KSOA 3W4KA 2Q3JA 4MJXA 5KWVA 3LL7A 3L4KA 1JKFA 3V2GA 1D8AA 1C7ZA 2Y1EA 2Q49A 2XMBA 1PFWA 1EJ6A 3F3KA 4HXEB 4DNFA 4CIDA 1SCNE 3NV7A 5JY6A 4BTLA 1I5EA 5BV0A 3WISA 4IS2A 5DYIA 2CL0X 5FADA 3RTEA 2ASVA 3IIJA 2WIKA 1WXIA 2JASA 1CJKC 1JNYA 3O95A 4A8PA 3U4GA 2FWIA 3DAGA 1FFWA 1TDJA 1LLDA 1BS2A 2GZDA 2QYOA 3DLAA 1SKMA 1Q2XA 2B1QA 3CCBA 1HPLA 4MPDA 1W93A 4QKQA 2WC1A 2XBMA 5CVVA 1HFKA 4INOA 4E4TA 5KQMA 5D1HA 5CIYA 2XOEA 1KAMA 4TRNA 4Y0AA 8OHMA 2IS4A 4EITA 5DSTA 3DE5X 2R3SA 5K8LA 4OSPA 4EEKA 2PWYA 4NMHA 2C29D 2I2CA 4QDUA 3R5JA 2P2GA 1JAYA 1CR0A 3UJCA 2CB0A 3RJTA 3PU6A 4W5RA 3V7YA 5SY9A 1M2VA 4Y6LA 4FFOA 2PH1A 4R2MA 4LF5B 3O3OB 2CEAA 1J8YF 3A2MA 1SUCA 1YZYA 2JKVA 1NL3A 4LOKA 3OMXA 4EGJA 1C8KA 1Y1RA 4BZQA 3AUSA 5L7TA 3ZLVA 4JT4A 4OHRA 4HNUA 5A3SA 2W2OA 3G23A 2DTDA 3UMRA 1COWA 3VAZA 2HMAA 2Z1DA 1XEXB 3L7NA 4L7VA 1NYLA 1UMKA 3ZEIA 2LCIA 2PY6A 421PA 1L7BA 2IYZA 1Y8ZA 4F60A 2WD9A 1OYOA 3AHGA 1HO3A 2J6CA 3FDZB 1DQZA 5H81A 4AZ3A 3IIKA 1PO7A 3I2HA 4MUNA 4LHXA 3KZ1E 3PC8C 5JJKA 1RC1A 2XUQA 3B89A 1YZNA 2NAFA 1S6YA 3H2JA 2H4WA 4PSDA 2HRZA 3EZFA 2RJOA 2M9MA 4RGVA 1U0RA 1XPOA 1H2XA 4PRKA 4BUJA 1XHEA 3OZSA 1AKNA 4IL5A 3UG6A 1PJRA 2SECE 1MG0A 4H59A 4MWOA 4YP9A 3M83A 3WA7A 1SCBA 4RZQA 2JFGA 2QAIA 4YFYA 4KGDA 1XR3A 3LGAA 4HH1A 4M2LA 4DJ5X 5IULC 4C2TA 3B20A 1II9A 3QKIA 4LTDA 1ODLA 2AI1A 5JY1A 2NZ8A 4MCAA 1WSWA 2ZUEA 4YO7A 2Q7DA 4R9RA 1U1FA 4TTAA 3VBEA 3AKZA 3FZNA 1NN5A 2QRGA 2D7DA 3Q8LA 2Q3HA 2O3UA 3LWDA 4CMAA 2B0JA 3HP7A 4R2HA 4FFPA 5ICGA 3U1BA 1BQ4A 3OX1A 3TI7A 4PYRA 3LOUA 1JHPA 3GDWA 2PHZA 3GT0A 2WMYA 5EWJA 4AG3A 1PK9A 1Y80A 3JYHA 1Z8DA 5HRCA 3MCZA 2NUBA 4GBJA 3JQGB 1AY0A 4PZCA 4EUKA 1UPBA 4LFCB 3RRYA 1TEXA 3RH0A 5HJ5A 2KE5A 5DOZA 3RO7A 1RJGA 3FVTA 3B3JA 1KORA 2B4RO 4OLFA 1R74A 5ER9A 1GHTA 1DEXA 5INTA 2FXIA 1KP2A 2H54A 4YAKA 4KR6A 1MNQA 2B21A 2Y66A 1JJFA 3ABSB 3F97A 4RKYA 3DMDA 3E9ZA 3ER9A 1RYZA 3E9DA 5DTIA 1Y8RA 3HKCA 4YRDA 4MR8A 2J5XA 4LBWA 1OE0A 5IK2A 4TVOA 3GEEA 4QFMA 1SU4A 1LI4A 2ODQA 5B1HA 1J56A 2P35A 3CIFA 4CETA 3Q10A 5HWSA 2EKZA 1U2RA 1NMYA 2VSNA 1KY5A 1CZOA 3O1HB 4IICA 4A5SA 5AW2A 5FX2A 5EE1A 1TC1A 3EODA 4BBJA 1MT0A 4LA4A 2TMKA 3G8CA 3UTDA 4Q05A 2QX4A 3DWFA 1P39A 3B48A 4G26A 3D31A 1QK5A 2EW1A 4I08A 5DT9A 1PDWA 1XQXA 2CXSA 3I58A 4JB8A 4ZO9A 1R3DA 4CKCA 2Q0QA 3DV2A 1UKEA 3IVRA 4KQHA 4RIFA 1Q0QA 1YKFA 2P7IA 2PLNA 4U0KA 1J7KA 4NYIQ 4BKRA 1Z0DA 2J3KA 3KZXA 4KQKA 5CVUA 3NM5A 5IXJA 1FVXA 3ZQKA 5TMDA 1SUWA 1K5GA 4MV0A 4PZUA 4G3XA 2XT9A 4EB0A 5EJ5A 4QNMA 5K8IA 3FYUC 5EXSA 3RSLA 4YT5A 2HLHA 3T1NA 2GJSA 3AP3A 3IQXA 2R7LA 3LA8A 4OXYA 4ZOQI 3D9QX 2RK4A 2H0AA 4RKQA 4EZBA 4RFLA 1GZSA 1TIKA 3EIXA 1GPAA 2OCPA 2RGRA 4FSDA 2W83A 1H23A 2OSBA 1L8AA 2BN4A 3NM4A 1R5NA 4B0PA 2ADFA 4WCFB 5HKKA 1ZS9A 4IOKA 1UKAA 4IOJA 4BVFA 4HT3B 3WO1A 3AETA 4MI6A 3R8XA 1NULA 3TE6A 2FOIA 2ZB4A 4Y7CA 4EBBA 2G72A 3FJOA 3NZEA 5NLLA 4C3OB 2YWFA 1QLJA 3GJQA 4BV8A 1ZK1A 2VC2B 2ZSAA 1NDUA 4XOIA 2VDPB 1PL0A 2E55A 2B2NA 3GP3A 3KJHA 5DK6A 1MJGM 1BDBA 2HWXA 3B1ZA 3RUAA 1GPKA 3AOEC 3DE6X 3MWEA 4G0OA 1RRPA 4PNZA 4DW8A 2IUSA 2BHTA 4ZZ3A 3B38A 4BMYA 1Z06A 3G2IA 2DPGA 2YV4A 5C37A 1W88B 2GF2A 1QK3A 2F90A 3NDBB 1N8TA 3SS7X 1HTBA 2VXOA 1C9YA 1AN9A 1KSHA 1MHPA 1I7DA 2I65A 4POOA 4BZWA 4JAVC 4TZ6A 2BEJA 1TNDA 5HFAA 3T99A 2CLKB 2J8ZA 1L1RA 4NYJR 2A86A 4TKVA 4W8GA 4XLZA 1RJ9A 2R25B 1L8LA 2NYVA 5B64A 1YKSA 4JGBA 4RHXA 3ANMA 3BHNA 4ZOLA 3TSWA 3VU9B 1X7YB 1E3WB 1SUPA 2E0IA 2YCLA 3C6YA 3MCVA 3QX8A 1PNOA 3TOSA 4B46A 2J9XB 3UFXA 1FX0B 2UZ1A 4UHHA 1WXEA 4AUEA 3OPYA 3Q98A 4C2UA 4NMMA 2PSEA 2FA9A 3H97A 1SU6A 1FRVA 1KSGA 1SCKA 5KJEA 4YAUA 3UATA 5GM2A 3KPUA 4B9AA 3I9V6 1GUBA 3OZVA 2WJYA 3LT5A 4HDMA 1PJ2A 1JBKA 1DBRA 1XXHE 3OFNA 2O59A 1Z4MA 4G86A 4J4TA 4XQ9A 4LFAB 2GEKA 3UWDA 2HJVA 1G8KA 1IY8A 3IVXA 3DBRB 4CF6A 5JFGA 4YT2A 1F8UA 5DFAA 3NKLA 2D5AA 2R5FA 1E2JA 2HLNA 1FY2A 1RBZA 1WDLA 1LX7A 2E3JA 4XX0A 1EK1A 2ZLBA 4ZVTA 4YPVA 4NK5A 3TSAA 3P2IA 4KI7A 4PGFA 5CJPA 5CXUA 3H5LA 2DFKB 3HJHA 4M0CA 1KR5A 4BWGA 1QHHA 3U37A 3MNFA 1P1CA 1VPTA 2FP4B 4RNCA 4UARA 2G4CA 1WDMA 4BFWA 1P7ZA 3R5FA 1VE3A 5JLJA 1QQ5A 2HK6A 4V2IA 3GGSA 2QD5A 3FWPA 2AOXA 4ZAGA 2ZG6A 4O5AA 1I3NA 2EP5A 3A14A 1RHUA 2C07A 2HRDA 4WIAA 2WWVD 5JS1A 3STVA 3B51X 1U7ZA 2OBXA 2W71A 5AVOA 3UXYA 1VRVA 2ACVA 4XKJA 4XFDA 1O6GA 5GJBA 1T13A 1HT3A 3SJZA 3EC2A 1CJVC 4LN1A 4AICA 4TWAA 3ZV3A 2G7ZA 2VK8A 4W5HA 3ZWQA 5BNZA 5CLHA 1K0FA 1T15A 1VJCA 2XNDA 2ZJYA 3EGCA 4DR2B 1M0TA 4N48A 3LY8A 4GKBA 2HTEA 4V03A 3H4IA 3SJ7A 1SPXA 1CR6A 2GZ3A 5ENVA 3AY0A 4PYKA 5BV1A 1IY0A 1UZUA 2QL9A 2NV2B 1R5JA 1XZNA 3OF5A 3A3NA 1YB6A 3ZW9A 4IUYA 4DIDA 3KG2A 2YV3A 1VIDA 2HM7A 4KUEA 2WJGA 3NLLA 2D0DA 1KI6A 2WHQA 4AFNA 4P4TA 2BSQA 1SG6A 2Z9BA 3L93A 2DUWA 3VZQA 4BGDA 1JQBA 2C2MA 1T3TA 5CBKA 5FYDA 5DHPA 3ID6C 4L8WB 3RB8A 1V1MB 2PK3A 1SOMA 4XWWA 3DNMA 1QQ6A 1TKAA 4NRDA 3W6OA 1PD1A 4UNSA 1FOEB 3G1UA 4GM4A 4H35A 1JW9B 2V03A 3MWLA 4IXMA 3U7GA 4Z51A 3ZQ4A 1AS2A 4HPJB 2YH2A 5E8JA 2M32A 5A5EA 1MO4A 3G6WA 2VK2A 2DHQA 2XIQA 3UA3A 1Z16A 3MRSA 3PVZA 4JL6A 2XB8A 3WP1B 5AKJA 4UC0A 4YRKA 2XCLA 1WY7A 1OC4A 4HH3C 4FZJA 3TDNA 3MT7A 4IFTA 4L9RA 1EA7A 2Y27A 3N76A 1JXQA 1NY6A 3EJ6A 5A2QA 4LV6A 2XUFA 4L8FA 1JMKC 1GN9A 1I2MA 2KW5A 2ZRKA 3M9XA 1ZRSA 3ZEAA 3LCJA 3WG9A 7ADHA 1VE6A 2TMDA 2GOYA 4FYMA 4CEHA 2IL1A 5AW5A 4ICIA 4MW2A 1G1MA 4QYMA 1IPHA 1IXSB 2WAAA 5GPBA 3D5QA 2D6FA 5CW2A 1WOYA 2FX3A 5E2AA 5J2TF 3UVEA 3MSXA 3G5LA 3OVMA 2VS1A 3GP8A 4NEQA 2XH8A 1I30A 4DDUA 4C22A 2CL5A 4RQAA 5FKJA 2WNSA 2CXUA 4NH0A 3RHSA 2D1RA 2RKWA 4IRMA 4AJIA 4KIUA 4HF7A 3ITNA 2C4TA 3SXJA 4OUKX 1GUDA 2XCTB 1LFDB 1WCV1 1W29A 3DOEA 3JD2A 4YUAA 1MAAA 3HK2A 2GM9A 1DHTA 2WSIA 3RT1A 2R11A 1NU6A 4M0UA 4A16A 4A6XA 4ZAXA 2ACEA 1PQWA 2OHOA 1U5BB 3AL2A 1SK8A 2HMYB 2GEBA 1Q2UA 4WZ6A 5LYJA 2ZCUA 2QLJA 1LBHA 4OLHA 1IOZA 4L9AA 821PA 3DOUA 1E1KA 3LCVB 4HQ6A 1RWPA 3V1MA 1XAGA 3OT4A 1VPVA 4UPVA 4Z2YA 1P0MA 2VBGA 1PD0A 1RKUA 3EZXA 1YGYA 2MHCA 5EHQA 5F3DA 1PQ4A 3ENQA 1FFYA 2ZWMA 1V6SA 4GLBA 1FFBA 1Z4NA 5AW3A 1F38A 2NO6A 3SHWA 2AMJA 5CBPA 4ZO7A 4TGLA 3UWPA 5EZ5A 4E5PA 4EY4A 4KQGA 2WB4A 4BNUA 2VP0A 3DZ8A 4B6QA 4G0VA 4BX0A 1J97A 3K09A 3RSSA 3QSYA 3KB1A 3LXXA 1TEZA 1EQ2A 5LKRA 3GNTA 1S01A 4YRLA 3SQLA 8LDHA 1JNXX 2GEFA 4BAUA 1L3CA 3RIHA 3W3ZB 5K45A 5K20A 1IWBB 5BO5A 3WGMA 4J8PA 2FRDA 1SR8A 1CQJB 3NU1A 4NU8X 1LLCA 4UKDA 5GAJA 1SGWA 5BN3B 3JX9A 1KJJA 3L9WA 1FFGA 4WKBA 4ZKEA 4EA6A 1RAIA 2IVZA 1XKTA 2UUCB 4B6EA 1U3WA 1EFVB 3AHEA 3EVEA 5FOTA 5LA6B 1NW6A 4FBMA 3C4QA 1NX6A 4D4KA 4NG5A 3I1FA 2Z83A 4D4JA 5EOVA 2OGUA 3NRCA 3LPDA 4FFNA 4UHCA 2A92A 3QXXA 4QEDA 1OGJA 3UCXA 5FTMA 3UEOA 4BAZA 4LDJA 2GHTA 4X63A 2R8BA 3MA0A 1V95A 4GZ6A 3K15A 1E32A 1K75A 4M7RA 1L2TA 5CXSA 2E4UA 1KI8A 2ZUDA 2R4TA 3G0OA 4AKTA 4XTCS 4QHSA 3MGBA 5GM1A 1NMEA 3IH5A 2Y92A 2XYRA 1LGYA 1WMSA 2I34A 1SQ6A 3RUDA 1J5XA 1TUBA 2R8ZA 2X86A 4FMBB 3GLFB 5HE9A 1ORHA 2FOLA 6NULA 5IXSA 1FFSA 4LDZA 1MZVA 3NJRA 4WOKA 4DA7A 4K7JA 4QT4A 3LPMA 1EVKA 2PZFA 3ZBUA 2ZUTA 1NJFA 2I2BA 3R4CA 5E3HA 2QLBA 4QU0A 1A98A 1MORA 4I50F 2PKYX 4W1QA 2BJVA 3OCZA 3G0CA 4G5HA 3DBLA 2HA6A 4LGMA 5LZ7A 3VKHA 3T5CA 1YD7A 4HGNA 2ZGVA 4RK4A 5FPQA 1ZH4A 4HNVA 4XYGA 1L7OA 2GN6A 3SYLA 1TC2A 3BK2A 4LYAA 1NBME 3BWEA 1T2FA 4FZ5A 4OL0A 5SY6A 4MRPA 1DXHA 1OFVA 4BO1A 1C0IA 2Z3WA 1MW8X 4EYGA 1A8IA 3GFRA 1BO6A 4XB1A 4RD3A 5ADUS 2BGWA 3RYCA 1E0JA 4DCNA 1MEOA 1DBVO 1E3IA 3U81A 2MSEB 1HE1C 1J2EA 3VO9A 3JQ9C 4MINA 2QBYB 4RF5A 1QQ7A 4YECA 1T9HA 2QN6A 5AHWA 3VPBA 1BXRB 2Q5HA 3B12A 3GQBA 1JIIA 3VKFA 4O4LA 3WXMA 1YH3A 3PEEA 4WKOA 1DWPA 1RD4A 4KV7A 3S1LA 1VKNA 1KA9H 4IDHA 2B35A 3DOCA 2H92A 3FDFA 4WL0A 2VQFB 3DHWC 5DRYA 4FDVA 5EQTA 3PTZA 4DBVO 3V4PB 5ALQA 2IUUA 1PDVA 3ZHZA 4NF2A 3X1WA 4RJIA 3ADOA 1XTKA 5KNCD 1VMKA 3ZWPA 3NHKA 4DDKA 3NB0A 1ECLA 2NXCA 3DXYA 1XZEA 4IIFA 1KSFX 1Z2PX 3PXCX 3TLZA 2QM7A 2ORED 5K3OA 4PC6A 2H0QA 1ORVA 4ZT3A 5FF9A 4AULA 4MQLA 2E4ZA 2E85A 3KQLA 3GK3A 3ORSA 1FDTA 1GYRA 1YQEA 2IYWA 3CX7A 3R5KA 4EZEA 4RXMA 5M3BA 3GDOA 5CH5A 3K2BA 2H07A 2AX4A 1CR4A 2OENG 2ZJFA 1IEQA 5ETJA 3NFRA 4DMKA 1JHXA 4ANFA 2FCAA 1HZZC 1E1MA 1DRVA 2EX4A 2QTFA 1I4OA 1M5UA 3SKVA 1JZQA 3E7XA 2BD0A 1WUJS 1GXSA 1UJCA 1XLTC 4YLYA 4EO4A 1PV1A 4HEA6 2ZS7A 3F8SA 1HDRA 3JQBA 1SFRA 2PGXA 1W46A 2X0KA 5E2IA 1NN0A 2D3TA 1KPHA 3PEYA 1ZOPA 1RWWA 5KINB 3DFFA 3JAKB 3HDQA 2CT8A 1T3HA 3DKVA 4HNHA 1OVMA 4DQLA 1NRJB 4PN7A 3KJFA 3GRYA 3F1LA 2B9EA 1C30B 1ZL0A 2WP0A 4H3KB 3ZNQA 1U3FA 1N25A 4MWZA 4EA9A 1DKRA 2L17A 3I9LA 1XZAA 5DTRA 1P3JA 1ZMXA 5AXBA 5PNTA 2GRAA 3TTUA 1DXOA 1JLLA 1S8FA 4QPZA 3LHSA 3SIWA 4HQ0A 2QTTA 1W2WB 4DCUA 1XTQA 1S0UA 4I9UA 5AKGA 4MCIA 2FW7A 4C06A 2R79A 4PYIA 1C4OA 4GO1A 1ZHHA 2ODNA 3FRHA 5CB8A 1SXHA 4JQCA 2R8OA 1MO5A 1M73E 4PBTA 5I9SA 5JSHA 3TUJC 1EH5A 5B53A 3EN0A 3AM1A 4CMCA 3CIOA 4L2IA 1RZRA 2BI7A 1L6IA 4TL9A 3HWRA 4HQKA 1Z07A 2GDZA 5EVCA 1IVNA 4F5WA 3BXXA 1F8XA 4CI0B 3K1JA 5FEUA 3SQXA 2BFOA 3BZUA 1C41A 4IQ0A 3STUA 4C6RA 3BMQA 2FH5B 5EIHA 1NMSA 3SJUA 3TQFA 4URZR 4FQ8A 3DMTA 2J0UA 4EUEA 1UEIA 4MV6A 2BMDA 2D8AA 2HU2A 1CY1A 3UENA 2BZ0A 2Q3EA 1YFLA 2JLYA 5H59A 3WK8A 1DG9A 1XD9A 3GCXA 4CIAA 3EXFA 4CMIB 1R9JA 2CSUA 1RJWA 1N2ZA 1S8OA 2GJ8A 4HP8A 1R10A 5KPDA 1M1NB 2BLNA 2OWEA 3K7EA 4QDTA 2ZWPA 1OWLA 3DMYA 5EXXA 1OR8A 3U60B 2CCJA 3NP7A 3VSBA 2IYNA 4WLFA 3J80A 2QN1A 4BNXA 2I3GA 4AKEA 2O5VA 2PJRA 4C4PA 4EHDA 1X70A 3NGMA 4UM5A 3UJAA 1VGRA 5CFOA 5CXQA 4A0QA 2WV9A 4KQ1A 1XJ5A 3L4BC 2FDRA 3KHSA 5JNTA 2YWEA 3AHJA 3O21A 1TVCA 1G8JA 3AK4A 2CNLA 4WY2A 4YY3B 1YU6A 2GVNA 3KUCA 3Q87B 2GWHA 4Y2TA 2IYRA 4OAOA 5GOZA 3L02A 3GVIA 3WGOA 1U4OA 4ZZ1A 4NBKA 3H3XA 4FHGA 3L0IB 4A9AA 2OG1A 1UJ2A 4CEJB 4RPLA 1RCTE 2G0AA 4WOJA 2ECPA 5LDDC 1JXOA 1PGPA 3B7GA 4NBSA 2IU3A 4IM7A 1KVSA 3QVVA 2PV0A 5JEDA 4JLAA 4COKA 4O2LA 1NVTA 1TKBA 3F5MA 3PHIA 4J07A 5AW0A 3GB9A 2ZSKA 3VPHA 3SK0A 2A3NA 4ODIA 2EYQA 3LM8A 4MROA 3KL4A 4CGZA 3BQ9A 2Z6UA 1VB5A 1A1VA 3SWWA 5B2ZA 3R0XA 1U0FA 1Z18A 3DB1A 3WB0A 5AVTA 1YQQA 2P3OA 3PFBA 3H9GA 5K4AA 4MZDA 3EQ8A 1RS0A 3KKMA 2FP3A 1UKBA 3AVQA 4ZRNA 2RAFA 5GV8A 2XB2A 3G13A 4R8VA 4A0GA 2PRZA 5CT6A 5D7BA 2MCFA 4X5OA 2YYSA 1Y9DA 4FN5A 4DIFA 1RSZA 1HORA 5JCJA 2DBYA 4R7ZA 3TZLA 3WRXC 1T36A 1T8RA 1WEHA 4LXGA 1Y48E 4GZLA 5FPKA 3BXEA 4KBFA 3DZJA 4RHCA 4YAEA 3EA5A 5IDYA 4M22A 5AVWA 5I4IA 2C92A 1G291 1QOZA 3UF0A 4XWTA 5MGBA 1QE0A 4A15A 2PGIA 4QLBA 5C4MA 2V4MA 2Z1NA 2NVUB 4Z0PA 4IJ6A 2XA1A 4EHKA 2HBZA 1QQAA 1EK6A 2BJHA 1NZFA 4BMZA 1FSFA 3MJRA 3M9LA 3QXGA 1ULTA 4HWPA 3K9FC 4AUKA 2F3RA 2Z2KA 4PYOA 4Q82A 1JDPA 3ONFA 3HL4A 2JZOA 2C4UA 3C5WP 4MARA 2IV3A 3B9QA 1TT5B 3G2NA 4URUR 2DH5A 4AO8A 1M2OB 1TZJA 2Y93A 3HJBA 4HDKB 1VCMA 4E33A 4Q24A 3ZHXA 1FFAA 1GNSA 4QECA 1P1IA 1XTRA 4DKXA 1Y4ZA 5JPIA 1H0RA 3K2IA 1M7BA 3NBQA 4RD6A 4YRTA 5E1DA 3ZY5A 1FB5A 1NR7A 4AS1A 1L5RA 2E4XA 3R9XB 4GKJB 1NBOA 2ANBA 4S1NA 4F21A 1T3SA 2GPYA 2QR2A 3BGWA 3O8RA 1N8SA 2I4RA 3IDFA 4YREA 3SG0A 1CKEA 1E2BA 3JSXA 3IBSA 3NKVA 1YUBA 4RACA 2XKBA 4H7IA 1WQ4A 4EUSA 4HPWA 3BAFA 3TW6A 3TW0A 2UZ0A 1WBDA 4R1NA 4ZCMA 2HSJA 2R4UA 4MV8A 4AXBA 1IXRC 2O0MA 5DT2A 4B40A 1T2CA 1RIIA 4E22A 1TYCA 4FYVA 1DKOA 2V7XA 2WFLB 1A8SA 4O4HF 1E89A 1NP7A 4KH0A 2PS3A 4ZQHA 2FFBA 3QVJA 4WFIA 2R1TB 3WIOA 2QP4A 4HWRA 3IAHA 4YDSA 3DGEC 1QX4A 1O4WA 2QPOA 4ENTA 4Z7OB 4KJXA 2IDMA 5E0KB 5BN5B 1BH6A 4QYWA 2H2AA 5DM0A 5LBUA 1GGFA 5BWLA 3FR7A 4ZAYA 5IU6A 1MB9A 4XWYA 2VNAA 3KTAB 4B3BA 4KMOA 3EISA 4ZVSA 1J24A 2OD7A 1YOVA 4JZKA 5CD9A 3SYMA 2PSFA 2X9GA 2C83A 2HADA 4IGKA 3PE3A 3N7AA 2NQ8A 3C5VA 1WUIS 1GY8A 3MC1A 3CUWA 2FPRA 2QD3A 4N0QA 1CJSA 1RXSA 1U3GA 4WNCA 4CIWA 1DAPA 1T4MA 5EN4A 2R5NA 2OZVA 2WFZA 4WUVA 1E9DA 4KV9A 1XMOB 1F9AA 1N77A 2VAWA 4EHIA 1SC4A 4F1WA 2YCBA 5IZCC 5CFZA 3TF5A 4E2WA 2C7OA 1G8FA 5I7OA 1UKYA 3SFZA 4I19A 1IN8A 3WIBA 1KMIY 5HIJA 2EP7A 1JSXA 5JXWA 1ZCFA 2P2DA 3U7IA 3V2IA 4KFCA 4HWTA 3TTVA 3VU8A 4D4GA 4ARCA 2UYGA 3KLNA 5A1TA 3F7MA 1D09A 3JQ8A 4QNRA 3C6XA 1IZ8A 2PUHA 1EWTA 1X42A 1Z45A 2WYUA 3OX4A 2AFIE 4GRIA 2LDXA 5CCDA 5TQVA 2I9KA 2FZLA 1CRZA 1S3IA 4ED9A 1G3RA 3EVTA 3UXEA 3BJIC 4JQSA 1X94A 5C1IA 2FI1A 4CTMA 1YIAA 1YR8A 1YSCA 3EK2A 1PUJA 1ZVQA 1HFJA 1ZU4A 2G1UA 3RJZA 1JG1A 3DBVO 3V33A 2QMYA 4BN4A 1DBIA 1WXDA 2Q1WA 3SYKA 3D8HA 1YI0A 3L4EA 3Q7EA 2B25A 5M34A 5DSXA 2FMFA 5CX1B 4AW9A 1GLNA 5AJTA 2B36A 1OLUB 3LQ2A 3MS2A 4KACA 2X1VA 3G2OA 3EXAA 1DXYA 3L6CA 3ZU3A 4URHA 4I14A 2WU3A 2V54A 1FYWA 2Q6LA 1DLJA 1Y7LA 1AKTA 2F1RA 3VYRB 5AW4A 2O6HA 4NZ9A 3CKYA 3K0AB 1IIRA 3FCEA 3K16A 2CVFA 4V2UA 3OF3A 5IEBA 4QM7A 1QUFA 2FR1A 1HDZA 4AMGA 1E5XA 4DUGA 4JQOA 4EFMA 1G5TA 2XGMA 2NU7A 1E20A 3FTEA 3U0VA 2BDTA 1XVLA 1C0KA 3QYJA 4OXQA 1GNQA 4LQDA 3ROKA 2D7JA 1IMOA 1CB7A 3KKKA 4WXHA 3ZUPA 3A6DA 3NR2A 4JR1A 2QMUA 5HX7A 2ZR7A 2ZRCA 1IZ9A 1LNZA 3RYHA 2VA8A 1TPYA 5CPBA 1YTLA 2HJHA 3MPUA 4WECA 3LHDA 1TAUA 4YWHA 1UR5A 5DBIA 4ALNA 4BLVA 2B3TA 5HF9A 4FDUA 2X9LA 1XXHB 4ZJYA 1FTNA 4RNDB 1CZKA 1OX4B 1CUEA 3CSUA 3P5BA 4EY5A 3G0BA 1W36B 4U7DA 1B16A 3TKYA 1EFPA 3A6LA 1KYWA 4RJJA 2OV3A 4MV4A 1YAHA 5B7GA 5I5EA 5DNWA 2X7JA 1FSGA 4QATA 1SM4A 3L7AA 4RK0A 4WCDA 4CMGA 4EVIA 2PX4A 2VDQB 3S4YA 2HWYA 4DQKA 2HZ7A 2Q3BA 4QGAA 4OHUA 5EZYB 4EO9A 2I3DA 1M10A 3JZIA 3DLPX 3K6KA 1RZUA 3HDJA 1KJYA 1PIWA 4YMHA 3GN1A 4JLOA 3LRPA 1F06A 2A0UA 3MHPA 4XAQA 4BN5A 2DPXA 4GYKA 5ESRA 4C6HA 4RMJA 1W4BA 2YV1A 4JJIA 2FSUA 4PQFA 3ROZA 2PX5A 4QAQA 4AZWA 1L4YA 4B09A 4D6PA 1A04A 3BCRA 5C35A 3GRAA 1LJ8A 3DZKA 4GMKA 4HAWA 1XEWY 4ARAA 1I3KA 1IZYA 3AI3A 4UVEA 4BTEA 3OG9A 2GEJA 5D1NA 2OOKA 5ITWA 1LTQA 1RVV1 2C0PA 2WJWA 2C7QA 3HVHA 1MPTA 4NH4A 1WV0A 1KE1A 3DO5A 3X1DA 5FH9A 5K8UA 4KHZA 1NXTA 3VJLA 3ZVLA 1NXPA 4OEHA 3UUFA 3CEPB 2E7ZA 1GQFA 1MB3A 1L4GA 2HUNA 5EAIA 4M1TA 3WBFA 3BHMA 5EUQB 5DMHA 3ET4A 3GNLA 4NCXA 2GMWA 4EIWA 2CL6X 1DSSG 3WIUA 1S4QA 1U0EA 2XJ4A 2OAP1 3WQQA 1D1SA 1XP8A 4YACA 3UOGA 5BSHA 1GV1A 1KWKA 4KHPB 4DARA 4FOSA 3GXBA 2HT6A 4D9JA 2IQ5A 4JOBA 3ND5A 4RFVA 1MMFB 5CIWA 4GI3A 4P7JA 4FZRA 2H1WA 2LVBA 2VJOA 2G6TA 4A2WA 1A5BB 3R0VA 1RQ7A 1GZ5A 2KBFA 3EA0A 4REQB 2EZ8A 1H8HD 1J8FA 1NJSA 3C3AA 2WPNA 5AI0A 3VKVA 1VL1A 2FMIA 5JPDA 3D54D 5B3JA 2HB6A 4D6XA 3D6UA 3SVTA 5K0NA 3TXAA 3WGKA 5FNZA 1AZTA 2NT3A 4BMSA 4LNHA 2Y0DA 4RD2A 4YMUA 2ID7A 4EY3A 1GSAA 2JFPA 3MJVA 3VZBA 1P2SA 3I2KA 3NFYA 3TRJA 4TL7A 4RH3A 3LI2A 1K8QA 3QELB 5HK9A 5IJ0B 2IEYA 3M6LA 2ZI4A 3AOGA 4JR0A 2AJDA 2XB6A 1Q7RA 4ZICA 1RR6A 4X6YA 3JQDA 3AFHA 3DE2X 2VSXA 1EE9A 3H6GA 3J81k 4ERXA 3EARA 2WKPA 3ZJUA 4JYAB 1MA3A 2QLTA 4GBMA 5CA0B 3OP4A 5ALDA 1URPA 1KYZA 4KXMA 3T0IA 1P2TA 1IBRA 5JNSA 1F6WA 2AMLA 4N8SA 4E5NA 1PLKA 3RFFA 3UJHA 1F1BA 3BM5A 4FX5A 4WGFA 3AMVA 2A2ZA 4W5OA 1G98A 3H8JA 3K72B 3N8GA 4QTXA 1FYDA 4R81A 3CJQA 3RSOA 2B98A 4G01B 4WESA 4G0QA 3EWNA 2O5CA 3VNVA 3TPZA 1F51E 2AVDA 3PEFA 4PC1A 3DWIA 1SHKA 3TNFA 3SDBA 4WJZA 1QP0A 1CUCA 1ZMOA 3BQNB 3CO0S 1HZJA 3R8CA 1J22A 1RE1A 3WFZA 3HBJA 2W6QA 1NR1A 4PG7A 4XRRA 3R9IA 1QVWA 3T8YA 1FE8A 3JQ6A 4K6MA 3IP6A 3PIIA 4Q7EA 4JKIA 1W87A 2OORA 2G0NA 4B6PA 1P31A 3E3MA 5T6MA 2QXUA 3FYCA 3LVRE 3G79A 3BS4A 3JASA 2XMQA 3BMOB 4O4JB 4JT8A 4MAAA 4MVJH 4KOEC 1LFAA 3FUCA 5ULLA 1DV1A 1EFTA 1VP3A 1ZCJA 2XCIA 1Q0ZA 3ETGA 4M0LA 2ZANA 4Q4CA 4ZQBA 5KJFA 3UMJA 3IE1A 3LS2A 4DJDC 2YV2A 3E3LA 1U5CA 1U8CB 1VLJA 3O3MB 1THGA 4RX1A 3V5NA 2P9CA 1PHPA 1L1FA 4DA4A 1I5OA 3W8EA 1ACMA 1L5HB 4Q1FA 3WNVA 1JZTA 1VLLA 1XROA 2AI3A 3B13B 4M60A 1HYGA 4EG8A 3FYSA 1GOTA 3M3DA 1QLWA 2Y4OA 1P2BA 4C88A 2ESRA 2QZSA 4ERNA 1WWKA 4Z4EA 4H0CA 4HVTA 4DS3A 4KWIA 1AQLA 5IVDA 1GTJ1 1YR1A 2ZRJA 2A0XA 3JALB 2J30A 1K4KA 3PICA 4OLJA 1RWOA 1VSQA 1A9ZA 2G67A 2JHAA 2YWBA 3SQDA 4BNYA 5JH7B 1C3XA 3QJYA 2YS7A 4QOSA 1NI4A 1KQFA 1SQGA 2Y1WA 3RBVA 2QGFA 4E3WA 2UVDA 2ORVA 1Q0TA 2HMUA 2RC6A 3WVNA 3SZLA 4EPWA 5ADHA 2AFHE 1Y37A 3M1LA 2E4YA 3P52A 1O0CA 2VRCA 2OLKA 1YRLA 3AEUA 4FKMA 3BB3A 3TW8B 4U0JA 4L51A 2EZ9A 3AR6A 3CM0A 4QHYA 2P6RA 3CUEF 4Y2SA 2Q1UA 3BD7A 1Z75A 1UC9A 1G8HA 1SU8A 3IEIA 2REBA 2XD9A 5AKIA 3NAQA 3IE2A 1YB5A 3JVDA 3NBKA 4MUXA 1VBMA 4QNNA 2J9YB 2QX7A 1ISMA 1DAMA 1MX3A 2A3RA 2YRFA 3MTGA 1L9XA 4NQZA 2V6JA 3P2YA 4YUVA 4CF4A 5KYXA 2WU0A 4UMVA 1U8UA 2EU8A 1LWNA 2J7KA 4FNAA 3AEQA 3IT2A 3O0TA 4N0DA 3WK7A 1XTBA 3WL7A 3PCXA 2AKYA 1R0WA 1KC1A 3EDQA 4XEHA 1L5NA 4MRSA 3UBMA 4DV4B 2O8EA 1NBHA 2ZE8A 1QYXA 3FZEA 3JY6A 4GE3A 4BZXA 3QUAA 3G9ZA 4HXFB 2QU7A 5K2OA 2QVLA 5I7WA 1GFZA 5CM2Z 3I9MA 1ZZGA 2OG2A 4MWBA 4D99A 1VKOA 1CFJA 3WL3A 4C03A 1RXIA 2DHRA 5C3MA 2ZSUA 2C5GA 5CB4B 1MAHA 2ZTLA 4HLNA 5FB3A 2N47A 4TROA 5TMPA 2ZREA 3RKUA 3C4JA 4YP5A 2FWJA 2NUAB 3V3KA 1JN0A 1VJRA 4IIGA 2B78A 3VYUB 3KSUA 3Q72A 1XU7A 2FMHA 5M2QA 4Q4HB 1E9SA 4X8MA 4TLAA 1MRSA 3FKQA 4N7JA 1W85B 4FZ3A 1KEEA 3F1KA 4P4SB 3OQMA 2RHHA 4GGMX 3SNKA 1SVOA 1YJ5A 3ZGVA 2A7QA 2DUMA 4ZQCB 1LI7A 1NYRA 1K3UB 2E6UX 5HIMA 3DUFB 4I3GA 4YCDA 3G2JA 3EXHA 4R54A 2Z58A 5DEOA 2OZLB 1HRKA 2QENA 5A71A 2A9QA 3CRNA 4JI4B 4QOHA 2QJWA 2IX3A 2F48A 1B15A 3F9CA 4K40A 4BE4A 1DTWB 2AKAB 3ETHA 4FUQA 4QGGA 3NT5A 2PUWA 2W48A 2YYAA 1TMOA 3ZCQA 3DYBA 2UZ3A 1U94A 1X1DA 4M1MA 4JVNA 2O2EA 5JATA 3L4JA 1HDIA 2V3CC 1XU4A 4P3PA 4F12A 4UTZA 4GM1A 4DQXA 4JX9A 4DR3B 2MSWA 1I0IA 4IVNA 5AIAA 3UMFA 3WZ2A 3MMZA 1FP7A 1GCOA 1VKJA 2FSPA 2JHFA 3E0XA 4ROTA 5EWMA 5CCEA 4HNAB 5JRZA 5GZ3A 5KNBD 2BMVA 1C1XB 3AJ8A 5G4LA 3UMBA 1AQJA 3IL2A 4OFZA 3RVOA 2R00A 2I71A 2H7XA 5EE9A 1TF5A 2IP1A 1TQDA 3SEFA 3WKEA 1T4DA 5IJ9A 3NJ8A 1U9YA 4UNQA 2J3LA 4IO0A 5JAZA 5BR4A 3QPCA 4IGFA 5JCOC 2DF8A 5ALOA 2X0IA 2WB2A 1XD2B 4AJ2A 2GYVA 3A4LA 1WU7A 3UUEA 3SBOA 4N0PA 1VYUA 4DMCA 2IP4A 1JJBA 2K6GA 1E1QD 4CKEB 5TF4A 4AJOA 1WS6A 1REQA 1SCUA 2EFEB 3ECCA 4IV5A 4LZJA 1HETA 2XQFA 5EQFA 4OI1A 3EA4A 1CY0A 4YRIA 5K99A 4FCTA 3JD1A 3UICA 3DZGA 4LX0A 1IY1A 4PX2A 1EP9A 4KE8A 1CUWA 1C9KA 1IJFA 1VG0B 4JNCA 4FEYA 4AYTA 3R7FA 3NWOA 1IUNA 5K0CA 4YMLA 5AO9A 1Z0ZA 2GETA 2BFFA 3HVUA 1S9HA 1BX1A 4ZIRB 1N6KA 1KGDA 1AKWA 5AI5A 2OCDA 2YW2A 5FRDA 4GXTA 4LZAA 3FCUB 3HY6A 5FLKA 3CLRC 1CLEA 2HF8A 1SULA 2EX1A 3L18A 4WCFC 1RDFA 2H1VA 3CFYA 3UHPA 2C84A 1WMAA 2JFBA 2AZ4A 4C7JA 4UTRA 2RGNC 4CMBA 5B57C 4PW0A 4NHOA 4I1UA 5HNKA 1PT7A 4WXRA 2RD2A 3VGJA 1PR4A 4IEIA 4LSZA 4K9SA 3RIEA 4YHBA 3JD0A 4G0UA 1C7EA 3FOZA 2CGEA 1ACJA 1X2EA 2FXVA 4G0ZA 1YZLA 4KFUA 2WHXA 1K27A 3C70A 4LJAA 4BB6A 1Y0BA 3AB8A 1EBFA 3Q3EA 3T1OA 2CXRA 4OK6A 1QTNA 4WHMA 5K2MA 2C00A 5KYGA 2HWKA 1L7EA 4I8XA 5BNWA 4Q3CA 1T29A 4DB2A 2HPVA 4MJ7A 4BO0A 3L49A 2KLBA 1CY6A 4UJ5A 1A88A 2EBHX 5FBWB 1OI4A 2ZRBA 2GJAA 1KXJA 5KREA 5EY5B 4QULA 1RHMA 3QX3A 1OZHA 3SSMA 2PUEA 1BGVA 1VL0A 4OHOA 3SJCA 3I6IA 1UMDA 2HGZA 5G02A 4AP5A 2HAEA 3LWBA 5HGXA 3PDHA 3U7FB 3H8SA 2HKIA 1UDBA 2AXNA 4LC9A 5D84A 2O2HA 3T5MA 2B69A 4UFNA 1UT8A 1QO0A 1X1CA 3C3XA 1NNEA 5D3MA 2IZZA 2CFCA 4MV3A 4DJAA 3D8BA 3DULA 1E3LA 1ECJA 5BXYA 2J33A 1E96A 4QSMA 3OOYA 2QUIA 3CB4A 2OCIA 2FPKA 2HXGA 5ALEA 1MPXA 1LBIA 2YOFA 4M87A 1G63A 5ELMA 1ZIDA 3A4MA 3F5FA 1USUA 1P75A 3P96A 2DFLA 2Q8NA 1HR0B 4QBGB 5J2TA 1H6BA 3ZHTA 4XVUA 3GIWA 2X6TA 2CHEA 3OM8A 4NZPA 1Z88A 5KYKA 2XCRB 4NE7A 3KKLA 1LH0A 4JLNA 4Q66C 3LRTA 4E14A 4RJKA 4RYDA 4MS4B 4M8SA 5K3CA 3VDQA 2GN4A 5SYNA 4YIHA 2AYYA 3WKCA 4GE0A 1FP1D 2CHVA 1VGQA 1CVLA 2WWRA 1YDHA 4JVOA 1GZ6A 3PWTA 3NEYA 3PUKA 5K3AA 1NXVA 4RSRA 4X1OA 1ID1A 2JGNA 4N3NA 1M0EA 2XT6A 4BAGA