3ON5A

Crystal structure of a xanthine dehydrogenase (bh1974) from bacillus halodurans at 2.80 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
336
structure length
336
Chain Sequence
MSDIELLETLAGTDQPRVMATIIHVEGSSYRKEGAMMLFQEDGTQVGLLSGGCLETDLTIKAQKVWQEQLPRTVVYDLSSEDDLSWGQGSGCNGTISVLLEPVDLKLRQHLKRVYDYLCAGKSVFHVKKLSTSGAVLEYAFILDESVYFGEWHSGHPVEWIRKIDENEEPLMFTHIYSPKERLIIFGAGPDVPPLVTFASNVGFYTVVTDWRPNQCEKHFFPDADEIIVDFPADFLRKFLIRPDDFVLIMTHHFQKDQEILHFLLEKELRYIGILGSKERTRRLLQNRKPPDHLYSPVGLSIDAQGPEEIAISIVAQLIQLIRSRKQASSPFSYLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH1974 protein
publication title Crystal structure of a xanthine dehydrogenase (BH1974) from Bacillus halodurans at 2.80 A resolution
rcsb
source organism Bacillus halodurans
molecule tags Oxidoreductase
total genus 88
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02625 XdhC_CoxI XdhC and CoxI family
A PF13478 XdhC_C XdhC Rossmann domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3on5A02
1S6YA 2DTDA 3FWZA 4MVJA 3ETEA 5CDYA 3COSA 3QJ5A 4FFLA 4E33A 4JXKA 1M76A 4U0KA 2QQ5A 4WLOA 4XYLA 4YTEA 3PPIA 1T2AA 3ZWVA 1E3WB 4C7KA 2P4HX 4FR5A 4XYGA 1GFSA 3ON5A 2YV3A 4KZPA 1A4UA 2E37A 3PYMA 4GWGA 4OJNA 1NFRA 4ZRNA 4DC0A 4KOAA 4XR9A 1XR3A 4D41A 2JKVA 1N1EA 2F1KA 1Y8QA 3GGOA 4XIJA 4BNZA 4B3IA 1XELA 4RJTA 1V9LA 3INRA 3UFXA 1NVGA 2O3UA 4L4RA 4KTVE 3B1FA 3BTUA 3EK2A 2Q1SA 1QSGA 4UREA 2R00C 2HKIA 4JK3A 2VN8A 1Y9EA 2EHDA 3H3FA 4B4OA 3MJTA 2X0RA 4AJLA 3IP3A 1H5QA 3AY7A 2PKQO 1FMCA 4IJWA 1LDYA 4B8ZA 2JD0A 2C54A 3G0OA 4YBZA 1QKIA 4F3YA 3P5SA 4E5KA 3UH1A 2V6BA 3JYQA 1DBVO 3INGA 4C7JA 2B69A 3DONA 3KO8A 4PN3A 3K2BA 3DO5A 4ONEA 1KVUA 1WDLA 1W8DA 4FFMA 4LK3A 1E7MA 4TRJA 4JROA 5JYEA 4WJZA 1ADGA 1GQ2A 2EV9A 3ENKA 4XB1A 3CINA 2WJPA 5T5QA 2VZ8A 2FPGA 2D0IA 4XB2A 5JAMA 3DAFA 1JWBB 2W8ZA 2CNBA 2XF8A 2J5QA 3V5NA 4NDNE 4CLRB 3PFWO 3DAGA 5JY6A 4OO3A 3RC2A 3UXYA 4BNXA 3QSGA 1SAYA 3SLKA 4CM9A 5CP8A 4MVJI 3H4VA 6ADHA 2Y1OA 5G0WA 3ZWOA 4R54A 5TNXA 5B1YA 2NVBA 3NUGA 1U7HA 2X4GA 1IUKA 2CVQA 5IN5A 3Q11A 2VWQA 4ND4A 4NFHA 1PJQA 4W7HA 1ZK0A 3WQRA 4BV9A 4FB5A 1BRMA 5C5IA 4ZQHA 3CZRA 1SOVA 1IOLA 1SOWA 2X0JA 3EMKA 1MFPA 1PIWA 3BHMA 4UVDA 2YQ4A 1TXGA 5T57A 4DBVO 2IZZA 3BMNB 4L8VA 5G0TA 2VTDA 4DTIA 2DLDA 5JMPA 4CV3A 3GQVA 4W9NA 4WEOA 1G0NA 4AJHA 2X5JO 3PWZA 5DCUA 3S2FA 5AOVA 1B2LA 1C1XB 1DRWA 3JSAA 2P9EA 1ZK4A 1Y5MA 3PHGA 4M8SA 3ETDA 5BT9A 2GZ1A 1YL6A 2HQ1A 2YUTA 1LU9A 1AXGA 1X1EA 3WLEA 4PZEA 2A92A 4IGFA 3B20A 5B12A 1R6DA 1E6WA 1NBOA 1PJ2A 1TVEA 3O26A 4D7AA 4PRKA 3K8ZA 3Q9UA 5CHEA 2YHIA 2DKNA 4KP7A 4CR6A 1ZEMA 4HNGA 2ZQZA 5ILOA 4A2CA 2V6GA 4CUKA 2FWMX 3ZGYA 4A5OA 1MXFA 3FTNA 3MEQA 4MVJE 1VJ1A 2JHGA 4KQXA 4HBGA 2X0IA 1PS0A 4QFDA 3WXBA 3LC1O 2CZCA 4BL5A 4J16A 2XPCA 5HM8A 1VL8A 1ADBA 4HNHA 4DRYA 5F1OA 1NHGA 1A7KA 2IE0A 2VHVA 4B3HA 1GCOA 3T4XA 1A9ZA 5JDCA 3E5RA 5CEEA 5EQFA 1SBYA 1KY4A 1A5ZA 1H6CA 3QHAA 3IJRA 5G0SA 3JTMA 4YJHA 2VHYA 4IUYA 1YOVB 1CQJA 3KB6A 1KEWA 4H15A 4P38A 2Y1CA 4IS3A 1BDBA 4EUFA 1GV0A 4IDEA 4D45A 3KLMX 1I2ZA 1BTOA 1N7HA 4BO8A 4LVUA 1ZUD1 4PLVA 4CMEC 4QSMA 3PYLA 1KEPA 2JL1A 1YB4A 1EBFA 4II3A 4D3DA 4N5NA 1W4ZA 4IBOA 4WASA 1NASA 3TFOA 5DBGA 2I67A 2FR1A 1N92A 3HUDA 2DVMA 4YJGA 3W4KA 2QZZA 3I3OA 1ZJZA 2AHRA 3RFXA 2VT3A 3VTFA 2NTJA 2UDPA 2ZK7A 2DQ4A 3H8VA 4XD2A 5AYVA 5L7TA 1K6XA 4CMIA 4AJNA 1MP0A 2OP1A 4Q3NA 2PZLA 4QT0A 5H82A 3VC7A 5IF3A 5T8KC 3GVPA 3VPHA 3GHHA 3JQ7A 4LN1A 4I5FA 4TKMA 2EWMA 2Y0CA 1QYDA 3DFZA 1PSDA 5L4LA 1RYEA 2ZB3A 1UDAA 5I9MA 1EFKA 1CRWG 3PWKA 2D5AA 4PZDA 4U7WA 2VHXA 3S8MA 1CEQA 2VYVD 3Q9NA 3WSVA 1B0AA 1GEEA 3I6QA 1I2BA 1ZKMA 4RVHA 1HF3A 4IDDA 2EERA 2LDBA 4XRRA 4WLEA 3TOXA 1PZEA 4UUNA 2E4AA 1ADCA 3O8QA 5TLSA 4FOOA 4CLEA 5IZCC 1UXGA 2NQ8A 3DHNA 4NBTA 1N9GA 1SZJG 2GPTA 1GR0A 2C59A 1QYVA 5BR7A 1B3BA 1MX3A 3F6YA 5FF9A 1ISJA 4U8GA 5KJ6A 2CDCA 1HETA 2O4UX 3AY3A 4TMFA 3JQ6A 4YT5A 1KERA 4PLHA 3DDNA 3V2GA 2VYVA 3AM5A 3DWFA 4RPKA 4Y8VA 3G79A 2OZPA 4RF4A 1P77A 3NEPX 3MWDB 3PZBA 2AQIA 1VJ0A 4O0LA 3WIEA 2EF1A 1QYCA 2ILTA 2YHIB 3LT2A 4OAQA 3MJCA 1LDEA 1U5AA 3D64A 1BMDA 2C2XA 3GEMA 4R5MA 2Y99A 4E0BA 4NPCA 4GSKA 3UICA 3WWZA 4CODB 3LF1A 4QFCA 3ROKA 4UVHA 5FI3A 5T6BA 3JQGB 2GN6A 2QRKA 1U3UA 3GRPA 1NPDA 1PGNA 4CV1A 3VH4A 3QWBA 2GSDA 3E03A 1EEHA 3SLGA 5ER6A 7ADHA 4X54A 4RORA 5BNIA 1PQPA 5G0VA 2GNAA 1V35A 1IB6A 2PZMA 5JYDA 4BQPA 3WYCA 8ADHA 1N8KA 1UR5A 2NVUA 3E18A 4XWYA 3H9EO 1E3LA 4D0RA 1ISHA 5L45A 5KTKA 3WB9A 1X7HA 4L9RA 4F45A 3RI3A 3RC1A 3KV3O 3LLSA 1EZ4A 1DAPA 4Q39A 3AK4A 2DUUA 5EL0A 4D3FA 4BKRA 4BHTA 4YJGB 3GVIA 1BDMA 3I4FA 3L4BA 5DP2A 4MVJG 4YT2A 2BRUA 4ND1A 4Q3BA 5TQVA 4CMIB 1BXKA 1OI7A 4J1SA 2AA3A 3JYOA 4CV2A 2F00A 3L6DA 3A14A 4UEKA 3WQSB 1Z45A 3E48A 3CZMA 3GVXA 1KETA 4IDBA 5ITVA 3S55A 5AQ1A 1QG6A 2PD4A 3JQ7B 4Q9NA 1WNTA 2HRZA 1T1SA 1U9JA 3AOEA 5EQDA 3PJEA 4ZU3A 1TLTA 1UAYA 1TI7A 1E1NA 1E1LA 3NYWA 4JX8A 4UVGA 4QO7A 2VNAA 3IAHA 4R1UA 3WMWA 1HSOA 1E6EA 2IXBA 3KZVA 3ZV4A 3OA0A 3RU9A 4AICA 1GD1O 4L4SA 4RF3A 3EZYA 1EK5A 3D4OA 4BGIA 4BNWA 5JPIA 1H94A 3R1IA 3C7AA 4BNHA 1MB4A 4JQCA 4IINA 1BXZA 3SJUA 3O8QB 3VH3A 1GZ6A 1C0LA 2AG5A 4BO9A 3I4CA 1ZJYA 4NH4A 5TT0A 3TZQA 2BLLA 4QTZA 1N9GB 1Z7EA 2P5YA 3I9MA 4HY3A 4PCVA 4J1NA 4H7PA 1L1FA 4E5YA 4L76A 3MOIA 1G1AA 4BGUA 2ZTLA 3E6AA 3OH8A 1Z82A 2POQX 4RDIA 3H2ZA 4LCJA 2DPGA 2EIHA 1YDWA 2X7HA 3LDHA 4ILKA 3KVOA 3U4CA 3W4JA 3WJ7A 3OF2A 3PQEA 1XHLA 4IMRA 3VPGA 3TSCA 4IDFA 1V0JA 1ZSNA 1SPXA 3QE3A 1KVQA 3MJVA 4PVDA 3U4HA 4PRLA 1R0SA 4J7UA 3RC7A 3RBZA 3FWNA 2A94A 2WE8A 2PZKA 3VDQA 3H6KA 5J23A 4N18A 3ZV6A 3FNHA 3LVFO 4GGOA 5CDUA 1U4OA 2IEDA 3PGXA 4AJOA 4KDFA 4RPGA 3U49A 4W9NC 4P8RA 3WICA 1PS8A 1EVZA 5KWEA 1DC6A 1EUCA 1HDYA 5HWSA 2Y1FA 3GT0A 4LCEA 4B4UA 4FQ8A 2P4QA 3FNEA 3ZU5A 4RGBA 3LK7A 3MJ4A 2UVDA 3T4EA 3WGTA 4DLLA 1ZK2A 1P1FA 3DBLB 4E2XA 1A27A 4LMRA 4D42A 2ZTMA 3U09A 5B4TA 1ZZEA 2RH4A 1YQXA 4UAGA 4FGSA 4CLOA 1UDCA 1WAMA 3ZNNA 2PGJA 4BO7A 2I66A 4Z0TA 1U1IA 1XYGA 3B6ZA 3NJ4A 4ZGWA 2YZ7A 2FPPA 1H6AA 1KYQA 3PHHA 2J3HA 2FSVA 4Z9YA 4U5QA 4HFRA 4YWJA 3VVCA 3X2FA 4TRMA 4ZA2A 4GX1A 4CMCA 5A05A 2NACA 2PGDA 2Q4BA 1Q0LA 1R4MA 2O3TA 4H16A 4WNCA 2CMDA 4BNNA 4Z6KA 5LDHA 1ISIA 4UUMA 1G6KA 5T64A 2H63A 3TDKA 3GK3A 4H3VA 3OJEA 4CQLB 4XR4A 1J0XO 1K2WA 2VHZA 2HUNA 4TWRA 5JDCC 3DTYA 2B0JA 4OKIA 3ZZNA 1EVJA 4XGKA 2AG8A 1C0PA 3WGZA 1Z7BA 3I9NA 4J49A 3RJ5A 4DL9A 5IN4A 1DFIA 3DZIA 3WGYA 5EINA 3QW2A 4MIOA 5JLAA 3AY6A 1EMDA 3VPSA 4CMKA 2J3JA 3H2SA 1Q7GA 3I5MA 3CXRA 4ND3A 2B35A 1QV7A 4CM8B 3SC6A 1O9BA 2GDZA 1P0FA 3R0IA 1T1RA 4PG4A 2NNLD 1EVYA 1RM0A 3H5RA 5ITWA 3B1KA 3AWDA 5ADHA 3JQFA 1IYZA 4M86A 3RKRA 4NBWA 5AVOA 4OQYA 1Y1PA 5DBFA 1BWSA 3EVNA 5A3JA 2FRDA 1DDOA 3HDYA 2OP0A 4BMSA 5BSFA 1U28A 3MOGA 4FW8A 1OFGA 1RM5A 1YBAA 2Q2WA 3F4LA 4FFPA 2Q45A 1OC2A 3I1JA 1TEHA 4I5GA 2QRLA 1J6UA 4R51A 1LSJA 5T67A 3W1VA 1NWHA 3ZWXA 2AQKA 4YVFA 4QEDA 1SB8A 5KVSA 3AFNA 1DHRA 2D5CA 4BO5A 4I08A 3R3SA 2J3KA 3FN4A 4PIVA 4TVBA 4BNJA 1NQ5A 1HYGA 2Q49A 2ZTVA 2V6FA 3B1JA 1I5RA 1M6HA 4U6SA 3KYCB 4D79A 1P44A 2E6UX 4NBUA 1PEDA 4YAEA 1UAGA 4YRDA 3NDJA 1TT7A 2ZKLA 2Q99A 4M87A 1X7DA 4EDFA 5A04A 1E3EA 4BKPA 3WS7A 1JVBA 1U8FO 2I65A 3PZRA 4J0EA 4UULA 1YB5A 2DC1A 3GNSA 1IHXA 1UXJA 4L0QA 4RVUA 4Z0PA 3EUWA 3OJFA 3V8BA 4NU6A 3MTGA 4R5HA 1PGPA 5FYDA 2Y1DA 1JDJA 3NAQA 1ENPA 4IQ8A 5BSGA 1NQAO 2DM6A 2IXAA 1LQTA 1XA0A 2OOSA 3C1AA 2VUUA 4BMVA 1XEAA 1LSSA 2Q2QA 1N7GA 1SCUA 3CE6A 4PG7A 3AW9A 3SX2A 3WWYA 3W8DA 1DC5A 1ENOA 3VOSA 3EHEA 2I3AA 3OEWA 2P2SA 1CF2O 3PYXA 2W2LA 4FJ0A 3DEYX 3CH6A 1R12A 1UP4A 3ZWCA 1R37A 5TGDA 4J7XA 3OEYA 4D46A 5IXSA 2RIRA 4KUGA 5AXDA 3RUAA 1BG6A 4A73A 4NQZA 3H7AA 3LSYA 3GDOA 4BNFA 5CDTA 4LSMA 1KEVA 4TVOA 1PWZA 1X7GA 3AM4A 4G5HA 1OBFO 5JC1A 1Q1NA 3WG9A 4MKXA 1HYHA 1MFZA 3WIDA 1HDCA 1PU2A 3ZWWA 2ZTUA 3JD1A 3NV9A 4XQEA 5TRTA 1ZSYA 4E2ZA 2FN7A 3HG7A 2J5RA 1U3TA 3HN2A 3C8MA 3JQ8A 4I1IA 1ZH8A 3GEDA 4AJ2A 4IQGA 5IDWA 4E5MA 3SJ7A 3L4BC 1HXHA 5HS4A 2H5LA 3BMOA 2EKLA 3I83A 1L7EA 2WSBA 1DFGA 2CFCA 2QIOA 3CMCO 3I9OA 4CMBA 5ENVA 1SC6A 3C3XA 3SVTA 2O3RA 4DGSA 2GERA 2BD0A 3PJFA 3SXPA 3FR8A 1U8XX 3KM0A 3ZWPA 1DIGA 1W0CA 1E6UA 3AU8A 3NJ8A 1ISFA 4R3WA 2ZB4A 5ENDA 5IJZA 3RJ9A 4DBZA 4DREA 1LLCA 2QYTA 1IULA 2BKAA 3AOEC 2FY8A 3CUKA 3ENNA 4O6VA 1E5QA 1Z6ZA 2P5UA 3VPXA 1G0OA 3UW3A 2PH5A 2QZ9A 3PLRA 3EYWA 1RKXA 3N58A 3WYBA 4GX0A 4FC7A 3VH2A 4YAGA 3ZHYA 3TZHA 3HADA 3C7CB 3CSDA 1CETA 1LC3A 4CV0A 2B5WA 5DP1A 4PG5A 3S1LA 3KSDO 3F3SA 2A9FA 3MCVA 1FDUA 4YJFA 1V3UA 2BFPA 1CERA 1Q0HA 3UN1A 4RF2A 4B79A 3VPFA 5KKCA 3L4SO 4XYEA 3WGHA 4E5NA 2VZ9A 1JTVA 1HKUA 3GDGA 3VVBA 4WCDA 2JCVA 3DBVO 3PJDA 1ZXBA 3IQDB 4OQZA 1VC2A 1ULSA 1YB1A 5KNLA 2FR0A 2EP7A 3RASA 1GQYA 4GAEA 2W2KB 1LTHR 2PA3A 3I23A 5GZ3A 1F8FA 4OH1A 1NYTA 5L4SA 3IUPA 4I9NA 3RFTA 4F6LA 4EITA 1IE3A 4L75A 4EBFA 3ADOA 3N7UA 2CVOA 4ND2A 1KEUA 2RAFA 1ZMTA 3TPCA 1PL8A 3KLPX 2GD1O 4IS2A 4GKBA 2EJVA 4I5DA 1P1IA 2BGLA 2P91A 3Q3CA 1ARZA 4WKGA 4AVYA 1XKQA 4J3FA 4FJ1A 4BKUA 3OIFA 2QYSA 5A9SB 4DIOA 3BAZA 2AE1A 3PQFA 4AJ4A 4YQYA 5JO0A 1O89A 1K3TA 3ULKA 1LSOA 5EERA 1Q0QA 3IDSA 3RU7A 1ID1A 4XEHA 5C3MA 2I6TA 3RBVA 5IG2A 1WMAA 3AM3A 3GH3A 1DFHA 1BW9A 5HS6A 4DPKA 5L53A 4YYZA 3A9WA 3QWHA 1NM5A 1DC3A 1R4NA 3IMFA 1QP8A 1OZAA 1W6UA 4XYBA 5JXWA 1GYPA 3WTBA 1PTJA 3RUEA 4J43A 2G82A 2ZATA 2PKQP 1NQOA 2VHWA 3JQ8B 1HDOA 3G49A 3T7CA 1QV6A 4NFYA 1DEHA 2DFVA 2Y67A 2Y66A 4WOJA 5F21A 1F8GA 2Z95A 2VT2A 3BMQA 3ZW8A 2YFHA 2ZB8A 4IJUA 5EESA 1PJ3A 2C29D 2PWZA 5I7SA 4GLOA 3PGJA 4Y67A 3ST7A 3ONFA 5HBRA 4JIGA 2C7GA 2X86A 2GYYA 4N54A 1P31A 3U9LA 1GADO 1YVEI 1PQWA 1MC5A 2GGSA 1GU7A 3PTZA 1PJCA 4J1QA 4JP2A 4ZD6A 4PG8A 2GUGA 2P9CA 1DC4A 2H6EA 5ER9A 5I8ZA 2G0TA 4WGGA 3RUCA 5MGBA 2B4QA 2SCUA 5JAQA 4GBJA 2EP5A 5IDYA 2JCYA 2VUTA 2O3SA 4JBGA 2UYYA 2IEBA 4ALNA 1A71A 5U4QA 1PJ4A 1HDGO 1K6JA 4IQ0A 2C2YA 4K9DA 1V8BA 4BNUA 4ID9A 4PGFA 4YJFB 3IUSA 3VZQA 4CM4A 3DB2A 1DOHA 1Y8QB 4ROSA 3KYDA 3ZWBA 1F17A 1U2DA 4KMSA 2HMSA 4HV4A 1CIVA 4A7PA 3H9GA 3BYZA 3GF4A 3A4VA 4IXTA 5F3RA 4DMMA 4B8WA 3WSWA 3JQFC 1M75A 5MDHA 2FZEA 2J5KA 4JJFA 4DPLA 4EYEA 5HA5A 3CIFA 2D8AA 3GZNA 1KOLA 3ZHBA 1LDBA 2IDZA 4Y6RA 2B4TO 3VZSA 4DQUA 1O8CA 4J4BA 3ZWAA 4BNKA 1YDEA 3LU1A 3JYNA 2GZ2A 1ZVMA 4OSOA 2HCTA 1WZEA 2FSSA 4FBGA 4J0FA 4AG3A 4CL8A 2I99A 1RJWA 2EXXA 3P2OA 5THKA 1JKJA 2Q3EA 5DCYA 3RWBA 4NK4A 1LDGA 5I9LA 4RF5A 4OL9A 5BNFA 1LNQA 4MKRA 2NV6A 4R4JA 1YL5A 1HL3A 4XZ3A 3KEQA 4DIFA 3GGGA 1VKNA 4E13A 4TSKA 1F14A 5KOIA 1MC4A 3EC7A 4NG5A 4DYVA 1WZIA 1LX6A 3RUFA 3D4PA 2NU8A 3TFQA 2UAGA 1I32A 1N2SA 3X2EA 2O2SA 1DB3A 4I8XA 4RPJA 4AJEA 2EW8A 3WR5A 2QX7A 1WDMA 2XOXA 4ALLA 2VCYA 1P33A 1R4NB 1K89A 3A06A 4CUJA 3KRTA 3PQDA 5G4KA 3GVCA 1KS9A 3FSRA 2O7SA 5L7YA 2C20A 3JD3A 4AJKA 2IZ0A 2AMFA 2FOIA 1B8PA 3GR6A 3DMTA 3H9JA 3BMQB 4IDAA 4MOWA 5KCZA 4IGEA 4C4OA 1HE5A 3SBOA 2VNSA 2Q1WA 5EJ2A 1ONPA 3DAPA 3OETA 3UCXA 4AJIA 1Y8RA 5FEUA 4XYMA 4RO0A 2Q1UA 1ISGA 4ZQEA 5TSDA 3EW7A 4BNMA 1NNUA 2VOEA 4IM7A 4XCVA 1W73A 3GEGA 1C0IA 1P0CA 2AE2A 2R6JA 3UF0A 3FNFA 5CDGA 1QMGA 4TZKA 4U6QA 4OM8A 2BHLA 1UXKA 4WE3A 5BSEA 5A1TA 1T26A 4M49A 3C24A 1AN9A 4CM4B 3NGXA 2B83A 3KYDB 2O3QA 2ZYDA 1VKOA 1U2GA 1E3JA 6LDHA 3U4IA 4RQTA 3ZNPA 3GVHA 2D3TA 1DLJA 3ZN2A 4AFNA 1WDKA 3K92A 1EQUA 1M2WA 2Y68A 3MZ0A 2YW9A 4N5LA 1GQQA 1T4BA 3WQQA 1KY5A 3GZNB 4PLPA 4DQXA 1HE3A 3TJRA 5DN9A 4YJHB 4YA6A 4FS3A 3V1UA 3AOGA 4TQGA 3F9IA 4UVEA 1U4SA 3UOGA 1UXHA 3GFBA 4CQMD 1KVRA 1MLDA 3DZGA 4HADA 1HYEA 2D59A 2I5PO 1LLUA 1PQUA 2JAHA 2X8LA 1SEPA 4E4YA 1ZNQO 3RUIA 3GZ4A 5KVCA 1H2BA 3K2EA 1EE2A 5JC8A 2VYND 1O6ZA 2WYUA 3RSHA 3PK0A 3DBRA 1R16A 2P68A 1DO8A 2NWQA 2O23A 3DBHA 4XQGA 4NJMA 3RVDA 4EUHA 4GKVA 1Z75A 4LISA 1DLIA 1LLDA 4GI2A 3QWAA 4XJTA 2NUAA 4CQMA 4INAA 4CLHA 1UXIA 3V2HA 1LEHA 2TMGA 1PR3A 4XRGA 1WP4A 2CD9A 4E3ZA 1U3WA 4JJGA 2CVZA 4WK6A 1HWYA 4JLWA 7MDHA 3GPDG 5JCJD 3IJPA 3D5QA 4RVDA 5A02A 3OM9A 4E31A 2BH9A 1EUDA 5C7OO 2RCYA 1D7OA 4UUOA 1PZFA 4ND5A 3QIVA 1GUZA 5JAIA 2BF7A 2Y0EA 4WNIA 4FDAA 1GCUA 4ZVVA 3PVZA 4BNYA 1JKIA 3JQ9A 4IZIA 3E1KA 3WDSA 1CQIA 2W4QA 4DA9A 1I3MA 4KWIA 2HAEA 3C7DB 4J7CA 1Y8RB 4EGFA 2J6IA 2X22A 4A0SA 4Z9XA 2NTVA 3RBXA 3IP1A 4CM6A 1XLTA 4KQWA 1LLQA 3DQPA 4S3MA 5DDIP 3TWOA 1DIHA 1E1MA 2EW2A 2FP4A 1C14A 3FPLA 3ZWYA 4A10A 4BS9A 3HNPA 4BNLA 4CM7A 3O4RA 5AXBA 4CPDA 3OJLA 4FD3A 3LZ6A 3DZJA 1H6DA 1JVSA 3GA0A 4WOKA 4NI5A 2G5CA 1TT5A 1LBEA 5TS3A 3GUCA 4YDRA 1DSSG 1P1KA 1NAHA 1VPDA 1Y7TA 3AI3A 3L0DA 4PLWA 4DLAA 1T25A 4FPXA 3EVTA 1UDBA 5COQA 3DC2A 5EN4A 5JFOA 2VWGA 4J1TA 3EY4A 2OL4A 4ALMA 2HMVA 4DMLA 1GZ4A 3OHSX 4Y98A 3JYPA 3PDJA 5KJCA 1EUZA 3AJRA 5A5FA 3V2UA 1KIFA 2HU2A 3W8FA 1XU7A 3MJSA 2GCGA 4LRSB 1V3TA 3TF5A 3JQAD 5LDGA 3Q1LA 1I01A 2BGKA 4MVJF 4RZIA 4HUJA 4BO3A 2DTXA 3D5TA 1QRRA 4YT4A 2NVUB 4GQAA 1Z74A 3JD2A 3PDUA 1IHYA 3A28A 2AQ8A 3BA1A 4YAIA 2GN8A 4ZHSA 1SO8A 3BMCA 2HMUA 3L6EA 1V6AA 3QWFA 3R3JA 5DCWA 1GY8A 2ZYGA 3WJAA 4BOYA 3PP8A 1P1JA 3BZUA 5BSHA 1HDZA 2NQTA 4HP8A 2X0NA 1IZ9A 3GDFA 3JQAA 2PR2A 4NJMB 2QW8A 5JW6A 3FNGA 2Z5LA 4O1MA 1K5HA 4D44A 2GLXA 3WFJA 4ZQFA 2VZ0A 2YFQA 1VSUA 1F12A 5F1KA 4PLCA 2ZCVA 5CG1A 1UZLA 3TOZA 2FHSA 2OHXA 2B4RO 3FCOA 4KDEA 5U1PA 1NR1A 3FBGA 1ZK3A 1Y6JA 4R41A 1NTOA 2O7QA 4BVAA 1NWCA 3WMXA 3OMLA 4QQRA 1FDVA 5JS6A 3GGPA 4URFA 5GY7A 4LGVA 4DXHA 1YKFA 2E49A 5DF1A 5A06A 3NDRA 1XSEA 2V6MA 3E9MA 4J90A 1ZK1A 2PNFA 4ZJUA 3PWSA 3G3EA 4R1TA 3KYBA 1NVMB 4E21A 1E77A 4HFMA 1RYDA 4NMHA 2CSUA 2AEFA 4J9VA 1SEVA 4CMGA 1NR7A 3U5TA 4YXFA 4PFJA 3FF4A 2X9VA 3JD0A 1QLHA 5KKAA 1Q2XA 1KVTA 1Y5RA 2J8ZA 3C85A 2NU7A 1PR9A 3AUAA 3OQ1A 2AEJA 4I5EA 3GG2A 2JHFA 4FSHA 2O3JA 3ZV3A 4E6PA 4IPTA 4DQVA 3D3EA 4BNVA 1I3KA 3E82A 4UVIA 1VL0A 2ET6A 2GZ3A 3TL3A 3PLNA 4WCFA 2EKPA 3JYLA 1FXSA 1B8UA 4QO8A 2WYVA 2DAPA 3D1LA 2OUIA 1A72A 2GN9A 4LRTB 3WOHA 2C82A 3DZFA 2PFGA 3GNTA 1SB9A 2QHXA 1UZMA 1YQGA 4OYRA 3HB5X 4RV9A 3GAZA 3ANNA 1E3IA 3RFVA 1WMBA 2HLPA 3H9QA 4B7CA 1AE1A 3UUWA 3NTQA 3EDMA 3LQFA 3DMTC 3HFGA 1FJHA 3WNQA 5IAAA 4FFNA 4NBRA 1PGOA 1HT0A 3NDIA 5CAEA 5LCXA 3IL2A 5CPFA 4G65A 5BNTA 1DIAA 3JQBA 4HKTA 5K0ZA 3GFGA 2RBEA 5B4UA 1X13A 3F1KA 3U4DA 5DOZA 3S2IA 3GUYA 4FN4A 4GGPA 3D3WA 1Q7BA 4P4LA 1MA0A 4CLOB 3VTZA 3BMCB 2BI7A 3STHA 4CLXA 4E32A 2BI8A 3A1NA 2HMTA 5DNAA 1E7WA 5L3ZA 5K6AA 1O5IA 1CWUA 2BGMA 2W90A 4K6FA 4MPDA 1EDZA 1HE2A 1ZXLA 3UGKA 1XGKA 1E7RA 1AHIA 3NT4A 1XCBA 1I8TA 1PZGA 3INTA 4BO2A 5TIIA 3OICA 3OFSA 2EEZA 5G4LA 2I76A 3GHYA 1C0KA 3QVOA 1NPTO 1R4MB 4WPGA 2GN4A 3ADPA 3M6IA 1PS9A 2DTEA 4N7RA 1GPDG 1ORRA 2RH8A 3DR3A 4LMPA 1OC4A 4RVFA 3UKOA 1ISMA 1O0SA 2JD2A 4OXYA 4M89A 1E7YA 4P4NA 1T2CA 3ZWMA 5IXYA 1I0ZA 4R3NA 2HK7A 3ZU2A 3QY9A 4FJ2A 3S2GA 1DRVA 1JAYA 1RM3A 4D0SA 1HLPA 5CEFA 3H3JA 4HX5A 4ALKA 1LI4A 4HFNA 4NFSA 1PX0A 2PKRA 2BFOA 3SC4A 2G76A 2DBZA 4GSLA 4JGBA 1LRJA 5L40A 4CM5A 1VE9A 3K96A 2CF5A 2BFAA 1WPQA 1EQ2A 1GL3A 3ZV5A 1ENYA 5IZ4A 2Y93A 4GWKA 4TZTA 4CLRA 1H2HA 3DMYA 1EFLA 4J91A 2Q50A 3QVXA 4PG6A 2O48X 1XQ1A 1GTMA 3K31A 4MVJP 3IKVA 2O2YA 2O50A 4TROA 4XJSA 2GF2A 1X0XA 4W6ZA 4YB8A 2IRWA 1IZ0A 4L4XA 4AJJA 3PEFA 2ZJ0A 1BXGA 4YPOA 2B36A 3RQSA 4OXKA 3G17A 1YBVA 4ITUA 5ES3A 2B37A 4RVSA 2DFDA 3UVEA 1GPJA 3WNVA 3KUXA 3QVWA 4BNTA 1NHWA 1D1TA 4RLSA 5JNLA 3OECA 5DZSA 2JFHA 2BMAA 4WUVA 5JDIA 3JQ9C 2X58A 1E5LA 4MDHA 3QV1A 1QR6A 2ZQYA 4RL6A 4R9SA 1SMKA 3GRKA 1D3AA 5EPOA 3HQ4O 1VM6A 1H6BA 3KHUA 1O94A 2D1YA 1YBMA 3DZHA 3G1UA 1C1XA 1EBUA 4MO2A 1RM4A 2HK9A 2VWPA 4EJ6A 3F5SA 3PHIA 2JJYA 3D3WB 1NQTA 4BNIA 4YR9A 3L9WA 4ZQGA 4BO0A 4RPHA 1YJQA 3HN7A 4Z9FA 3NT5A 4KTTE 2WM3A 3W6UA 1CYDA 2PD3A 1J49A 4LVCA 3ZH2A 2XXBA 2YV2A 2Z1NA 1GDHA 1LUAA 4Z3KA 3WYEA 2IZ1A 5BQFA 1EVIA 2NU6A 3ICPA 3WTCA 3BXXA 3RCBA 1Y81A 2WE7A 3GPIA 1LDNA 2Q1TA 3QP9A 5IFLA 4BV8A 4IJVA 1NVTA 4HWKA 3RC9A 1I30A 1S7CA 1A7AA 1MV8A 1XQ6A 4I9HA 2RHCA 4IJKA 3LT1A 3WGQA 3JV7A 2NSDA 4YACA 1XIVA 1HZJA 3ASVA 3CPSA 4FIZA 4IZHA 2GR9A 5F1PA 4F46A 2IYOA 3WBFA 4R1SA 4BUCA 3N74A 3OJOA 1KBZA 1YOVA 2ZIZA 1L7DA 4DC1A 1VSVA 8LDHA 4NNJA 4A03A 1GEGA 1LJ8A 4XIYA 1VJTA 4RPLA 1MG5A 4CM9D 4GLLA 4UEOA 4CMAA 4J6FA 1I36A 3HWRA 3DHEA 2W98A 5COAA 1T4DA 1DRUA 1ULUA 2A35A 3IIEA 5TJHA 2X6TA 3PFFA 2JFGA 1B15A 4B7XA 1PJTA 5CEJA 1ZO8A 2G1UA 1DAOA 1HSZA 1D1SA 1ZCJA 4BKQA 4U0JA 2VTEA 5TF4A 4EI2A 5AXAA 4CL3A 1YE3A 2EG9A 4DUPA 3GNQA 3BMOB 3CKYA 4TRRA 2WWRA 9LDBA 2VUSA 1U3VA 4EJ0A 3MTJA 4B7UA 4J2OA 5B37A 1JAXA 2YDYA 1AGNA 2OFPA 4BKOA 3U3XA 3DXFA 1BXGB 2DPHA 3AUSA 3ROPA 1MXHA 3KOUA 3IC5A 2OXIA 1YXMA 4OMUA 5DOVA 4B4VA 1XWFA 1X14A 3L07A 3EZLA 4YEDA 3WFIA 4BNGA 4WEQA 2YQ5A 1GAEO 3PI7A 1DIRA 1FDTA 2C5EA 2FZWA 2BELA 4CM3A 2HJSA 1T2EA 1NFQA 5TT1A 4BB6A 4KWHA 4A26A 4PVCA 1Y9AA 4AJPA 2D2IA 4Y9DA 3HDQA 4PLZA 4E2WA 4K26A 4KUHA 1HZZA 2Y05A 2X5KO 4W4TA 4MJLA 3HSKA 1P74A 1U7TA 3RROA 3ETGA 1QXSA 4WECA 4LSWA 5DT9A 2D4AA 1HEUA 2DBRA 1ZEJA 2UUOA 3BTOA 3FR7A 3IKTA 3ROQA 5GZ6A 2AW5A 4OOFA 3TQHA 1NP3A 1WW8A 3KTDA 4NK5A 4WCFC 4DPMA 1HE4A 4E5PA 2QRJA 3ITDA 1Z73A 4PZCA 3W6ZA 4EUEA 4OIMA 4XKJA 1KVSA 3L6OO 3C1OA 2CDAA 1RWBA 2G17A 4YAJA 5G2OA 1ZMOA 1LDMA 3JQGA 4IY1A 2YYYA 3LC7O 3RIHA 4HXYA 1RPNA 1JN0A 2AXQA 4Z3DA 3GOHA 2PGLA 3S2EA 9LDTA 3LYLA 1LA2A 2IYPA 3AI2A 5C7IO 4R69A 4XQCA 3JQBC 4YT8A 4WLVA 1BGVA 1DJNA 4XDYA 1JU9A 1NPYA 1BW9B 2DU8A 2NVWA 1P9LA 2ZYAA 5ICSA 2WEKA 4CR7A 2ZJ1A 2XXJA 3ZWNA 2EKQA 3VZRA 3BTSA 2NLOA 3D4NA 1R0LA 2IODA 5K6AC 2QG4A 5JSFA 1R66A 1IPEA 4J9UE 3WGOA 1AHHA 4XA8A 4B3JA 5KJ1A 2PK3A 2CUKA 4ALJA 4MINA 3DZKA 2PLAA 1YL7A 3NGLA 3UCEA 2WYWA 4HFJA 1PJSA 4M1QA 2PZJA 3FI9A 3TNLA 1UH5A 4O5OA 2NM0A 3ZHXA 4E12A 1EDOA 3E9QA 3UHAA 4OXNA 1BHSA 4OOEA 3HJAA 3O38A 1M66A 1YQDA 1B26A 4UEJA 4Q3CA 2H1SA 3UCFA 3GN2A 4GVLA 3AUTA 3TL2A 3WLFA 5L95A 1FDWA 4R01A 1QYWA 2VOJA 4UUPA 3K30A 3VH1A 3HE3A 3RUDA 1K0UA 4YRAA 1BVRA 2AQHA 1LSUA 4K28A 2Y0DA 2WD7A 1OMOA 3D0OA 1NXQA 1P3DA 1XG5A 3I52A 3GMDA 3FRJA 4CUZA 4GX5A 3HFSA 2X5OA 3F46A 4R68A 5JAZA 4W82A 3LLVA 4FOSA 4XQ9A 4K6CA 5GZ1A 5A9TA 4YCAA 2I3GA 4PLYA 3BTVA 1KC3A 1X15A 4II2A 3PJGA 2OMEA 2DBVO 4IDGA 2WD8A 3ORFA 3PRJA 5AXCA 1UUFA 1LRKA 2GASA 1D8AA 2ZB7A 3B70A 5I8WA 1NAIA 1E1KA 2J3IA 2FR8A 1X1TA 2DUWA 5FFFA 1C3VA 4JBIA 4W99A 4RCVA 3SEFA 2C5AA 1XDWA 5TX7A 4WLNA 4PLTA 4CJXA 4GL4A 4GMGA 4JCOA 1JA9A 2O4CA 4BGVA 2AEMA 1H0KA 4Y6SA 4GX2A 4YJDA 2VRCD 1M67A 4O63O 4QX6A 2C7VA 2JD1A 1I2CA 4IIVA 4W7IA 2PTGA 3JQCA 1SNYA 2A4KA 1N1GA 3PXXA 4L73A 3FHLA 3K5PA 5I7FA 2FMUA 3ZDFA 5F5LA 3G1TA 5L9AA 4JP3A 1I3LA 2Q46A 1YO6A 1E3SA 4QXMA 5JDIC 4AJ1A 1HLDA 1ZSVA 2VRCA 5A03A 5A4DA 3DBLA 1P1RA 1QYXA 1IPFA 2HDHA 4CLDA 3NT2A 1TA4A 5A5EA 3FTPA 5JE8A 3NRCA 1DIBA 4P4GA 1QLJA 2X1HA 5TC4A 2PH3A 2VYNA 3ZI0A 4NU5A 5G4KB 1K6IA 4TRNA 3U62A 3PIIA 5JO9A 4MP3A 4EJMA 3ZCXA 5K9ZA 1H93A 1GUYA 3BHIA 1VRWA 3T7EA 5F5NA 4NHEA 1T2FA 4F6CA 2Z1MA 3VKVA 3P7MA 3Q0EA 3V1TC 1I24A 3KETA 3DFUA 3LT4A 4FC6A 4MVJH 4CQLA 3NTOA 1JWAB 3CEAA 3NKLA 5JCJA 4BGEA 4DIBA 2HJRA 2EGHA 3DOJA 4ESOA 3AFMA 1FK8A 3ANMA 1A4IA 3QQPA 3IS3A 3AUUA 2TMDA 3FBTA 1B16A 5JBIA 1UP6A 3ZNOA 3VZPA 4XGNA 1VL6A 3LT0A 2WD7B 4DWVA 3GAFA 1PGQA 4A27A 3OA2A 4MIYA 4I9UA 1WXDA 1O95A 5KVQA 2HMWA 3CTMA 3K6JA 3KBOA 2PV7A 1ONNA 4CM8A 1NFFA 4R16A 4JN6B 4RDHA 3RKUA 4FFRA 3FD8A 4BQRA 2P9GA 1VLLA 3OBBA 2B5VA 4EEZA 3AI1A 1Q7CA 3JD4A 4BO6A 4DVJA 1FF9A 4K1LA 4CMHA 1JLLA 5JY1A 1WWKA 1F06A 1DHTA 2R00A 3QVSA 3I6IA 5CG2A 4S1VA 3EAGA 3BIOA 1YS4A 4L74A 1GYRA 1H9AA 3WBBA 1WVGA 5CPBA 3L9XA 3GY0A 3Q2IA 1J5PA 1MUUA 3KXDA 3PHJA 3OSUA 5KJFA 5HRUA 1LRLA 1UP7A 2X23A 4MIEA 3CMMA 4IIUA 1YGYA 1ZIDA 4BMNA 1ENZA 2DBQA 4FCCA 5EMHA 1GV1A 4YAKA 3DL2A 1DPGA 1H9BA 5CFZA 4OHUA 1N5DA 1UZNA 3P2YA 4PLGA 4P22A 5G0UA 1ONOA 3DBRB 3F1LA 3KYCA 3DBHB 1OOEA 2UUPA 3NTRA 3FPCA 3AU9A 4J4TA 3I9KA 4CQMB 5B4VA 1YJ8A 4D43A 3M2PA 1MGOA 3ABIA 1YWGO 3W8EA 2RHRA 3K73O 3GLQA 1CDOA 4R9RA 4Y6PA 5GMOA 4Q3DA 4IMPA 3RD5A 2Q4EA 3EGOA 3F5QA 4R1NA 2UV8A 2XAAA 1AUPA 1HTBA 2Y1EA 1E0DA 4G2NA 4RVGA 1R15A 3HDJA 5CDSA 3RAJA 3ZU3A 3GG9A 3E9NA 3OQ6A 3VKUA 4DYDA 4NBVA 1B7GO 2GRAA 2H9IA 2HRBA 1GZ3A 4ALIA 1DXYA 4GH5A 1DJQA 3VAZA 4OSPA 2CF6A 3HZZA 2OO5A 2EGGA 4BO4A 3H5AA 3DOCA 3GMSA 2YJZA 5EIOA 1M6WA 3HDHA 3MJEA 5THQA 4G81A 2VWHA 4ZQBA 1C1DA 4IXWA 2VQ3A 3C1TA 4Q3AA 3NX4A 4QUKA 1BSVA 4EZBA 3WGGA 2WMDA 5A3VA 4OGWA 5IDQA 5FWNA 1U5CA 1AXEA 1TT5B 3QLJA 3WGIA 1UJMA 2R2GA 3JQEA 3IOYA 3OIGA 1WLYA 2DT5A 4JJIA 4GMFA 2E48A 5DULA 2NTNA 4IDCA 4B4WA 4ZN6A 5COBA 2JAPA 4MP8A 4ZRMA 1XU9A 4RQUA 5LC1A 4XGIA 1I33A 3UAGA 2OBYA 3M1AA 3QA9A 1E7QA 3MWEB 4M55A 1B8VA 2YDXA 1ZBQA 3O03A 3DOOA 4LW8A 3PIDA 3OQBA 1IY8A 1JW9B 3D7LA 3P19A 3ZNQA 2OGUA 5JCXA 1PGJA 4FGWA 5L4NA 3Q6IA 2HO5A 4CMEA 2PD6A 4MP6A 4RLHA 4GVXA 3F47A 4WLUA 4BB5A 2X9GA 1BVUA 2HK8A 1HDXA 3ZHZA 1MG0A 1TB4A 4YRBA 1PL7A 2OORA 4J2HA 3VDRA 5I7VA 3V1YA 4NZ9A 1E3WA 3WX0A 3H5NA 5HTOA 1PJBA 1T24A 1V3VA 4YQZA 4QECA 3E5MA 2CDBA 4NR0A 1YH3A 4PLFA 3H65A 3JQAB 4RZHA 2V65A 3ANLA 1E92A 2LDXA 3L77A 4WLFA 4CR8A 5FI5A 3ONDA 1IL0A 2JCXA 2YY7A 4D3SA 4E30A 5IDXA 2NADA 2CY0A 5T8KA 2NU9A 3KEOA 5A9RA 4MKZA 4OKNA 3F4BA 4XX0A 3DZBA 3U0BA 1LXCA 1GYQA 1PWXA 1NX6A 2W2LD 1OAAA 2ZCUA 1YONA 3BHJA 3OIDA 1B3RA 4JNKA 5I9NA 2JFFA 3KSZO 2W2KA 3Q2KA 5U9CA 1ZFNA 3QRWA 1LQUA 3RUHA 3QVTA 1VI2A 3KSUA 1LC0A 4TKLA 3M1LA 2BFMA 2YHUA 1GUFA 2OBNA 3R6DA 3TZ6A 4JBHA 3DTTA 3ICCA 5H81A 5DBIA 1KC1A 3PHLA 3OJ0A 3HHPA 3ITKA 1CJCA 2WDZA 5TJ9A 4BIIA 4EW6A 3JQDA 1X0VA 4XDZA 4Z0HO 5JMWA 4ZICA 1ML3A 4O59O 5IZCA 4J4HA 2I9PA 1ADFA 5ICMA 4AL4A 5KIAA 2PY6A 4NJOA 4GPD1 5A9SA 5L7WA 1C1DB 4CMJA 4Q3EA 4NIMA 3LF2A 2E82A 3DHYA 4FFOA 1PJLA 3OP4A 3W4IA 2HSDA 2Q2VA 3ASUA 1T2DA 1B14A 5C37A 1FDSA 4EEXA 1F0YA 1I10A 1JKFA 2C07A 3M2TA 3O9ZA 1D4FA 4WCFB 4E2YA 1PZHA 3ONEA 1A9YA 2EJWA 1JQBA 1YRLA 2FPIA 3GC6A 5C7LO 1E7SA 5KJEA 4DLBA 3HB4X 4KUEA 2C0CA 4N5MA 1EE9A 1HDRA 1I3NA 4M54A 1P45A 2GO1A 1QORA 3H9UA 1EK6A 4MVJD 5KVVA 3TZKA 1HRDA 2VRBA 5L51A 2X9NA 4MVJM 3JCZA 2WTBA 3BMNA 5I7EA 3TRIA 3LC2O 4BO1A 3QWIA 2V7PA 3TN7A 1P1HA 3I9LA 2YV1A 3TZCA 3VHRA 3ZW9A 3GN1A 5ILGA 3E8XA 4CM1A 1J4AA 1ZW1A 5H83A 2Y1GA 1R0KA 3K9QO 3ROMA 1PL6A 3ZU4A 3I9JA
chains in the Genus database with same CATH superfamily
1GPBA 2C4KA 1S6YA 3U13A 4C6TA 3WKEA 1ZM2A 4US1R 2J3DA 3GJYA 1M76A 3IR6A 2GF0A 3PV0A 4A2QA 1D8TA 1GVHA 4UZEA 5INTA 2V1UA 4YFVA 3PPIA 1T2AA 4LXTA 1Q1AA 4G26A 1BU5A 5J2UB 1P0QA 1YQTA 4IXMA 2Q3FA 2ONYA 4FR5A 4XYGA 3ON5A 4KZPA 1CUYA 4F9FA 4GWGA 1F38A 1PFKA 4OJNA 5B1SA 4DC0A 1GPYA 4DXAA 2C2BA 1O95C 2VH1A 4JJAA 4A0QA 5LOVA 4TZ6A 1N1EA 4AWAA 1JBQA 3GGOA 1UKCA 3FG9A 4EQZA 1RQ2A 5TVGA 4Q82A 2XVXA 2AFHB 3WNDA 1HG0A 1XELA 1Y89A 3R6TA 1V9LA 4B3IA 1C7RA 3VSBA 1OZHA 4TTIA 3UFXA 4G8CA 1KQGA 1IQ0A 2GM3A 4OQXA 2IVZA 4L4RA 3B1FA 3T7TA 1XZIA 4Q47A 3KCQA 3EK2A 4UREA 5FR2A 2ZB2A 1FVFA 2HKIA 1T13A 1TLFA 2NT4A 1Y9EA 3H3FA 1QFSA 1NVBA 4B4OA 3MJTA 1Y3CE 3UV7A 2X0RA 4EY7A 4CCAA 3FZGA 2ZSBA 4HAXA 3IILA 3IP3A 1QO0D 1YUBA 1H5QA 3U80A 1G2IA 4I36A 2PKQO 2P62A 1FMCA 3EOZA 4MCHA 4B6RA 1QP7A 1LS6A 3WO1A 1KWGA 3G0OA 1D5WA 2RGGA 2GUWA 4L7QA 2F67A 3VC2A 1SN7A 4YUWA 1ADJA 1EFPB 1UFRA 2V6BA 3JYQA 3KPJA 1CZKA 4TV9A 1KRHA 1ZGCA 4I66A 1AS0A 1WDLA 3OFND 1NNSA 2ZRJA 4LK3A 2ACWA 2W70A 1I2MA 3BH7A 3E9CA 5JYEA 1ULBA 2WJPA 1RI5A 3CINA 1R8SA 5DU2A 3HB7A 4R2LA 2ZXFA 3KAQA 5E38A 5JAMA 2SNIE 3AHDA 5JROA 4NDZA 2CVPA 3O91A 2CXUA 4NDNE 4CLRB 2HQSA 4BATA 4R8MA 1UT8A 3GD7A 4B3SB 4LF5B 4TXNA 4OO3A 1Y4UA 4MPTA 5KZMB 1BXRA 1P6XA 2FW0A 2OAGA 3QSGA 4FMDB 4PHHA 4XTCS 2PMKA 3W7VA 4R2MA 2E1PA 4ENRA 6ADHA 4G9BA 2XJ9A 3EEFA 2NVBA 3NUGA 5F7OA 1U7HA 5TF0A 2WPNA 1IUKA 2XTMA 2RKOA 5BWBA 3DFMA 4C76A 1M2GA 5BNWA 3U26A 4URVR 4MI1A 1AKYA 1P5ZB 4ZVRA 2VWQA 4ND4A 4H08A 4NFHA 3O2SB 1VYHA 4NV1A 1ZK0A 1JR3A 2Z6VA 5DGTA 5DRTA 4NLLA 3SHVA 3UJPA 4KFSA 2FWIA 4ZVQA 4HQLA 3IHLA 1G8HA 4CG0A 3VBEA 4ZQHA 5BW4A 3F6RA 1IOLA 1SOWA 2X0JA 2GA8A 1PFWA 2HW8A 3BHMA 1OWNA 5E4FA 5HDBB 5LBUA 4C0SA 1CUCA 2VTDA 3KZMA 3ND7A 5G0TA 4DTIA 2BKXA 1J2YA 3GQVA 4W9NA 2X5JO 1LQ2A 1YHYA 3BILA 3WWCA 2QMQA 4ZCTA 3FTFA 3L7OA 5DCUA 2RGXA 2EX0A 1FP4A 3HZOA 3PHBE 4UAVA 1PFVA 2CGEA 3AEUB 2OZVA 2II6A 2XB6A 4PYJA 1M2VB 1VIDA 1TLLA 3BH0A 3IDQA 1DKLA 2ZP1A 3JSAA 2GB4A 4MI6A 1KEEA 4M8SA 3ETDA 3GT4A 3LKDA 4ZEWA 1V8ZA 1YL6A 4C6TB 3EGWA 3JY6A 2YUTA 4GUDA 4UCWA 1NG1A 4AMUA 2OCAA 4WUTA 1OVMA 1X1EA 3MTAA 1IMOA 1QO7A 5H68A 2LIVA 2AJCA 4D7AA 4D92A 1QBGA 3MWDA 5F2NA 4PRKA 4LZOA 4EL5A 2WG0A 5LIRA 1I5EA 3IV7A 2VZLA 1U0SY 1ZEMA 3WE7A 4CR6A 4BLOA 3LSTA 1G42A 1MTZA 4ITVA 1JHMA 3TIIA 4MQFA 2V6GA 4BLQA 4ZGGA 4D25A 4CUKA 2Y2UA 4ETIA 1MXFA 2ZJOA 2CVHA 2X5NA 3MEQA 4LE0A 4TXMA 4KQXA 4HBGA 5FADA 1PS0A 2F1OA 5CVUA 5IVPA 1N2BA 1P4RA 4PAGA 1R5NA 2VP5A 2VXYA 4J16A 2XPCA 4JBLA 3I28A 1HNNA 1HT2E 4MITA 3FDFA 4EFDA 2BGIA 5HKOA 3X1DA 4B3HA 1L8XA 4AQ7A 1M72A 2OGSA 3E5RA 4KDRA 5JDCA 1QQAA 1G5FA 1CJSA 1A5ZA 1H6CA 3F5DA 3QHAA 4RPCA 4EI9A 1VRCA 3VR2A 1SU8A 1TF7A 3L0OA 3CVWA 4H15A 3R8CA 4P38A 2Y1CA 4JJ4A 4IUBS 5I6DA 1BDBA 1U11A 3OKAA 2EATA 2QE6A 4D45A 3AB7A 2IELA 3TNYA 3DKKA 4I6GA 1T0HB 2XY4A 4NY1A 5FPQA 5KDLA 4CMEC 2JLZA 1KEPA 3ZJ4A 1EBFA 2R6DA 4OI4A 1AU9A 5G3ZA 2JAXA 1EXMA 1JG7A 2I78A 4FZ3A 4IBOA 4N5NA 3T0FA 1NASA 3V2IA 1O6GA 2XUOA 5DBGA 1J56A 2YCLA 1OXVA 1DBWA 3LZCA 1YB2A 4REOA 3E53A 4EY4A 5E4YA 2N1MA 1A2BA 1TJ3A 2R97A 3LFHA 4YJGA 1QHSA 1KDTA 4JLVA 2UZ3A 2AHRA 3GMIA 2VT3A 3P4XA 3VTFA 4U39A 1DCMA 2UDPA 2GI4A 1ZJJA 2DQ4A 2ZK7A 3H8VA 4ZOLF 3RE1A 3PC4A 3ZQUA 3GZJA 4U4AA 1S01A 2XX3A 1TGYA 1V16A 4F5EA 2OKCA 4URWR 4AJNA 2AOVA 1BXRB 4YROA 3T1HB 2PZLA 4MVCA 4F8EA 1ZD8A 3DO6A 3EGXB 3HZHA 3COVA 4GOXA 3I2YX 3VC7A 3VDNB 3VR5H 4DMRA 4G0UA 4PC2A 4R9VA 5T8KC 5BV7A 3BRQA 3JQ7A 4YP6A 4LN1A 5HZKA 5AW0A 2EWMA 1IB0A 2B6HA 4YH1A 4UHEA 1OW3B 2IYVA 1JSXA 4JEHA 1PSDA 3B82A 1TAGA 3RSZA 5HRCA 2JGDA 3L0YA 3UXMA 1ODLA 1UDAA 3QTTA 4E2FA 1NQXA 2B1RA 3ER9A 2JVKA 4Q24A 2O7NA 3HBAA 4I3GA 1XOIA 1XAIA 2IZ7A 4MUBA 5K99A 3EWSA 4U7WA 2VHXA 2VT6A 3TGLA 1M34A 3R44A 1CR0A 3RHSA 1G38A 3WP1B 3CNNA 3N2GB 3Q3JB 4ZOCA 1HF3A 3IJ5A 4OHKA 2WJ4A 3X1JA 2EERA 4QAJA 3P0HA 1CULC 1YR7A 3X1MA 3C6ZA 2RJ3A 4UUNA 5DM70 2WWFA 4R84A 1JR3E 1T91A 1R0ZA 1Y34E 3KFLA 3A37A 3O8QA 4HWOA 3EZNA 3ZTTA 3ESZA 5HKBA 5HK8A 4RH0A 5TLSA 4LF7B 3GEIA 1UXGA 4B32A 3AINA 4NARA 4V0RA 4A16A 2IVFA 4NBTA 1RJGA 2BBWA 3AKZA 2EX4A 5LMZA 2GPTA 4QBKA 4XD7D 1QYVA 5BR7A 3TDNA 1MX3A 5FF9A 3FOBA 5MN6A 1FTQA 1P3JA 2RGCA 2CDCA 1TTHA 2O4UX 3AY3A 4D81A 2MSCB 3C16C 3RRJA 3WA7A 1EVEA 3QVKA 1KERA 2SBTA 3V2GA 3E15A 2OCIA 4H1WA 2QN7A 3AM5A 3DWFA 1V1RB 3OCUA 3G79A 4RPKA 4Y8VA 2VDQB 1P77A 5E0OA 3MWDB 3PZBA 4GOLD 1VJ0A 2ILTA 1PVOA 3CEMA 1RZRA 2BTOA 5AUOB 1LDEA 3O9VA 3PNSA 2FWBA 1U5AA 4XFDA 4MQFB 3TQQA 5CB4F 4NE7A 3HLKA 4DSUA 4MRPA 3N87A 1A4RA 2FF5A 2GQ0A 5KYUA 3QE0A 4MHOA 2G6BA 3E2IA 5LDDC 1F51E 3TKLA 1QYIA 1SXGA 1FL9A 2ZWPA 4R5MA 4NPCA 5B1IA 4GSKA 1Y6ZA 2XAUA 1UFVA 4CODB 1BOOA 4R83A 3FMIA 4F9GA 4JQOA 1CK4A 3JQGB 4C2BA 4PAMA 4CV1A 4CNBA 2GSDA 3C3JA 3RYHB 3E03A 2ZRPA 3V3KA 2ZJ7A 3F8TA 3IP5A 4X54A 4JBXA 3CZ5A 4RORA 3RWOA 1N8TA 1Z0UA 2VBIA 3HB1A 2EZ4A 1P0IA 1XHEA 3MBIA 4P54A 4JB3A 3VBCA 3WYCA 2VXCA 2NVUA 3MHPA 3E18A 4XWYA 1FXWF 3H9EO 3I2FA 1P0MA 4XUEA 5FT9A 3P9QA 4R98A 1Z5GA 5D5HA 4CG1A 5HIAA 2K7FA 4WERA 2NXCA 3NU1A 1B6TA 4QNMA 4WV3A 5I4IA 3L40A 5JQGA 2HHAA 4L9RA 4YJ3F 1Q3KA 2BR3A 3RC1A 1II0A 1KS2A 1L4YA 1B42A 1L1QA 3IA7A 3KV3O 4JR2A 1EZ4A 1DAPA 4NOJA 3AK4A 4Q39A 5EL0A 5L3RA 4D3FA 1O77A 4YJGB 4BHTA 3GVIA 1LJUA 1BDMA 4R2XA 1QCCA 3ILHA 4UPEA 4P0PB 3I4FA 3L4BA 5EI5A 3WMEA 4E7PA 5KSZA 3PT5A 1N6RA 2PSEA 4EUEA 4Q3BA 1FPMA 3AUJB 2FZ5A 3I12A 4MWDA 1M73E 2AD1A 1V16B 4KK3A 4F06A 4PNEA 3JYOA 5AHWA 2G9VA 5I4BA 1PT5A 4UEKA 3WQSB 4TLAA 1R5OA 3QNWA 1Y82A 2J3EA 4P5DA 2QX4A 3GVXA 2XD9A 3S55A 5FUWA 3JQ7B 3TL6A 4MGIR 4Q9NA 4IRUB 1T9KA 1GQSA 2G06A 3HXKA 4IXNA 4C4TA 1MABB 3TZLA 3CXUA 3PJEA 2JGDB 2QSUA 4B6JA 1RC8A 4TTJA 3BXFA 1GGKA 1XDUA 4JX8A 4IYJA 1D07A 1D2GA 5FOUA 4R1UA 2AIRA 3BUSA 4YR7A 4JVNA 1FUKA 4BFUA 4ICIA 1BX3A 5K0EA 1XDBA 1AKUA 2ZRIA 3RU9A 2QTAA 3SSMA 2PO7A 1M34B 3F5MA 2TSYB 4L4SA 3FFAA 4BNWA 4FBMA 1PD1A 2QTHA 3T5BA 2NZUG 4HYYA 2Z8ZA 2A33A 4TLLB 1Q77A 1J00A 1EHCA 2XOEA 3CZQA 3O8QB 2AG5A 3N0WA 3G2LA 3WNCA 2XUPA 3GB9A 3EDOA 3W04A 3UZUA 2XEXA 2XMZA 3NHSA 4R1MA 1Z7EA 1QF7A 3E22A 5F64A 2P6RA 1PR4A 1K66A 3CC8A 3Q7SA 4Q7QA 1M34E 4ESVA 1U7XA 4DQLA 4HQNA 5JYBA 3L4JA 2E5WA 2W2PA 3BXZA 3TIGA 3LKBA 3PEEA 3LO5A 5TVKA 2Q5OA 3QOFA 4LYJA 4F4CA 1OLSB 3OQIB 2J7PD 2QEQA 5E7JA 3V8QA 1TJ5A 1Z25A 4Q7EA 1EGMB 4LCJA 3O2NA 1PJZA 2EIHA 1YDWA 2X7HA 3SHQA 1XRJA 1OLOA 3JRNA 2Z9BA 4D4MA 2W2QA 3PQEA 5K8UA 3TSCA 2BBTA 4IDFA 5IMSA 4U7PB 5F73A 4RJLA 3NBUA 4GGMX 3FCXA 5JZMA 2EYUA 3L05A 5KX5F 3PNMA 4PVDA 3MJVA 4YMIA 1LBTA 2Q0QA 5HJ7A 3L5OA 1OXKB 1WUYA 3FWNA 4O4IA 1KJ9A 2P2YA 2PZKA 2WKWA 3VDQA 1TIBA 3C6KA 3FNHA 4G4GA 2JZNA 3BJEA 1MHPA 1U4OA 1VCOA 2FW9A 2GYVA 1N2CA 2IEDA 2VYFA 3IR5A 5C3UA 4KDFA 1ORVA 4RPGA 3FPFA 4W9NC 4WFKA 1HUQA 5AUNB 2QPOA 2ZJZA 2DULA 2WUDA 4IMIB 2X1LA 3K20A 5AICA 3BL5A 1E2EA 3GT0A 1JBEA 1F9AA 2W8BB 4L9AA 5F2KA 2P0AA 3WGTA 1EG2A 5DX8A 1F1JA 1RP1A 4LMRA 2IYEA 3AHEA 1MAAA 2B94A 1O57A 3U31A 1RWMA 1ZZEA 4Y6GB 3HCAA 2RH4A 4DQ0A 3WGLA 1YQXA 4UAGA 4CLOA 5JQGB 1WAMA 4YRLA 1HFEL 1K63A 3ZNNA 4BLTA 1J2TA 2I66A 1U6KA 1U1IA 1XYGA 1Y98A 3OZTA 5LQAA 2E6KA 3ZC3A 3L7DA 1ORTA 1NSYA 4W5RA 1H6AA 3NGMA 4QJIA 2FSVA 5AI0A 4Z9YA 3EE6A 1E8NA 4Q4CA 5B3LA 1WZCA 1SKAA 1KJQA 2F2TA 3H97A 1U7WA 4QRHA 5DHRA 5DSTA 3SDZA 3MWLA 4GO1A 4CMCA 5A05A 2N46A 1EX1A 5TS2A 3TCXB 5FPSA 2V0GA 4QULA 4YHBA 1R4MA 3AVPA 4J3JA 2Q5HA 4A3SA 2GM5A 1T0JB 4Z6KA 4L28A 1RXYA 4WK0B 3GIDA 1LGYA 3PCTA 4J16C 1G6KA 1YUMA 3FHJA 5T64A 2WF7A 4B6FA 2PE5A 4KR3A 4ZHQF 4LYHA 4OHRA 3TZEA 4FNGA 4BC1A 4TWRA 4UAJA 1IBSA 1OE0A 2ZJ6A 3DTYA 5JDCC 3WWOA 4OKIA 2JIRA 2FPUA 4EHAA 3U1BA 1X80A 2BR4A 3IE1A 4XGKA 1FNBA 3SZRA 4DTCA 3OU6A 4X85A 3LX4A 1QIFA 1EHYA 1WBJB 3WGYA 1BQ4A 4MW1A 2R68A 5EINA 1QGAA 2JATA 2ORED 1DXOA 1EMDA 3AY6A 1IHDA 1TQHA 2J3JA 3VOBA 4HNVA 4D9HA 1Q7GA 3T8YA 1ZONA 3QNUA 1XCGB 3VISA 5HIJA 3MTBA 1QV7A 1SD5A 1D4OA 2HRCA 4PTYA 1EWTA 4QHTA 3T4PA 1TC1A 4CM8B 3SC6A 4F11A 1JQJC 2WJAA 3DUWA 2Q0SA 5CT6A 3VR5D 1O9BA 2XODA 1P0FA 1YZLA 3L79A 2BZ0A 1VDZA 1I4OA 4TLEA 1EVYA 1I14A 1PVVA 3H5RA 3ZXIA 5CA0F 3B1KA 3EWIA 1GKUB 3ZQ6A 1JLLB 1L5HB 2CMGA 3JQFA 1ZOIA 3V6MA 3AVVA 2QK4A 3V6LA 4RY9A 2HGSA 1ZPDA 2OCPA 2RK3A 4KXVA 4Y1FA 1G6OA 2ZSIA 1XQ9A 4D9JA 4EELA 1VXOA 2FX3A 3EVNA 1GZSA 4O2BF 2VF7A 4JGGA 1DDOA 3HDYA 2OP0A 1CHDA 3K1YA 4BMSA 5C8DA 2H8GA 1FSGA 4FW8A 4GOJA 5HIMA 4MUIA 2Q2WA 3R5HA 1U3CA 3PCRB 3NYQA 3I6YA 1OC2A 4RY2A 4ZREA 3UW1A 1Z8FA 5K0JA 2QRLA 1L5YA 1Q7RA 3W1VA 1NWHA 1R8YA 1JLKA 2GPJA 1TJ4A 5DNDA 4HN9A 2XB2A 2XSZD 1IBRA 4TS1A 2QMEA 2ZAGA 4KAXA 4M8IA 721PA 1MJGA 1YQWA 4K5QA 5KVSA 4Z3OA 4M60A 2J3KA 4O4IB 1TQ4A 4TV8F 1CY0A 3QI7A 3BFKA 3N0TA 1XALA 4L0MA 6Q21A 5FL3A 1OFUA 1N2CB 1M6HA 2G8NA 2LE0A 3ZYCA 3ZJUA 1P44A 3MS4A 3NEJA 4YAEA 3ASYA 4TWIA 1KOJA 3NDJA 3NHLA 5DHTA 1NY6A 2NUPB 2H51A 1Q84A 1PWHA 3GXBA 1M7BA 3GFOA 1E2BA 5EUMA 4FKZA 1RU3A 1TEVA 4L57A 3WS7A 4GEGA 2AEEA 4UULA 2QV0A 2Y0BA 4WWHA 3RIXA 4DJ5X 2XE6A 4MS1B 4L0QA 1VJRA 1N2CE 1S1CA 4K6HA 3IQWA 3EUWA 1UMCA 3M9XA 3OJFA 4HTAA 4NU6A 1WABA 4RYLA 3MTGA 2HWXA 5EGSA 3TMAA 1I4LD 3ZPXA 1O6BA 2NNWB 3FUCA 1AUXA 1Q44A 3E7XA 3C8DA 4M0EA 2DZDA 4O4LB 4AYXA 1H05A 4LY0A 5IEJA 1XAGA 1JDJA 4IQ8A 1TUEA 1XTTA 3JU3A 2OOSA 3I9V6 3LYUA 1J0CA 3MC1A 2L2QA 2FUNB 5DI9A 1N7GA 2BMWA 5FHRA 1CEYA 1M8GA 5LLDA 4RPIA 4OMDA 3PDIB 2JLRA 1GTL1 2VPTA 4GYYA 1NY5A 1JECA 4HDMB 2FRXA 2R8EA 1GUDA 5JSQA 4FJ0A 2PX8A 4KVFA 3PYXA 1MOSA 3CH6A 3EIEA 5F51A 3LP5A 1R12A 3MF4A 3ZWCA 2ZR7A 1KNXA 2ZUDA 1X80B 2R2AA 2RI6A 1V71A 5ICEA 1Z4PX 2MCFA 5IXSA 4RANA 5AXDA 2DSTA 1M8PA 3M1IA 5LZ7A 3LSYA 4C7MA 2YZKA 3BSYA 1I51A 3LA6A 1A9QA 3EBPA 1VG0B 4DLYA 4AWXA 3X1WA 5BR4A 5JC1A 1US8A 1JJBA 4DQKA 3HCFA 1AGRA 4MKXA 1Q6YA 2AKAB 3SBDA 1U4NA 3OX2A 1AKQA 5IM4A 4M36A 4Z1MA 1W5EA 4RENA 2B98A 4XWOA 7YASA 1BS1A 1LVHA 1Y6FA 4DVGA 1WBDA 3JD1A 5TRTA 2XITA 3THYB 2J5RA 4EI7A 3JSXA 1D2NA 4DR2B 3UUEA 1UJ4A 2WTAA 1KI2A 1ZH8A 2HXYA 4I1IA 4FZRA 4V2UA 2AYXA 2NYAA 2H1WA 3FWYA 4QZVA 1ZGJA 1QP4A 3D8UA 4E5MA 2WICA 3L4BC 2B7CA 2H5LA 1WW3A 2WSBA 3KBBA 4HLNA 5KI6A 3TW0A 4JI6B 5ES4B 3PQ6A 3C3XA 2PGNA 5ESRA 2O3RA 1VHLA 1RHKA 2J30A 1GSHA 2GXSA 4CF7A 1PV1A 4JY7A 2GERA 5FBWB 2O06A 4OHZA 5K0SA 2QLJA 3P20A 2EVWX 1DIGA 1W0CA 3AU8A 4KFRA 4L5YA 3O8LA 1ISFA 1C7FA 3RJ9A 4DBZA 4EYSA 1AK2A 5IJZA 1A8SA 3KT0A 1E1QD 1EFVA 1E5QA 2P5UA 4KRYA 1RTTA 4XWKA 3RRNA 2BMJA 2FN4A 3ET5A 3HXQA 4WXMA 3BA6A 2QZ9A 4WJKB 4NONA 4RV5A 3TQSA 4AX4A 4CG3A 3SEQA 4PPYA 3V8NA 3S2SA 1FSPA 5KDOA 3PVCA 4BE9A 3TZHA 2OD2A 4X93A 3HADA 3OEED 1U2ZA 3KHSA 4MV3A 3ZDZB 4FYWA 4QGBA 1XPRA 2OVFA 3KAPA 4WVLA 4XM0A 5EIBD 4PG5A 1CEXA 2O8NA 2A9FA 2J67A 4UE2A 2DPMA 4PX9A 1UOOA 1V3UA 3KVRA 1Q0HA 4YJFA 1EUQA 4PC7A 1MTOA 2A84A 4B79A 3L4SO 1GZUA 3L43A 4C3VA 5E2IA 3K0HA 4MWTA 1CYEA 1U81A 4LJ9A 3ZZTA 4ZK6A 2VZ9A 4HAYA 1TJNA 3W2FA 1S3IA 4JDPA 3PJDA 1ZXBA 3IQDB 1KI8A 1UMCB 1BYIA 3KQQA 1E79D 2IHVA 3PR1A 3Q7EA 1S8NA 3RK0A 4X1KA 3O4IA 4CKCA 1GM5A 1F8FA 1LZKA 1NU6A 2GTIA 4OH1A 2PZBA 2ZUSA 3JALB 4H6XA 4I9NA 3ZXUB 1N3BA 3H8WA 4LJYA 5DYWA 4EITA 3CV3A 4IDHA 3N7UA 1RDFA 3VPDA 1KEUA 2RAFA 4ND6A 1NULA 3GJ5A 3RREA 1ECFA 1O96B 1PL8A 3EF0A 1CG6A 1U8EA 3EQ2A 4GBED 1P1IA 1WTAA 2BGLA 4F6RB 3Q3CA 1DBSA 4JSTA 5BVHA 2HSJA 1I6WA 4L8LA 2QD5A 1MC8A 1M6NA 2OHJA 4J3FA 4JU9A 3TBHA 2CJXA 1E0AA 4FJ1A 2GN0A 4QYSA 5F2OA 2AE1A 2OCYC 1LH0A 3ICEA 3SHWA 1K3TA 1WF3A 4U2GA 4DLXA 2IJGX 1YD7A 3FVWA 4W5OA 2XUJA 5CLQA 1JRLA 1VPTA 5TY0A 3RYCA 3C3CA 4XEHA 5FBHA 4B6GA 2C7OA 3L1IA 3LUKA 1WMAA 3AM3A 3ZQ4A 4DLKA 3PL5A 1Q3HA 2EW1A 3RRXA 5HS6A 1DQZA 2VXBA 3FPGA 4X64B 3NBQA 3HR4A 1K97A 3AR7A 3TCKA 3PFKA 4NCBA 5DNVA 4YYZA 3A9WA 5THXA 1YB6A 1DC3A 3PICA 1KSFX 1OZAA 4XYBA 3ESXA 3TPFA 1C9DB 1GYPA 3RUEA 4J43A 3ZOKA 2PR7A 3ZGVA 2G82A 1UK9A 1RTKA 4KGDA 1N2GA 4H31A 3TUJC 3ZHRA 3ZJTA 4DMGA 1HDOA 1QV6A 4NFYA 2DFVA 2QTGA 1XMSA 3OPNA 2J9ZB 2Q6VA 2Z95A 3QPCA 2VT2A 3BMQA 4GI1A 3CCCA 3JWPA 4ZVPA 2YFHA 1I9CA 2ZB8A 5KYKA 1CY8A 1LBHA 1STOA 2ODEA 1P5FA 2PX4A 5I7SA 3PHCA 4GLOA 1NXTA 1XZFA 3WIOA 4IDOA 3PGVA 4TL9A 3V9PA 2M32A 5SZKB 4G0WA 3DOIA 4N54A 3U9LA 2GGSA 1QLWA 2GOYA 3FHCB 4JBWA 3KQUA 3AL0C 3PTZA 3IOCA 1EFVB 2RBGA 4J1QA 4JP2A 4ZD6A 4B0OA 1XCJA 2I6UA 1WIWA 2WDPA 4LWOA 5ER9A 4PSVA 521PA 3NFRA 1SU7A 5LP1A 4NXMB 2AUMA 4WGGA 3RUCA 1FYVA 2B4QA 3K6RA 4MGEA 4MK4A 1NRWA 4YRIA 3BGWA 2SCUA 4MTCA 3ABOB 3C0KA 2EP5A 3OZEA 4GBJA 2WF8A 4PNPA 5DM0A 1KZ6A 2JCYA 2IHBA 1RCTE 2R8RA 3BE5A 5IDYA 5BSUA 4BB0A 1QBKC 5B2EA 2OCLA 2QL6A 2UYYA 2IEBA 3LFTA 2Z9CA 1A71A 3I6BA 5U4QA 1HDGO 4QYMA 4EG0A 2G07A 1VHQA 3DPIA 1VE5A 4BLSA 4ID9A 4YJFB 3UWDA 1S8AA 3IUSA 3VZQA 3DB2A 4ROSA 5FTWA 1GKYA 1QZTA 2BM0A 2HTEA 1U2DA 4BEJA 5JSHA 1NUAA 3H13A 2CNWA 5LNK6 2JI6A 1HM5A 1G8FA 2H3HA 2FJ0A 3L1VA 1YU6A 3T7SA 1MB9A 2WJWA 3KDAA 1OWPA 5IANA 3JQFC 1FMJA 2RC5A 2Z09A 4TWZA 4MKHA 3G6KA 4IO1A 3CIFA 1IBKB 4X60A 3AV3A 3K2QA 1Y4AE 3VYWA 1VKHA 3E9YA 4N39A 2YNMD 1K6EA 4MQLA 3VZSA 1KPIA 1EJ0A 1NUSA 1PLKA 1YKGA 1NN1A 2WWWA 2XCLA 3H1AA 4J4BA 3ZWAA 1YDEA 2H07A 2Q21A 3K0BA 1SZPA 2L19A 3LU1A 4FR0A 1MC1A 4RK0A 4S12A 3I73A 3QM1A 3RLIA 2AN9A 1Z4JA 1NMZA 1TO6A 1CB7A 2ZYRA 4JWKA 4PGHA 5DX1A 2EXXA 2JAUA 3P2OA 5THKA 1JKJA 3AP3A 4Y9TA 3L7LA 2HLDD 2NOAA 3NANA 2IXEA 4V0QA 3RWBA 5IWCA 1TKAA 4HJRA 3HA7A 2JZCA 4RF5A 2DCMA 5K03A 1LNQA 4D80A 2NV6A 1TD9A 4R4JA 1GG8A 1ZQ9A 1W4CA 4XZ3A 4DIFA 1E5DA 1G5HA 3FMVA 4N0DA 2PXAA 1VKNA 2IHTA 2EHJA 4TSKA 5KOIA 3EC7A 3MTIA 4Y7DA 4AM8A 4DIUA 1IMJA 1VECA 4DYVA 3PBKA 3SG0A 3JQPA 3RUFA 3ZD8A 3TFQA 5LKAA 3TAUA 4GDFA 2Z04A 2FVXA 2O8VA 2VBCA 4Q4AB 2O2SA 2HRDA 4LBWA 2RGNA 4RPJA 5ITSA 1WUTA 4LTDA 5CFQA 3LZDA 2ECFA 5F98A 3OIYA 5JBNA 4OBXA 4M9QA 1O7JA 5GIPE 1JKXA 1U0NA 5AKIA 5G4KA 5EIEA 1XTIA 4L72A 1JDVA 5L7YA 2C20A 2VP6A 2NT3A 4MYRA 5TDHA 3VO8A 2IZ0A 1IOZA 2RHDA 1A77A 2CXXA 3EDCA 4MW2A 4P2GA 3V7FA 3TDMA 5FBLB 1EK0A 4DY6A 1ND6A 3KR2A 1CIPA 3BMQB 2XE7A 2WIJA 5IASA 2PVPA 1NYRA 2DY0A 1BMFA 4LV6A 3FCSB 2VNSA 4IOJA 1V1MB 2Q1WA 2Q62A 2YY6A 3DOHA 2XXAB 3PLAE 1U2QA 2FEAA 3DJFA 4AJIA 5BQ5A 1JIQA 1X94A 3S29A 3SFTA 3T9EA 5FEUA 4RO0A 3UAWA 1ISGA 1ECCA 2Q5CA 2YWEA 4ZQEA 1NLMA 5IMBA 1S2DA 1SHKA 1TM5E 1ZM9A 1OFUX 1DVRA 4WOCA 3EQ7A 3QBTA 1NT4A 4G23A 1ORWA 4CKBB 1GL6A 3R9IA 3IEMA 1JFSA 4XCVA 2OCBA 2QRMA 3LMKA 1NXOA 3GEGA 3C3DA 4YO8A 2C7RA 4C4RA 4IFEA 2R6JA 5AW8A 1SULA 2VJBA 3FNFA 5CDGA 3OQJA 3FKJA 3UEOA 2XRMA 5C5CA 1XTKA 2ID8A 2BHLA 3SICE 4KZKA 1XAJA 2G5PA 3DDOA 2V4MA 3EN0A 4NYIR 3WYAA 2FMKA 1YR6A 4BFTA 1M2NA 2DWPA 3RGGA 4NH0A 5BSEA 2QPTA 4LJSA 4TXHA 3TQFA 2Y27A 3PUHA 3NRBA 4M49A 4DCPA 4MNTA 1BJRE 5BR8B 1AQLA 2XBUA 2ZYDA 2ZZKA 2QMZA 4YDQA 2Y92A 2CNNA 4JLOA 3ZJ5A 1U7PA 2JGMA 3CR8A 4UHKA 3GVHA 4IMJB 2D3TA 1SVSA 4OD0A 2WYOA 2JFXA 3ZN2A 1M2WA 2Y68A 3WFZA 3MZ0A 2A58A 5BWOA 2W42A 1P2VA 2A0UA 4RTKA 4N5LA 1GQQA 3L8CA 3MFYA 1Z68A 1KE1A 3BF7A 1Z5NA 1RXUA 4PLPA 2GNPA 1QDUA 4KPUA 1CZRA 5CW1A 2QTWB 3KUCA 5CX1A 5DN9A 3TJRA 5KQMA 1G7SA 5CFOA 4HNAA 4YA6A 5ALOA 4TQGA 1R8JA 3S28A 4TSFA 3UOGA 1UXHA 1J9ZA 3ZK9A 2E21A 1KVRA 1S2MA 1WXHA 2AC7A 1MLDA 2H4WA 3DZGA 1ZH4A 1HYEA 1TKBA 4TTTS 5ALQA 4ZZ3A 2IU3A 3CRMA 2I5PO 3LX6A 5J2UF 3MBOA 4TOIA 1VHTA 1A9SA 5A4JA 1JKJB 2H06A 2GZAA 1WUJS 3TD2A 1SEPA 1T6XA 4XWTA 3RUIA 3IQEA 3U4GA 3GZ4A 5KVCA 1H2BA 2BI4A 3I92A 3K2EA 3W5HA 2KHZA 3CH5A 4NL4H 3V8MA 4F93B 2E4VA 4UTVA 1ISPA 2NWQA 4DZTA 4GKVA 3W06A 4OYHA 1CJMA 1YNSA 1JPJA 3G0DA 4LISA 5F23A 2CMKA 3OZGA 4GI2A 1AB5A 1SCIA 3GLHA 4HAVA 4EHNA 4QPPA 3QWAA 3FAKA 2NUAA 1V5WA 3A1DA 2MTBA 4XGRA 3KPWA 4J0IA 1ZVKA 1UXIA 2XNJA 16PKA 3GQBB 1XVIA 3LHIA 4B80A 4XRGA 1WP4A 2NW6A 3S2YA 3BWVA 2CUZA 4E3ZA 1QG0A 3NTLA 5AOAA 4Q3OA 2CVZA 3CW2A 4UXJA 3ZUGA 5G3YA 3IJPA 3D5QA 2BUBA 4GP7A 3OM9A 3UMBA 4JA0A 4EFMA 3IKLA 4OHOA 1YCHA 2VQDA 2RCNA 4IICA 5FA8A 1GKKA 1DV2A 5JWHA 1Y48E 1GUZA 2FVYA 3QIVA 3SM3A 1BOFA 2H5JA 4WNIA 5KNBA 1SBTA 4WFIA 3TO5A 4ZT2A 4ZVVA 5AW9A 4PANA 3V4FA 2XQGA 5CD9A 3CZ9A 1NZJA 2QTFA 1KH2A 4CKWB 1VMKA 5H3HA 2G09A 2PGOA 4DA9A 1NF8A 1QF9A 1D4AA 1NW7A 3KQTA 4KWIA 2HAEA 4S1TA 5B6JA 2TRSB 4DABA 3ES9A 5EWMA 2M1XA 8ABPA 5F7XA 5C35A 2ZU6A 3UNXA 3WKAA 3R7SA 1MH9A 4YRCA 2IDJA 5JECA 3KOWA 1RLUA 3FZEA 1M10A 3ECSA 5J4YA 2NYRA 3BFJA 4S3MA 2P0EA 4QLBA 1E2PA 1P5JA 5DDIP 5K4HA 3ND5A 3R6WA 4A10A 3PFGA 3FPLA 1C14A 4GM0A 4BS9A 5AK6A 3HNPA 4N0EA 4ZVLA 3I30X 2QNBA 3KFVA 3O4FA 1O08A 3LZ6A 1OPXA 1JFVA 4QUBA 5IBPA 2ZU0C 4EGCB 2GVDC 1TVKB 2HF2A 2C4TA 1XLWA 4LX8A 4NI5A 4YAFA 5E8RA 4F4IA 4B82A 2HJHA 2XT0A 2JLYA 1LBEA 2CL0X 4HNSA 3GUCA 1Z4MA 1DSSG 4TT3D 4YI5A 1P1KA 1P72A 4BDSA 4HRYA 4BFZA 2DLCX 3HMQA 2CLHB 4KO4S 2ZM6B 2YMPA 3D2CA 1UDBA 3S70A 4ZKDA 1KSJA 3DC2A 5EN4A 4GMDA 4QIHA 1H2YA 3C3PA 5IJ0A 3EY4A 4JUDX 1EX7A 3UWPA 4ALMA 1ZIOA 3NBFA 1SVNA 5C1IA 1KI6B 4FDTA 3FYTA 3PDJA 1NW5A 2I1LA 4F96A 1ODSA 5NULA 4MW9A 3V2UA 3BXGA 1GR1A 2I87A 2ZJ3A 3TB6A 5JNSA 3MQ4A 5LDGA 1KFEB 3Q1LA 4ARAA 1Z6GA 3LUDA 1ZWKA 4JC8A 4PTZA 3UQZA 4HUJA 4RW0A 3C6QA 3GA7A 2ORWA 1C30A 5CVDA 1DINA 5K0BA 1YS1X 1WD5A 2ON6A 1JYEA 4YT4A 3KZOA 4MVXA 1XZGA 2ONJA 3C6MA 3C6XA 1N5RA 1Z74A 5LYYA 3SBEA 3ET4A 3BX1A 1KQOA 5DHUA 5DNUA 1IHYA 4MYHA 3G5LA 3A28A 1RMQA 1EBBA 1SQGA 1A9PA 3BA1A 4DC9A 1J99A 1RHJA 4YMHA 1C3LA 1EIZA 4ZHSA 3L6EA 2H2WA 3OQOA 4CI9A 1XUOA 1MAUA 5LOVF 1XROA 2ZYGA 3E2PA 3WJAA 1VMIA 3QHQA 3ZCUA 2V0NA 4HP8A 4EA6A 5BN4A 2NO7A 4RKFA 1EXDA 1FNCA 2PR2A 2QW8A 2JJ2D 4IW3B 2C57A 4MA4A 5HFAA 3RVSA 3ZHOA 3GLHB 1QIDA 2NUAB 1AO3A 2BGRA 2DUJA 3ZDBA 4AG5A 2ZCVA 1U2DC 1MJNA 1KORA 3RTAA 5EJ5A 2B4RO 3JXEA 1K27A 3VAYA 5U1PA 4ER6A 2G7ZA 2XUKA 1TTTA 4R41A 4IUCS 3UANA 3HWX1 3WDLA 2XBMA 2UYGA 3GLHE 4QG7A 4PC3A 3GGPA 1QJCA 3GCDA 4NNOA 1U6JA 4LGVA 4ZQIA 2MINA 5GY7A 4B09A 3T95A 2E49A 3F6SA 4TV9F 5DF1A 4BX0A 2FKNA 2X13A 1UJ5A 3B12A 3QLEA 1ZL2A 3E9MA 1KZHA 3SYTA 2XT6A 4PCUA 2O8FA 1M3SA 3W5DA 1XV5A 4MX8A 3IP9A 1GT91 5IYZB 3GCWA 4LY3A 1X7WA 1NVMB 3M6WA 1VZ2A 1J21A 1RYDA 4Z5XA 1DMSA 3PQ4A 2ZE7A 4FTWA 5EWMB 3VU9A 1A4XA 3U5TA 4RLFA 4PFJA 4EVSA 2PUEA 5HGJA 2ZT6A 1USUA 2P2GA 3EVBA 3HBFA 5KNCH 4AG6A 3E1SA 1G3RA 3KX2A 3LCMA 2J8ZA 4WZ6A 3C85A 1EDEA 3A9TA 3LLMA 3T41A 1Y5IA 5BW8A 2FWPA 1KA9H 4QEZA 4C5BA 1MQSA 3ABRB 2IU6A 4E6PA 5AM5A 1VIMA 1KMHA 1BJTA 1RWVA 1JR6A 4BNVA 3R20A 1VL0A 3EXEA 4HB0A 2JRCA 2RGNC 1K9VF 4WCFA 3JYLA 3A32A 4OHYA 1B8UA 1LWOA 3IERA 1SCNE 2DAPA 3D1LA 3GARA 1A72A 2JANA 1SUBA 1SIWA 3CT4A 4RZ3A 2C82A 1C9KA 5EXSA 4TZ0A 1QGED 3GNTA 2HTFA 2WWVD 2AOTA 2WIGA 4PZYA 1T3HA 2QGFA 4RV9A 1ZNZA 4JS0A 2NG1A 1M5TA 4YAOA 5CYGA 3PA8A 4M1OA 3VNSA 3ODPA 3RHTA 1I4WA 4Q48A 3UUWA 2AKYA 1OHHD 3LQFA 2C9ZA 2ZAYA 1SK9A 5DCLA 1ZM3A 4KJXA 5IWAB 1G17A 1FJHA 4FQ7A 1G9SA 1P60A 1PGOA 1YZHA 3MCUA 2B8EA 1MEJA 2IP1A 3OOHA 4X6UA 1DX6A 3LP6A 3LCUA 2OLEA 2FWRA 4MUYA 5C34B 1EGQA 1C30B 3MD9A 4LF6B 4PAQA 2BFWA 2C8VA 4BMCA 3P32A 3AVTA 1FNMA 3WC4A 4H35A 2VNJA 1JI0A 5C8ZA 4J8PA 5F9MA 5K4AA 4ENWA 5FFNA 4BP8A 2XKJE 4PZPA 5IK2D 4NXNB 4MYSA 3VTZA 3AB8A 1XNJA 1E7WA 2WIAA 5K0NA 4JIMA 5J40A 1BZYA 5L3ZA 3TBFA 5K6AA 1CWUA 2W90A 5L3SB 5LJLA 5JVDB 1UBTS 4ZAZA 3B6KA 4HGPA 1XGKA 3WY9A 4DRXA 1ACMA 1AHIA 3NT4A 1XCBA 3N3BC 3DFKA 1FA9A 2Z0MA 3UJ3X 2P65A 3DCNA 3FYSA 3RANA 5TIIA 2EZUA 2EEZA 3CWQA 1Z4IA 1P29A 3QVOA 1SCJA 4BQIA 4RDCA 1KYIA 4WPGA 3O4GA 2GN4A 3ADPA 4DEXA 4EJSB 1PS9A 3AGQA 4N7RA 4MGHA 4D3YA 3DR3A 4FHCA 4IIJB 4XI9A 4JQYA 4DSZA 2CFRA 1OC4A 1VFNA 2C78A 3G68A 1ISMA 1HTWA 5H3LA 2G1PA 5HNKA 4P4NA 5FUVA 1T2CA 3ZWMA 5CGQB 1N3IA 1I0ZA 5FLYA 5AK4A 1QUFA 7ABPA 2HK7A 1U8TA 2F6RA 1DRVA 4NKRA 4ROTA 5EZQA 3W6NA