3ONHA

Crystal structure of uba2ufd-ubc9: insights into e1-e2 interactions in sumo pathways
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
113
structure length
113
Chain Sequence
KVCRGVIKLSSDCLNKMKLSDFVVLIREKYSYPQDISLLDASNQRLLFDYDFEDLNDRTLSEINLGNGSIILFSDEEGDTMIRKAIELFLDVDDELPCNTCSLPDVEVPLIKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-activating enzyme E1-like
publication title Crystal structure of UBA2(ufd)-Ubc9: insights into E1-E2 interactions in Sumo pathways.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
total genus 32
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2010-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.290.20 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A Ubiquitin-like 2 activating enzyme e1b. Chain: B, domain 3 3onhA01
1Y8RB 5FQ2B 3KYDB 1Y8QB 3FN1A 2LQ7A 3KYCB 3ONGA 4W5VB 1Y8XB 3ONHA 2NVUB
chains in the Genus database with same CATH superfamily
2UXBD 4GKKD 2UUCD 4B3TD 4X66D 4DR2D 1FJGD 2UUBD 4JI8D 1XNRD 4DV5D 4JV5D 4LF6D 4JI3D 4LF5D 1IBMD 4JI5D 4LFAD 2VQED 4DV0D 2E5LD 3J7AF 5LMND 4JI2D 3OTOD 1N36D 3T1HD 4B3SD 4JI0D 4DR3D 4JI6D 4K0KD 4LF9D 1N34D 2VQFD 4DR6D 3HP7A 4NXMD 4B3RD 1HNWD 4LGTA 2UUAD 4YY3D 2K6PA 2ZM6D 4JYAD 4DV4D 1KSLA 1H3EA 4DR5D 1Y8QB 2LQ7A 5FLXE 1IBKD 1VIOA 4DR4D 4X64D 4LF7D 3KYCB 4DR1D 4KHPD 1FKAD 5LL6S 4JI7D 4GKJD 1KSKA 4DV3D 2F4VD 1XNQD 2ZTBA 1HNXD 1J5ED 4DR7D 5KNLA 4B3MD 1C05A 5A2QE 2HHHD 3ONHA 4OX9D 5FQ2B 1I94D 3KBGA 1HR0D 3DH3A 4W5VB 1HNZD 4YHHD 1P9KA 1N32D 1IBLD 2I1SA 4LFCD 1Y8RB 3ONGA 4JI1D 4DUZD 4DUYD 3T1YD 3CMMA 4II3A 1XMOD 4LF8D 4DV2D 3J80E 2UXDD 3KYDB 1C06A 4DV7D 5IWAD 5IT9E 2UU9D 1Y8XB 2KTLA 2ISTA 1KSVA 2UXCD 1N33D 4II2A 5BR8D 4DV6D 1XMQD 2JANA 2NVUB 4LF4D 1H3FA 4AQYD 4NNJA 3J81E 4LFBD 5LMUD 4DV1D 1JH3A 1DM9A 4OUDA 4NXND 3FN1A 4X62D 3JAME 4JI4D 4X65D
chains in the Genus database with same CATH topology
1Y8RB 5FQ2B 3KYDB 1Y8QB 3FN1A 2LQ7A 3KYCB 3ONGA 4W5VB 1Y8XB 3ONHA 2NVUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8R B;  5FQ2 B;  3KYD B;  1Y8Q B;  3FN1 A;  2LQ7 A;  3KYC B;  3ONG A;  4W5V B;  1Y8X B;  3ONH A;  2NVU B; 
#chains in the Genus database with same CATH topology
 2UXB D;  4GKK D;  2UUC D;  4B3T D;  4X66 D;  4DR2 D;  1FJG D;  2UUB D;  4JI8 D;  1XNR D;  4DV5 D;  4JV5 D;  4LF6 D;  4JI3 D;  4LF5 D;  1IBM D;  4JI5 D;  4LFA D;  2VQE D;  4DV0 D;  2E5L D;  3J7A F;  5LMN D;  4JI2 D;  3OTO D;  1N36 D;  3T1H D;  4B3S D;  4JI0 D;  4DR3 D;  4JI6 D;  4K0K D;  4LF9 D;  1N34 D;  2VQF D;  4DR6 D;  3HP7 A;  4NXM D;  4B3R D;  1HNW D;  4LGT A;  2UUA D;  4YY3 D;  2K6P A;  2ZM6 D;  4JYA D;  4DV4 D;  1KSL A;  1H3E A;  4DR5 D;  1Y8Q B;  2LQ7 A;  5FLX E;  1IBK D;  1VIO A;  4DR4 D;  4X64 D;  4LF7 D;  3KYC B;  4DR1 D;  4KHP D;  1FKA D;  5LL6 S;  4JI7 D;  4GKJ D;  1KSK A;  4DV3 D;  2F4V D;  1XNQ D;  2ZTB A;  1HNX D;  1J5E D;  4DR7 D;  5KNL A;  4B3M D;  1C05 A;  5A2Q E;  2HHH D;  3ONH A;  4OX9 D;  5FQ2 B;  1I94 D;  3KBG A;  1HR0 D;  3DH3 A;  4W5V B;  1HNZ D;  4YHH D;  1P9K A;  1N32 D;  1IBL D;  2I1S A;  4LFC D;  1Y8R B;  3ONG A;  4JI1 D;  4DUZ D;  4DUY D;  3T1Y D;  3CMM A;  4II3 A;  1XMO D;  4LF8 D;  4DV2 D;  3J80 E;  2UXD D;  3KYD B;  1C06 A;  4DV7 D;  5IWA D;  5IT9 E;  2UU9 D;  1Y8X B;  2KTL A;  2IST A;  1KSV A;  2UXC D;  1N33 D;  4II2 A;  5BR8 D;  4DV6 D;  1XMQ D;  2JAN A;  2NVU B;  4LF4 D;  1H3F A;  4AQY D;  4NNJ A;  3J81 E;  4LFB D;  5LMU D;  4DV1 D;  1JH3 A;  1DM9 A;  4OUD A;  4NXN D;  3FN1 A;  4X62 D;  3JAM E;  4JI4 D;  4X65 D; 
#chains in the Genus database with same CATH homology
 1Y8R B;  5FQ2 B;  3KYD B;  1Y8Q B;  3FN1 A;  2LQ7 A;  3KYC B;  3ONG A;  4W5V B;  1Y8X B;  3ONH A;  2NVU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...