3ONJA

Crystal structure of yeast vti1p_habc domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
97
structure length
97
Chain Sequence
b'SLLISYESDFKTTLEQAKASLAEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVEVNNSIGDASERATYKAKLREWKKTIQSDIKRPLQSLVDSGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords t-SNARE VTI1
publication title Epsin N-terminal homology domains bind on opposite sides of two SNAREs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 44
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2010-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05008 V-SNARE Vesicle transport v-SNARE protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 3onjA00
3ONJA 2V8SV 2QYWA 1VCSA 3ONLC
chains in the Genus database with same CATH superfamily
2JJ9A 4DR4T 2FBWA 5A1LA 1T98A 1Z8UA 2LLYA 4LFBT 4F8HA 4GOUA 2E5LT 3N9PA 3T8OA 4H9OC 3ZC1A 4GYRA 3KVBA 5LBQB 3HI2A 2A9UA 4QH1A 3FXEB 5H6QB 4XBFB 3FHNA 2E9XA 3AA6B 3TLWA 2LKHA 2UXBT 2R6GF 2LM2A 4ILAA 3N9MA 4H9QC 5ABEA 3LG7A 2CEAA 1UURA 4EOZB 3EUHA 2WU5A 1IBKT 2LOPA 3ETUA 3NVOA 3CPZA 3NZPA 4HEAA 1R8IA 3PUQA 1IBMT 3ETVA 4AKLA 2NW9A 5FY1A 5J2UE 2BS4A 1HFAA 2ZMAA 3ZSTA 4NXMT 2XTLA 4QX7B 3FXDB 4LF4T 5ADXL 5CGMA 3N2GE 4JLEA 3K3NA 4COFA 1J5ET 3C4WA 5JDLA 1D1CA 4TNVA 3RIAA 4NUUA 3KINB 5AQOB 1OEDE 5HEHA 4BJMA 2BG9C 3KV6A 1FIOA 4P0BA 1VRBA 2GK9A 3QOFA 3LK3B 2V7IA 4X64T 1SE7A 2WMOA 3N9QA 2XQ3A 3P8CD 4EXTA 3WAJA 4ILCA 3PUZF 3GWHA 3P4RA 4U33A 2W61A 2V7MA 3N5LA 3OYXA 3KV9A 3CQCB 3OJAA 3ZMSB 1NENA 4OK0A 4QWNB 3RRCA 4I0UA 3AE2A 4LF6T 2BKNA 4KX6A 4P09A 5L3BB 2IW5B 3J7Yq 3UUXB 4ZI7E 4KHPT 3PUSA 4WBOA 3A5XA 3BQKA 1XNQT 3F31A 3PUYF 3NKZA 4YY3T 3AXJB 2NP9A 1KNZA 3OVUA 3AA7B 1OXZA 2M6IA 1V9DA 3G06A 3IEEA 2VQET 4IDNA 5F5WA 3C51A 3IHRA 4DV6T 2I59A 1AJ3A 4AQFC 3JCFA 4MLKA 1MMDA 2XHEB 5JRCB 3A8YC 2K24A 2X0LB 5EZYE 3O1IA 2QYWA 1QLBA 4TWFA 5HXCA 4AISA 5JRCA 4N78D 4Z90A 4GKJT 4AXPA 4LMJA 2ZM8A 3UUMA 4DR6T 1BR4A 1XDPA 3UUBA 3Q5XA 2KWHA 4HFIA 2VKOA 3UTKA 4JEUB 4WYVA 3AEFA 2KXPB 3KVAA 4CZZB 1HR0T 4PJMA 3RGLA 2JMKA 2C5JA 3T1HT 4ADZA 4DO0A 1T72A 4YSZA 3B57A 4O4JE 4A5XA 3AE1A 4EIWA 3F57A 1IJ6A 2BKOA 2X68A 5LJMA 2CHNA 3V5UA 5JDHA 3MK7C 5FY7A 5ETWA 2CCQA 4O4IE 3L39A 2I0MA 1E2AA 5C3JA 2IMLA 3UQ4A 3TLUA 4JI5T 4JI3T 2G0UA 1HTJF 3M3ZB 1J5WA 4PK5A 3LDQB 3UFGA 4TUYE 3BK9A 4ZOLE 3ZEFB 1G8XA 2XZEA 4PJJA 1DU2A 5LB7B 5L2LA 5LMUT 5AQIB 4DNDA 2XSBA 4HWIB 3SFDA 3B5MA 2MTQA 4PW8A 1S35A 4LF8T 3RKGA 2JPFA 4EZ4A 5L3CB 5JREA 5HEUA 1SA0E 1UX4A 5LGNB 4O2AE 4LMKA 3QNUA 2PBIA 2VB6A 4YJ3E 3ZCJA 1HG2A 1OEDA 4XZCA 3RC3A 5LHHB 2X66A 2RPAA 3C50A 2WWVA 4ZS3A 1MMNA 3R84B 4HFCA 2YU2A 3I9YA 5LOVE 2XM1A 3PU8A 3KV4A 2CM0A 2LRKA 5JR9C 4BA9A 1B7TA 3ZCIA 4YTNA 1YQ4A 2DLRA 4X1YE 3VR8A 3FZFB 2E5VA 2VL0A 4X1IE 3RIUC 3SFEA 4JI8T 2LSJA 4EEBA 4PAGA 5AQNB 4PJNA 2XSAA 4E7SA 2HPJA 1UGOA 2XAFB 3ZLIA 1WYBA 3RRWA 3P50A 4UV8B 3UQ7A 1JNRA 3BQLA 2BBHA 1HG5A 2BZBA 2YDQA 3RHWA 1YQ3A 3FZKB 3LBXB 2CMRA 3EDUA 2JQKA 3EABA 3C64A 5AQFB 3NRYA 2E2AA 2QA7A 5GONE 5FL1A 3N9OA 2VQFT 2H89A 2VL8A 4KBMB 2CE7A 2K48A 1ZKEA 3ANWB 4UXNB 2VK9A 2CXFA 3RX6A 3I1AA 4XAXB 4QH5A 2UUAT 4CN6A 3ANWA 2UUBT 5KDMC 3ZMVB 4TWHA 2VURA 3I9WA 2HN1A 3UU4A 3BQIA 1D1BA 4H63H 4HGAA 4OYKA 5LA6E 5FMNA 1LVKA 4LF7T 2L3LA 5HCJA 3OBVE 4DV1T 2N1GA 4FI5A 1ZV4X 1I6ZA 2H7OA 2X9XA 1SHZC 3PUWF 2DHRA 2JQ9A 3VRAA 1SUMB 4UR9A 4H9PC 3ZYMA 1WLXA 5AFUL 4GK5E 3AB3B 2NR4A 3ABVA 2MAWA 1ZHCA 2XAGB 5JDFA 3MACA 2XQ4A 2WY2A 4WBNE 5EK3A 4YTPA 4KHZF 4KI0F 2ES0A 4ZEYA 4JI1T 2DI4A 4TN7B 5AQGB 2WMNA 3WI3A 2UUCT 2J4GA 2BS2A 2WSSV 2BG9B 3Q9DA 2HN2A 3PV0F 4DV4T 2BDEA 5IHYA 5FXZA 4KMCA 3H3AA 2XPKA 2BG9A 4DVDA 4I4TE 1W9RA 3Q5WA 4ZI3C 1N33T 2PJQA 3V5SA 3QC9A 2IIUA 1NAFA 2MYSA 4PFPA 1WCRA 4ZS2A 2V1DB 4DBQA 3MJXA 4X5TA 1MNEA 2QRXA 3PJAA 2UU9T 3KV5A 2XQ7A 1W0BA 3N9LA 5CB4E 5FL0A 1Z0PA 3O1JA 4UF0B 2CWYA 1FMVA 2OLTA 4ZI2C 4NXNT 4IL9A 1WFDA 3TLVA 3AE7A 4EGWA 2VWAA 4J2CA 4EAHA 4UF0A 3AECA 5HWXA 3KFWX 1MIVA 5LYJE 2X0HA 2V8SV 1U5PA 4PK6A 5JVDE 2AXDS 3K3QC 5AQJB 3SWHA 1NEKA 2KSRA 3LK42 4F6RC 2HH7A 5KMGP 2KT9A 2V7JA 3D0TA 2YINA 5JTGA 3A7MA 1WYCA 3LK2B 4YSXA 4AQFA 2E8IA 3T1YT 2X9WA 2V7KA 2CRBA 4U72A 5J0ZA 4FJOA 4ANJA 1ZEEA 3ZC0A 1W0AA 3ZKRA 1YKHB 4Q25A 4UV9B 4X66T 2KLQA 4IT4A 2UXNB 2NTYA 3E22E 1US7B 3RYIE 4YLHA 1CHUA 3AE6A 4AKGA 2MBGA 4HFVA 2CA5A 4MALA 5TAOA 3GA8A 3IA3A 3PE0A 2IC6A 2NTXA 4U31A 1T7SA 4HFBA 1YD8G 2E9XC 3I0QA 3ONXA 4NUVA 3VRBA 2VKHA 5LGUB 3VU7H 3QB5K 1LKXA 1LVFA 3NRXA 2VASA 2X67A 3RYFE 4KUMB 4AQYT 3L8RA 4BJNA 3O4XE 1QUUA 3AEBA 5BMVE 3FZLB 3GMIA 2XM2A 3ZT7A 3AXJA 3C4XA 3Q5DA 5EK2A 4O2BE 5AQHB 5LG4A 1HS7A 5LCYA 1HCIA 3ZN1B 1HX1B 5LNKA 3C98B 3L3PA 4HN9A 2M67A 3HA4A 4IDQA 3AE5A 2A72A 4DR1T 2MPKA 3K8PC 3P4PA 3ZT6A 2Q9QC 4LF9T 2F4VT 5L3DB 5FY0A 4Z91A 2WU2A 3JC6D 3CMLA 4IE6A 1MMAA 4CI1B 5J2TE 4YFSA 3LSVA 4PNIA 1XDOA 4DR7T 3KBUA 4CXYA 3CQGB 1S94A 2UXDT 1HX8A 3Q5EA 4IE5A 4ILBA 4E7ZA 2WAUA 4H9SE 3RYCE 1BR1A 2ZLYA 3CX6B 5JR9B 2J62A 3AEEA 5FXVA 4AKRB 4IHJE 4CI2B 2VVSA 3AVRA 5JH7E 2BVLA 5JR9A 5JQGE 3RKOA 5HAXA 3VKGA 4ASKA 3VKHA 4IIJE 3MA9A 2PFVA 3RIUA 2P9BA 5ABGA 4IE7A 3UT5E 5HXEA 1NWMX 2AE9A 4MHCA 2ZM0A 2YOEA 3HKDE 2NW7A 3SRZA 2HHHT 5HYAA 3TLTA 4TX5A 2XAJB 3DJBA 3ZYKA 1KNPA 2LRLA 3ZSSA 2XUEA 2BG9E 4V1Av 4PJLA 1YXRA 2BBJA 4CI3B 3JADA 2SPCA 5L47A 1G73A 5L4EA 4JI7T 1ZOYA 3EI0A 3RQWA 3ONLC 3WAKA 2YDSA 5BR8T 1Y64B 3HR0A 4UVCB 2KMFA 2YU1A 2XQ9A 1MIYA 2A2FX 4H9RC 1VOMA 1D0ZA 2RP4A 2EHOC 1ZP0A 3HKBE 2OA5A 4QH4A 3MKDA 1KK7A 4ISSA 4OYJA 5LJNA 5IWAT 2N9DA 1X79A 2ACXA 2ZM2A 5LBMA 1MNDA 2UXXB 4QXBB 2B76A 4MFRA 4IE0A 2HPLA 2PG8A 1HNWT 3OTOT 4L0RA 2NWBA 2W0GA 2N2NA 4BAYB 2KNDA 2PTFA 4GK0E 2V5CA 1YW0A 4JEHB 2YEVC 3PU3A 4DMVA 2WZIA 3CX8B 3P4QA 2LSKA 3EHZA 4U74A 2XAHB 2V6YB 5ABHA 4AQGA 3PUXF 4TV9E 1GQEA 1WR0A 2CBIA 3Q2MA 1D0YA 5L4HA 4AI6A 2W67A 2V6YA 3FZHB 3LBXA 4CXXA 4HKAA 3RYHE 5F8PA 1XWMA 4PFOA 4X62T 4JV5T 2B1EA 1E7PA 4YHHT 1OEDC 5DQWA 1WRDA 4JI0T 2CLYC 2WCAA 4LFCT 2WDRA 1UCUA 4A98A 3OKQA 2XAQB 2LE8A 5ABFB 1VCTA 4HE8A 3CVRA 2IAKA 1LRZA 2OV9A 2XQ6A 3AE4A 3AA1B 1UUSA 2WB5A 4WW0A 4UIGA 4U2YA 2NW8A 2QGSA 4IL4A 1JNZA 4HWDA 4QX8B 4HWFA 1E1HB 2D0UA 3CX7B 3N2KE 4YHJA 5JDQA 5AQLB 3W15B 4IDOA 3IF8B 2X9HA 2LKGA 2XJ7A 3FB2A 4U3CA 4WNKA 3EAMA 2C0SA 3U3IA 4DIDB 2WS3A 3HKCE 4CN1A 1L0VA 2WM9A 2ACZA 4DV7T 5FP3A 4EB6E 2VKJA 5FNVE 4YT0A 2H88A 2Y6XA 4MBQA 2LJLA 4DUYT 5HWYA 1M7KA 2XQAA 4HFHA 4QXCB 3B13A 5IUXA 3AVSA 4K0UA 2QVAA 4JYAT 5HCMA 2JQQA 3VR9A 3QB5A 1YKEB 3ZN0B 5JDGA 1EZ3A 4PK4A 4X1KE 2LSGA 2JIWA 4KP3C 4O4HE 5HEOA 1FJGT 2A3DA 4DV2T 2E9XB 3UUNA 1H7CA 3HKEE 2C5KT 2JRKA 4JI4T 4DMWA 3GN5B 4EZHA 3AEGA 5M4YA 3RI5A 4B6XA 4GIWA 4ZHQE 2D9DA 4DBRA 2K9AA 4AKIA 3CIRA 2FJDA 3GN5A 2ZM6T 5CFBA 4H63V 3AE9A 4P0AA 5LXTE 3RF1A 2V7LA 2X51A 4I43B 2KZ7B 4HWHA 2LM9A 3H3MA 1OWAA 3SOLA 2Z6EA 4WZXA 4TWDA 4TV8E 3KBTA 4B3RT 4HWCA 3CKDA 1N36T 3ZMZB 2XQ8A 4UVAB 2WDQA 5LG3A 1T8BA 4OFZA 1FMWA 3FZMB 3AEDA 2CXDA 4DV0T 2W66A 2D2SA 4NIQA 3LJCA 4L5GA 2Q9QB 1O3XA 3MZKB 5JDMA 2JMHA 2D5UA 4UELA 5KX5E 5LHIB 2VVNA 2XQ5A 5DABA 4EYUA 5H6RB 2EHOD 2Q9QA 2LHRA 4UVBB 5FKYA 2W63A 2IC9A 4QHOA 2X0YA 4JBWF 2KINB 3N9NA 3EVYA 1UX5A 5CJ5A 2CXLA 2V6XA 5AQTB 5J1GA 2BS3A 1I94T 4NPPA 4B3MT 5AQVB 1J1JA 5FYMA 4I55E 5HXHA 3PUAA 2H3RA 5HXRA 4H9NC 3C4ZA 4CN4A 3I0OA 2IHR1 3K1SA 2C5IT 4AIUA 1XMQT 1BR0A 2BVMA 2WDVA 2DL1A 3ZJ1A 4CQIA 3R6NA 1XZYA 4ISTA 3AAIA 5FXXA 5FVKA 4ERRA 5HXSA 4YXDA 1CUNA 1KF6A 1KNRA 4CXWA 4A97A 4Z8XA 1VCSA 2M6BA 5CA0E 2FUPA 4U7IA 2K3WA 4HFEA 4DV5T 3K3OA 5AQQB 4C90A 3PDYA 2W00A 2XY8B 4OHFA 5L3EB 4U2ZA 3ZYLA 2IUBA 3H37A 2CBJA 5AQRB 2DCFA 3DP7A 5AQUB 4AKHA 4IDPA 3UU3A 4ZXLA 2KWIB 3RIFA 5E0OA 2Y48B 2ODUA 3P4SA 3HL6A 2LSYA 4IDZA 3RLFF 3PUVF 4B3ST 3RPUA 3L09A 1WR6A 2EHOB 4OX9T 2WQYA 1D1AA 1MMGA 3QUJA 4M1PA 1U4QA 3CQXC 5LMNT 2EHOA 3ZJ2A 1IAPA 1MIWA 5JDNA 2LOSA 2Y8DA 3UU5A 5HEJA 2BKPA 4DR5T 2YDRA 3OPCA 4TZ4C 4LMLA 4HFDA 3X1DA 1IBLT 2J1DG 3EDVA 4O8SA 2VKDA 5CA1E 3VHLA 3ZMUB 3PUGA 4ZI3D 1XNRT 3KDSE 5LP6E 2WBLA 3JAEA 5KXJA 3P4WA 3QK6A 4JI2T 4DR2T 5FXWA 5IYZE 2FJEA 4EEDA 3SS1A 3AE8A 2CWOA 3ZT5A 3PTRB 4JI6T 3TKLB 3ONJA 5LHGB 3E0ZA 2CPTA 3MXZA 4P1NA 4UEMA 1OEDB 4ZI2D 3PURA 4O4LE 3AAAB 3FBLA 2CLYB 4EYYR 4LFAT 2LT3A 4JUYA 4U7YA 3F2EA 5C2TA 5AQPB 4TNWA 3UU8A 3UFEA 2W4XA 3OYZA 2YN6A 1HNZT 4LF5T 5AQKB 4IE4A 2K5BB 4ZZBA 2DWKA 3RC8A 3PJAJ 1N32T 2WP9A 2MOZA 2NOXA 4C91A 2FJBA 5C8YE 3S4UA 2YK0A 3ZMTB 1N34T 4X20E 5EK4A 5DJQC 2DWGA 2XQYA 5AQSB 1UK5A 2D0TA 2V5DA 2V26A 5F3JA 4YJ2E 3P7IA 3O9XA 3IBPA 1KFYA 5AQMB 4DV3T 5FVLA 2I6HA 3NBXX 5HEGA 3J9X1 1W09A 2ODVA 2E9XD 2L8KA 1BR2A 3UU6A 3CK6A 2YKSA 2RA1A 3UULA 4L9IA 4GKKT 2IDOB 3TLSA 1X9BA 2W2UA 2LSIA 2LEHA 4ZZCA 1M62A 3M65A 2WZHA 4IREA 3O1HA 4DUZT 2L9QA 5L3FB 1KEYA 3ESLA 3U78A 5L3GB 2WWUA 4G2AA 4YTMA 2X9YA 4YSYA 3RH3A 5ABFA 4DR3T 1HNXT 2CHOA 1QSDA 3JAFA 2H7VC 4I50E 3AE3A 1FEWA 3JC6C 4QKNA 2DNXA 1IJ5A 2XASB 3DTOA 2J47A 1HF8A 5LGTB 3NZQA 2Q9QD 3LFMA 2UXCT 3CWZB 1D0XA 3E08A 4QXHB 3AEAA 1IZNB 3AA0B 2W62A 3AAEB 2FJAA 3RQUA 3NWIA 3ZPOA 3FBZA 4G63A 1XMOT 2JQHA 5DQVA 4A56A 4GYSA 4EV6A 2LHNA 4IGUA 4HTEA 3N2OA 4X65T 1Y01A 4B3TT 4K0KT 4ILUA
chains in the Genus database with same CATH topology
3ONJA 2V8SV 2QYWA 1VCSA 3ONLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONJ A;  2V8S V;  2QYW A;  1VCS A;  3ONL C; 
#chains in the Genus database with same CATH topology
 2JJ9 A;  4DR4 T;  2FBW A;  5A1L A;  1T98 A;  1Z8U A;  2LLY A;  4LFB T;  4F8H A;  4GOU A;  2E5L T;  3N9P A;  3T8O A;  4H9O C;  3ZC1 A;  4GYR A;  3KVB A;  5LBQ B;  3HI2 A;  2A9U A;  4QH1 A;  3FXE B;  5H6Q B;  4XBF B;  3FHN A;  2E9X A;  3AA6 B;  3TLW A;  2LKH A;  2UXB T;  2R6G F;  2LM2 A;  4ILA A;  3N9M A;  4H9Q C;  5ABE A;  3LG7 A;  2CEA A;  1UUR A;  4EOZ B;  3EUH A;  2WU5 A;  1IBK T;  2LOP A;  3ETU A;  3NVO A;  3CPZ A;  3NZP A;  4HEA A;  1R8I A;  3PUQ A;  1IBM T;  3ETV A;  4AKL A;  2NW9 A;  5FY1 A;  5J2U E;  2BS4 A;  1HFA A;  2ZMA A;  3ZST A;  4NXM T;  2XTL A;  4QX7 B;  3FXD B;  4LF4 T;  5ADX L;  5CGM A;  3N2G E;  4JLE A;  3K3N A;  4COF A;  1J5E T;  3C4W A;  5JDL A;  1D1C A;  4TNV A;  3RIA A;  4NUU A;  3KIN B;  5AQO B;  1OED E;  5HEH A;  4BJM A;  2BG9 C;  3KV6 A;  1FIO A;  4P0B A;  1VRB A;  2GK9 A;  3QOF A;  3LK3 B;  2V7I A;  4X64 T;  1SE7 A;  2WMO A;  3N9Q A;  2XQ3 A;  3P8C D;  4EXT A;  3WAJ A;  4ILC A;  3PUZ F;  3GWH A;  3P4R A;  4U33 A;  2W61 A;  2V7M A;  3N5L A;  3OYX A;  3KV9 A;  3CQC B;  3OJA A;  3ZMS B;  1NEN A;  4OK0 A;  4QWN B;  3RRC A;  4I0U A;  3AE2 A;  4LF6 T;  2BKN A;  4KX6 A;  4P09 A;  5L3B B;  2IW5 B;  3J7Y q;  3UUX B;  4ZI7 E;  4KHP T;  3PUS A;  4WBO A;  3A5X A;  3BQK A;  1XNQ T;  3F31 A;  3PUY F;  3NKZ A;  4YY3 T;  3AXJ B;  2NP9 A;  1KNZ A;  3OVU A;  3AA7 B;  1OXZ A;  2M6I A;  1V9D A;  3G06 A;  3IEE A;  2VQE T;  4IDN A;  5F5W A;  3C51 A;  3IHR A;  4DV6 T;  2I59 A;  1AJ3 A;  4AQF C;  3JCF A;  4MLK A;  1MMD A;  2XHE B;  5JRC B;  3A8Y C;  2K24 A;  2X0L B;  5EZY E;  3O1I A;  2QYW A;  1QLB A;  4TWF A;  5HXC A;  4AIS A;  5JRC A;  4N78 D;  4Z90 A;  4GKJ T;  4AXP A;  4LMJ A;  2ZM8 A;  3UUM A;  4DR6 T;  1BR4 A;  1XDP A;  3UUB A;  3Q5X A;  2KWH A;  4HFI A;  2VKO A;  3UTK A;  4JEU B;  4WYV A;  3AEF A;  2KXP B;  3KVA A;  4CZZ B;  1HR0 T;  4PJM A;  3RGL A;  2JMK A;  2C5J A;  3T1H T;  4ADZ A;  4DO0 A;  1T72 A;  4YSZ A;  3B57 A;  4O4J E;  4A5X A;  3AE1 A;  4EIW A;  3F57 A;  1IJ6 A;  2BKO A;  2X68 A;  5LJM A;  2CHN A;  3V5U A;  5JDH A;  3MK7 C;  5FY7 A;  5ETW A;  2CCQ A;  4O4I E;  3L39 A;  2I0M A;  1E2A A;  5C3J A;  2IML A;  3UQ4 A;  3TLU A;  4JI5 T;  4JI3 T;  2G0U A;  1HTJ F;  3M3Z B;  1J5W A;  4PK5 A;  3LDQ B;  3UFG A;  4TUY E;  3BK9 A;  4ZOL E;  3ZEF B;  1G8X A;  2XZE A;  4PJJ A;  1DU2 A;  5LB7 B;  5L2L A;  5LMU T;  5AQI B;  4DND A;  2XSB A;  4HWI B;  3SFD A;  3B5M A;  2MTQ A;  4PW8 A;  1S35 A;  4LF8 T;  3RKG A;  2JPF A;  4EZ4 A;  5L3C B;  5JRE A;  5HEU A;  1SA0 E;  1UX4 A;  5LGN B;  4O2A E;  4LMK A;  3QNU A;  2PBI A;  2VB6 A;  4YJ3 E;  3ZCJ A;  1HG2 A;  1OED A;  4XZC A;  3RC3 A;  5LHH B;  2X66 A;  2RPA A;  3C50 A;  2WWV A;  4ZS3 A;  1MMN A;  3R84 B;  4HFC A;  2YU2 A;  3I9Y A;  5LOV E;  2XM1 A;  3PU8 A;  3KV4 A;  2CM0 A;  2LRK A;  5JR9 C;  4BA9 A;  1B7T A;  3ZCI A;  4YTN A;  1YQ4 A;  2DLR A;  4X1Y E;  3VR8 A;  3FZF B;  2E5V A;  2VL0 A;  4X1I E;  3RIU C;  3SFE A;  4JI8 T;  2LSJ A;  4EEB A;  4PAG A;  5AQN B;  4PJN A;  2XSA A;  4E7S A;  2HPJ A;  1UGO A;  2XAF B;  3ZLI A;  1WYB A;  3RRW A;  3P50 A;  4UV8 B;  3UQ7 A;  1JNR A;  3BQL A;  2BBH A;  1HG5 A;  2BZB A;  2YDQ A;  3RHW A;  1YQ3 A;  3FZK B;  3LBX B;  2CMR A;  3EDU A;  2JQK A;  3EAB A;  3C64 A;  5AQF B;  3NRY A;  2E2A A;  2QA7 A;  5GON E;  5FL1 A;  3N9O A;  2VQF T;  2H89 A;  2VL8 A;  4KBM B;  2CE7 A;  2K48 A;  1ZKE A;  3ANW B;  4UXN B;  2VK9 A;  2CXF A;  3RX6 A;  3I1A A;  4XAX B;  4QH5 A;  2UUA T;  4CN6 A;  3ANW A;  2UUB T;  5KDM C;  3ZMV B;  4TWH A;  2VUR A;  3I9W A;  2HN1 A;  3UU4 A;  3BQI A;  1D1B A;  4H63 H;  4HGA A;  4OYK A;  5LA6 E;  5FMN A;  1LVK A;  4LF7 T;  2L3L A;  5HCJ A;  3OBV E;  4DV1 T;  2N1G A;  4FI5 A;  1ZV4 X;  1I6Z A;  2H7O A;  2X9X A;  1SHZ C;  3PUW F;  2DHR A;  2JQ9 A;  3VRA A;  1SUM B;  4UR9 A;  4H9P C;  3ZYM A;  1WLX A;  5AFU L;  4GK5 E;  3AB3 B;  2NR4 A;  3ABV A;  2MAW A;  1ZHC A;  2XAG B;  5JDF A;  3MAC A;  2XQ4 A;  2WY2 A;  4WBN E;  5EK3 A;  4YTP A;  4KHZ F;  4KI0 F;  2ES0 A;  4ZEY A;  4JI1 T;  2DI4 A;  4TN7 B;  5AQG B;  2WMN A;  3WI3 A;  2UUC T;  2J4G A;  2BS2 A;  2WSS V;  2BG9 B;  3Q9D A;  2HN2 A;  3PV0 F;  4DV4 T;  2BDE A;  5IHY A;  5FXZ A;  4KMC A;  3H3A A;  2XPK A;  2BG9 A;  4DVD A;  4I4T E;  1W9R A;  3Q5W A;  4ZI3 C;  1N33 T;  2PJQ A;  3V5S A;  3QC9 A;  2IIU A;  1NAF A;  2MYS A;  4PFP A;  1WCR A;  4ZS2 A;  2V1D B;  4DBQ A;  3MJX A;  4X5T A;  1MNE A;  2QRX A;  3PJA A;  2UU9 T;  3KV5 A;  2XQ7 A;  1W0B A;  3N9L A;  5CB4 E;  5FL0 A;  1Z0P A;  3O1J A;  4UF0 B;  2CWY A;  1FMV A;  2OLT A;  4ZI2 C;  4NXN T;  4IL9 A;  1WFD A;  3TLV A;  3AE7 A;  4EGW A;  2VWA A;  4J2C A;  4EAH A;  4UF0 A;  3AEC A;  5HWX A;  3KFW X;  1MIV A;  5LYJ E;  2X0H A;  2V8S V;  1U5P A;  4PK6 A;  5JVD E;  2AXD S;  3K3Q C;  5AQJ B;  3SWH A;  1NEK A;  2KSR A;  3LK4 2;  4F6R C;  2HH7 A;  5KMG P;  2KT9 A;  2V7J A;  3D0T A;  2YIN A;  5JTG A;  3A7M A;  1WYC A;  3LK2 B;  4YSX A;  4AQF A;  2E8I A;  3T1Y T;  2X9W A;  2V7K A;  2CRB A;  4U72 A;  5J0Z A;  4FJO A;  4ANJ A;  1ZEE A;  3ZC0 A;  1W0A A;  3ZKR A;  1YKH B;  4Q25 A;  4UV9 B;  4X66 T;  2KLQ A;  4IT4 A;  2UXN B;  2NTY A;  3E22 E;  1US7 B;  3RYI E;  4YLH A;  1CHU A;  3AE6 A;  4AKG A;  2MBG A;  4HFV A;  2CA5 A;  4MAL A;  5TAO A;  3GA8 A;  3IA3 A;  3PE0 A;  2IC6 A;  2NTX A;  4U31 A;  1T7S A;  4HFB A;  1YD8 G;  2E9X C;  3I0Q A;  3ONX A;  4NUV A;  3VRB A;  2VKH A;  5LGU B;  3VU7 H;  3QB5 K;  1LKX A;  1LVF A;  3NRX A;  2VAS A;  2X67 A;  3RYF E;  4KUM B;  4AQY T;  3L8R A;  4BJN A;  3O4X E;  1QUU A;  3AEB A;  5BMV E;  3FZL B;  3GMI A;  2XM2 A;  3ZT7 A;  3AXJ A;  3C4X A;  3Q5D A;  5EK2 A;  4O2B E;  5AQH B;  5LG4 A;  1HS7 A;  5LCY A;  1HCI A;  3ZN1 B;  1HX1 B;  5LNK A;  3C98 B;  3L3P A;  4HN9 A;  2M67 A;  3HA4 A;  4IDQ A;  3AE5 A;  2A72 A;  4DR1 T;  2MPK A;  3K8P C;  3P4P A;  3ZT6 A;  2Q9Q C;  4LF9 T;  2F4V T;  5L3D B;  5FY0 A;  4Z91 A;  2WU2 A;  3JC6 D;  3CML A;  4IE6 A;  1MMA A;  4CI1 B;  5J2T E;  4YFS A;  3LSV A;  4PNI A;  1XDO A;  4DR7 T;  3KBU A;  4CXY A;  3CQG B;  1S94 A;  2UXD T;  1HX8 A;  3Q5E A;  4IE5 A;  4ILB A;  4E7Z A;  2WAU A;  4H9S E;  3RYC E;  1BR1 A;  2ZLY A;  3CX6 B;  5JR9 B;  2J62 A;  3AEE A;  5FXV A;  4AKR B;  4IHJ E;  4CI2 B;  2VVS A;  3AVR A;  5JH7 E;  2BVL A;  5JR9 A;  5JQG E;  3RKO A;  5HAX A;  3VKG A;  4ASK A;  3VKH A;  4IIJ E;  3MA9 A;  2PFV A;  3RIU A;  2P9B A;  5ABG A;  4IE7 A;  3UT5 E;  5HXE A;  1NWM X;  2AE9 A;  4MHC A;  2ZM0 A;  2YOE A;  3HKD E;  2NW7 A;  3SRZ A;  2HHH T;  5HYA A;  3TLT A;  4TX5 A;  2XAJ B;  3DJB A;  3ZYK A;  1KNP A;  2LRL A;  3ZSS A;  2XUE A;  2BG9 E;  4V1A v;  4PJL A;  1YXR A;  2BBJ A;  4CI3 B;  3JAD A;  2SPC A;  5L47 A;  1G73 A;  5L4E A;  4JI7 T;  1ZOY A;  3EI0 A;  3RQW A;  3ONL C;  3WAK A;  2YDS A;  5BR8 T;  1Y64 B;  3HR0 A;  4UVC B;  2KMF A;  2YU1 A;  2XQ9 A;  1MIY A;  2A2F X;  4H9R C;  1VOM A;  1D0Z A;  2RP4 A;  2EHO C;  1ZP0 A;  3HKB E;  2OA5 A;  4QH4 A;  3MKD A;  1KK7 A;  4ISS A;  4OYJ A;  5LJN A;  5IWA T;  2N9D A;  1X79 A;  2ACX A;  2ZM2 A;  5LBM A;  1MND A;  2UXX B;  4QXB B;  2B76 A;  4MFR A;  4IE0 A;  2HPL A;  2PG8 A;  1HNW T;  3OTO T;  4L0R A;  2NWB A;  2W0G A;  2N2N A;  4BAY B;  2KND A;  2PTF A;  4GK0 E;  2V5C A;  1YW0 A;  4JEH B;  2YEV C;  3PU3 A;  4DMV A;  2WZI A;  3CX8 B;  3P4Q A;  2LSK A;  3EHZ A;  4U74 A;  2XAH B;  2V6Y B;  5ABH A;  4AQG A;  3PUX F;  4TV9 E;  1GQE A;  1WR0 A;  2CBI A;  3Q2M A;  1D0Y A;  5L4H A;  4AI6 A;  2W67 A;  2V6Y A;  3FZH B;  3LBX A;  4CXX A;  4HKA A;  3RYH E;  5F8P A;  1XWM A;  4PFO A;  4X62 T;  4JV5 T;  2B1E A;  1E7P A;  4YHH T;  1OED C;  5DQW A;  1WRD A;  4JI0 T;  2CLY C;  2WCA A;  4LFC T;  2WDR A;  1UCU A;  4A98 A;  3OKQ A;  2XAQ B;  2LE8 A;  5ABF B;  1VCT A;  4HE8 A;  3CVR A;  2IAK A;  1LRZ A;  2OV9 A;  2XQ6 A;  3AE4 A;  3AA1 B;  1UUS A;  2WB5 A;  4WW0 A;  4UIG A;  4U2Y A;  2NW8 A;  2QGS A;  4IL4 A;  1JNZ A;  4HWD A;  4QX8 B;  4HWF A;  1E1H B;  2D0U A;  3CX7 B;  3N2K E;  4YHJ A;  5JDQ A;  5AQL B;  3W15 B;  4IDO A;  3IF8 B;  2X9H A;  2LKG A;  2XJ7 A;  3FB2 A;  4U3C A;  4WNK A;  3EAM A;  2C0S A;  3U3I A;  4DID B;  2WS3 A;  3HKC E;  4CN1 A;  1L0V A;  2WM9 A;  2ACZ A;  4DV7 T;  5FP3 A;  4EB6 E;  2VKJ A;  5FNV E;  4YT0 A;  2H88 A;  2Y6X A;  4MBQ A;  2LJL A;  4DUY T;  5HWY A;  1M7K A;  2XQA A;  4HFH A;  4QXC B;  3B13 A;  5IUX A;  3AVS A;  4K0U A;  2QVA A;  4JYA T;  5HCM A;  2JQQ A;  3VR9 A;  3QB5 A;  1YKE B;  3ZN0 B;  5JDG A;  1EZ3 A;  4PK4 A;  4X1K E;  2LSG A;  2JIW A;  4KP3 C;  4O4H E;  5HEO A;  1FJG T;  2A3D A;  4DV2 T;  2E9X B;  3UUN A;  1H7C A;  3HKE E;  2C5K T;  2JRK A;  4JI4 T;  4DMW A;  3GN5 B;  4EZH A;  3AEG A;  5M4Y A;  3RI5 A;  4B6X A;  4GIW A;  4ZHQ E;  2D9D A;  4DBR A;  2K9A A;  4AKI A;  3CIR A;  2FJD A;  3GN5 A;  2ZM6 T;  5CFB A;  4H63 V;  3AE9 A;  4P0A A;  5LXT E;  3RF1 A;  2V7L A;  2X51 A;  4I43 B;  2KZ7 B;  4HWH A;  2LM9 A;  3H3M A;  1OWA A;  3SOL A;  2Z6E A;  4WZX A;  4TWD A;  4TV8 E;  3KBT A;  4B3R T;  4HWC A;  3CKD A;  1N36 T;  3ZMZ B;  2XQ8 A;  4UVA B;  2WDQ A;  5LG3 A;  1T8B A;  4OFZ A;  1FMW A;  3FZM B;  3AED A;  2CXD A;  4DV0 T;  2W66 A;  2D2S A;  4NIQ A;  3LJC A;  4L5G A;  2Q9Q B;  1O3X A;  3MZK B;  5JDM A;  2JMH A;  2D5U A;  4UEL A;  5KX5 E;  5LHI B;  2VVN A;  2XQ5 A;  5DAB A;  4EYU A;  5H6R B;  2EHO D;  2Q9Q A;  2LHR A;  4UVB B;  5FKY A;  2W63 A;  2IC9 A;  4QHO A;  2X0Y A;  4JBW F;  2KIN B;  3N9N A;  3EVY A;  1UX5 A;  5CJ5 A;  2CXL A;  2V6X A;  5AQT B;  5J1G A;  2BS3 A;  1I94 T;  4NPP A;  4B3M T;  5AQV B;  1J1J A;  5FYM A;  4I55 E;  5HXH A;  3PUA A;  2H3R A;  5HXR A;  4H9N C;  3C4Z A;  4CN4 A;  3I0O A;  2IHR 1;  3K1S A;  2C5I T;  4AIU A;  1XMQ T;  1BR0 A;  2BVM A;  2WDV A;  2DL1 A;  3ZJ1 A;  4CQI A;  3R6N A;  1XZY A;  4IST A;  3AAI A;  5FXX A;  5FVK A;  4ERR A;  5HXS A;  4YXD A;  1CUN A;  1KF6 A;  1KNR A;  4CXW A;  4A97 A;  4Z8X A;  1VCS A;  2M6B A;  5CA0 E;  2FUP A;  4U7I A;  2K3W A;  4HFE A;  4DV5 T;  3K3O A;  5AQQ B;  4C90 A;  3PDY A;  2W00 A;  2XY8 B;  4OHF A;  5L3E B;  4U2Z A;  3ZYL A;  2IUB A;  3H37 A;  2CBJ A;  5AQR B;  2DCF A;  3DP7 A;  5AQU B;  4AKH A;  4IDP A;  3UU3 A;  4ZXL A;  2KWI B;  3RIF A;  5E0O A;  2Y48 B;  2ODU A;  3P4S A;  3HL6 A;  2LSY A;  4IDZ A;  3RLF F;  3PUV F;  4B3S T;  3RPU A;  3L09 A;  1WR6 A;  2EHO B;  4OX9 T;  2WQY A;  1D1A A;  1MMG A;  3QUJ A;  4M1P A;  1U4Q A;  3CQX C;  5LMN T;  2EHO A;  3ZJ2 A;  1IAP A;  1MIW A;  5JDN A;  2LOS A;  2Y8D A;  3UU5 A;  5HEJ A;  2BKP A;  4DR5 T;  2YDR A;  3OPC A;  4TZ4 C;  4LML A;  4HFD A;  3X1D A;  1IBL T;  2J1D G;  3EDV A;  4O8S A;  2VKD A;  5CA1 E;  3VHL A;  3ZMU B;  3PUG A;  4ZI3 D;  1XNR T;  3KDS E;  5LP6 E;  2WBL A;  3JAE A;  5KXJ A;  3P4W A;  3QK6 A;  4JI2 T;  4DR2 T;  5FXW A;  5IYZ E;  2FJE A;  4EED A;  3SS1 A;  3AE8 A;  2CWO A;  3ZT5 A;  3PTR B;  4JI6 T;  3TKL B;  3ONJ A;  5LHG B;  3E0Z A;  2CPT A;  3MXZ A;  4P1N A;  4UEM A;  1OED B;  4ZI2 D;  3PUR A;  4O4L E;  3AAA B;  3FBL A;  2CLY B;  4EYY R;  4LFA T;  2LT3 A;  4JUY A;  4U7Y A;  3F2E A;  5C2T A;  5AQP B;  4TNW A;  3UU8 A;  3UFE A;  2W4X A;  3OYZ A;  2YN6 A;  1HNZ T;  4LF5 T;  5AQK B;  4IE4 A;  2K5B B;  4ZZB A;  2DWK A;  3RC8 A;  3PJA J;  1N32 T;  2WP9 A;  2MOZ A;  2NOX A;  4C91 A;  2FJB A;  5C8Y E;  3S4U A;  2YK0 A;  3ZMT B;  1N34 T;  4X20 E;  5EK4 A;  5DJQ C;  2DWG A;  2XQY A;  5AQS B;  1UK5 A;  2D0T A;  2V5D A;  2V26 A;  5F3J A;  4YJ2 E;  3P7I A;  3O9X A;  3IBP A;  1KFY A;  5AQM B;  4DV3 T;  5FVL A;  2I6H A;  3NBX X;  5HEG A;  3J9X 1;  1W09 A;  2ODV A;  2E9X D;  2L8K A;  1BR2 A;  3UU6 A;  3CK6 A;  2YKS A;  2RA1 A;  3UUL A;  4L9I A;  4GKK T;  2IDO B;  3TLS A;  1X9B A;  2W2U A;  2LSI A;  2LEH A;  4ZZC A;  1M62 A;  3M65 A;  2WZH A;  4IRE A;  3O1H A;  4DUZ T;  2L9Q A;  5L3F B;  1KEY A;  3ESL A;  3U78 A;  5L3G B;  2WWU A;  4G2A A;  4YTM A;  2X9Y A;  4YSY A;  3RH3 A;  5ABF A;  4DR3 T;  1HNX T;  2CHO A;  1QSD A;  3JAF A;  2H7V C;  4I50 E;  3AE3 A;  1FEW A;  3JC6 C;  4QKN A;  2DNX A;  1IJ5 A;  2XAS B;  3DTO A;  2J47 A;  1HF8 A;  5LGT B;  3NZQ A;  2Q9Q D;  3LFM A;  2UXC T;  3CWZ B;  1D0X A;  3E08 A;  4QXH B;  3AEA A;  1IZN B;  3AA0 B;  2W62 A;  3AAE B;  2FJA A;  3RQU A;  3NWI A;  3ZPO A;  3FBZ A;  4G63 A;  1XMO T;  2JQH A;  5DQV A;  4A56 A;  4GYS A;  4EV6 A;  2LHN A;  4IGU A;  4HTE A;  3N2O A;  4X65 T;  1Y01 A;  4B3T T;  4K0K T;  4ILU A; 
#chains in the Genus database with same CATH homology
 3ONJ A;  2V8S V;  2QYW A;  1VCS A;  3ONL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...