3ONJA

Crystal structure of yeast vti1p_habc domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
97
structure length
97
Chain Sequence
SLLISYESDFKTTLEQAKASLAEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVEVNNSIGDASERATYKAKLREWKKTIQSDIKRPLQSLVDSGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords t-SNARE VTI1
publication title Epsin N-terminal homology domains bind on opposite sides of two SNAREs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 44
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2010-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05008 V-SNARE Vesicle transport v-SNARE protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 3onjA00
2QYWA 1VCSA 3ONJA 2V8SV 3ONLC
chains in the Genus database with same CATH superfamily
1YXRA 2QA7A 3GN5A 1KF6A 5AQPB 3ZJ2A 2CM0A 1HR0T 4EB6E 2WDVA 3N9OA 1OEDE 2XQ3A 3CPZA 1ZOYA 4UVAB 1D0XA 2WS3A 3UQ4A 1JNZA 4EZ4A 5J2UE 2CRBA 3ZMTB 2QVAA 4LFAT 1Z8UA 3QUJA 2R6GF 3PTRB 2E2AA 4U33A 5HXCA 3L8RA 1ZKEA 2JIWA 3LK3B 3RKOA 1QUUA 4JEHB 1WCRA 4CN6A 3ZMVB 5AFUL 1UCUA 2PG8A 2L9QA 4PAGA 4OK0A 2ES0A 4YTMA 5JTGA 1HX8A 2X67A 3K3OA 5HWYA 2PJQA 4GYSA 3AEGA 3ZC0A 1L0VA 4A97A 2LEHA 3M3ZB 4L0RA 4IL9A 3AB3B 2ZMAA 3FZHB 4U7YA 3AXJA 2B76A 3UFEA 4DV0T 4FJOA 3OKQA 1X9BA 4NUVA 5FMNA 4QH4A 1Y64B 2KXPB 3P7IA 4WYVA 5JR9A 1HCIA 5KDMC 3ZCIA 2V26A 4HFEA 4IIJE 2NR4A 3PURA 4DNDA 3B5MA 4V1Av 3RH3A 2AXDS 4NIQA 4LFBT 4ZI3C 3LDQB 5ABFB 1WYCA 3MA9A 4QKNA 1LRZA 3KFWX 4IE4A 2M67A 3QB5K 5JDGA 2V5DA 3ZEFB 1YW0A 2UUCT 2DWGA 1HNXT 1BR2A 4UF0A 3N2OA 3EVYA 4P0AA 3UU8A 2VKJA 5HCJA 1VCTA 1XMQT 3UUNA 3VKHA 5L4HA 4JI5T 2WWUA 4YHJA 3I9WA 2JPFA 2LSGA 1OEDA 1W0AA 2DCFA 5AQFB 4KI0F 4CI2B 1SE7A 2NW9A 2XY8B 2VURA 2CPTA 4YT0A 2MAWA 3SFDA 5C8YE 3RIAA 1UX5A 3QK6A 5FY7A 3ZPOA 4DV5T 3WI3A 4BA9A 4KHPT 3ZYLA 3N9LA 1CHUA 5AQUB 4YSXA 1I6ZA 1BR1A 4UXNB 5AQLB 1BR4A 2C5KT 4AQFA 4IGUA 3KINB 5JREA 4YTPA 3OBVE 3AECA 5JDFA 3GN5B 3AAEB 3ZSTA 1MMGA 4QX7B 5JQGE 4C90A 3I1AA 4IT4A 1LVKA 4X66T 3G06A 2WZHA 3HI2A 2CHOA 3R6NA 4LF8T 1XWMA 5BMVE 5LCYA 4ILBA 3SFEA 2XQ5A 2CEAA 5IUXA 3HA4A 3HR0A 3K3NA 2LOSA 4JYAT 4P09A 5HXEA 2N2NA 3JCFA 2FJDA 5LP6E 1OEDC 2CMRA 3AE3A 4K0UA 1G73A 3P4QA 4GIWA 4CN1A 2WP9A 5HXRA 1NENA 1IJ5A 2VVNA 4O4HE 4YFSA 4Z91A 1MMAA 3NWIA 2BBHA 4MBQA 5ADXL 2LT3A 2MTQA 3O1JA 4JV5T 4WBNE 3P4RA 2YN6A 3ONLC 1HFAA 5L3BB 1H7CA 2ODVA 4GKJT 5KMGP 1D1BA 5LMUT 1R8IA 3Q9DA 1XNRT 3BK9A 2WU2A 2W63A 5JH7E 3AXJB 3AA0B 4ANJA 4B3RT 3IA3A 5TAOA 4AKGA 1UGOA 2CXFA 4X65T 3LBXA 3P4WA 3KBUA 5JR9B 4QH1A 3CX6B 3NRYA 4ZI2D 2NWBA 2XAFB 3DTOA 1HNZT 4TV9E 3WAJA 5J1GA 4COFA 4U31A 5HXSA 4TNWA 2W66A 2LSJA 1VOMA 4PJLA 2RPAA 4F8HA 2BG9A 2JQHA 5FVLA 3PJAJ 4UF0B 1D1CA 3RI5A 3U78A 2WM9A 5LG3A 3RLFF 4HFCA 5KX5E 2D2SA 3FBLA 5AQHB 1YD8G 4ZZCA 2WY2A 2X0HA 5DABA 2W0GA 4DV6T 1OEDB 2XSBA 4UVCB 2VQFT 4U72A 4X1IE 4KBMB 4MALA 3OVUA 4TWHA 3RC3A 1X79A 3ZKRA 4AQYT 4AKHA 4LF9T 4JUYA 4E7ZA 3CMLA 3RPUA 3N9PA 4ZEYA 5L3CB 4JLEA 4TNVA 2BKOA 4QX8B 1IBKT 3Q5XA 4ZXLA 3VRBA 4YSYA 4NUUA 1ZHCA 4AISA 4GK0E 3CX8B 3IEEA 2KT9A 4LMLA 3O4XE 4IL4A 2UUAT 4HEAA 3P4SA 5HEOA 1KNZA 4Z8XA 2CE7A 3ONJA 1LKXA 4HFDA 5F5WA 3RIUC 3TLSA 3HKEE 4TX5A 2QRXA 1J5WA 2VVSA 2LSYA 2BBJA 2LKGA 4OX9T 4PK4A 3DP7A 3AE8A 3TLUA 5AQOB 3C51A 3FZKB 4I0UA 4JEUB 1ZEEA 3GA8A 3A8YC 2WDRA 4LFCT 3KV9A 3ETVA 3VHLA 5LGTB 4CXXA 3CKDA 4YXDA 4DO0A 3AE6A 4HFVA 2C0SA 1UX4A 4I4TE 4X1KE 2NOXA 4KX6A 4LF7T 4HFBA 2LM2A 5AQVB 2Z6EA 3I9YA 3Q5WA 3UULA 3KV4A 2NW8A 2VKHA 4PFOA 3MXZA 2KZ7B 4AXPA 3VR8A 2ZM2A 3O1HA 4BAYB 2QYWA 3LBXB 3V5UA 5CGMA 3NBXX 2JMKA 2HHHT 2YKSA 1HTJF 2AE9A 3H3AA 4DV3T 5J2TE 2WZIA 4LMJA 3ZC1A 1IZNB 3RKGA 5LMNT 5L47A 1IBMT 4DR3T 4DUZT 2XASB 2IIUA 1N32T 1Y01A 3CK6A 1KNPA 4L9IA 2BG9B 2W00A 2ACZA 4JI1T 3PU8A 1T7SA 2WDQA 4KHZF 2X9HA 3VR9A 4YSZA 2IMLA 4HWDA 4H9PC 4UR9A 3UU6A 2XPKA 5LB7B 4C91A 2WQYA 1J1JA 2VASA 2IUBA 2A2FX 1VCSA 3QOFA 1FEWA 3VU7H 3PUYF 4TUYE 2M6IA 4O4JE 4AIUA 2VQET 1D0ZA 4ZI7E 1D0YA 2YINA 2V7LA 5AQKB 4X1YE 3J9X1 3BQKA 5DQVA 2C5IT 3AVRA 2KWHA 2X9WA 3AEFA 2VKDA 4EIWA 3FBZA 5HCMA 3RX6A 5F8PA 2UU9T 3RGLA 2Q9QA 4WW0A 3BQIA 3AA7B 3FZFB 3B13A 4DV1T 5LXTE 4DR5T 3S4UA 4ILUA 4MLKA 2JQ9A 4LF4T 1M62A 4H9OC 3SOLA 3T1HT 3ONXA 2XAGB 3NZQA 2Q9QD 5IWAT 1B7TA 4HGAA 2CWYA 1IJ6A 1U5PA 5LBQB 4EV6A 1N33T 2BS4A 4NXNT 4YY3T 1WR6A 5F3JA 4N78D 4WZXA 3L3PA 2X66A 4FI5A 2XQ6A 2J1DG 5CFBA 1WRDA 5DJQC 2K24A 1ZV4X 2ACXA 3ZN1B 5LHHB 4DMVA 3AEAA 2LLYA 1SHZC 4ZHQE 3E0ZA 2BS3A 4O2AE 5JDHA 1S35A 2M6BA 3C98B 3MZKB 3VKGA 4ZS2A 4AQGA 1DU2A 1UUSA 3NZPA 4G2AA 2BG9E 2LHRA 3HKBE 2E9XA 4PNIA 3VRAA 4H9QC 5JR9C 4KMCA 3KBTA 4PJJA 4U2ZA 4EGWA 2V6YA 4TV8E 5AQRB 2Q9QC 4L5GA 2PBIA 2KWIB 2UXNB 3RYCE 2YDSA 3FXEB 2DL1A 5DQWA 2E9XD 1W09A 3ZJ1A 2IW5B 2ZM8A 3O9XA 4NPPA 3E08A 5FL1A 3UUXB 1FMVA 3H37A 5LBMA 4DVDA 2YOEA 4M1PA 2XQ9A 3AE5A 3PDYA 4UEMA 1NAFA 3EHZA 3UU5A 3FZLB 5HEUA 4IDZA 3K8PC 1E1HB 5CA0E 5LNKA 2YDRA 4HTEA 3KDSE 3PV0F 4UVBB 2VB6A 2IDOB 3C4XA 4O8SA 1LVFA 2YK0A 2A72A 2VKOA 2MOZA 2DI4A 1WLXA 5HYAA 3OTOT 3TKLB 5L3GB 1KNRA 2X51A 2V7KA 4LF6T 3ZCJA 5GONE 2KMFA 4EXTA 4PJMA 3AE9A 3ZN0B 2UXBT 3GWHA 3ZMSB 1NWMX 4NXMT 4JI6T 2E9XC 4H63V 4X64T 5AQNB 4CXYA 3LK2B 3ZLIA 1KK7A 3LFMA 4CI1B 4PW8A 4AQFC 5JVDE 3EABA 1IBLT 3RIFA 1M7KA 2XM2A 3LSVA 3N5LA 3X1DA 3RHWA 2CLYC 1MMNA 2D0TA 3TLVA 3HKDE 2W4XA 4IDNA 3F31A 2H3RA 3UQ7A 2IC6A 3CQCB 3PUZF 4B3MT 2Q9QB 5LG4A 1AJ3A 2YU1A 3CWZB 3PUVF 5AQMB 3CX7B 3F2EA 3FXDB 4U3CA 1XZYA 3WAKA 1T8BA 4ERRA 4OFZA 3PJAA 2RP4A 2C5JA 5FNVE 3QNUA 3SRZA 2E5LT 1FJGT 2H7OA 3RRCA 4G63A 3A7MA 1O3XA 3UUMA 3AE7A 2LHNA 3UUBA 4YJ2E 2XSAA 3ZMZB 4DV7T 1N36T 3FHNA 4DIDB 4F6RC 4IE7A 3ZMUB 2B1EA 3Q5EA 4OHFA 1UURA 3QC9A 4ZZBA 4X62T 3HKCE 4ZI2C 3AE1A 3UT5E 2HPJA 3A5XA 2VWAA 3IBPA 5HEGA 2XQAA 4EEBA 5JDQA 2XQ8A 5H6RB 4ISTA 2CXDA 1HNWT 2E9XB 2JRKA 2BKNA 3N2KE 4DV4T 2NTYA 1J5ET 3V5SA 3PUQA 1N34T 4IDPA 4CI3B 3P4PA 2LM9A 2V8SV 4DR2T 2V6YB 1BR0A 3GMIA 2CLYB 2L8KA 2NW7A 3MK7C 3OYZA 2X0YA 4P0BA 4J2CA 2BVMA 5L3EB 4JI3T 2BG9C 5L3FB 2ZLYA 4CZZB 2IC9A 2LJLA 2I59A 5A1LA 5J0ZA 3EDVA 5CA1E 3NVOA 4CXWA 2Y48B 5HAXA 2XM1A 1D1AA 2V6XA 2W61A 2RA1A 3EAMA 1WYBA 3T1YT 1HX1B 1E2AA 1W0BA 3ANWA 3PE0A 4PJNA 5L3DB 4ILCA 2LOPA 3PUXF 3AE4A 1OXZA 4UIGA 4EYYR 5H6QB 5HEHA 4LMKA 5FXZA 4P1NA 2QGSA 5LJMA 4IHJE 2K48A 1MIYA 4Q25A 3W15B 4YLHA 2LE8A 4XZCA 2WMOA 2WCAA 4I50E 2VL8A 5LHGB 4QXHB 3MKDA 4IDOA 2XAHB 3PUSA 3L09A 2XJ7A 2F4VT 2MPKA 4UELA 2WSSV 5AQSB 2ODUA 4X5TA 3L39A 3TLTA 1SUMB 3FZMB 4TZ4C 3LK42 4DR6T 5ABHA 1MNEA 4OYJA 5LHIB 2FJBA 4KUMB 4BJNA 1MMDA 1G8XA 2KNDA 2L3LA 2Y8DA 4QH5A 3UU3A 2A3DA 4TN7B 4U2YA 4H9NC 3AAIA 2DNXA 4HWFA 1HG5A 3AEBA 2XUEA 3O1IA 3LJCA 2VK9A 2FJEA 2D0UA 2W67A 2BZBA 1IAPA 4JI0T 2CXLA 4DMWA 2XZEA 2A9UA 5E0OA 4DBRA 3CQXC 3KV5A 4ISSA 4ZI3D 4QXCB 2G0UA 2SPCA 3JC6D 2P9BA 3BQLA 3KVBA 2H89A 3K3QC 4LF5T 4HFIA 2WMNA 3B57A 3RYIE 5AQJB 5L2LA 1HG2A 4JI4T 5HEJA 1QLBA 4MFRA 2Y6XA 5FVKA 2JMHA 2EHOA 1WR0A 3ZT5A 4H9SE 2BVLA 2KSRA 2V7IA 3OPCA 4I55E 3N9NA 3C50A 2MBGA 3RQUA 3RC8A 2XQYA 5LGNB 1FMWA 4JI8T 2OV9A 2LRLA 2XAJB 3ETUA 2UUBT 2EHOD 1Z0PA 3JADA 3PUAA 2HPLA 3N9QA 1XDOA 5EZYE 2IHR1 2LSKA 1T98A 2DLRA 4JBWF 2H88A 2XAQB 3FB2A 2J47A 3JC6C 3AEEA 2FJAA 5FP3A 2XTLA 5ABEA 4HWCA 1WFDA 5HXHA 3R84B 3ANWB 2K9AA 4TWDA 5JDLA 4IDQA 2YDQA 5LA6E 3OYXA 4H9RC 4CQIA 5FXWA 1HS7A 5IYZE 3AEDA 1YKEB 3AA1B 4AI6A 3RRWA 4TWFA 2K5BB 5M4YA 3JAEA 4UV9B 2J62A 2LKHA 2CCQA 3RF1A 3AA6B 2WB5A 2XHEB 1NEKA 3ZYKA 1V9DA 5EK4A 3E22E 4EAHA 4A98A 2EHOC 3UFGA 4AKLA 1FIOA 3IHRA 4YJ3E 5FY1A 4A5XA 5AQGB 2YU2A 2KLQA 5ABGA 1VRBA 3N2GE 2CBJA 5JDMA 4HWHA 3EI0A 1KFYA 4IE5A 2UXCT 4HFHA 4GK5E 3KV6A 4K0KT 3JAFA 3ABVA 2BS2A 3QB5A 2WU5A 2V7MA 2UXXB 2V7JA 4DBQA 4DR1T 5JRCA 5ETWA 2VL0A 2BKPA 3RYHE 4WNKA 4DV2T 5LJNA 5EK3A 3RYFE 2I0MA 3EDUA 1T72A 3C64A 5BR8T 2JQQA 1XDPA 1XMOT 4EOZB 4B3ST 4AKIA 2CA5A 2D9DA 1MNDA 2JQKA 3LG7A 4IREA 1CUNA 4UV8B 4HE8A 2PTFA 3PUWF 2NTXA 2YEVC 3K1SA 4KP3C 2BDEA 2CWOA 1U4QA 2K3WA 5FXVA 5FYMA 2KINB 3P50A 2DWKA 4PK6A 1QSDA 4IE6A 3SS1A 2I6HA 4WBOA 3ZSSA 2EHOB 2CBIA 4I43B 5EK2A 4MHCA 3U3IA 3OJAA 4Z90A 4PK5A 5L4EA 5IHYA 2D5UA 3P8CD 4CN4A 1MIVA 4X20E 2GK9A 3ZT6A 1JNRA 2WWVA 1HF8A 3ZT7A 4U74A 1I94T 2J4GA 3MACA 1S94A 1GQEA 2N9DA 3J7Yq 1ZP0A 4H63H 3RQWA 4QXBB 2FBWA 4HKAA 2HN1A 3IF8B 3RIUA 4E7SA 4EEDA 4JI2T 2WAUA 4BJMA 1XNQT 5HWXA 1YQ4A 4AKRB 3UTKA 2E5VA 3ZYMA 4B6XA 2NP9A 3DJBA 3C4ZA 2FUPA 4EZHA 4DUYT 5LGUB 3PUGA 3KVAA 4QWNB 2X68A 3AE2A 2OLTA 2LSIA 4O2BE 2X9YA 3MJXA 3C4WA 4HN9A 3CVRA 4GYRA 2JJ9A 5LYJE 2ZM6T 5FY0A 4A56A 1EZ3A 4ZOLE 4XBFB 4HWIB 4O4IE 4YTNA 2V5CA 4PFPA 5C2TA 2CHNA 2PFVA 4GOUA 5AQTB 5LOVE 5KXJA 5FXXA 3AAAB 5CJ5A 3CIRA 2E8IA 2X0LB 4IE0A 1YKHB 4DR4T 5C3JA 4O4LE 4GKKT 1US7B 3ESLA 1UK5A 2W62A 2XQ4A 5ABFA 2UXDT 2MYSA 4ILAA 5JRCB 1W9RA 3UU4A 2N1GA 2LRKA 3PU3A 3I0OA 4QHOA 5AQIB 2DHRA 2OA5A 3H3MA 4EYUA 4DR7T 3NRXA 3Q2MA 1OWAA 5JDNA 4ZS3A 2IAKA 2X9XA 2HH7A 3EUHA 3F57A 1YQ3A 3SWHA 4XAXB 1MIWA 2W2UA 3I0QA 2V1DB 1KEYA 1SA0E 3Q5DA 3TLWA 3HL6A 2H7VC 3M65A 2HN2A 2ZM0A 5FL0A 4JI7T 4YHHT 3NKZA 3T8OA 4B3TT 3D0TA 5AQQB 3AVSA 3CQGB 5CB4E 2XQ7A 4U7IA 4OYKA 2WBLA 5FKYA 4ASKA 1E7PA 3N9MA 4ADZA
chains in the Genus database with same CATH topology
2QYWA 1VCSA 3ONJA 2V8SV 3ONLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QYW A;  1VCS A;  3ONJ A;  2V8S V;  3ONL C; 
#chains in the Genus database with same CATH topology
 1YXR A;  2QA7 A;  3GN5 A;  1KF6 A;  5AQP B;  3ZJ2 A;  2CM0 A;  1HR0 T;  4EB6 E;  2WDV A;  3N9O A;  1OED E;  2XQ3 A;  3CPZ A;  1ZOY A;  4UVA B;  1D0X A;  2WS3 A;  3UQ4 A;  1JNZ A;  4EZ4 A;  5J2U E;  2CRB A;  3ZMT B;  2QVA A;  4LFA T;  1Z8U A;  3QUJ A;  2R6G F;  3PTR B;  2E2A A;  4U33 A;  5HXC A;  3L8R A;  1ZKE A;  2JIW A;  3LK3 B;  3RKO A;  1QUU A;  4JEH B;  1WCR A;  4CN6 A;  3ZMV B;  5AFU L;  1UCU A;  2PG8 A;  2L9Q A;  4PAG A;  4OK0 A;  2ES0 A;  4YTM A;  5JTG A;  1HX8 A;  2X67 A;  3K3O A;  5HWY A;  2PJQ A;  4GYS A;  3AEG A;  3ZC0 A;  1L0V A;  4A97 A;  2LEH A;  3M3Z B;  4L0R A;  4IL9 A;  3AB3 B;  2ZMA A;  3FZH B;  4U7Y A;  3AXJ A;  2B76 A;  3UFE A;  4DV0 T;  4FJO A;  3OKQ A;  1X9B A;  4NUV A;  5FMN A;  4QH4 A;  1Y64 B;  2KXP B;  3P7I A;  4WYV A;  5JR9 A;  1HCI A;  5KDM C;  3ZCI A;  2V26 A;  4HFE A;  4IIJ E;  2NR4 A;  3PUR A;  4DND A;  3B5M A;  4V1A v;  3RH3 A;  2AXD S;  4NIQ A;  4LFB T;  4ZI3 C;  3LDQ B;  5ABF B;  1WYC A;  3MA9 A;  4QKN A;  1LRZ A;  3KFW X;  4IE4 A;  2M67 A;  3QB5 K;  5JDG A;  2V5D A;  3ZEF B;  1YW0 A;  2UUC T;  2DWG A;  1HNX T;  1BR2 A;  4UF0 A;  3N2O A;  3EVY A;  4P0A A;  3UU8 A;  2VKJ A;  5HCJ A;  1VCT A;  1XMQ T;  3UUN A;  3VKH A;  5L4H A;  4JI5 T;  2WWU A;  4YHJ A;  3I9W A;  2JPF A;  2LSG A;  1OED A;  1W0A A;  2DCF A;  5AQF B;  4KI0 F;  4CI2 B;  1SE7 A;  2NW9 A;  2XY8 B;  2VUR A;  2CPT A;  4YT0 A;  2MAW A;  3SFD A;  5C8Y E;  3RIA A;  1UX5 A;  3QK6 A;  5FY7 A;  3ZPO A;  4DV5 T;  3WI3 A;  4BA9 A;  4KHP T;  3ZYL A;  3N9L A;  1CHU A;  5AQU B;  4YSX A;  1I6Z A;  1BR1 A;  4UXN B;  5AQL B;  1BR4 A;  2C5K T;  4AQF A;  4IGU A;  3KIN B;  5JRE A;  4YTP A;  3OBV E;  3AEC A;  5JDF A;  3GN5 B;  3AAE B;  3ZST A;  1MMG A;  4QX7 B;  5JQG E;  4C90 A;  3I1A A;  4IT4 A;  1LVK A;  4X66 T;  3G06 A;  2WZH A;  3HI2 A;  2CHO A;  3R6N A;  4LF8 T;  1XWM A;  5BMV E;  5LCY A;  4ILB A;  3SFE A;  2XQ5 A;  2CEA A;  5IUX A;  3HA4 A;  3HR0 A;  3K3N A;  2LOS A;  4JYA T;  4P09 A;  5HXE A;  2N2N A;  3JCF A;  2FJD A;  5LP6 E;  1OED C;  2CMR A;  3AE3 A;  4K0U A;  1G73 A;  3P4Q A;  4GIW A;  4CN1 A;  2WP9 A;  5HXR A;  1NEN A;  1IJ5 A;  2VVN A;  4O4H E;  4YFS A;  4Z91 A;  1MMA A;  3NWI A;  2BBH A;  4MBQ A;  5ADX L;  2LT3 A;  2MTQ A;  3O1J A;  4JV5 T;  4WBN E;  3P4R A;  2YN6 A;  3ONL C;  1HFA A;  5L3B B;  1H7C A;  2ODV A;  4GKJ T;  5KMG P;  1D1B A;  5LMU T;  1R8I A;  3Q9D A;  1XNR T;  3BK9 A;  2WU2 A;  2W63 A;  5JH7 E;  3AXJ B;  3AA0 B;  4ANJ A;  4B3R T;  3IA3 A;  5TAO A;  4AKG A;  1UGO A;  2CXF A;  4X65 T;  3LBX A;  3P4W A;  3KBU A;  5JR9 B;  4QH1 A;  3CX6 B;  3NRY A;  4ZI2 D;  2NWB A;  2XAF B;  3DTO A;  1HNZ T;  4TV9 E;  3WAJ A;  5J1G A;  4COF A;  4U31 A;  5HXS A;  4TNW A;  2W66 A;  2LSJ A;  1VOM A;  4PJL A;  2RPA A;  4F8H A;  2BG9 A;  2JQH A;  5FVL A;  3PJA J;  4UF0 B;  1D1C A;  3RI5 A;  3U78 A;  2WM9 A;  5LG3 A;  3RLF F;  4HFC A;  5KX5 E;  2D2S A;  3FBL A;  5AQH B;  1YD8 G;  4ZZC A;  2WY2 A;  2X0H A;  5DAB A;  2W0G A;  4DV6 T;  1OED B;  2XSB A;  4UVC B;  2VQF T;  4U72 A;  4X1I E;  4KBM B;  4MAL A;  3OVU A;  4TWH A;  3RC3 A;  1X79 A;  3ZKR A;  4AQY T;  4AKH A;  4LF9 T;  4JUY A;  4E7Z A;  3CML A;  3RPU A;  3N9P A;  4ZEY A;  5L3C B;  4JLE A;  4TNV A;  2BKO A;  4QX8 B;  1IBK T;  3Q5X A;  4ZXL A;  3VRB A;  4YSY A;  4NUU A;  1ZHC A;  4AIS A;  4GK0 E;  3CX8 B;  3IEE A;  2KT9 A;  4LML A;  3O4X E;  4IL4 A;  2UUA T;  4HEA A;  3P4S A;  5HEO A;  1KNZ A;  4Z8X A;  2CE7 A;  3ONJ A;  1LKX A;  4HFD A;  5F5W A;  3RIU C;  3TLS A;  3HKE E;  4TX5 A;  2QRX A;  1J5W A;  2VVS A;  2LSY A;  2BBJ A;  2LKG A;  4OX9 T;  4PK4 A;  3DP7 A;  3AE8 A;  3TLU A;  5AQO B;  3C51 A;  3FZK B;  4I0U A;  4JEU B;  1ZEE A;  3GA8 A;  3A8Y C;  2WDR A;  4LFC T;  3KV9 A;  3ETV A;  3VHL A;  5LGT B;  4CXX A;  3CKD A;  4YXD A;  4DO0 A;  3AE6 A;  4HFV A;  2C0S A;  1UX4 A;  4I4T E;  4X1K E;  2NOX A;  4KX6 A;  4LF7 T;  4HFB A;  2LM2 A;  5AQV B;  2Z6E A;  3I9Y A;  3Q5W A;  3UUL A;  3KV4 A;  2NW8 A;  2VKH A;  4PFO A;  3MXZ A;  2KZ7 B;  4AXP A;  3VR8 A;  2ZM2 A;  3O1H A;  4BAY B;  2QYW A;  3LBX B;  3V5U A;  5CGM A;  3NBX X;  2JMK A;  2HHH T;  2YKS A;  1HTJ F;  2AE9 A;  3H3A A;  4DV3 T;  5J2T E;  2WZI A;  4LMJ A;  3ZC1 A;  1IZN B;  3RKG A;  5LMN T;  5L47 A;  1IBM T;  4DR3 T;  4DUZ T;  2XAS B;  2IIU A;  1N32 T;  1Y01 A;  3CK6 A;  1KNP A;  4L9I A;  2BG9 B;  2W00 A;  2ACZ A;  4JI1 T;  3PU8 A;  1T7S A;  2WDQ A;  4KHZ F;  2X9H A;  3VR9 A;  4YSZ A;  2IML A;  4HWD A;  4H9P C;  4UR9 A;  3UU6 A;  2XPK A;  5LB7 B;  4C91 A;  2WQY A;  1J1J A;  2VAS A;  2IUB A;  2A2F X;  1VCS A;  3QOF A;  1FEW A;  3VU7 H;  3PUY F;  4TUY E;  2M6I A;  4O4J E;  4AIU A;  2VQE T;  1D0Z A;  4ZI7 E;  1D0Y A;  2YIN A;  2V7L A;  5AQK B;  4X1Y E;  3J9X 1;  3BQK A;  5DQV A;  2C5I T;  3AVR A;  2KWH A;  2X9W A;  3AEF A;  2VKD A;  4EIW A;  3FBZ A;  5HCM A;  3RX6 A;  5F8P A;  2UU9 T;  3RGL A;  2Q9Q A;  4WW0 A;  3BQI A;  3AA7 B;  3FZF B;  3B13 A;  4DV1 T;  5LXT E;  4DR5 T;  3S4U A;  4ILU A;  4MLK A;  2JQ9 A;  4LF4 T;  1M62 A;  4H9O C;  3SOL A;  3T1H T;  3ONX A;  2XAG B;  3NZQ A;  2Q9Q D;  5IWA T;  1B7T A;  4HGA A;  2CWY A;  1IJ6 A;  1U5P A;  5LBQ B;  4EV6 A;  1N33 T;  2BS4 A;  4NXN T;  4YY3 T;  1WR6 A;  5F3J A;  4N78 D;  4WZX A;  3L3P A;  2X66 A;  4FI5 A;  2XQ6 A;  2J1D G;  5CFB A;  1WRD A;  5DJQ C;  2K24 A;  1ZV4 X;  2ACX A;  3ZN1 B;  5LHH B;  4DMV A;  3AEA A;  2LLY A;  1SHZ C;  4ZHQ E;  3E0Z A;  2BS3 A;  4O2A E;  5JDH A;  1S35 A;  2M6B A;  3C98 B;  3MZK B;  3VKG A;  4ZS2 A;  4AQG A;  1DU2 A;  1UUS A;  3NZP A;  4G2A A;  2BG9 E;  2LHR A;  3HKB E;  2E9X A;  4PNI A;  3VRA A;  4H9Q C;  5JR9 C;  4KMC A;  3KBT A;  4PJJ A;  4U2Z A;  4EGW A;  2V6Y A;  4TV8 E;  5AQR B;  2Q9Q C;  4L5G A;  2PBI A;  2KWI B;  2UXN B;  3RYC E;  2YDS A;  3FXE B;  2DL1 A;  5DQW A;  2E9X D;  1W09 A;  3ZJ1 A;  2IW5 B;  2ZM8 A;  3O9X A;  4NPP A;  3E08 A;  5FL1 A;  3UUX B;  1FMV A;  3H37 A;  5LBM A;  4DVD A;  2YOE A;  4M1P A;  2XQ9 A;  3AE5 A;  3PDY A;  4UEM A;  1NAF A;  3EHZ A;  3UU5 A;  3FZL B;  5HEU A;  4IDZ A;  3K8P C;  1E1H B;  5CA0 E;  5LNK A;  2YDR A;  4HTE A;  3KDS E;  3PV0 F;  4UVB B;  2VB6 A;  2IDO B;  3C4X A;  4O8S A;  1LVF A;  2YK0 A;  2A72 A;  2VKO A;  2MOZ A;  2DI4 A;  1WLX A;  5HYA A;  3OTO T;  3TKL B;  5L3G B;  1KNR A;  2X51 A;  2V7K A;  4LF6 T;  3ZCJ A;  5GON E;  2KMF A;  4EXT A;  4PJM A;  3AE9 A;  3ZN0 B;  2UXB T;  3GWH A;  3ZMS B;  1NWM X;  4NXM T;  4JI6 T;  2E9X C;  4H63 V;  4X64 T;  5AQN B;  4CXY A;  3LK2 B;  3ZLI A;  1KK7 A;  3LFM A;  4CI1 B;  4PW8 A;  4AQF C;  5JVD E;  3EAB A;  1IBL T;  3RIF A;  1M7K A;  2XM2 A;  3LSV A;  3N5L A;  3X1D A;  3RHW A;  2CLY C;  1MMN A;  2D0T A;  3TLV A;  3HKD E;  2W4X A;  4IDN A;  3F31 A;  2H3R A;  3UQ7 A;  2IC6 A;  3CQC B;  3PUZ F;  4B3M T;  2Q9Q B;  5LG4 A;  1AJ3 A;  2YU1 A;  3CWZ B;  3PUV F;  5AQM B;  3CX7 B;  3F2E A;  3FXD B;  4U3C A;  1XZY A;  3WAK A;  1T8B A;  4ERR A;  4OFZ A;  3PJA A;  2RP4 A;  2C5J A;  5FNV E;  3QNU A;  3SRZ A;  2E5L T;  1FJG T;  2H7O A;  3RRC A;  4G63 A;  3A7M A;  1O3X A;  3UUM A;  3AE7 A;  2LHN A;  3UUB A;  4YJ2 E;  2XSA A;  3ZMZ B;  4DV7 T;  1N36 T;  3FHN A;  4DID B;  4F6R C;  4IE7 A;  3ZMU B;  2B1E A;  3Q5E A;  4OHF A;  1UUR A;  3QC9 A;  4ZZB A;  4X62 T;  3HKC E;  4ZI2 C;  3AE1 A;  3UT5 E;  2HPJ A;  3A5X A;  2VWA A;  3IBP A;  5HEG A;  2XQA A;  4EEB A;  5JDQ A;  2XQ8 A;  5H6R B;  4IST A;  2CXD A;  1HNW T;  2E9X B;  2JRK A;  2BKN A;  3N2K E;  4DV4 T;  2NTY A;  1J5E T;  3V5S A;  3PUQ A;  1N34 T;  4IDP A;  4CI3 B;  3P4P A;  2LM9 A;  2V8S V;  4DR2 T;  2V6Y B;  1BR0 A;  3GMI A;  2CLY B;  2L8K A;  2NW7 A;  3MK7 C;  3OYZ A;  2X0Y A;  4P0B A;  4J2C A;  2BVM A;  5L3E B;  4JI3 T;  2BG9 C;  5L3F B;  2ZLY A;  4CZZ B;  2IC9 A;  2LJL A;  2I59 A;  5A1L A;  5J0Z A;  3EDV A;  5CA1 E;  3NVO A;  4CXW A;  2Y48 B;  5HAX A;  2XM1 A;  1D1A A;  2V6X A;  2W61 A;  2RA1 A;  3EAM A;  1WYB A;  3T1Y T;  1HX1 B;  1E2A A;  1W0B A;  3ANW A;  3PE0 A;  4PJN A;  5L3D B;  4ILC A;  2LOP A;  3PUX F;  3AE4 A;  1OXZ A;  4UIG A;  4EYY R;  5H6Q B;  5HEH A;  4LMK A;  5FXZ A;  4P1N A;  2QGS A;  5LJM A;  4IHJ E;  2K48 A;  1MIY A;  4Q25 A;  3W15 B;  4YLH A;  2LE8 A;  4XZC A;  2WMO A;  2WCA A;  4I50 E;  2VL8 A;  5LHG B;  4QXH B;  3MKD A;  4IDO A;  2XAH B;  3PUS A;  3L09 A;  2XJ7 A;  2F4V T;  2MPK A;  4UEL A;  2WSS V;  5AQS B;  2ODU A;  4X5T A;  3L39 A;  3TLT A;  1SUM B;  3FZM B;  4TZ4 C;  3LK4 2;  4DR6 T;  5ABH A;  1MNE A;  4OYJ A;  5LHI B;  2FJB A;  4KUM B;  4BJN A;  1MMD A;  1G8X A;  2KND A;  2L3L A;  2Y8D A;  4QH5 A;  3UU3 A;  2A3D A;  4TN7 B;  4U2Y A;  4H9N C;  3AAI A;  2DNX A;  4HWF A;  1HG5 A;  3AEB A;  2XUE A;  3O1I A;  3LJC A;  2VK9 A;  2FJE A;  2D0U A;  2W67 A;  2BZB A;  1IAP A;  4JI0 T;  2CXL A;  4DMW A;  2XZE A;  2A9U A;  5E0O A;  4DBR A;  3CQX C;  3KV5 A;  4ISS A;  4ZI3 D;  4QXC B;  2G0U A;  2SPC A;  3JC6 D;  2P9B A;  3BQL A;  3KVB A;  2H89 A;  3K3Q C;  4LF5 T;  4HFI A;  2WMN A;  3B57 A;  3RYI E;  5AQJ B;  5L2L A;  1HG2 A;  4JI4 T;  5HEJ A;  1QLB A;  4MFR A;  2Y6X A;  5FVK A;  2JMH A;  2EHO A;  1WR0 A;  3ZT5 A;  4H9S E;  2BVL A;  2KSR A;  2V7I A;  3OPC A;  4I55 E;  3N9N A;  3C50 A;  2MBG A;  3RQU A;  3RC8 A;  2XQY A;  5LGN B;  1FMW A;  4JI8 T;  2OV9 A;  2LRL A;  2XAJ B;  3ETU A;  2UUB T;  2EHO D;  1Z0P A;  3JAD A;  3PUA A;  2HPL A;  3N9Q A;  1XDO A;  5EZY E;  2IHR 1;  2LSK A;  1T98 A;  2DLR A;  4JBW F;  2H88 A;  2XAQ B;  3FB2 A;  2J47 A;  3JC6 C;  3AEE A;  2FJA A;  5FP3 A;  2XTL A;  5ABE A;  4HWC A;  1WFD A;  5HXH A;  3R84 B;  3ANW B;  2K9A A;  4TWD A;  5JDL A;  4IDQ A;  2YDQ A;  5LA6 E;  3OYX A;  4H9R C;  4CQI A;  5FXW A;  1HS7 A;  5IYZ E;  3AED A;  1YKE B;  3AA1 B;  4AI6 A;  3RRW A;  4TWF A;  2K5B B;  5M4Y A;  3JAE A;  4UV9 B;  2J62 A;  2LKH A;  2CCQ A;  3RF1 A;  3AA6 B;  2WB5 A;  2XHE B;  1NEK A;  3ZYK A;  1V9D A;  5EK4 A;  3E22 E;  4EAH A;  4A98 A;  2EHO C;  3UFG A;  4AKL A;  1FIO A;  3IHR A;  4YJ3 E;  5FY1 A;  4A5X A;  5AQG B;  2YU2 A;  2KLQ A;  5ABG A;  1VRB A;  3N2G E;  2CBJ A;  5JDM A;  4HWH A;  3EI0 A;  1KFY A;  4IE5 A;  2UXC T;  4HFH A;  4GK5 E;  3KV6 A;  4K0K T;  3JAF A;  3ABV A;  2BS2 A;  3QB5 A;  2WU5 A;  2V7M A;  2UXX B;  2V7J A;  4DBQ A;  4DR1 T;  5JRC A;  5ETW A;  2VL0 A;  2BKP A;  3RYH E;  4WNK A;  4DV2 T;  5LJN A;  5EK3 A;  3RYF E;  2I0M A;  3EDU A;  1T72 A;  3C64 A;  5BR8 T;  2JQQ A;  1XDP A;  1XMO T;  4EOZ B;  4B3S T;  4AKI A;  2CA5 A;  2D9D A;  1MND A;  2JQK A;  3LG7 A;  4IRE A;  1CUN A;  4UV8 B;  4HE8 A;  2PTF A;  3PUW F;  2NTX A;  2YEV C;  3K1S A;  4KP3 C;  2BDE A;  2CWO A;  1U4Q A;  2K3W A;  5FXV A;  5FYM A;  2KIN B;  3P50 A;  2DWK A;  4PK6 A;  1QSD A;  4IE6 A;  3SS1 A;  2I6H A;  4WBO A;  3ZSS A;  2EHO B;  2CBI A;  4I43 B;  5EK2 A;  4MHC A;  3U3I A;  3OJA A;  4Z90 A;  4PK5 A;  5L4E A;  5IHY A;  2D5U A;  3P8C D;  4CN4 A;  1MIV A;  4X20 E;  2GK9 A;  3ZT6 A;  1JNR A;  2WWV A;  1HF8 A;  3ZT7 A;  4U74 A;  1I94 T;  2J4G A;  3MAC A;  1S94 A;  1GQE A;  2N9D A;  3J7Y q;  1ZP0 A;  4H63 H;  3RQW A;  4QXB B;  2FBW A;  4HKA A;  2HN1 A;  3IF8 B;  3RIU A;  4E7S A;  4EED A;  4JI2 T;  2WAU A;  4BJM A;  1XNQ T;  5HWX A;  1YQ4 A;  4AKR B;  3UTK A;  2E5V A;  3ZYM A;  4B6X A;  2NP9 A;  3DJB A;  3C4Z A;  2FUP A;  4EZH A;  4DUY T;  5LGU B;  3PUG A;  3KVA A;  4QWN B;  2X68 A;  3AE2 A;  2OLT A;  2LSI A;  4O2B E;  2X9Y A;  3MJX A;  3C4W A;  4HN9 A;  3CVR A;  4GYR A;  2JJ9 A;  5LYJ E;  2ZM6 T;  5FY0 A;  4A56 A;  1EZ3 A;  4ZOL E;  4XBF B;  4HWI B;  4O4I E;  4YTN A;  2V5C A;  4PFP A;  5C2T A;  2CHN A;  2PFV A;  4GOU A;  5AQT B;  5LOV E;  5KXJ A;  5FXX A;  3AAA B;  5CJ5 A;  3CIR A;  2E8I A;  2X0L B;  4IE0 A;  1YKH B;  4DR4 T;  5C3J A;  4O4L E;  4GKK T;  1US7 B;  3ESL A;  1UK5 A;  2W62 A;  2XQ4 A;  5ABF A;  2UXD T;  2MYS A;  4ILA A;  5JRC B;  1W9R A;  3UU4 A;  2N1G A;  2LRK A;  3PU3 A;  3I0O A;  4QHO A;  5AQI B;  2DHR A;  2OA5 A;  3H3M A;  4EYU A;  4DR7 T;  3NRX A;  3Q2M A;  1OWA A;  5JDN A;  4ZS3 A;  2IAK A;  2X9X A;  2HH7 A;  3EUH A;  3F57 A;  1YQ3 A;  3SWH A;  4XAX B;  1MIW A;  2W2U A;  3I0Q A;  2V1D B;  1KEY A;  1SA0 E;  3Q5D A;  3TLW A;  3HL6 A;  2H7V C;  3M65 A;  2HN2 A;  2ZM0 A;  5FL0 A;  4JI7 T;  4YHH T;  3NKZ A;  3T8O A;  4B3T T;  3D0T A;  5AQQ B;  3AVS A;  3CQG B;  5CB4 E;  2XQ7 A;  4U7I A;  4OYK A;  2WBL A;  5FKY A;  4ASK A;  1E7P A;  3N9M A;  4ADZ A; 
#chains in the Genus database with same CATH homology
 2QYW A;  1VCS A;  3ONJ A;  2V8S V;  3ONL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...