3ONJA

Crystal structure of yeast vti1p_habc domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
97
structure length
97
Chain Sequence
SLLISYESDFKTTLEQAKASLAEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVEVNNSIGDASERATYKAKLREWKKTIQSDIKRPLQSLVDSGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Epsin N-terminal homology domains bind on opposite sides of two SNAREs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords t-SNARE VTI1
total genus 44
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2010-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05008 V-SNARE Vesicle transport v-SNARE protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 3onjA00
2V8SV 3ONLC 1VCSA 3ONJA 2QYWA
chains in the Genus database with same CATH superfamily
3CX6B 3UULA 4IE4A 1HS7A 4ILAA 3RYIE 2BS3A 3Q5EA 2IIUA 2WCAA 4ZS3A 3UU8A 3PUZF 2WU2A 3AAEB 2WB5A 4CXYA 4OX9T 2ZMAA 3K3QC 1NWMX 2XQ7A 4UV9B 3OJAA 3ANWA 2WWVA 4A98A 1V9DA 4ANJA 4EYYR 4X62T 1E7PA 3AE6A 4DV4T 2BS4A 3H3AA 4M1PA 4HFIA 5C3JA 2LSYA 2SPCA 2LT3A 3BQKA 3N9MA 3W15B 1JNRA 3U3IA 5CA1E 2XASB 3C4WA 3QB5A 2LLYA 5LYJE 1S35A 3X1DA 2CEAA 1X9BA 4KX6A 2YDQA 4X1KE 4UVCB 1YD8G 5LG3A 1BR4A 5HEJA 5ETWA 4DR1T 5L3FB 3KV4A 3IEEA 4E7SA 3RF1A 4AKGA 5L3EB 1IBKT 5DABA 1IZNB 3JADA 2DHRA 3LBXA 4QX7B 5ADXL 5ABFA 1XDPA 2J62A 2LJLA 3P4WA 4PJLA 5EK4A 3NRXA 1FEWA 4PK6A 5J2TE 5BR8T 1HNWT 2W61A 3AEGA 3WAKA 5L3GB 2X68A 1W0BA 4UR9A 4TWHA 1MIWA 2JQHA 5FY7A 3PURA 3RKGA 1BR1A 4JI0T 4P0AA 1XZYA 4DMWA 2HPJA 5JTGA 5FYMA 1ZOYA 2XQ9A 2J4GA 4AKRB 1YXRA 1J5ET 4EZHA 4P0BA 5AQKB 3RIFA 4JI5T 4EXTA 4AKHA 4YSYA 3ZSTA 4EEBA 5JDLA 2FJAA 1GQEA 2DCFA 2K48A 2YU1A 2FJEA 3A7MA 3FZFB 2X0HA 5HXEA 2BDEA 3O9XA 1YQ4A 3ZJ2A 1FJGT 3VR8A 3ZLIA 5JDGA 3N9NA 1ZKEA 4FI5A 3RC3A 2WSSV 2XQAA 3UU4A 3OYXA 4YTPA 4EB6E 2C0SA 4F8HA 4HEAA 4L5GA 4AISA 5AQFB 3EI0A 4ZI7E 2V5CA 1O3XA 2QRXA 3LBXB 2BVMA 4BJMA 3EUHA 1MMAA 4ZI2D 5CGMA 4DR4T 2V6YA 2KNDA 1XMOT 2B1EA 3AEAA 5IWAT 3ZSSA 2WZHA 3T1HT 2ES0A 2H89A 2V6XA 4DBQA 5LHHB 2J1DG 2VASA 2XQ5A 3KVBA 5AQQB 5AQTB 2WZIA 3L8RA 2EHOA 2H88A 2LKHA 3O1IA 3PUGA 5IHYA 4BA9A 2XPKA 1QUUA 2WS3A 1NENA 2YN6A 4MBQA 2DWGA 4OK0A 5AQUB 5FMNA 5HEGA 3PU8A 3Q9DA 3RPUA 4IHJE 2NW9A 1FIOA 3EDUA 3N2GE 5KX5E 3A8YC 3AE9A 3PDYA 5LA6E 1Z0PA 2MAWA 2QVAA 4X1YE 3HR0A 4PFOA 2NW8A 4ZI2C 1JNZA 2XAGB 1OWAA 3P8CD 2X9WA 1R8IA 2K24A 3AE5A 3RYHE 3S4UA 4YXDA 3RIUC 3B57A 3PV0F 2WDVA 4KP3C 3ONJA 3Q5XA 1W9RA 2DWKA 2JQ9A 4CI3B 5LGNB 5L2LA 4QHOA 3UUBA 3FB2A 4MHCA 2LSGA 2W4XA 3GN5A 5JR9C 1UCUA 5EZYE 4DR6T 4H9QC 2XUEA 1US7B 2Y48B 2N1GA 3N9LA 2H7OA 4L0RA 4DV0T 4O4IE 3LK42 3N5LA 3VKHA 1G8XA 5LCYA 4AQFC 2W63A 2VQFT 2QA7A 4X1IE 4YHJA 2VK9A 3H37A 3KBUA 2XJ7A 3C50A 1IJ5A 4GKKT 2H7VC 3N9OA 2CLYC 2VURA 2CWYA 3I0QA 3KFWX 3I1AA 4L9IA 5AQRB 3VU7H 2W66A 3K1SA 4TNWA 4QKNA 1HFAA 2HPLA 3QC9A 4IGUA 4X65T 4JI6T 3UU6A 3FXDB 2Q9QD 2BG9B 4JBWF 4GOUA 3AE2A 4NUVA 3RYFE 4EAHA 4ZZCA 2NW7A 2ZLYA 3GN5B 4TUYE 2CHOA 3UFEA 4ZI3D 2ACXA 4TWDA 2KT9A 3CK6A 4O4LE 1SE7A 1OXZA 2RPAA 4PJJA 4ZI3C 1YKEB 3M3ZB 5JDHA 1SA0E 3ETUA 5GONE 2KWIB 4KI0F 4X5TA 1Y01A 4H63H 5FY0A 3LFMA 1J1JA 3ESLA 3JAEA 2JMHA 2L9QA 1MNDA 2ZM8A 2Q9QA 3C4ZA 5L3BB 1UX4A 3UQ7A 2D5UA 2V8SV 4DV2T 1T98A 4JI7T 2CE7A 2BKNA 3AEDA 3P4PA 3ZMSB 4U2YA 2X67A 4QX8B 4U7YA 5FY1A 4BJNA 3MXZA 4JI1T 1KK7A 1HG2A 3UQ4A 3CQCB 2UXDT 2QGSA 3F31A 4O2BE 4ILUA 5CFBA 4HFEA 4ZOLE 3LG7A 2H3RA 3RQWA 2KINB 2XQ8A 4KHZF 1SUMB 3UFGA 4YSXA 4LF7T 1KNZA 2WDQA 2V7KA 4UF0A 4X20E 1MMGA 3CQGB 3P7IA 3MA9A 4IDPA 2D0TA 4PNIA 3KBTA 1HNXT 2JIWA 5H6RB 2BG9C 3RGLA 2YEVC 3HKEE 1UK5A 5FKYA 2MBGA 2LRKA 4NUUA 4WBOA 1MMNA 3QUJA 3MJXA 3N2KE 5DQWA 4JI2T 2UUAT 3EDVA 2X66A 3HKDE 4YJ3E 2C5KT 1WR6A 3Q5DA 4NPPA 3CIRA 4U31A 3H3MA 4YLHA 4DUZT 4DV6T 4QXBB 3AXJB 4AKIA 2A3DA 5LB7B 4GKJT 4JI4T 2I6HA 5HAXA 1WCRA 3LK2B 4ZHQE 4HN9A 3CWZB 1LVFA 3AVSA 4G2AA 2EHOD 4O8SA 3RC8A 3PTRB 2V7JA 2E9XB 3UU3A 2NWBA 4P09A 2C5IT 4IIJE 3I0OA 4JEUB 4LFCT 3IHRA 1S94A 2EHOB 4C91A 1MIVA 5J2UE 2XSAA 2LHNA 4AKLA 1UUSA 4HWIB 3FBLA 4U72A 4LMJA 4U2ZA 1T8BA 3AA1B 4AQGA 2K9AA 5HWXA 2XM1A 4KHPT 1MMDA 2XAJB 3RH3A 4Z90A 2LKGA 2XAHB 5TAOA 5FVLA 2ZM6T 5A1LA 5M4YA 1D1CA 4PAGA 2F4VT 4DV1T 3OBVE 3GA8A 4HGAA 3RX6A 3TLWA 1XNRT 3LJCA 2WDRA 3IA3A 4COFA 2DL1A 3J9X1 4Z91A 3NWIA 3ONLC 4GK5E 4IDOA 5HEHA 2W00A 4DR2T 2JMKA 3AAIA 2CPTA 3C51A 3CX7B 4P1NA 5LMUT 3JCFA 1HX8A 3LDQB 5HEUA 2UUBT 2BKOA 4CXWA 3NBXX 3ZT6A 4YSZA 4X66T 3GMIA 1FMWA 2FJDA 1VCSA 5AQNB 2W62A 3R6NA 3ZCJA 4GIWA 5DQVA 3ZMZB 4ZEYA 3HKCE 4AQYT 3PU3A 1YKHB 2A72A 2QYWA 3RIAA 5JQGE 2VVSA 3OTOT 4O2AE 3AE3A 2JQKA 4HTEA 2HH7A 4UF0B 2E2AA 3DJBA 3L39A 1HCIA 3VRAA 3ZN0B 2GK9A 4B3RT 2BKPA 2K3WA 1CUNA 4TWFA 5HWYA 3ZMVB 4ERRA 2CA5A 3KINB 1W0AA 5BMVE 4YJ2E 5LP6E 4O4JE 1QSDA 4EV6A 1D1BA 3RIUA 4EZ4A 1KFYA 2VKOA 2CCQA 2HN1A 4GK0E 4HWCA 1OEDA 2CXLA 3ZC1A 3ETVA 4Q25A 2PTFA 2FBWA 3ZN1B 2UXCT 2XAFB 4K0UA 5JDMA 3CVRA 2ZM0A 4K0KT 2BG9A 3AXJA 3KV5A 3O1HA 2G0UA 1G73A 3OVUA 4JI3T 4IDZA 1T72A 3KV6A 1DU2A 2E9XC 3NZPA 1WR0A 2KLQA 3FHNA 4EEDA 1J5WA 3EVYA 1KF6A 4WBNE 2Y8DA 3HL6A 3FZLB 1L0VA 1YQ3A 3AE1A 2FUPA 1E1HB 3SWHA 3ZEFB 2BS2A 3ZT5A 4LFAT 1WLXA 4MLKA 1LVKA 3WI3A 3OPCA 2XZEA 4HFHA 2Q9QB 1XMQT 3LK3B 3PUQA 3C4XA 1MIYA 2LRLA 4H63V 2XSBA 4IL4A 5FNVE 2Y6XA 4KMCA 5HXRA 2WM9A 4U7IA 3ZPOA 1Y64B 5LHIB 1Z8UA 5F5WA 3VKGA 4DNDA 5JRCA 5HEOA 2IUBA 4N78D 4PK4A 4BAYB 3VRBA 3B13A 5FL0A 2CXDA 2BBHA 5FXZA 4H9RC 1FMVA 3PUAA 5J1GA 4DUYT 3ZT7A 4IE6A 5LMNT 3Q5WA 5AQHB 2X9XA 3ZYLA 2Z6EA 4TV8E 5AQMB 3J7Yq 2V5DA 3IBPA 3MK7C 4HFCA 5LOVE 3RRWA 2YOEA 4TV9E 1I6ZA 4UEMA 1BR0A 3HKBE 1IAPA 1D1AA 5AQOB 3UUMA 5JH7E 4NXNT 3FZHB 3PJAA 2I0MA 3AA7B 2V1DB 1D0YA 2N9DA 2YDSA 5LG4A 5LNKA 3WAJA 4YY3T 4IE0A 1IBLT 1D0XA 2CBJA 2MTQA 2W0GA 4QXHB 3AAAB 4ASKA 4IDQA 4EGWA 4H9NC 2PG8A 3AVRA 1I94T 3UT5E 1NAFA 2R6GF 2VL8A 3E22E 5KXJA 2WBLA 1N36T 3JC6D 4QH5A 2P9BA 3EABA 3NZQA 3BQIA 1ZV4X 4HFVA 4NXMT 5FXXA 2IDOB 4IREA 4O4HE 4PJNA 2NR4A 4DV3T 2LM9A 3LSVA 5LBQB 2VWAA 3TLUA 2BBJA 4UIGA 3RRCA 2ODVA 2NTXA 3RQUA 4E7ZA 2RP4A 4PJMA 4ZXLA 2NOXA 4QH1A 2V7MA 5FP3A 3JAFA 2VKHA 2LSIA 3AA6B 3ZMUB 4DBRA 2XHEB 3FBZA 3N9PA 4EIWA 5IUXA 3FXEB 5ABEA 2ZM2A 3C98B 3PUWF 5J0ZA 1KNPA 2RA1A 3EAMA 3I9YA 3TLTA 2VQET 4PW8A 4CN1A 4J2CA 5L4EA 4GYSA 2CXFA 4JI8T 2W2UA 4B3MT 4JYAT 3V5UA 2B76A 5EK3A 1H7CA 5FVKA 2PFVA 3T1YT 1XWMA 2D9DA 3ZYKA 2WU5A 5FXVA 2NTYA 2CHNA 2IHR1 4ADZA 1KEYA 2KXPB 3AA0B 4HE8A 3AE8A 4G63A 5AQJB 5LBMA 5ABFB 2E5LT 4HWFA 5AQPB 2JJ9A 1WFDA 3RHWA 2LSKA 5JR9B 2KZ7B 2N2NA 3K3NA 4IE5A 2BZBA 5F8PA 2DLRA 3ABVA 2K5BB 3SRZA 5H6QB 4CXXA 2HN2A 2XY8B 4DO0A 3KV9A 2E5VA 4WW0A 2E9XA 4ISTA 3GWHA 3CPZA 3HI2A 3QK6A 3ZMTB 2LM2A 1OEDC 3DP7A 4DMVA 5L4HA 3RKOA 3PJAJ 3TLSA 4MALA 2IW5B 4IL9A 1OEDE 2AE9A 2VB6A 4GYRA 4MFRA 4XAXB 4KUMB 3ZYMA 2KWHA 4TX5A 5ABGA 3FZMB 3RI5A 4I50E 3VR9A 4C90A 5EK2A 5CA0E 2IC9A 4LMLA 1B7TA 2NP9A 2X9HA 1WYCA 3CX8B 3UUXB 3PUYF 4CN6A 2VVNA 2W67A 1HF8A 2JQQA 1YW0A 4HFDA 4CQIA 5KMGP 5LJMA 4B3TT 1ZP0A 2JPFA 2WQYA 1IJ6A 1W09A 2LHRA 1VOMA 5ABHA 1LRZA 3EHZA 5AFUL 3R84B 5KDMC 2E9XD 2LSJA 2C5JA 3PE0A 3SS1A 5C2TA 1N32T 2A2FX 3ZCIA 2XTLA 3MZKB 5L47A 3RLFF 4ISSA 2I59A 3Q2MA 5AQSB 2HHHT 1U5PA 4A5XA 5LJNA 4JLEA 4NIQA 1WRDA 4CI1B 2UXBT 1BR2A 4I55E 3T8OA 3N2OA 4LFBT 3UU5A 2JRKA 2OLTA 2WY2A 1WYBA 3ANWB 3MACA 3PUXF 3CQXC 2MPKA 2X9YA 3V5SA 5CB4E 3M65A 4YT0A 5JDFA 4PFPA 1LKXA 3U78A 4XZCA 1M62A 1D0ZA 2LEHA 4I4TE 2V7LA 3UUNA 5JRCB 3FZKB 4UXNB 1VRBA 2L8KA 2X0LB 2X0YA 3TLVA 1OEDB 4U3CA 4DVDA 3O1JA 5L3DB 2WMNA 2Q9QC 5HYAA 5LGUB 1X79A 1UURA 2OV9A 2CBIA 2A9UA 3P50A 3E08A 4LF8T 3ZKRA 4H9SE 2BVLA 1HX1B 3UTKA 5JR9A 4DR3T 1XNQT 2X51A 4H9PC 2IMLA 1MNEA 2E8IA 2CM0A 2L3LA 3G06A 4HWDA 2VKJA 3CKDA 2YINA 2PJQA 4OYJA 3MKDA 4WYVA 5DJQC 2PBIA 5AQVB 4IE7A 4CZZB 4DV7T 1HR0T 4TZ4C 4AI6A 4IDNA 2IAKA 3ZC0A 4UV8B 2LOPA 4Z8XA 4AIUA 2CWOA 1AJ3A 5JVDE 3D0TA 4X64T 3CMLA 3DTOA 3AEBA 3AEFA 4ZS2A 4LF6T 3OKQA 3AE7A 2CRBA 4UELA 2UUCT 2VKDA 3QB5K 4EYUA 2ODUA 2DNXA 1HNZT 2MYSA 3N9QA 2XQYA 2ACZA 2MOZA 3NKZA 4U33A 3KDSE 2CMRA 4CN4A 4TN7B 2YDRA 4CI2B 2VL0A 3VHLA 5JREA 4WZXA 4QWNB 3C64A 3SOLA 4IT4A 4OHFA 3AE4A 2V7IA 5LXTE 4DV5T 1T7SA 3A5XA 4ILBA 3BQLA 1E2AA 2KMFA 2V6YB 2V26A 2IC6A 2BG9E 2WP9A 1IBMT 2KSRA 4F6RC 3K8PC 3F57A 4QH4A 5HXCA 3OYZA 5F3JA 3BK9A 4LMKA 1HG5A 1VCTA 2D2SA 4WNKA 2WAUA 2LOSA 2M67A 4A56A 4UVAB 4AQFA 5LGTB 4B3ST 4ZZBA 4UVBB 5CJ5A 3F2EA 2LE8A 3I9WA 2XM2A 1EZ3A 3L09A 2WWUA 4QXCB 4YFSA 3IF8B 5HCMA 5L3CB 2M6IA 1KNRA 4YTMA 4OFZA 4U74A 4H9OC 4B6XA 4JV5T 4V1Av 3TKLB 2YKSA 3AB3B 1HTJF 3RYCE 1UX5A 4DR5T 2XQ6A 2UU9T 2UXNB 2AXDS 3QOFA 5HCJA 4I0UA 3QNUA 4HWHA 1U4QA 3AECA 5AQLB 3NRYA 2YU2A 4EOZB 4LF5T 2WMOA 5FXWA 5AQIB 4A97A 3K3OA 5LHGB 5HXSA 2D0UA 3NVOA 1N34T 3SFEA 2XAQB 2FJBA 2EHOC 2CLYB 1ZHCA 3L3PA 3ZJ1A 4AXPA 3P4SA 1UGOA 3JC6C 4FJOA 5HXHA 2UXXB 4DR7T 2XQ3A 4I43B 3O4XE 4JUYA 2OA5A 5IYZE 5FL1A 4PK5A 4OYKA 3SFDA 3P4RA 3AEEA 4HFBA 5JDQA 3ONXA 4LF9T 4DIDB 3PUSA 3B5MA 5C8YE 2XQ4A 5JDNA 1XDOA 3E0ZA 1N33T 3KVAA 4KBMB 2YK0A 3HA4A 5E0OA 1M7KA 3PUVF 4TNVA 4YTNA 2DI4A 2J47A 5AQGB 2M6BA 1QLBA 1NEKA 4LF4T 4ILCA 3P4QA 1CHUA 4JEHB 4YHHT 4XBFB 1ZEEA 1SHZC 4HKAA
chains in the Genus database with same CATH topology
2V8SV 3ONLC 1VCSA 3ONJA 2QYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8S V;  3ONL C;  1VCS A;  3ONJ A;  2QYW A; 
#chains in the Genus database with same CATH topology
 3CX6 B;  3UUL A;  4IE4 A;  1HS7 A;  4ILA A;  3RYI E;  2BS3 A;  3Q5E A;  2IIU A;  2WCA A;  4ZS3 A;  3UU8 A;  3PUZ F;  2WU2 A;  3AAE B;  2WB5 A;  4CXY A;  4OX9 T;  2ZMA A;  3K3Q C;  1NWM X;  2XQ7 A;  4UV9 B;  3OJA A;  3ANW A;  2WWV A;  4A98 A;  1V9D A;  4ANJ A;  4EYY R;  4X62 T;  1E7P A;  3AE6 A;  4DV4 T;  2BS4 A;  3H3A A;  4M1P A;  4HFI A;  5C3J A;  2LSY A;  2SPC A;  2LT3 A;  3BQK A;  3N9M A;  3W15 B;  1JNR A;  3U3I A;  5CA1 E;  2XAS B;  3C4W A;  3QB5 A;  2LLY A;  5LYJ E;  1S35 A;  3X1D A;  2CEA A;  1X9B A;  4KX6 A;  2YDQ A;  4X1K E;  4UVC B;  1YD8 G;  5LG3 A;  1BR4 A;  5HEJ A;  5ETW A;  4DR1 T;  5L3F B;  3KV4 A;  3IEE A;  4E7S A;  3RF1 A;  4AKG A;  5L3E B;  1IBK T;  5DAB A;  1IZN B;  3JAD A;  2DHR A;  3LBX A;  4QX7 B;  5ADX L;  5ABF A;  1XDP A;  2J62 A;  2LJL A;  3P4W A;  4PJL A;  5EK4 A;  3NRX A;  1FEW A;  4PK6 A;  5J2T E;  5BR8 T;  1HNW T;  2W61 A;  3AEG A;  3WAK A;  5L3G B;  2X68 A;  1W0B A;  4UR9 A;  4TWH A;  1MIW A;  2JQH A;  5FY7 A;  3PUR A;  3RKG A;  1BR1 A;  4JI0 T;  4P0A A;  1XZY A;  4DMW A;  2HPJ A;  5JTG A;  5FYM A;  1ZOY A;  2XQ9 A;  2J4G A;  4AKR B;  1YXR A;  1J5E T;  4EZH A;  4P0B A;  5AQK B;  3RIF A;  4JI5 T;  4EXT A;  4AKH A;  4YSY A;  3ZST A;  4EEB A;  5JDL A;  2FJA A;  1GQE A;  2DCF A;  2K48 A;  2YU1 A;  2FJE A;  3A7M A;  3FZF B;  2X0H A;  5HXE A;  2BDE A;  3O9X A;  1YQ4 A;  3ZJ2 A;  1FJG T;  3VR8 A;  3ZLI A;  5JDG A;  3N9N A;  1ZKE A;  4FI5 A;  3RC3 A;  2WSS V;  2XQA A;  3UU4 A;  3OYX A;  4YTP A;  4EB6 E;  2C0S A;  4F8H A;  4HEA A;  4L5G A;  4AIS A;  5AQF B;  3EI0 A;  4ZI7 E;  2V5C A;  1O3X A;  2QRX A;  3LBX B;  2BVM A;  4BJM A;  3EUH A;  1MMA A;  4ZI2 D;  5CGM A;  4DR4 T;  2V6Y A;  2KND A;  1XMO T;  2B1E A;  3AEA A;  5IWA T;  3ZSS A;  2WZH A;  3T1H T;  2ES0 A;  2H89 A;  2V6X A;  4DBQ A;  5LHH B;  2J1D G;  2VAS A;  2XQ5 A;  3KVB A;  5AQQ B;  5AQT B;  2WZI A;  3L8R A;  2EHO A;  2H88 A;  2LKH A;  3O1I A;  3PUG A;  5IHY A;  4BA9 A;  2XPK A;  1QUU A;  2WS3 A;  1NEN A;  2YN6 A;  4MBQ A;  2DWG A;  4OK0 A;  5AQU B;  5FMN A;  5HEG A;  3PU8 A;  3Q9D A;  3RPU A;  4IHJ E;  2NW9 A;  1FIO A;  3EDU A;  3N2G E;  5KX5 E;  3A8Y C;  3AE9 A;  3PDY A;  5LA6 E;  1Z0P A;  2MAW A;  2QVA A;  4X1Y E;  3HR0 A;  4PFO A;  2NW8 A;  4ZI2 C;  1JNZ A;  2XAG B;  1OWA A;  3P8C D;  2X9W A;  1R8I A;  2K24 A;  3AE5 A;  3RYH E;  3S4U A;  4YXD A;  3RIU C;  3B57 A;  3PV0 F;  2WDV A;  4KP3 C;  3ONJ A;  3Q5X A;  1W9R A;  2DWK A;  2JQ9 A;  4CI3 B;  5LGN B;  5L2L A;  4QHO A;  3UUB A;  3FB2 A;  4MHC A;  2LSG A;  2W4X A;  3GN5 A;  5JR9 C;  1UCU A;  5EZY E;  4DR6 T;  4H9Q C;  2XUE A;  1US7 B;  2Y48 B;  2N1G A;  3N9L A;  2H7O A;  4L0R A;  4DV0 T;  4O4I E;  3LK4 2;  3N5L A;  3VKH A;  1G8X A;  5LCY A;  4AQF C;  2W63 A;  2VQF T;  2QA7 A;  4X1I E;  4YHJ A;  2VK9 A;  3H37 A;  3KBU A;  2XJ7 A;  3C50 A;  1IJ5 A;  4GKK T;  2H7V C;  3N9O A;  2CLY C;  2VUR A;  2CWY A;  3I0Q A;  3KFW X;  3I1A A;  4L9I A;  5AQR B;  3VU7 H;  2W66 A;  3K1S A;  4TNW A;  4QKN A;  1HFA A;  2HPL A;  3QC9 A;  4IGU A;  4X65 T;  4JI6 T;  3UU6 A;  3FXD B;  2Q9Q D;  2BG9 B;  4JBW F;  4GOU A;  3AE2 A;  4NUV A;  3RYF E;  4EAH A;  4ZZC A;  2NW7 A;  2ZLY A;  3GN5 B;  4TUY E;  2CHO A;  3UFE A;  4ZI3 D;  2ACX A;  4TWD A;  2KT9 A;  3CK6 A;  4O4L E;  1SE7 A;  1OXZ A;  2RPA A;  4PJJ A;  4ZI3 C;  1YKE B;  3M3Z B;  5JDH A;  1SA0 E;  3ETU A;  5GON E;  2KWI B;  4KI0 F;  4X5T A;  1Y01 A;  4H63 H;  5FY0 A;  3LFM A;  1J1J A;  3ESL A;  3JAE A;  2JMH A;  2L9Q A;  1MND A;  2ZM8 A;  2Q9Q A;  3C4Z A;  5L3B B;  1UX4 A;  3UQ7 A;  2D5U A;  2V8S V;  4DV2 T;  1T98 A;  4JI7 T;  2CE7 A;  2BKN A;  3AED A;  3P4P A;  3ZMS B;  4U2Y A;  2X67 A;  4QX8 B;  4U7Y A;  5FY1 A;  4BJN A;  3MXZ A;  4JI1 T;  1KK7 A;  1HG2 A;  3UQ4 A;  3CQC B;  2UXD T;  2QGS A;  3F31 A;  4O2B E;  4ILU A;  5CFB A;  4HFE A;  4ZOL E;  3LG7 A;  2H3R A;  3RQW A;  2KIN B;  2XQ8 A;  4KHZ F;  1SUM B;  3UFG A;  4YSX A;  4LF7 T;  1KNZ A;  2WDQ A;  2V7K A;  4UF0 A;  4X20 E;  1MMG A;  3CQG B;  3P7I A;  3MA9 A;  4IDP A;  2D0T A;  4PNI A;  3KBT A;  1HNX T;  2JIW A;  5H6R B;  2BG9 C;  3RGL A;  2YEV C;  3HKE E;  1UK5 A;  5FKY A;  2MBG A;  2LRK A;  4NUU A;  4WBO A;  1MMN A;  3QUJ A;  3MJX A;  3N2K E;  5DQW A;  4JI2 T;  2UUA T;  3EDV A;  2X66 A;  3HKD E;  4YJ3 E;  2C5K T;  1WR6 A;  3Q5D A;  4NPP A;  3CIR A;  4U31 A;  3H3M A;  4YLH A;  4DUZ T;  4DV6 T;  4QXB B;  3AXJ B;  4AKI A;  2A3D A;  5LB7 B;  4GKJ T;  4JI4 T;  2I6H A;  5HAX A;  1WCR A;  3LK2 B;  4ZHQ E;  4HN9 A;  3CWZ B;  1LVF A;  3AVS A;  4G2A A;  2EHO D;  4O8S A;  3RC8 A;  3PTR B;  2V7J A;  2E9X B;  3UU3 A;  2NWB A;  4P09 A;  2C5I T;  4IIJ E;  3I0O A;  4JEU B;  4LFC T;  3IHR A;  1S94 A;  2EHO B;  4C91 A;  1MIV A;  5J2U E;  2XSA A;  2LHN A;  4AKL A;  1UUS A;  4HWI B;  3FBL A;  4U72 A;  4LMJ A;  4U2Z A;  1T8B A;  3AA1 B;  4AQG A;  2K9A A;  5HWX A;  2XM1 A;  4KHP T;  1MMD A;  2XAJ B;  3RH3 A;  4Z90 A;  2LKG A;  2XAH B;  5TAO A;  5FVL A;  2ZM6 T;  5A1L A;  5M4Y A;  1D1C A;  4PAG A;  2F4V T;  4DV1 T;  3OBV E;  3GA8 A;  4HGA A;  3RX6 A;  3TLW A;  1XNR T;  3LJC A;  2WDR A;  3IA3 A;  4COF A;  2DL1 A;  3J9X 1;  4Z91 A;  3NWI A;  3ONL C;  4GK5 E;  4IDO A;  5HEH A;  2W00 A;  4DR2 T;  2JMK A;  3AAI A;  2CPT A;  3C51 A;  3CX7 B;  4P1N A;  5LMU T;  3JCF A;  1HX8 A;  3LDQ B;  5HEU A;  2UUB T;  2BKO A;  4CXW A;  3NBX X;  3ZT6 A;  4YSZ A;  4X66 T;  3GMI A;  1FMW A;  2FJD A;  1VCS A;  5AQN B;  2W62 A;  3R6N A;  3ZCJ A;  4GIW A;  5DQV A;  3ZMZ B;  4ZEY A;  3HKC E;  4AQY T;  3PU3 A;  1YKH B;  2A72 A;  2QYW A;  3RIA A;  5JQG E;  2VVS A;  3OTO T;  4O2A E;  3AE3 A;  2JQK A;  4HTE A;  2HH7 A;  4UF0 B;  2E2A A;  3DJB A;  3L39 A;  1HCI A;  3VRA A;  3ZN0 B;  2GK9 A;  4B3R T;  2BKP A;  2K3W A;  1CUN A;  4TWF A;  5HWY A;  3ZMV B;  4ERR A;  2CA5 A;  3KIN B;  1W0A A;  5BMV E;  4YJ2 E;  5LP6 E;  4O4J E;  1QSD A;  4EV6 A;  1D1B A;  3RIU A;  4EZ4 A;  1KFY A;  2VKO A;  2CCQ A;  2HN1 A;  4GK0 E;  4HWC A;  1OED A;  2CXL A;  3ZC1 A;  3ETV A;  4Q25 A;  2PTF A;  2FBW A;  3ZN1 B;  2UXC T;  2XAF B;  4K0U A;  5JDM A;  3CVR A;  2ZM0 A;  4K0K T;  2BG9 A;  3AXJ A;  3KV5 A;  3O1H A;  2G0U A;  1G73 A;  3OVU A;  4JI3 T;  4IDZ A;  1T72 A;  3KV6 A;  1DU2 A;  2E9X C;  3NZP A;  1WR0 A;  2KLQ A;  3FHN A;  4EED A;  1J5W A;  3EVY A;  1KF6 A;  4WBN E;  2Y8D A;  3HL6 A;  3FZL B;  1L0V A;  1YQ3 A;  3AE1 A;  2FUP A;  1E1H B;  3SWH A;  3ZEF B;  2BS2 A;  3ZT5 A;  4LFA T;  1WLX A;  4MLK A;  1LVK A;  3WI3 A;  3OPC A;  2XZE A;  4HFH A;  2Q9Q B;  1XMQ T;  3LK3 B;  3PUQ A;  3C4X A;  1MIY A;  2LRL A;  4H63 V;  2XSB A;  4IL4 A;  5FNV E;  2Y6X A;  4KMC A;  5HXR A;  2WM9 A;  4U7I A;  3ZPO A;  1Y64 B;  5LHI B;  1Z8U A;  5F5W A;  3VKG A;  4DND A;  5JRC A;  5HEO A;  2IUB A;  4N78 D;  4PK4 A;  4BAY B;  3VRB A;  3B13 A;  5FL0 A;  2CXD A;  2BBH A;  5FXZ A;  4H9R C;  1FMV A;  3PUA A;  5J1G A;  4DUY T;  3ZT7 A;  4IE6 A;  5LMN T;  3Q5W A;  5AQH B;  2X9X A;  3ZYL A;  2Z6E A;  4TV8 E;  5AQM B;  3J7Y q;  2V5D A;  3IBP A;  3MK7 C;  4HFC A;  5LOV E;  3RRW A;  2YOE A;  4TV9 E;  1I6Z A;  4UEM A;  1BR0 A;  3HKB E;  1IAP A;  1D1A A;  5AQO B;  3UUM A;  5JH7 E;  4NXN T;  3FZH B;  3PJA A;  2I0M A;  3AA7 B;  2V1D B;  1D0Y A;  2N9D A;  2YDS A;  5LG4 A;  5LNK A;  3WAJ A;  4YY3 T;  4IE0 A;  1IBL T;  1D0X A;  2CBJ A;  2MTQ A;  2W0G A;  4QXH B;  3AAA B;  4ASK A;  4IDQ A;  4EGW A;  4H9N C;  2PG8 A;  3AVR A;  1I94 T;  3UT5 E;  1NAF A;  2R6G F;  2VL8 A;  3E22 E;  5KXJ A;  2WBL A;  1N36 T;  3JC6 D;  4QH5 A;  2P9B A;  3EAB A;  3NZQ A;  3BQI A;  1ZV4 X;  4HFV A;  4NXM T;  5FXX A;  2IDO B;  4IRE A;  4O4H E;  4PJN A;  2NR4 A;  4DV3 T;  2LM9 A;  3LSV A;  5LBQ B;  2VWA A;  3TLU A;  2BBJ A;  4UIG A;  3RRC A;  2ODV A;  2NTX A;  3RQU A;  4E7Z A;  2RP4 A;  4PJM A;  4ZXL A;  2NOX A;  4QH1 A;  2V7M A;  5FP3 A;  3JAF A;  2VKH A;  2LSI A;  3AA6 B;  3ZMU B;  4DBR A;  2XHE B;  3FBZ A;  3N9P A;  4EIW A;  5IUX A;  3FXE B;  5ABE A;  2ZM2 A;  3C98 B;  3PUW F;  5J0Z A;  1KNP A;  2RA1 A;  3EAM A;  3I9Y A;  3TLT A;  2VQE T;  4PW8 A;  4CN1 A;  4J2C A;  5L4E A;  4GYS A;  2CXF A;  4JI8 T;  2W2U A;  4B3M T;  4JYA T;  3V5U A;  2B76 A;  5EK3 A;  1H7C A;  5FVK A;  2PFV A;  3T1Y T;  1XWM A;  2D9D A;  3ZYK A;  2WU5 A;  5FXV A;  2NTY A;  2CHN A;  2IHR 1;  4ADZ A;  1KEY A;  2KXP B;  3AA0 B;  4HE8 A;  3AE8 A;  4G63 A;  5AQJ B;  5LBM A;  5ABF B;  2E5L T;  4HWF A;  5AQP B;  2JJ9 A;  1WFD A;  3RHW A;  2LSK A;  5JR9 B;  2KZ7 B;  2N2N A;  3K3N A;  4IE5 A;  2BZB A;  5F8P A;  2DLR A;  3ABV A;  2K5B B;  3SRZ A;  5H6Q B;  4CXX A;  2HN2 A;  2XY8 B;  4DO0 A;  3KV9 A;  2E5V A;  4WW0 A;  2E9X A;  4IST A;  3GWH A;  3CPZ A;  3HI2 A;  3QK6 A;  3ZMT B;  2LM2 A;  1OED C;  3DP7 A;  4DMV A;  5L4H A;  3RKO A;  3PJA J;  3TLS A;  4MAL A;  2IW5 B;  4IL9 A;  1OED E;  2AE9 A;  2VB6 A;  4GYR A;  4MFR A;  4XAX B;  4KUM B;  3ZYM A;  2KWH A;  4TX5 A;  5ABG A;  3FZM B;  3RI5 A;  4I50 E;  3VR9 A;  4C90 A;  5EK2 A;  5CA0 E;  2IC9 A;  4LML A;  1B7T A;  2NP9 A;  2X9H A;  1WYC A;  3CX8 B;  3UUX B;  3PUY F;  4CN6 A;  2VVN A;  2W67 A;  1HF8 A;  2JQQ A;  1YW0 A;  4HFD A;  4CQI A;  5KMG P;  5LJM A;  4B3T T;  1ZP0 A;  2JPF A;  2WQY A;  1IJ6 A;  1W09 A;  2LHR A;  1VOM A;  5ABH A;  1LRZ A;  3EHZ A;  5AFU L;  3R84 B;  5KDM C;  2E9X D;  2LSJ A;  2C5J A;  3PE0 A;  3SS1 A;  5C2T A;  1N32 T;  2A2F X;  3ZCI A;  2XTL A;  3MZK B;  5L47 A;  3RLF F;  4ISS A;  2I59 A;  3Q2M A;  5AQS B;  2HHH T;  1U5P A;  4A5X A;  5LJN A;  4JLE A;  4NIQ A;  1WRD A;  4CI1 B;  2UXB T;  1BR2 A;  4I55 E;  3T8O A;  3N2O A;  4LFB T;  3UU5 A;  2JRK A;  2OLT A;  2WY2 A;  1WYB A;  3ANW B;  3MAC A;  3PUX F;  3CQX C;  2MPK A;  2X9Y A;  3V5S A;  5CB4 E;  3M65 A;  4YT0 A;  5JDF A;  4PFP A;  1LKX A;  3U78 A;  4XZC A;  1M62 A;  1D0Z A;  2LEH A;  4I4T E;  2V7L A;  3UUN A;  5JRC B;  3FZK B;  4UXN B;  1VRB A;  2L8K A;  2X0L B;  2X0Y A;  3TLV A;  1OED B;  4U3C A;  4DVD A;  3O1J A;  5L3D B;  2WMN A;  2Q9Q C;  5HYA A;  5LGU B;  1X79 A;  1UUR A;  2OV9 A;  2CBI A;  2A9U A;  3P50 A;  3E08 A;  4LF8 T;  3ZKR A;  4H9S E;  2BVL A;  1HX1 B;  3UTK A;  5JR9 A;  4DR3 T;  1XNQ T;  2X51 A;  4H9P C;  2IML A;  1MNE A;  2E8I A;  2CM0 A;  2L3L A;  3G06 A;  4HWD A;  2VKJ A;  3CKD A;  2YIN A;  2PJQ A;  4OYJ A;  3MKD A;  4WYV A;  5DJQ C;  2PBI A;  5AQV B;  4IE7 A;  4CZZ B;  4DV7 T;  1HR0 T;  4TZ4 C;  4AI6 A;  4IDN A;  2IAK A;  3ZC0 A;  4UV8 B;  2LOP A;  4Z8X A;  4AIU A;  2CWO A;  1AJ3 A;  5JVD E;  3D0T A;  4X64 T;  3CML A;  3DTO A;  3AEB A;  3AEF A;  4ZS2 A;  4LF6 T;  3OKQ A;  3AE7 A;  2CRB A;  4UEL A;  2UUC T;  2VKD A;  3QB5 K;  4EYU A;  2ODU A;  2DNX A;  1HNZ T;  2MYS A;  3N9Q A;  2XQY A;  2ACZ A;  2MOZ A;  3NKZ A;  4U33 A;  3KDS E;  2CMR A;  4CN4 A;  4TN7 B;  2YDR A;  4CI2 B;  2VL0 A;  3VHL A;  5JRE A;  4WZX A;  4QWN B;  3C64 A;  3SOL A;  4IT4 A;  4OHF A;  3AE4 A;  2V7I A;  5LXT E;  4DV5 T;  1T7S A;  3A5X A;  4ILB A;  3BQL A;  1E2A A;  2KMF A;  2V6Y B;  2V26 A;  2IC6 A;  2BG9 E;  2WP9 A;  1IBM T;  2KSR A;  4F6R C;  3K8P C;  3F57 A;  4QH4 A;  5HXC A;  3OYZ A;  5F3J A;  3BK9 A;  4LMK A;  1HG5 A;  1VCT A;  2D2S A;  4WNK A;  2WAU A;  2LOS A;  2M67 A;  4A56 A;  4UVA B;  4AQF A;  5LGT B;  4B3S T;  4ZZB A;  4UVB B;  5CJ5 A;  3F2E A;  2LE8 A;  3I9W A;  2XM2 A;  1EZ3 A;  3L09 A;  2WWU A;  4QXC B;  4YFS A;  3IF8 B;  5HCM A;  5L3C B;  2M6I A;  1KNR A;  4YTM A;  4OFZ A;  4U74 A;  4H9O C;  4B6X A;  4JV5 T;  4V1A v;  3TKL B;  2YKS A;  3AB3 B;  1HTJ F;  3RYC E;  1UX5 A;  4DR5 T;  2XQ6 A;  2UU9 T;  2UXN B;  2AXD S;  3QOF A;  5HCJ A;  4I0U A;  3QNU A;  4HWH A;  1U4Q A;  3AEC A;  5AQL B;  3NRY A;  2YU2 A;  4EOZ B;  4LF5 T;  2WMO A;  5FXW A;  5AQI B;  4A97 A;  3K3O A;  5LHG B;  5HXS A;  2D0U A;  3NVO A;  1N34 T;  3SFE A;  2XAQ B;  2FJB A;  2EHO C;  2CLY B;  1ZHC A;  3L3P A;  3ZJ1 A;  4AXP A;  3P4S A;  1UGO A;  3JC6 C;  4FJO A;  5HXH A;  2UXX B;  4DR7 T;  2XQ3 A;  4I43 B;  3O4X E;  4JUY A;  2OA5 A;  5IYZ E;  5FL1 A;  4PK5 A;  4OYK A;  3SFD A;  3P4R A;  3AEE A;  4HFB A;  5JDQ A;  3ONX A;  4LF9 T;  4DID B;  3PUS A;  3B5M A;  5C8Y E;  2XQ4 A;  5JDN A;  1XDO A;  3E0Z A;  1N33 T;  3KVA A;  4KBM B;  2YK0 A;  3HA4 A;  5E0O A;  1M7K A;  3PUV F;  4TNV A;  4YTN A;  2DI4 A;  2J47 A;  5AQG B;  2M6B A;  1QLB A;  1NEK A;  4LF4 T;  4ILC A;  3P4Q A;  1CHU A;  4JEH B;  4YHH T;  4XBF B;  1ZEE A;  1SHZ C;  4HKA A; 
#chains in the Genus database with same CATH homology
 2V8S V;  3ONL C;  1VCS A;  3ONJ A;  2QYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...