3ONJA

Crystal structure of yeast vti1p_habc domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
97
structure length
97
Chain Sequence
SLLISYESDFKTTLEQAKASLAEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVEVNNSIGDASERATYKAKLREWKKTIQSDIKRPLQSLVDSGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Epsin N-terminal homology domains bind on opposite sides of two SNAREs
pubmed doi rcsb
molecule keywords t-SNARE VTI1
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 44
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2010-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05008 V-SNARE Vesicle transport v-SNARE protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 3onjA00
2V8SV 2QYWA 3ONLC 3ONJA 1VCSA
chains in the Genus database with same CATH superfamily
3ONLC 4HFDA 4YSXA 2XQ4A 2WBLA 3JC6D 4U72A 1WR6A 2KLQA 3P50A 4HFEA 1J5WA 3UU4A 5ABHA 1UURA 3P4SA 2AXDS 2Q9QA 4PFPA 2XQ6A 3WI3A 3K8PC 3ZN1B 4PNIA 2FJDA 2ZM2A 3HL6A 2FJAA 3AVRA 2DWGA 4H9RC 3FB2A 2WU5A 2CBIA 3E08A 1T98A 1UX5A 4KMCA 4EGWA 3N9LA 4U74A 1H7CA 4JI0T 1EZ3A 3RPUA 3B13A 4L5GA 1MMGA 5J2TE 4CXYA 3OYXA 2QRXA 5ABGA 5LG4A 4NIQA 3OYZA 4ADZA 3PUYF 3SRZA 3CQGB 5F8PA 2BG9B 4OHFA 4JI8T 1WR0A 3IA3A 3X1DA 5HEHA 3N9MA 2BKPA 3CVRA 3QC9A 5JTGA 1S94A 2LLYA 1D0ZA 2CM0A 4FJOA 1KK7A 3GN5A 3SS1A 2VWAA 2BKOA 3O1HA 3EVYA 2R6GF 2BBHA 3FZMB 3PTRB 2A72A 2WMNA 1FEWA 1UCUA 1VRBA 3OBVE 3O9XA 4EYUA 4H9SE 3HKCE 3JC6C 2PBIA 2IMLA 4ZS3A 3ONJA 4AKGA 2JQHA 2JQKA 2XAFB 1MMDA 2BZBA 3UUBA 4UF0A 4LFBT 4E7SA 2J4GA 5F3JA 1WYCA 1W9RA 3U78A 5EZYE 1B7TA 4TWFA 3L09A 3I1AA 3AEAA 5AFUL 1KNZA 4PFOA 2WP9A 5LMUT 2MTQA 4CZZB 2YDRA 2J62A 2WM9A 3C98B 3TLWA 3T1HT 4DR1T 3QOFA 2YK0A 4UR9A 3ABVA 1JNZA 3Q2MA 1OEDC 3P4RA 1UX4A 2CRBA 2YDQA 4GYRA 1KNPA 2W67A 3AEBA 3WAKA 3ZSTA 2XZEA 3BQKA 4F6RC 2H3RA 2XAHB 1MIWA 2BS4A 3MZKB 5JR9C 1MIVA 2C5JA 3MKDA 3O1JA 2X66A 4CQIA 3CX7B 3FZHB 1BR4A 4HFBA 4TV8E 3RH3A 4HFIA 2KZ7B 1HNZT 3AE6A 2E5LT 3ZMVB 5IYZE 3C51A 4MFRA 1NWMX 4LF5T 1QSDA 5DABA 3PDYA 2IHR1 4BJMA 4B3ST 2CLYB 3F31A 3ESLA 2Z6EA 4M1PA 2LOPA 1L0VA 3CX6B 1GQEA 2X68A 3ZPOA 5AQFB 2K9AA 2RA1A 1D0YA 3HKEE 3RYCE 5CGMA 5H6QB 5ETWA 5HCMA 3UUMA 5CFBA 5C2TA 2IIUA 2ZMAA 4DV5T 2C5IT 2W62A 3K1SA 4I43B 2K3WA 4JI7T 4LF4T 3ZC0A 4YT0A 1OEDA 4LFAT 5AQPB 2WZHA 4Z8XA 3N2KE 4WZXA 3AEEA 5J0ZA 1AJ3A 2QYWA 1HG5A 3N9OA 5ABEA 2A9UA 3PUSA 2BVMA 3ANWA 5JR9A 2YU2A 4UEMA 3K3NA 1IJ5A 4I0UA 2XQYA 3FZFB 2VKJA 4U31A 2XQ5A 4GOUA 1HR0T 2XHEB 3MJXA 2K5BB 1M62A 5L3CB 4DV2T 3OPCA 1UUSA 1I94T 5CB4E 2X0LB 4IE7A 1XDPA 3TLUA 2E9XD 4ILAA 4DBQA 4JI4T 2LRLA 3TLSA 1WYBA 3BQIA 3ZEFB 2KXPB 4ZXLA 3V5UA 3E0ZA 4UV9B 5AQMB 5LA6E 3QB5K 3EAMA 4A98A 2DLRA 4GIWA 1ZEEA 4ILCA 3ONXA 3D0TA 2BG9E 5FP3A 1YKHB 2V5CA 2LSGA 3LK2B 2N1GA 4X1YE 3ZMSB 2G0UA 1YKEB 4O8SA 5HXCA 4ZI2D 4DR5T 1US7B 5LOVE 3Q5EA 4TX5A 4DUZT 2UXXB 4UVCB 1HNWT 3GA8A 1XMQT 3AXJA 2CPTA 4PK5A 4AKHA 2CEAA 4QX7B 4NXNT 3A8YC 2WWVA 3ZJ2A 3HKDE 3JADA 4KHPT 5KDMC 2VKHA 4PJLA 1G8XA 5AQQB 5FY7A 4JI1T 3MACA 2VKDA 4K0KT 3UUNA 5LG3A 2W4XA 4O4IE 3VKHA 2VVSA 2WCAA 3L3PA 4EEDA 4YTPA 2E9XC 5LHGB 4BA9A 2KNDA 1W0BA 2WB5A 1YQ4A 5FXZA 1XNRT 3P7IA 2CA5A 2B1EA 3HR0A 5LJNA 2UUBT 4O4JE 2VL0A 4LF9T 4XAXB 1LRZA 1ZP0A 1IJ6A 2XAJB 5LGTB 4AQYT 1WRDA 2XQ7A 4ZI2C 2WQYA 2EHOB 3EDUA 3RIAA 2BG9C 3PUXF 4I55E 2A2FX 1MMAA 2XAQB 3K3QC 2JRKA 2HPLA 5J1GA 5H6RB 4X1IE 4AQGA 2MBGA 4KP3C 3SWHA 2D5UA 1LKXA 3QNUA 5L4HA 3RYHE 1BR2A 3ZSSA 2X9XA 2V8SV 5AQJB 3RF1A 5L2LA 3CK6A 1D0XA 3LBXA 3KVAA 2Y6XA 5LHHB 3RC3A 3DJBA 2VQFT 3PURA 5L47A 2NP9A 2NOXA 3CQXC 4G63A 1KNRA 4YHJA 4QHOA 2DNXA 4H9PC 2KMFA 2FJEA 2BS2A 4IE4A 3UU3A 2W61A 4GYSA 3AA7B 2LHRA 2E9XA 2WDRA 4PK6A 3QB5A 1FJGT 4KBMB 2CE7A 5KXJA 3I0QA 1ZOYA 2L9QA 1MNDA 3AVSA 3VKGA 1CHUA 2DCFA 2WAUA 3AE7A 1M7KA 1G73A 4EZHA 3RQWA 3BQLA 3HI2A 3RIUC 4GK5E 4ZEYA 3L39A 1N34T 4GK0E 4IREA 2UUAT 4TZ4C 2JPFA 2BG9A 4U3CA 3P8CD 4ZOLE 3EDVA 5FKYA 4JI6T 2JQQA 2LKGA 5LBQB 3C4WA 3PJAA 1KEYA 4HE8A 2DI4A 5HEJA 4JEUB 1Y01A 4TWHA 5IUXA 4IDPA 2X51A 5JDNA 4B6XA 1HTJF 2V7JA 2UXCT 1E1HB 5AQHB 4H63H 4ILUA 2X9YA 2E5VA 3DTOA 5LGUB 1CUNA 2V6YB 5AQKB 4AKRB 3SFDA 2D0UA 3NBXX 3EHZA 1MMNA 5AQNB 4E7ZA 2UXDT 3H3AA 4U7YA 3GN5B 2XJ7A 5HXSA 4BAYB 1SA0E 3U3IA 1Z0PA 3ZT6A 2VKOA 2V26A 2LEHA 4C90A 4Z91A 2HHHT 3J7Yq 4CI1B 4CI3B 4DR3T 5BR8T 5JDQA 4JI2T 2KWIB 4IIJE 2J1DG 4DV4T 1WLXA 5ADXL 2DL1A 4U2ZA 4IDNA 4UF0B 4LMJA 4IDQA 2OLTA 4YSZA 3SFEA 5CJ5A 5AQOB 4B3TT 2H7VC 1W09A 4A56A 3LSVA 3RIUA 3ZMUB 3EABA 2BDEA 1YD8G 4MHCA 4X65T 2IUBA 1KF6A 4WBOA 2CXLA 4C91A 3HKBE 1QUUA 3TLTA 2W63A 4Q25A 3OTOT 3AE8A 2CBJA 2I0MA 2LE8A 4DO0A 5JRCA 2X9HA 3NZPA 4KUMB 4QWNB 3H37A 4H9OC 5DQWA 1J1JA 3W15B 5FL1A 2ZM0A 4P0AA 5L3BB 5J2UE 4G2AA 4O2AE 5JDHA 4PJMA 3KDSE 3LK42 2X67A 2W2UA 5LYJE 3MA9A 4NXMT 1HF8A 3ZC1A 5JDLA 2V7IA 5AQVB 3RYIE 3Q9DA 5LCYA 1E7PA 3RRCA 2QA7A 2PJQA 2VURA 5HXHA 5FVKA 2QGSA 5FL0A 1YQ3A 4HEAA 4I50E 3O1IA 3PUWF 4X20E 2WWUA 4YJ3E 4LFCT 4ISSA 5LNKA 2MPKA 2L8KA 4IE6A 4EEBA 2D0TA 1D1AA 1SE7A 2JMHA 4L9IA 3AA0B 4IDOA 5LGNB 2PTFA 2XSAA 3JCFA 2BVLA 2EHOD 2PG8A 2W0GA 2WS3A 1XMOT 1OXZA 3RQUA 3P4WA 1LVKA 4PJNA 2LSIA 3TLVA 4LMLA 4WNKA 4JV5T 2FUPA 4I4TE 4DR2T 3I9WA 3KINB 4DV6T 4HN9A 4WYVA 5E0OA 3KV9A 3CX8B 4JEHB 2V7LA 2IC6A 4TN7B 1E2AA 3K3OA 2XTLA 1OEDB 2C0SA 3PUAA 4UELA 2BS3A 2BBJA 4FI5A 4PJJA 2YEVC 5L4EA 5EK3A 1V9DA 3LDQB 4O4LE 3RLFF 3BK9A 4NUUA 4YTMA 2XSBA 3UFEA 4HKAA 2L3LA 4ASKA 3N2OA 1VCSA 4ISTA 4LF8T 3ZT5A 1JNRA 5KMGP 5FVLA 4TV9E 1IBKT 4KHZF 3IHRA 4EV6A 3Q5XA 1I6ZA 2UXBT 3ZN0B 1BR0A 4Z90A 1J5ET 3FHNA 3ZJ1A 5HXEA 2EHOC 3O4XE 3Q5DA 1OWAA 4COFA 2YKSA 5HCJA 2VB6A 4HTEA 3UUXB 5C3JA 2KT9A 5HEOA 3WAJA 5A1LA 4OYJA 4X62T 1NENA 4X5TA 2NTYA 4EOZB 4ZS2A 2XPKA 3N5LA 4ZZBA 5M4YA 3CMLA 3AXJB 4K0UA 4P09A 3RI5A 4H9NC 4JLEA 4YY3T 4YJ2E 3ETUA 1HNXT 2D9DA 1HCIA 2YDSA 3G06A 5ABFB 2HN2A 2BKNA 3I9YA 4NUVA 4CXWA 2AE9A 4A5XA 1IAPA 4QH1A 5FXXA 2GK9A 1HX1B 2XY8B 1X79A 3AA1B 1FMWA 2CHNA 3T1YT 2LHNA 3NZQA 4B3MT 3AE4A 4EAHA 3PUQA 3AAAB 4YLHA 3LK3B 2XQ8A 2H88A 2JMKA 2M67A 2NR4A 2FBWA 3RIFA 3PU3A 2XUEA 2EHOA 3KBTA 5FY0A 3F2EA 1XNQT 2ZM8A 3R6NA 4CN6A 3RC8A 2ODVA 1UK5A 4TUYE 2V1DB 2KINB 1X9BA 4ANJA 2B76A 2YOEA 1O3XA 2CWOA 3UT5E 4CI2B 5DQVA 3R84B 2E8IA 2IDOB 4HFVA 3AE1A 3S4UA 4QXBB 4AIUA 4P0BA 3FXDB 2NW8A 2ODUA 5IWAT 3VRBA 4OX9T 3PUVF 2VVNA 3UU8A 3LJCA 5AQRB 5DJQC 5HAXA 4CXXA 2HH7A 3ETVA 3A5XA 3LBXB 4JUYA 3MXZA 4HWHA 5FMNA 3ZCJA 3AE5A 5HXRA 2SPCA 2W00A 3JAFA 4DV7T 3IBPA 1IBMT 2FJBA 3ZKRA 1NAFA 3L8RA 3I0OA 2K48A 4EIWA 5L3FB 4JI5T 2Q9QB 2E9XB 4X64T 2XASB 3KV6A 2LM2A 4EYYR 1WCRA 5AQIB 2NW7A 3P4PA 3M65A 3OKQA 3VU7H 4GKKT 4AISA 3DP7A 4JI3T 3M3ZB 2H7OA 5EK2A 4DV1T 2LJLA 3FBZA 2M6BA 2MYSA 2WY2A 3CPZA 2ES0A 4AI6A 5AQGB 3FXEB 1IBLT 4LF7T 1OEDE 5LHIB 2N9DA 4DUYT 3UTKA 4QX8B 3C50A 4TWDA 3FZKB 2UUCT 3J9X1 3PJAJ 2F4VT 3RX6A 5CA1E 4AKLA 3AECA 4HFCA 2WMOA 2HN1A 3UQ7A 2JJ9A 4J2CA 4DR6T 2V6YA 4HWFA 1T72A 5JDFA 4MALA 1YXRA 1YW0A 2CLYC 1T8BA 4DMWA 1WFDA 3NRXA 4XZCA 3AE2A 3ZYLA 2ACXA 3HA4A 2WZIA 4UVBB 3AEGA 3ZMZB 5FY1A 2DWKA 2Y8DA 1BR1A 4PW8A 3RKOA 4PAGA 5L3DB 3PE0A 3EUHA 2WDQA 1Z8UA 4ILBA 4OFZA 4KX6A 2WDVA 4H63V 4PK4A 1QLBA 2CMRA 2LSYA 2V7MA 5AQUB 4F8HA 3T8OA 2XQ3A 4DIDB 2PFVA 4TNVA 2LOSA 5JVDE 3LG7A 2XAGB 4WW0A 2LM9A 2C5KT 2Y48B 5LXTE 4P1NA 3UU6A 2IC9A 4IE0A 5CA0E 4N78D 3P4QA 4DV0T 4EB6E 4O2BE 2D2SA 3H3MA 3VR8A 1XZYA 2DHRA 3RGLA 5LP6E 4CN1A 2V6XA 4X1KE 4QH4A 3KV4A 2MAWA 3QUJA 2LKHA 4IHJE 3KBUA 1R8IA 2WSSV 2IW5B 2M6IA 1MIYA 2XQ9A 3NVOA 3PUGA 3UQ4A 3E22E 3ZT7A 2QVAA 2CXDA 5JRCB 2RPAA 1HFAA 4LMKA 3CIRA 1U5PA 3N9NA 4IDZA 4ERRA 1LVFA 2X9WA 2JIWA 4TNWA 3SOLA 2VQET 1XDOA 3IF8B 4ZI3D 5TAOA 2YN6A 4HFHA 2OV9A 4DVDA 1FMVA 5FXVA 4HGAA 4H9QC 5C8YE 5FXWA 3VHLA 3AE3A 4YTNA 1ZV4X 3UULA 2VK9A 3N9PA 3PV0F 2A3DA 5EK4A 2N2NA 3PU8A 1NEKA 2LRKA 4OYKA 2NW9A 2MOZA 2E2AA 3AA6B 4MBQA 3B57A 4GKJT 2V7KA 4UXNB 1FIOA 3ZCIA 4QH5A 3TKLB 3V5SA 1IZNB 2VASA 4JBWF 3AAEB 5JREA 4B3RT 3A7MA 2K24A 5LBMA 4AXPA 4XBFB 5LB7B 2CCQA 3OJAA 3NWIA 3OVUA 3AB3B 4O4HE 2HPJA 4OK0A 3ANWB 5JR9B 3ZYKA 2NWBA 2CXFA 4U7IA 2CWYA 3AEFA 4QKNA 4DMVA 5KX5E 2CHOA 2KSRA 4UVAB 3AAIA 1Y64B 4BJNA 4ZI3C 2LT3A 2RP4A 2V5DA 1SHZC 2Q9QD 2P9BA 3F57A 2ACZA 5FYMA 4ZHQE 4HWCA 4YSYA 4IL9A 4DNDA 4QXHB 5AQTB 4YHHT 2J47A 3Q5WA 4EXTA 2X0HA 4UIGA 3GWHA 3MK7C 2YU1A 3PUZF 3B5MA 5GONE 4JYAT 3N2GE 4YFSA 3UFGA 4LF6T 4IE5A 4KI0F 5JQGE 3FBLA 3CQCB 2NTXA 3KFWX 4QXCB 3FZLB 5JDGA 5JDMA 3JAEA 4ZI7E 5JH7E 4DR7T 1S35A 3VR9A 2XQAA 3C4ZA 4U33A 4WBNE 3GMIA 3RYFE 3CWZB 5HEGA 5HWYA 2I59A 4L0RA 2VL8A 3NRYA 2LSKA 4HWIB 3QK6A 1U4QA 4AQFC 4NPPA 2X0YA 4UV8B 4ZZCA 2I6HA 5ABFA 4HWDA 4EZ4A 4X66T 1HG2A 4DR4T 1HS7A 5LMNT 2YINA 3C4XA 2ZM6T 5HWXA 4MLKA 5LJMA 5HEUA 2ZLYA 3AEDA 1VCTA 2LSJA 4CN4A 1DU2A 5FNVE 4IGUA 1KFYA 2OA5A 4DV3T 1ZKEA 2Q9QC 3RRWA 1UGOA 2W66A 4DBRA 4IL4A 1SUMB 5L3EB 4A97A 5F5WA 1XWMA 1HX8A 3CKDA 1N36T 3VRAA 2WU2A 2IAKA 3UU5A 2KWHA 2JQ9A 1T7SA 2UU9T 3ZYMA 4YXDA 3RHWA 3NKZA 4IT4A 1D1CA 2H89A 2XM1A 1VOMA 5HYAA 5AQLB 3C64A 3ZMTB 2XM2A 2UXNB 3IEEA 3KVBA 1D1BA 3ZLIA 3AE9A 1ZHCA 1W0AA 5BMVE 5L3GB 3N9QA 1N33T 1N32T 4AKIA 3LFMA 3KV5A 4AQFA 1MNEA 4U2YA 3EI0A 4V1Av 5IHYA 5AQSB 3RKGA
chains in the Genus database with same CATH topology
2V8SV 2QYWA 3ONLC 3ONJA 1VCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8S V;  2QYW A;  3ONL C;  3ONJ A;  1VCS A; 
#chains in the Genus database with same CATH topology
 3ONL C;  4HFD A;  4YSX A;  2XQ4 A;  2WBL A;  3JC6 D;  4U72 A;  1WR6 A;  2KLQ A;  3P50 A;  4HFE A;  1J5W A;  3UU4 A;  5ABH A;  1UUR A;  3P4S A;  2AXD S;  2Q9Q A;  4PFP A;  2XQ6 A;  3WI3 A;  3K8P C;  3ZN1 B;  4PNI A;  2FJD A;  2ZM2 A;  3HL6 A;  2FJA A;  3AVR A;  2DWG A;  4H9R C;  3FB2 A;  2WU5 A;  2CBI A;  3E08 A;  1T98 A;  1UX5 A;  4KMC A;  4EGW A;  3N9L A;  4U74 A;  1H7C A;  4JI0 T;  1EZ3 A;  3RPU A;  3B13 A;  4L5G A;  1MMG A;  5J2T E;  4CXY A;  3OYX A;  2QRX A;  5ABG A;  5LG4 A;  4NIQ A;  3OYZ A;  4ADZ A;  3PUY F;  3SRZ A;  3CQG B;  5F8P A;  2BG9 B;  4OHF A;  4JI8 T;  1WR0 A;  3IA3 A;  3X1D A;  5HEH A;  3N9M A;  2BKP A;  3CVR A;  3QC9 A;  5JTG A;  1S94 A;  2LLY A;  1D0Z A;  2CM0 A;  4FJO A;  1KK7 A;  3GN5 A;  3SS1 A;  2VWA A;  2BKO A;  3O1H A;  3EVY A;  2R6G F;  2BBH A;  3FZM B;  3PTR B;  2A72 A;  2WMN A;  1FEW A;  1UCU A;  1VRB A;  3OBV E;  3O9X A;  4EYU A;  4H9S E;  3HKC E;  3JC6 C;  2PBI A;  2IML A;  4ZS3 A;  3ONJ A;  4AKG A;  2JQH A;  2JQK A;  2XAF B;  1MMD A;  2BZB A;  3UUB A;  4UF0 A;  4LFB T;  4E7S A;  2J4G A;  5F3J A;  1WYC A;  1W9R A;  3U78 A;  5EZY E;  1B7T A;  4TWF A;  3L09 A;  3I1A A;  3AEA A;  5AFU L;  1KNZ A;  4PFO A;  2WP9 A;  5LMU T;  2MTQ A;  4CZZ B;  2YDR A;  2J62 A;  2WM9 A;  3C98 B;  3TLW A;  3T1H T;  4DR1 T;  3QOF A;  2YK0 A;  4UR9 A;  3ABV A;  1JNZ A;  3Q2M A;  1OED C;  3P4R A;  1UX4 A;  2CRB A;  2YDQ A;  4GYR A;  1KNP A;  2W67 A;  3AEB A;  3WAK A;  3ZST A;  2XZE A;  3BQK A;  4F6R C;  2H3R A;  2XAH B;  1MIW A;  2BS4 A;  3MZK B;  5JR9 C;  1MIV A;  2C5J A;  3MKD A;  3O1J A;  2X66 A;  4CQI A;  3CX7 B;  3FZH B;  1BR4 A;  4HFB A;  4TV8 E;  3RH3 A;  4HFI A;  2KZ7 B;  1HNZ T;  3AE6 A;  2E5L T;  3ZMV B;  5IYZ E;  3C51 A;  4MFR A;  1NWM X;  4LF5 T;  1QSD A;  5DAB A;  3PDY A;  2IHR 1;  4BJM A;  4B3S T;  2CLY B;  3F31 A;  3ESL A;  2Z6E A;  4M1P A;  2LOP A;  1L0V A;  3CX6 B;  1GQE A;  2X68 A;  3ZPO A;  5AQF B;  2K9A A;  2RA1 A;  1D0Y A;  3HKE E;  3RYC E;  5CGM A;  5H6Q B;  5ETW A;  5HCM A;  3UUM A;  5CFB A;  5C2T A;  2IIU A;  2ZMA A;  4DV5 T;  2C5I T;  2W62 A;  3K1S A;  4I43 B;  2K3W A;  4JI7 T;  4LF4 T;  3ZC0 A;  4YT0 A;  1OED A;  4LFA T;  5AQP B;  2WZH A;  4Z8X A;  3N2K E;  4WZX A;  3AEE A;  5J0Z A;  1AJ3 A;  2QYW A;  1HG5 A;  3N9O A;  5ABE A;  2A9U A;  3PUS A;  2BVM A;  3ANW A;  5JR9 A;  2YU2 A;  4UEM A;  3K3N A;  1IJ5 A;  4I0U A;  2XQY A;  3FZF B;  2VKJ A;  4U31 A;  2XQ5 A;  4GOU A;  1HR0 T;  2XHE B;  3MJX A;  2K5B B;  1M62 A;  5L3C B;  4DV2 T;  3OPC A;  1UUS A;  1I94 T;  5CB4 E;  2X0L B;  4IE7 A;  1XDP A;  3TLU A;  2E9X D;  4ILA A;  4DBQ A;  4JI4 T;  2LRL A;  3TLS A;  1WYB A;  3BQI A;  3ZEF B;  2KXP B;  4ZXL A;  3V5U A;  3E0Z A;  4UV9 B;  5AQM B;  5LA6 E;  3QB5 K;  3EAM A;  4A98 A;  2DLR A;  4GIW A;  1ZEE A;  4ILC A;  3ONX A;  3D0T A;  2BG9 E;  5FP3 A;  1YKH B;  2V5C A;  2LSG A;  3LK2 B;  2N1G A;  4X1Y E;  3ZMS B;  2G0U A;  1YKE B;  4O8S A;  5HXC A;  4ZI2 D;  4DR5 T;  1US7 B;  5LOV E;  3Q5E A;  4TX5 A;  4DUZ T;  2UXX B;  4UVC B;  1HNW T;  3GA8 A;  1XMQ T;  3AXJ A;  2CPT A;  4PK5 A;  4AKH A;  2CEA A;  4QX7 B;  4NXN T;  3A8Y C;  2WWV A;  3ZJ2 A;  3HKD E;  3JAD A;  4KHP T;  5KDM C;  2VKH A;  4PJL A;  1G8X A;  5AQQ B;  5FY7 A;  4JI1 T;  3MAC A;  2VKD A;  4K0K T;  3UUN A;  5LG3 A;  2W4X A;  4O4I E;  3VKH A;  2VVS A;  2WCA A;  3L3P A;  4EED A;  4YTP A;  2E9X C;  5LHG B;  4BA9 A;  2KND A;  1W0B A;  2WB5 A;  1YQ4 A;  5FXZ A;  1XNR T;  3P7I A;  2CA5 A;  2B1E A;  3HR0 A;  5LJN A;  2UUB T;  4O4J E;  2VL0 A;  4LF9 T;  4XAX B;  1LRZ A;  1ZP0 A;  1IJ6 A;  2XAJ B;  5LGT B;  4AQY T;  1WRD A;  2XQ7 A;  4ZI2 C;  2WQY A;  2EHO B;  3EDU A;  3RIA A;  2BG9 C;  3PUX F;  4I55 E;  2A2F X;  1MMA A;  2XAQ B;  3K3Q C;  2JRK A;  2HPL A;  5J1G A;  5H6R B;  4X1I E;  4AQG A;  2MBG A;  4KP3 C;  3SWH A;  2D5U A;  1LKX A;  3QNU A;  5L4H A;  3RYH E;  1BR2 A;  3ZSS A;  2X9X A;  2V8S V;  5AQJ B;  3RF1 A;  5L2L A;  3CK6 A;  1D0X A;  3LBX A;  3KVA A;  2Y6X A;  5LHH B;  3RC3 A;  3DJB A;  2VQF T;  3PUR A;  5L47 A;  2NP9 A;  2NOX A;  3CQX C;  4G63 A;  1KNR A;  4YHJ A;  4QHO A;  2DNX A;  4H9P C;  2KMF A;  2FJE A;  2BS2 A;  4IE4 A;  3UU3 A;  2W61 A;  4GYS A;  3AA7 B;  2LHR A;  2E9X A;  2WDR A;  4PK6 A;  3QB5 A;  1FJG T;  4KBM B;  2CE7 A;  5KXJ A;  3I0Q A;  1ZOY A;  2L9Q A;  1MND A;  3AVS A;  3VKG A;  1CHU A;  2DCF A;  2WAU A;  3AE7 A;  1M7K A;  1G73 A;  4EZH A;  3RQW A;  3BQL A;  3HI2 A;  3RIU C;  4GK5 E;  4ZEY A;  3L39 A;  1N34 T;  4GK0 E;  4IRE A;  2UUA T;  4TZ4 C;  2JPF A;  2BG9 A;  4U3C A;  3P8C D;  4ZOL E;  3EDV A;  5FKY A;  4JI6 T;  2JQQ A;  2LKG A;  5LBQ B;  3C4W A;  3PJA A;  1KEY A;  4HE8 A;  2DI4 A;  5HEJ A;  4JEU B;  1Y01 A;  4TWH A;  5IUX A;  4IDP A;  2X51 A;  5JDN A;  4B6X A;  1HTJ F;  2V7J A;  2UXC T;  1E1H B;  5AQH B;  4H63 H;  4ILU A;  2X9Y A;  2E5V A;  3DTO A;  5LGU B;  1CUN A;  2V6Y B;  5AQK B;  4AKR B;  3SFD A;  2D0U A;  3NBX X;  3EHZ A;  1MMN A;  5AQN B;  4E7Z A;  2UXD T;  3H3A A;  4U7Y A;  3GN5 B;  2XJ7 A;  5HXS A;  4BAY B;  1SA0 E;  3U3I A;  1Z0P A;  3ZT6 A;  2VKO A;  2V26 A;  2LEH A;  4C90 A;  4Z91 A;  2HHH T;  3J7Y q;  4CI1 B;  4CI3 B;  4DR3 T;  5BR8 T;  5JDQ A;  4JI2 T;  2KWI B;  4IIJ E;  2J1D G;  4DV4 T;  1WLX A;  5ADX L;  2DL1 A;  4U2Z A;  4IDN A;  4UF0 B;  4LMJ A;  4IDQ A;  2OLT A;  4YSZ A;  3SFE A;  5CJ5 A;  5AQO B;  4B3T T;  2H7V C;  1W09 A;  4A56 A;  3LSV A;  3RIU A;  3ZMU B;  3EAB A;  2BDE A;  1YD8 G;  4MHC A;  4X65 T;  2IUB A;  1KF6 A;  4WBO A;  2CXL A;  4C91 A;  3HKB E;  1QUU A;  3TLT A;  2W63 A;  4Q25 A;  3OTO T;  3AE8 A;  2CBJ A;  2I0M A;  2LE8 A;  4DO0 A;  5JRC A;  2X9H A;  3NZP A;  4KUM B;  4QWN B;  3H37 A;  4H9O C;  5DQW A;  1J1J A;  3W15 B;  5FL1 A;  2ZM0 A;  4P0A A;  5L3B B;  5J2U E;  4G2A A;  4O2A E;  5JDH A;  4PJM A;  3KDS E;  3LK4 2;  2X67 A;  2W2U A;  5LYJ E;  3MA9 A;  4NXM T;  1HF8 A;  3ZC1 A;  5JDL A;  2V7I A;  5AQV B;  3RYI E;  3Q9D A;  5LCY A;  1E7P A;  3RRC A;  2QA7 A;  2PJQ A;  2VUR A;  5HXH A;  5FVK A;  2QGS A;  5FL0 A;  1YQ3 A;  4HEA A;  4I50 E;  3O1I A;  3PUW F;  4X20 E;  2WWU A;  4YJ3 E;  4LFC T;  4ISS A;  5LNK A;  2MPK A;  2L8K A;  4IE6 A;  4EEB A;  2D0T A;  1D1A A;  1SE7 A;  2JMH A;  4L9I A;  3AA0 B;  4IDO A;  5LGN B;  2PTF A;  2XSA A;  3JCF A;  2BVL A;  2EHO D;  2PG8 A;  2W0G A;  2WS3 A;  1XMO T;  1OXZ A;  3RQU A;  3P4W A;  1LVK A;  4PJN A;  2LSI A;  3TLV A;  4LML A;  4WNK A;  4JV5 T;  2FUP A;  4I4T E;  4DR2 T;  3I9W A;  3KIN B;  4DV6 T;  4HN9 A;  4WYV A;  5E0O A;  3KV9 A;  3CX8 B;  4JEH B;  2V7L A;  2IC6 A;  4TN7 B;  1E2A A;  3K3O A;  2XTL A;  1OED B;  2C0S A;  3PUA A;  4UEL A;  2BS3 A;  2BBJ A;  4FI5 A;  4PJJ A;  2YEV C;  5L4E A;  5EK3 A;  1V9D A;  3LDQ B;  4O4L E;  3RLF F;  3BK9 A;  4NUU A;  4YTM A;  2XSB A;  3UFE A;  4HKA A;  2L3L A;  4ASK A;  3N2O A;  1VCS A;  4IST A;  4LF8 T;  3ZT5 A;  1JNR A;  5KMG P;  5FVL A;  4TV9 E;  1IBK T;  4KHZ F;  3IHR A;  4EV6 A;  3Q5X A;  1I6Z A;  2UXB T;  3ZN0 B;  1BR0 A;  4Z90 A;  1J5E T;  3FHN A;  3ZJ1 A;  5HXE A;  2EHO C;  3O4X E;  3Q5D A;  1OWA A;  4COF A;  2YKS A;  5HCJ A;  2VB6 A;  4HTE A;  3UUX B;  5C3J A;  2KT9 A;  5HEO A;  3WAJ A;  5A1L A;  4OYJ A;  4X62 T;  1NEN A;  4X5T A;  2NTY A;  4EOZ B;  4ZS2 A;  2XPK A;  3N5L A;  4ZZB A;  5M4Y A;  3CML A;  3AXJ B;  4K0U A;  4P09 A;  3RI5 A;  4H9N C;  4JLE A;  4YY3 T;  4YJ2 E;  3ETU A;  1HNX T;  2D9D A;  1HCI A;  2YDS A;  3G06 A;  5ABF B;  2HN2 A;  2BKN A;  3I9Y A;  4NUV A;  4CXW A;  2AE9 A;  4A5X A;  1IAP A;  4QH1 A;  5FXX A;  2GK9 A;  1HX1 B;  2XY8 B;  1X79 A;  3AA1 B;  1FMW A;  2CHN A;  3T1Y T;  2LHN A;  3NZQ A;  4B3M T;  3AE4 A;  4EAH A;  3PUQ A;  3AAA B;  4YLH A;  3LK3 B;  2XQ8 A;  2H88 A;  2JMK A;  2M67 A;  2NR4 A;  2FBW A;  3RIF A;  3PU3 A;  2XUE A;  2EHO A;  3KBT A;  5FY0 A;  3F2E A;  1XNQ T;  2ZM8 A;  3R6N A;  4CN6 A;  3RC8 A;  2ODV A;  1UK5 A;  4TUY E;  2V1D B;  2KIN B;  1X9B A;  4ANJ A;  2B76 A;  2YOE A;  1O3X A;  2CWO A;  3UT5 E;  4CI2 B;  5DQV A;  3R84 B;  2E8I A;  2IDO B;  4HFV A;  3AE1 A;  3S4U A;  4QXB B;  4AIU A;  4P0B A;  3FXD B;  2NW8 A;  2ODU A;  5IWA T;  3VRB A;  4OX9 T;  3PUV F;  2VVN A;  3UU8 A;  3LJC A;  5AQR B;  5DJQ C;  5HAX A;  4CXX A;  2HH7 A;  3ETV A;  3A5X A;  3LBX B;  4JUY A;  3MXZ A;  4HWH A;  5FMN A;  3ZCJ A;  3AE5 A;  5HXR A;  2SPC A;  2W00 A;  3JAF A;  4DV7 T;  3IBP A;  1IBM T;  2FJB A;  3ZKR A;  1NAF A;  3L8R A;  3I0O A;  2K48 A;  4EIW A;  5L3F B;  4JI5 T;  2Q9Q B;  2E9X B;  4X64 T;  2XAS B;  3KV6 A;  2LM2 A;  4EYY R;  1WCR A;  5AQI B;  2NW7 A;  3P4P A;  3M65 A;  3OKQ A;  3VU7 H;  4GKK T;  4AIS A;  3DP7 A;  4JI3 T;  3M3Z B;  2H7O A;  5EK2 A;  4DV1 T;  2LJL A;  3FBZ A;  2M6B A;  2MYS A;  2WY2 A;  3CPZ A;  2ES0 A;  4AI6 A;  5AQG B;  3FXE B;  1IBL T;  4LF7 T;  1OED E;  5LHI B;  2N9D A;  4DUY T;  3UTK A;  4QX8 B;  3C50 A;  4TWD A;  3FZK B;  2UUC T;  3J9X 1;  3PJA J;  2F4V T;  3RX6 A;  5CA1 E;  4AKL A;  3AEC A;  4HFC A;  2WMO A;  2HN1 A;  3UQ7 A;  2JJ9 A;  4J2C A;  4DR6 T;  2V6Y A;  4HWF A;  1T72 A;  5JDF A;  4MAL A;  1YXR A;  1YW0 A;  2CLY C;  1T8B A;  4DMW A;  1WFD A;  3NRX A;  4XZC A;  3AE2 A;  3ZYL A;  2ACX A;  3HA4 A;  2WZI A;  4UVB B;  3AEG A;  3ZMZ B;  5FY1 A;  2DWK A;  2Y8D A;  1BR1 A;  4PW8 A;  3RKO A;  4PAG A;  5L3D B;  3PE0 A;  3EUH A;  2WDQ A;  1Z8U A;  4ILB A;  4OFZ A;  4KX6 A;  2WDV A;  4H63 V;  4PK4 A;  1QLB A;  2CMR A;  2LSY A;  2V7M A;  5AQU B;  4F8H A;  3T8O A;  2XQ3 A;  4DID B;  2PFV A;  4TNV A;  2LOS A;  5JVD E;  3LG7 A;  2XAG B;  4WW0 A;  2LM9 A;  2C5K T;  2Y48 B;  5LXT E;  4P1N A;  3UU6 A;  2IC9 A;  4IE0 A;  5CA0 E;  4N78 D;  3P4Q A;  4DV0 T;  4EB6 E;  4O2B E;  2D2S A;  3H3M A;  3VR8 A;  1XZY A;  2DHR A;  3RGL A;  5LP6 E;  4CN1 A;  2V6X A;  4X1K E;  4QH4 A;  3KV4 A;  2MAW A;  3QUJ A;  2LKH A;  4IHJ E;  3KBU A;  1R8I A;  2WSS V;  2IW5 B;  2M6I A;  1MIY A;  2XQ9 A;  3NVO A;  3PUG A;  3UQ4 A;  3E22 E;  3ZT7 A;  2QVA A;  2CXD A;  5JRC B;  2RPA A;  1HFA A;  4LMK A;  3CIR A;  1U5P A;  3N9N A;  4IDZ A;  4ERR A;  1LVF A;  2X9W A;  2JIW A;  4TNW A;  3SOL A;  2VQE T;  1XDO A;  3IF8 B;  4ZI3 D;  5TAO A;  2YN6 A;  4HFH A;  2OV9 A;  4DVD A;  1FMV A;  5FXV A;  4HGA A;  4H9Q C;  5C8Y E;  5FXW A;  3VHL A;  3AE3 A;  4YTN A;  1ZV4 X;  3UUL A;  2VK9 A;  3N9P A;  3PV0 F;  2A3D A;  5EK4 A;  2N2N A;  3PU8 A;  1NEK A;  2LRK A;  4OYK A;  2NW9 A;  2MOZ A;  2E2A A;  3AA6 B;  4MBQ A;  3B57 A;  4GKJ T;  2V7K A;  4UXN B;  1FIO A;  3ZCI A;  4QH5 A;  3TKL B;  3V5S A;  1IZN B;  2VAS A;  4JBW F;  3AAE B;  5JRE A;  4B3R T;  3A7M A;  2K24 A;  5LBM A;  4AXP A;  4XBF B;  5LB7 B;  2CCQ A;  3OJA A;  3NWI A;  3OVU A;  3AB3 B;  4O4H E;  2HPJ A;  4OK0 A;  3ANW B;  5JR9 B;  3ZYK A;  2NWB A;  2CXF A;  4U7I A;  2CWY A;  3AEF A;  4QKN A;  4DMV A;  5KX5 E;  2CHO A;  2KSR A;  4UVA B;  3AAI A;  1Y64 B;  4BJN A;  4ZI3 C;  2LT3 A;  2RP4 A;  2V5D A;  1SHZ C;  2Q9Q D;  2P9B A;  3F57 A;  2ACZ A;  5FYM A;  4ZHQ E;  4HWC A;  4YSY A;  4IL9 A;  4DND A;  4QXH B;  5AQT B;  4YHH T;  2J47 A;  3Q5W A;  4EXT A;  2X0H A;  4UIG A;  3GWH A;  3MK7 C;  2YU1 A;  3PUZ F;  3B5M A;  5GON E;  4JYA T;  3N2G E;  4YFS A;  3UFG A;  4LF6 T;  4IE5 A;  4KI0 F;  5JQG E;  3FBL A;  3CQC B;  2NTX A;  3KFW X;  4QXC B;  3FZL B;  5JDG A;  5JDM A;  3JAE A;  4ZI7 E;  5JH7 E;  4DR7 T;  1S35 A;  3VR9 A;  2XQA A;  3C4Z A;  4U33 A;  4WBN E;  3GMI A;  3RYF E;  3CWZ B;  5HEG A;  5HWY A;  2I59 A;  4L0R A;  2VL8 A;  3NRY A;  2LSK A;  4HWI B;  3QK6 A;  1U4Q A;  4AQF C;  4NPP A;  2X0Y A;  4UV8 B;  4ZZC A;  2I6H A;  5ABF A;  4HWD A;  4EZ4 A;  4X66 T;  1HG2 A;  4DR4 T;  1HS7 A;  5LMN T;  2YIN A;  3C4X A;  2ZM6 T;  5HWX A;  4MLK A;  5LJM A;  5HEU A;  2ZLY A;  3AED A;  1VCT A;  2LSJ A;  4CN4 A;  1DU2 A;  5FNV E;  4IGU A;  1KFY A;  2OA5 A;  4DV3 T;  1ZKE A;  2Q9Q C;  3RRW A;  1UGO A;  2W66 A;  4DBR A;  4IL4 A;  1SUM B;  5L3E B;  4A97 A;  5F5W A;  1XWM A;  1HX8 A;  3CKD A;  1N36 T;  3VRA A;  2WU2 A;  2IAK A;  3UU5 A;  2KWH A;  2JQ9 A;  1T7S A;  2UU9 T;  3ZYM A;  4YXD A;  3RHW A;  3NKZ A;  4IT4 A;  1D1C A;  2H89 A;  2XM1 A;  1VOM A;  5HYA A;  5AQL B;  3C64 A;  3ZMT B;  2XM2 A;  2UXN B;  3IEE A;  3KVB A;  1D1B A;  3ZLI A;  3AE9 A;  1ZHC A;  1W0A A;  5BMV E;  5L3G B;  3N9Q A;  1N33 T;  1N32 T;  4AKI A;  3LFM A;  3KV5 A;  4AQF A;  1MNE A;  4U2Y A;  3EI0 A;  4V1A v;  5IHY A;  5AQS B;  3RKG A; 
#chains in the Genus database with same CATH homology
 2V8S V;  2QYW A;  3ONL C;  3ONJ A;  1VCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...