3ONLC

Yeast ent3_enth-vti1p_habc complex structure
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
95
structure length
95
Chain Sequence
SLLISYESDFKTTLEQAKASLAEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVEVNNSIGDASERATYKAKLREWKKTIQSDIKRPLQSLVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Epsin N-terminal homology domains bind on opposite sides of two SNAREs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Epsin-3
total genus 41
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2010-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05008 V-SNARE Vesicle transport v-SNARE protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 3onlC00
2V8SV 2QYWA 1VCSA 3ONJA 3ONLC
chains in the Genus database with same CATH superfamily
3E0ZA 2H7VC 3P4WA 2WWVA 4EZHA 2GK9A 5L3CB 1VOMA 3W15B 3JADA 2XQ6A 4PNIA 3WAKA 2IMLA 4YSYA 2XJ7A 4H9QC 1CHUA 3ETVA 5LA6E 2LT3A 3RPUA 5JR9B 2UUAT 3EI0A 2KLQA 3KBUA 3LG7A 4H63H 2WDVA 5HEOA 4NIQA 5FXWA 4BAYB 5HAXA 2W0GA 5LBMA 4CN6A 4HN9A 4YLHA 4TWFA 4EB6E 1FEWA 3EVYA 3AE5A 3QC9A 4UV9B 4H9SE 4EYUA 5LNKA 4ILAA 2JMKA 4WW0A 2HN1A 4X1KE 2K48A 3P4PA 3QNUA 4YJ3E 3AEFA 5E0OA 3TLWA 4TWHA 3RIAA 2CLYB 2JIWA 3Q5XA 2C0SA 2FUPA 3EAMA 4HFBA 1HR0T 4O2AE 2LSKA 1ZP0A 1NWMX 1WFDA 3SFEA 4QH4A 3L09A 5C2TA 5LMUT 5IHYA 4DV4T 3RIFA 3ZCJA 2VQET 4AKIA 2EHOD 2ODVA 2Y8DA 2WU2A 3BQIA 5LOVE 1SHZC 3A8YC 3JAEA 3NRXA 1EZ3A 2MBGA 3ZJ2A 4EXTA 4HWFA 4EYYR 3T8OA 2BS2A 2KSRA 3CQGB 3MJXA 5AQSB 5C8YE 2CRBA 2X51A 3P50A 3Q5EA 3SWHA 5LXTE 4NXNT 3EHZA 4HFVA 2PJQA 5JREA 2JQQA 1UK5A 2CPTA 2KWHA 3KDSE 4G2AA 1S94A 2J47A 2VWAA 2YDSA 2V7JA 3N2KE 4A56A 2D5UA 3RHWA 1SA0E 3VHLA 2FJBA 3NRYA 4U7IA 5AQFB 4CN1A 5AQKB 3A5XA 3ZLIA 2MOZA 3CX7B 3C4XA 5FY1A 3PUGA 3UFEA 4CI2B 4DV5T 4ERRA 1I94T 2CBIA 3ZSSA 3C50A 4AIUA 2CHOA 1M7KA 4HEAA 4PJLA 2JQKA 3C98B 4DVDA 5KMGP 5KDMC 4DV0T 1ZKEA 4A98A 3Q5WA 4O4JE 4DMVA 2HHHT 4HWCA 2AXDS 4UEMA 4YSZA 1OEDB 4Z8XA 5FL1A 1J5WA 4JV5T 2D0UA 3H3AA 3OVUA 5HCMA 2IHR1 4TX5A 4X20E 4COFA 1HCIA 3N9QA 5LHGB 4TNVA 5DQVA 3WI3A 5KX5E 2LEHA 1N34T 5CGMA 2UUCT 5AQQB 5FVKA 1AJ3A 2VVSA 2JJ9A 4B3MT 1WYBA 2V7LA 1X9BA 3AXJA 3UU4A 4LF6T 3N9PA 2K3WA 3LBXA 3ZMZB 3RGLA 3GA8A 3GN5A 4FI5A 3UFGA 2YN6A 4A5XA 4PK4A 1HX1B 1M62A 4X1IE 1D1AA 2K9AA 3PUAA 4X66T 1LRZA 2W62A 3TLSA 3EABA 3ZEFB 1UX4A 5JDNA 3VKGA 3L3PA 3K8PC 1KNZA 2V1DB 1DU2A 2WQYA 5JRCB 2NW7A 2CE7A 3NWIA 5HEGA 4PAGA 3RQUA 4YSXA 1IZNB 1ZEEA 2IDOB 4BJMA 4CI1B 1I6ZA 3CVRA 4ZXLA 3ONJA 4OFZA 5JDGA 5LJMA 2JQ9A 4GKKT 2E5VA 3VRAA 2UXDT 5LMNT 2WDRA 3RF1A 3QK6A 4G63A 5H6QB 2VB6A 1IJ6A 2BKPA 1J1JA 1UGOA 4ADZA 2X0LB 1T8BA 2XSAA 2RP4A 4MFRA 4O2BE 5AQTB 5LCYA 4WYVA 3TLVA 2BKNA 3FHNA 3AA0B 2UXCT 2X0YA 4B3RT 1HNZT 3P7IA 5HXCA 4ZI3D 1US7B 3PUWF 5FXXA 3RRWA 1MMDA 3DTOA 3N9LA 5IYZE 2XM1A 3O1JA 4GK0E 2ZM2A 4IDNA 3RRCA 3N9OA 3Q2MA 4O4IE 4YY3T 2BBJA 2LKGA 4LF5T 3ABVA 4U72A 4LMKA 2EHOC 4YJ2E 3S4UA 5L3BB 4DUYT 2X9HA 4KX6A 5CB4E 3CQXC 1FIOA 3B13A 4BJNA 3UU6A 5AQVB 4EGWA 4DV7T 4JI7T 2XM2A 3MA9A 2K5BB 4GYSA 1CUNA 3C51A 3OJAA 2DWGA 4X62T 4ANJA 3FBZA 2KXPB 3U3IA 5HXRA 1IAPA 2A72A 2FJEA 2HPLA 4MBQA 3ZYMA 3AA7B 1Z0PA 4DIDB 4YHHT 4JI3T 4I55E 4O8SA 3ONLC 2UXNB 4UF0B 1MMGA 4CN4A 4EV6A 2CCQA 2VL0A 2LHNA 2IIUA 2J62A 5FXZA 5JDQA 5L3FB 4X1YE 3GN5B 2D2SA 1MMAA 4ZI2C 4DV1T 4JI0T 4IDQA 2QRXA 5JDLA 2VQFT 3TKLB 4WNKA 1SUMB 2CM0A 5LGTB 2K24A 2X68A 2CXDA 4ZS3A 3B57A 5J1GA 3PUXF 4YT0A 3ZYKA 2X67A 2LRKA 1IBKT 3P4QA 4U3CA 2WMNA 2KWIB 2YU2A 4PJNA 1XNRT 5JTGA 4KHZF 2XHEB 3Q5DA 2B76A 3FB2A 2VURA 4K0UA 2Y48B 2PFVA 2QA7A 1QSDA 3FBLA 2YKSA 4TV8E 3J7Yq 4O4HE 3D0TA 4L0RA 5FKYA 3EUHA 2E5LT 2XZEA 4JEUB 4AKHA 4NPPA 5AQLB 5IWAT 5LGNB 1FJGT 2BDEA 2WB5A 2CWYA 2XPKA 3AEEA 5CJ5A 1MNDA 2V26A 5KXJA 1E7PA 4HWIB 2W61A 2XASB 3B5MA 3IEEA 3ZC1A 5JH7E 2ZM6T 2LM2A 3NZPA 3PV0F 4UXNB 4AQGA 4V1Av 1OXZA 5FP3A 3P4SA 5LG4A 4LMLA 1KK7A 4DR7T 3L8RA 4EEDA 3N5LA 1YW0A 3ZSTA 3KINB 4EOZB 4JI6T 3P8CD 3ZT7A 2XQ8A 1IJ5A 2X66A 2YU1A 1E2AA 2E8IA 3MK7C 3N2GE 1ZOYA 4EAHA 1YQ3A 2AE9A 2ES0A 2LSGA 3AE3A 3T1YT 2V6YA 2J4GA 4NUUA 3FZFB 3KVBA 4Q25A 2VVNA 2XQYA 3R6NA 4EEBA 1HNXT 4GYRA 3CMLA 2N2NA 3TLUA 5JRCA 2XQ7A 5FMNA 2JMHA 4UVCB 5LYJE 2YINA 2IC9A 4OYJA 4DBRA 4TWDA 4LFAT 2C5JA 2EHOB 2XAGB 2XAQB 4IE7A 5AQGB 4HFDA 3AE8A 3G06A 5DABA 5ABFA 2M6BA 1ZV4X 1FMVA 2LSJA 2NW9A 5BMVE 3JAFA 4QX8B 1YKEB 2CXFA 2X9WA 4U31A 5ABHA 2HPJA 4MLKA 5L2LA 3O1HA 4DUZT 2BS3A 1BR4A 3HKCE 1B7TA 5CFBA 3ESLA 4CXWA 3N2OA 5IUXA 4DR5T 2V7KA 3FXDB 4U74A 3M65A 4JI1T 4AQYT 2P9BA 5JDFA 1Y64B 1D0YA 2WWUA 4E7ZA 1W0BA 2V8SV 5ABFB 4AKGA 4O4LE 4QHOA 5HEUA 2Y6XA 3RIUA 2NP9A 1T98A 4UIGA 3RYHE 3ZT6A 4JI4T 1U5PA 4HKAA 2W63A 2M67A 2YK0A 4LF8T 5M4YA 3VR9A 1Y01A 2B1EA 3TLTA 1D1BA 3PTRB 4LFBT 5CA0E 4TV9E 4NXMT 4C91A 1LKXA 2BG9A 3BK9A 3DP7A 3UU8A 1L0VA 4DMWA 4DBQA 2UXBT 5FXVA 4IREA 3AA6B 5C3JA 4KBMB 2DI4A 4IDZA 5L47A 3RYIE 3KBTA 4IL9A 4IDOA 3UUBA 1QLBA 2DL1A 3RYFE 1YKHB 2C5KT 3KFWX 2OA5A 5AQOB 1MIWA 3PU3A 3ZYLA 4AKLA 3E22E 4JI8T 3IA3A 1UCUA 3H37A 4NUVA 2ZM8A 3QB5A 4DR6T 2LM9A 2W2UA 3OYXA 5L4EA 4PK5A 3AEAA 5ABGA 3ZMUB 3UUXB 2DWKA 4C90A 2E9XA 4L5GA 4JBWF 2F4VT 1HFAA 2G0UA 2MAWA 1V9DA 3PDYA 4B6XA 1S35A 1OEDA 1WR6A 2DLRA 2CEAA 2J1DG 2QGSA 1WCRA 3KV9A 2XAFB 3ZJ1A 3T1HT 3IF8B 3ZCIA 2V6YB 3UQ7A 3RI5A 2XSBA 3AEGA 3OBVE 4TNWA 2IW5B 3AVSA 2MTQA 2ZM0A 3MZKB 3N9MA 3RKGA 3U78A 5HXSA 3ANWB 3P4RA 4IL4A 3AVRA 1LVKA 1BR1A 1O3XA 4PK6A 1MNEA 5J2TE 4H63V 4DR3T 4QH1A 3NZQA 2UUBT 4YTNA 2VK9A 1GQEA 5LHIB 2LOSA 2XUEA 1T7SA 1KEYA 5LJNA 4XBFB 3FZLB 2W00A 1T72A 3SRZA 2PG8A 2L3LA 2WU5A 2QVAA 3LDQB 3RKOA 3HI2A 3I0OA 1Z8UA 4XZCA 5L4HA 4CXXA 5GONE 2XTLA 3CX6B 3AEDA 3KV6A 2XAHB 2BVMA 1QUUA 3I9WA 4ASKA 1JNRA 3UU3A 4KHPT 1NENA 2NTYA 4U2ZA 3I0QA 4YFSA 5FVLA 1XMOT 2X9XA 2EHOA 2H3RA 3Q9DA 4KMCA 2VL8A 4UF0A 1NEKA 4HFHA 4QX7B 2ZMAA 2D9DA 3AA1B 4KUMB 2H88A 4H9PC 4JEHB 4CZZB 1N32T 2W66A 5H6RB 3UUMA 1HNWT 4YTMA 5LHHB 4DV2T 3PURA 3PUYF 2WMOA 2Q9QC 4QKNA 4QXCB 2KNDA 3VU7H 5J0ZA 2WZHA 3OTOT 4AQFA 5AQPB 3AEBA 2MPKA 2VKOA 4HGAA 3SOLA 3RQWA 1UURA 2PBIA 2LSYA 2ACZA 2Q9QD 3AB3B 5F3JA 1KF6A 3VRBA 5AQMB 1ZHCA 4TZ4C 4UVAB 4Z90A 5J2UE 3EDUA 3RC8A 3C4ZA 5FL0A 2V7MA 1G8XA 1XZYA 3O4XE 4BA9A 2CMRA 3M3ZB 3NKZA 3OPCA 3J9X1 4KI0F 5JR9C 3I1AA 1XMQT 4PJMA 4UR9A 5LG3A 3E08A 4B3TT 4ZOLE 2XY8B 1R8IA 2QYWA 3KV4A 3JCFA 5FY7A 2KINB 4U33A 3QB5K 3FZMB 1X79A 3HKDE 1U4QA 1XNQT 4K0KT 2WZIA 4H9NC 5AQUB 5BR8T 4CQIA 1BR0A 2BG9B 2XQ3A 2LJLA 4LMJA 4OHFA 1FMWA 5AQHB 2XQ5A 2BKOA 2BBHA 3F57A 3R84B 3UT5E 4U7YA 5HCJA 5JQGE 4TN7B 3DJBA 1XDPA 4WBOA 4IE6A 2NR4A 3I9YA 3AE9A 4FJOA 4DNDA 4MHCA 3F31A 1HS7A 3A7MA 3HKBE 3LK42 4JLEA 2Q9QA 2WDQA 2WM9A 2V7IA 2YEVC 4IHJE 3AECA 3ZC0A 3KVAA 4I0UA 4LFCT 3RH3A 1D0XA 4OYKA 2VKDA 2JQHA 4OX9T 3MXZA 2HH7A 5AQJB 1E1HB 2E9XB 2PTFA 3AAEB 3F2EA 3H3MA 5F8PA 4ZEYA 2XQ9A 1VRBA 4AI6A 4UV8B 3RYCE 3PE0A 1OWAA 2D0TA 5A1LA 4IE4A 2BG9E 3UUNA 4WBNE 4DV3T 1UX5A 5ABEA 3ZT5A 1N33T 3VKHA 1XDOA 3K1SA 3V5UA 4ZI2D 2CXLA 2MYSA 4ZS2A 3ZPOA 5HWXA 2V5CA 3X1DA 3ZMSB 2ACXA 4CI3B 3O9XA 3PUSA 1SE7A 5AFUL 2LKHA 1G73A 3CIRA 3RLFF 1HF8A 3V5SA 3ZN1B 3MKDA 2OV9A 3PUVF 4YTPA 4ZHQE 4QWNB 2N1GA 3LFMA 4B3ST 4HFCA 2R6GF 4ZI7E 4AKRB 4HFEA 2W4XA 2XQAA 4OK0A 2YDRA 4QXBB 3UULA 1H7CA 5L3DB 2BZBA 2X9YA 3IBPA 4GOUA 4LF9T 2SPCA 2WAUA 2YOEA 4HFIA 4HTEA 5EZYE 4P0AA 3AE1A 2XQ4A 5AQNB 2M6IA 3RC3A 3CKDA 5HYAA 2X0HA 3AAIA 3GWHA 4ZI3C 3ZMTB 2LSIA 3AE4A 2E9XD 5FY0A 4JI5T 2A9UA 2IC6A 2WS3A 1IBMT 2N9DA 3LJCA 4H9OC 1W0AA 2CLYC 1WRDA 2VASA 4ZZBA 1VCSA 5HXEA 3EDVA 1W9RA 2WP9A 2VKJA 3AE6A 2RA1A 4IE0A 4IT4A 2ODUA 1IBLT 1YXRA 1VCTA 2ZLYA 3PUQA 4H9RC 2I59A 4TUYE 4HE8A 3VR8A 1MMNA 1YQ4A 4KP3C 4JI2T 4DR2T 3RIUC 3K3QC 3LK3B 4I43B 4UELA 4GIWA 1MIYA 1KFYA 2NOXA 2WY2A 2I0MA 3FZHB 2OLTA 3MACA 4AQFC 4DV6T 3GMIA 3HKEE 4A97A 5ETWA 5HWYA 4EIWA 4F6RC 1N36T 5LB7B 2Q9QB 2CA5A 3WAJA 2CHNA 2HN2A 3NVOA 4J2CA 1HX8A 5DJQC 4IGUA 4PFPA 3ZN0B 3CK6A 5L3GB 2JPFA 2E9XC 1XWMA 2VKHA 3PU8A 5ADXL 3AAAB 1BR2A 1KNRA 4PW8A 4AISA 1HTJF 3C64A 2L9QA 3AE2A 3BQLA 2V5DA 2WCAA 4U2YA 2CWOA 5F5WA 4YXDA 1UUSA 3HL6A 4IDPA 5TAOA 3UQ4A 2WSSV 3PUZF 3IHRA 4P0BA 2LLYA 3C4WA 3AE7A 5FYMA 5EK2A 1JNZA 4M1PA 1LVFA 4HWHA 2XAJB 3QOFA 4Z91A 4DR1T 2BVLA 4IIJE 3JC6D 2RPAA 2NW8A 4ILBA 1D1CA 2E2AA 2KT9A 3BQKA 2LHRA 1MIVA 3ETUA 4QH5A 4UVBB 4X65T 2CBJA 2UU9T 4IE5A 2A3DA 4PFOA 2LOPA 2FJAA 3UTKA 2LE8A 2BG9C 4GK5E 3UU5A 2WBLA 2YDQA 3FXEB 3CX8B 2H89A 3LSVA 4P1NA 4DO0A 1J5ET 2NTXA 5AQRB 3ZKRA 1WLXA 4I4TE 3CPZA 2A2FX 5JVDE 1W09A 2KZ7B 1HG2A 1NAFA 3CQCB 4X64T 4DR4T 3ANWA 3O1IA 2LRLA 5LGUB 1WYCA 5DQWA 2FJDA 1OEDE 3K3NA 3SFDA 3SS1A 3RX6A 3KV5A 4HWDA 5FNVE 3HR0A 4ISTA 2H7OA 1KNPA 1YD8G 3JC6C 5EK3A 3K3OA 3ZMVB 3N9NA 4EZ4A 3L39A 2IAKA 4L9IA 5JDHA 5JDMA 5EK4A 2V6XA 4ILCA 4XAXB 2I6HA 2NWBA 3OYZA 4I50E 1WR0A 4ISSA 5HEJA 4ILUA 4AXPA 5LBQB 3PJAA 4PJJA 4N78D 4QXHB 2DNXA 3NBXX 3QUJA 2DHRA 3AXJB 5LP6E 1HG5A 4MALA 4X5TA 5JR9A 2FBWA 4YHJA 3LBXB 5HEHA 4P09A 3ONXA 5HXHA 4CXYA 2UXXB 5AQIB 2IUBA 4LF7T 4JYAT 2DCFA 3LK2B 2JRKA 2L8KA 2Z6EA 3HA4A 3OKQA 1D0ZA 4WZXA 4GKJT 4F8HA 3FZKB 3CWZB 4ZZCA 2KMFA 4E7SA 5L3EB 4LF4T 3PJAJ 2BS4A 4JUYA 5CA1E 2W67A 1OEDC 2C5IT
chains in the Genus database with same CATH topology
2V8SV 2QYWA 1VCSA 3ONJA 3ONLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8S V;  2QYW A;  1VCS A;  3ONJ A;  3ONL C; 
#chains in the Genus database with same CATH topology
 3E0Z A;  2H7V C;  3P4W A;  2WWV A;  4EZH A;  2GK9 A;  5L3C B;  1VOM A;  3W15 B;  3JAD A;  2XQ6 A;  4PNI A;  3WAK A;  2IML A;  4YSY A;  2XJ7 A;  4H9Q C;  1CHU A;  3ETV A;  5LA6 E;  2LT3 A;  3RPU A;  5JR9 B;  2UUA T;  3EI0 A;  2KLQ A;  3KBU A;  3LG7 A;  4H63 H;  2WDV A;  5HEO A;  4NIQ A;  5FXW A;  4BAY B;  5HAX A;  2W0G A;  5LBM A;  4CN6 A;  4HN9 A;  4YLH A;  4TWF A;  4EB6 E;  1FEW A;  3EVY A;  3AE5 A;  3QC9 A;  4UV9 B;  4H9S E;  4EYU A;  5LNK A;  4ILA A;  2JMK A;  4WW0 A;  2HN1 A;  4X1K E;  2K48 A;  3P4P A;  3QNU A;  4YJ3 E;  3AEF A;  5E0O A;  3TLW A;  4TWH A;  3RIA A;  2CLY B;  2JIW A;  3Q5X A;  2C0S A;  2FUP A;  3EAM A;  4HFB A;  1HR0 T;  4O2A E;  2LSK A;  1ZP0 A;  1NWM X;  1WFD A;  3SFE A;  4QH4 A;  3L09 A;  5C2T A;  5LMU T;  5IHY A;  4DV4 T;  3RIF A;  3ZCJ A;  2VQE T;  4AKI A;  2EHO D;  2ODV A;  2Y8D A;  2WU2 A;  3BQI A;  5LOV E;  1SHZ C;  3A8Y C;  3JAE A;  3NRX A;  1EZ3 A;  2MBG A;  3ZJ2 A;  4EXT A;  4HWF A;  4EYY R;  3T8O A;  2BS2 A;  2KSR A;  3CQG B;  3MJX A;  5AQS B;  5C8Y E;  2CRB A;  2X51 A;  3P50 A;  3Q5E A;  3SWH A;  5LXT E;  4NXN T;  3EHZ A;  4HFV A;  2PJQ A;  5JRE A;  2JQQ A;  1UK5 A;  2CPT A;  2KWH A;  3KDS E;  4G2A A;  1S94 A;  2J47 A;  2VWA A;  2YDS A;  2V7J A;  3N2K E;  4A56 A;  2D5U A;  3RHW A;  1SA0 E;  3VHL A;  2FJB A;  3NRY A;  4U7I A;  5AQF B;  4CN1 A;  5AQK B;  3A5X A;  3ZLI A;  2MOZ A;  3CX7 B;  3C4X A;  5FY1 A;  3PUG A;  3UFE A;  4CI2 B;  4DV5 T;  4ERR A;  1I94 T;  2CBI A;  3ZSS A;  3C50 A;  4AIU A;  2CHO A;  1M7K A;  4HEA A;  4PJL A;  2JQK A;  3C98 B;  4DVD A;  5KMG P;  5KDM C;  4DV0 T;  1ZKE A;  4A98 A;  3Q5W A;  4O4J E;  4DMV A;  2HHH T;  4HWC A;  2AXD S;  4UEM A;  4YSZ A;  1OED B;  4Z8X A;  5FL1 A;  1J5W A;  4JV5 T;  2D0U A;  3H3A A;  3OVU A;  5HCM A;  2IHR 1;  4TX5 A;  4X20 E;  4COF A;  1HCI A;  3N9Q A;  5LHG B;  4TNV A;  5DQV A;  3WI3 A;  5KX5 E;  2LEH A;  1N34 T;  5CGM A;  2UUC T;  5AQQ B;  5FVK A;  1AJ3 A;  2VVS A;  2JJ9 A;  4B3M T;  1WYB A;  2V7L A;  1X9B A;  3AXJ A;  3UU4 A;  4LF6 T;  3N9P A;  2K3W A;  3LBX A;  3ZMZ B;  3RGL A;  3GA8 A;  3GN5 A;  4FI5 A;  3UFG A;  2YN6 A;  4A5X A;  4PK4 A;  1HX1 B;  1M62 A;  4X1I E;  1D1A A;  2K9A A;  3PUA A;  4X66 T;  1LRZ A;  2W62 A;  3TLS A;  3EAB A;  3ZEF B;  1UX4 A;  5JDN A;  3VKG A;  3L3P A;  3K8P C;  1KNZ A;  2V1D B;  1DU2 A;  2WQY A;  5JRC B;  2NW7 A;  2CE7 A;  3NWI A;  5HEG A;  4PAG A;  3RQU A;  4YSX A;  1IZN B;  1ZEE A;  2IDO B;  4BJM A;  4CI1 B;  1I6Z A;  3CVR A;  4ZXL A;  3ONJ A;  4OFZ A;  5JDG A;  5LJM A;  2JQ9 A;  4GKK T;  2E5V A;  3VRA A;  2UXD T;  5LMN T;  2WDR A;  3RF1 A;  3QK6 A;  4G63 A;  5H6Q B;  2VB6 A;  1IJ6 A;  2BKP A;  1J1J A;  1UGO A;  4ADZ A;  2X0L B;  1T8B A;  2XSA A;  2RP4 A;  4MFR A;  4O2B E;  5AQT B;  5LCY A;  4WYV A;  3TLV A;  2BKN A;  3FHN A;  3AA0 B;  2UXC T;  2X0Y A;  4B3R T;  1HNZ T;  3P7I A;  5HXC A;  4ZI3 D;  1US7 B;  3PUW F;  5FXX A;  3RRW A;  1MMD A;  3DTO A;  3N9L A;  5IYZ E;  2XM1 A;  3O1J A;  4GK0 E;  2ZM2 A;  4IDN A;  3RRC A;  3N9O A;  3Q2M A;  4O4I E;  4YY3 T;  2BBJ A;  2LKG A;  4LF5 T;  3ABV A;  4U72 A;  4LMK A;  2EHO C;  4YJ2 E;  3S4U A;  5L3B B;  4DUY T;  2X9H A;  4KX6 A;  5CB4 E;  3CQX C;  1FIO A;  3B13 A;  4BJN A;  3UU6 A;  5AQV B;  4EGW A;  4DV7 T;  4JI7 T;  2XM2 A;  3MA9 A;  2K5B B;  4GYS A;  1CUN A;  3C51 A;  3OJA A;  2DWG A;  4X62 T;  4ANJ A;  3FBZ A;  2KXP B;  3U3I A;  5HXR A;  1IAP A;  2A72 A;  2FJE A;  2HPL A;  4MBQ A;  3ZYM A;  3AA7 B;  1Z0P A;  4DID B;  4YHH T;  4JI3 T;  4I55 E;  4O8S A;  3ONL C;  2UXN B;  4UF0 B;  1MMG A;  4CN4 A;  4EV6 A;  2CCQ A;  2VL0 A;  2LHN A;  2IIU A;  2J62 A;  5FXZ A;  5JDQ A;  5L3F B;  4X1Y E;  3GN5 B;  2D2S A;  1MMA A;  4ZI2 C;  4DV1 T;  4JI0 T;  4IDQ A;  2QRX A;  5JDL A;  2VQF T;  3TKL B;  4WNK A;  1SUM B;  2CM0 A;  5LGT B;  2K24 A;  2X68 A;  2CXD A;  4ZS3 A;  3B57 A;  5J1G A;  3PUX F;  4YT0 A;  3ZYK A;  2X67 A;  2LRK A;  1IBK T;  3P4Q A;  4U3C A;  2WMN A;  2KWI B;  2YU2 A;  4PJN A;  1XNR T;  5JTG A;  4KHZ F;  2XHE B;  3Q5D A;  2B76 A;  3FB2 A;  2VUR A;  4K0U A;  2Y48 B;  2PFV A;  2QA7 A;  1QSD A;  3FBL A;  2YKS A;  4TV8 E;  3J7Y q;  4O4H E;  3D0T A;  4L0R A;  5FKY A;  3EUH A;  2E5L T;  2XZE A;  4JEU B;  4AKH A;  4NPP A;  5AQL B;  5IWA T;  5LGN B;  1FJG T;  2BDE A;  2WB5 A;  2CWY A;  2XPK A;  3AEE A;  5CJ5 A;  1MND A;  2V26 A;  5KXJ A;  1E7P A;  4HWI B;  2W61 A;  2XAS B;  3B5M A;  3IEE A;  3ZC1 A;  5JH7 E;  2ZM6 T;  2LM2 A;  3NZP A;  3PV0 F;  4UXN B;  4AQG A;  4V1A v;  1OXZ A;  5FP3 A;  3P4S A;  5LG4 A;  4LML A;  1KK7 A;  4DR7 T;  3L8R A;  4EED A;  3N5L A;  1YW0 A;  3ZST A;  3KIN B;  4EOZ B;  4JI6 T;  3P8C D;  3ZT7 A;  2XQ8 A;  1IJ5 A;  2X66 A;  2YU1 A;  1E2A A;  2E8I A;  3MK7 C;  3N2G E;  1ZOY A;  4EAH A;  1YQ3 A;  2AE9 A;  2ES0 A;  2LSG A;  3AE3 A;  3T1Y T;  2V6Y A;  2J4G A;  4NUU A;  3FZF B;  3KVB A;  4Q25 A;  2VVN A;  2XQY A;  3R6N A;  4EEB A;  1HNX T;  4GYR A;  3CML A;  2N2N A;  3TLU A;  5JRC A;  2XQ7 A;  5FMN A;  2JMH A;  4UVC B;  5LYJ E;  2YIN A;  2IC9 A;  4OYJ A;  4DBR A;  4TWD A;  4LFA T;  2C5J A;  2EHO B;  2XAG B;  2XAQ B;  4IE7 A;  5AQG B;  4HFD A;  3AE8 A;  3G06 A;  5DAB A;  5ABF A;  2M6B A;  1ZV4 X;  1FMV A;  2LSJ A;  2NW9 A;  5BMV E;  3JAF A;  4QX8 B;  1YKE B;  2CXF A;  2X9W A;  4U31 A;  5ABH A;  2HPJ A;  4MLK A;  5L2L A;  3O1H A;  4DUZ T;  2BS3 A;  1BR4 A;  3HKC E;  1B7T A;  5CFB A;  3ESL A;  4CXW A;  3N2O A;  5IUX A;  4DR5 T;  2V7K A;  3FXD B;  4U74 A;  3M65 A;  4JI1 T;  4AQY T;  2P9B A;  5JDF A;  1Y64 B;  1D0Y A;  2WWU A;  4E7Z A;  1W0B A;  2V8S V;  5ABF B;  4AKG A;  4O4L E;  4QHO A;  5HEU A;  2Y6X A;  3RIU A;  2NP9 A;  1T98 A;  4UIG A;  3RYH E;  3ZT6 A;  4JI4 T;  1U5P A;  4HKA A;  2W63 A;  2M67 A;  2YK0 A;  4LF8 T;  5M4Y A;  3VR9 A;  1Y01 A;  2B1E A;  3TLT A;  1D1B A;  3PTR B;  4LFB T;  5CA0 E;  4TV9 E;  4NXM T;  4C91 A;  1LKX A;  2BG9 A;  3BK9 A;  3DP7 A;  3UU8 A;  1L0V A;  4DMW A;  4DBQ A;  2UXB T;  5FXV A;  4IRE A;  3AA6 B;  5C3J A;  4KBM B;  2DI4 A;  4IDZ A;  5L47 A;  3RYI E;  3KBT A;  4IL9 A;  4IDO A;  3UUB A;  1QLB A;  2DL1 A;  3RYF E;  1YKH B;  2C5K T;  3KFW X;  2OA5 A;  5AQO B;  1MIW A;  3PU3 A;  3ZYL A;  4AKL A;  3E22 E;  4JI8 T;  3IA3 A;  1UCU A;  3H37 A;  4NUV A;  2ZM8 A;  3QB5 A;  4DR6 T;  2LM9 A;  2W2U A;  3OYX A;  5L4E A;  4PK5 A;  3AEA A;  5ABG A;  3ZMU B;  3UUX B;  2DWK A;  4C90 A;  2E9X A;  4L5G A;  4JBW F;  2F4V T;  1HFA A;  2G0U A;  2MAW A;  1V9D A;  3PDY A;  4B6X A;  1S35 A;  1OED A;  1WR6 A;  2DLR A;  2CEA A;  2J1D G;  2QGS A;  1WCR A;  3KV9 A;  2XAF B;  3ZJ1 A;  3T1H T;  3IF8 B;  3ZCI A;  2V6Y B;  3UQ7 A;  3RI5 A;  2XSB A;  3AEG A;  3OBV E;  4TNW A;  2IW5 B;  3AVS A;  2MTQ A;  2ZM0 A;  3MZK B;  3N9M A;  3RKG A;  3U78 A;  5HXS A;  3ANW B;  3P4R A;  4IL4 A;  3AVR A;  1LVK A;  1BR1 A;  1O3X A;  4PK6 A;  1MNE A;  5J2T E;  4H63 V;  4DR3 T;  4QH1 A;  3NZQ A;  2UUB T;  4YTN A;  2VK9 A;  1GQE A;  5LHI B;  2LOS A;  2XUE A;  1T7S A;  1KEY A;  5LJN A;  4XBF B;  3FZL B;  2W00 A;  1T72 A;  3SRZ A;  2PG8 A;  2L3L A;  2WU5 A;  2QVA A;  3LDQ B;  3RKO A;  3HI2 A;  3I0O A;  1Z8U A;  4XZC A;  5L4H A;  4CXX A;  5GON E;  2XTL A;  3CX6 B;  3AED A;  3KV6 A;  2XAH B;  2BVM A;  1QUU A;  3I9W A;  4ASK A;  1JNR A;  3UU3 A;  4KHP T;  1NEN A;  2NTY A;  4U2Z A;  3I0Q A;  4YFS A;  5FVL A;  1XMO T;  2X9X A;  2EHO A;  2H3R A;  3Q9D A;  4KMC A;  2VL8 A;  4UF0 A;  1NEK A;  4HFH A;  4QX7 B;  2ZMA A;  2D9D A;  3AA1 B;  4KUM B;  2H88 A;  4H9P C;  4JEH B;  4CZZ B;  1N32 T;  2W66 A;  5H6R B;  3UUM A;  1HNW T;  4YTM A;  5LHH B;  4DV2 T;  3PUR A;  3PUY F;  2WMO A;  2Q9Q C;  4QKN A;  4QXC B;  2KND A;  3VU7 H;  5J0Z A;  2WZH A;  3OTO T;  4AQF A;  5AQP B;  3AEB A;  2MPK A;  2VKO A;  4HGA A;  3SOL A;  3RQW A;  1UUR A;  2PBI A;  2LSY A;  2ACZ A;  2Q9Q D;  3AB3 B;  5F3J A;  1KF6 A;  3VRB A;  5AQM B;  1ZHC A;  4TZ4 C;  4UVA B;  4Z90 A;  5J2U E;  3EDU A;  3RC8 A;  3C4Z A;  5FL0 A;  2V7M A;  1G8X A;  1XZY A;  3O4X E;  4BA9 A;  2CMR A;  3M3Z B;  3NKZ A;  3OPC A;  3J9X 1;  4KI0 F;  5JR9 C;  3I1A A;  1XMQ T;  4PJM A;  4UR9 A;  5LG3 A;  3E08 A;  4B3T T;  4ZOL E;  2XY8 B;  1R8I A;  2QYW A;  3KV4 A;  3JCF A;  5FY7 A;  2KIN B;  4U33 A;  3QB5 K;  3FZM B;  1X79 A;  3HKD E;  1U4Q A;  1XNQ T;  4K0K T;  2WZI A;  4H9N C;  5AQU B;  5BR8 T;  4CQI A;  1BR0 A;  2BG9 B;  2XQ3 A;  2LJL A;  4LMJ A;  4OHF A;  1FMW A;  5AQH B;  2XQ5 A;  2BKO A;  2BBH A;  3F57 A;  3R84 B;  3UT5 E;  4U7Y A;  5HCJ A;  5JQG E;  4TN7 B;  3DJB A;  1XDP A;  4WBO A;  4IE6 A;  2NR4 A;  3I9Y A;  3AE9 A;  4FJO A;  4DND A;  4MHC A;  3F31 A;  1HS7 A;  3A7M A;  3HKB E;  3LK4 2;  4JLE A;  2Q9Q A;  2WDQ A;  2WM9 A;  2V7I A;  2YEV C;  4IHJ E;  3AEC A;  3ZC0 A;  3KVA A;  4I0U A;  4LFC T;  3RH3 A;  1D0X A;  4OYK A;  2VKD A;  2JQH A;  4OX9 T;  3MXZ A;  2HH7 A;  5AQJ B;  1E1H B;  2E9X B;  2PTF A;  3AAE B;  3F2E A;  3H3M A;  5F8P A;  4ZEY A;  2XQ9 A;  1VRB A;  4AI6 A;  4UV8 B;  3RYC E;  3PE0 A;  1OWA A;  2D0T A;  5A1L A;  4IE4 A;  2BG9 E;  3UUN A;  4WBN E;  4DV3 T;  1UX5 A;  5ABE A;  3ZT5 A;  1N33 T;  3VKH A;  1XDO A;  3K1S A;  3V5U A;  4ZI2 D;  2CXL A;  2MYS A;  4ZS2 A;  3ZPO A;  5HWX A;  2V5C A;  3X1D A;  3ZMS B;  2ACX A;  4CI3 B;  3O9X A;  3PUS A;  1SE7 A;  5AFU L;  2LKH A;  1G73 A;  3CIR A;  3RLF F;  1HF8 A;  3V5S A;  3ZN1 B;  3MKD A;  2OV9 A;  3PUV F;  4YTP A;  4ZHQ E;  4QWN B;  2N1G A;  3LFM A;  4B3S T;  4HFC A;  2R6G F;  4ZI7 E;  4AKR B;  4HFE A;  2W4X A;  2XQA A;  4OK0 A;  2YDR A;  4QXB B;  3UUL A;  1H7C A;  5L3D B;  2BZB A;  2X9Y A;  3IBP A;  4GOU A;  4LF9 T;  2SPC A;  2WAU A;  2YOE A;  4HFI A;  4HTE A;  5EZY E;  4P0A A;  3AE1 A;  2XQ4 A;  5AQN B;  2M6I A;  3RC3 A;  3CKD A;  5HYA A;  2X0H A;  3AAI A;  3GWH A;  4ZI3 C;  3ZMT B;  2LSI A;  3AE4 A;  2E9X D;  5FY0 A;  4JI5 T;  2A9U A;  2IC6 A;  2WS3 A;  1IBM T;  2N9D A;  3LJC A;  4H9O C;  1W0A A;  2CLY C;  1WRD A;  2VAS A;  4ZZB A;  1VCS A;  5HXE A;  3EDV A;  1W9R A;  2WP9 A;  2VKJ A;  3AE6 A;  2RA1 A;  4IE0 A;  4IT4 A;  2ODU A;  1IBL T;  1YXR A;  1VCT A;  2ZLY A;  3PUQ A;  4H9R C;  2I59 A;  4TUY E;  4HE8 A;  3VR8 A;  1MMN A;  1YQ4 A;  4KP3 C;  4JI2 T;  4DR2 T;  3RIU C;  3K3Q C;  3LK3 B;  4I43 B;  4UEL A;  4GIW A;  1MIY A;  1KFY A;  2NOX A;  2WY2 A;  2I0M A;  3FZH B;  2OLT A;  3MAC A;  4AQF C;  4DV6 T;  3GMI A;  3HKE E;  4A97 A;  5ETW A;  5HWY A;  4EIW A;  4F6R C;  1N36 T;  5LB7 B;  2Q9Q B;  2CA5 A;  3WAJ A;  2CHN A;  2HN2 A;  3NVO A;  4J2C A;  1HX8 A;  5DJQ C;  4IGU A;  4PFP A;  3ZN0 B;  3CK6 A;  5L3G B;  2JPF A;  2E9X C;  1XWM A;  2VKH A;  3PU8 A;  5ADX L;  3AAA B;  1BR2 A;  1KNR A;  4PW8 A;  4AIS A;  1HTJ F;  3C64 A;  2L9Q A;  3AE2 A;  3BQL A;  2V5D A;  2WCA A;  4U2Y A;  2CWO A;  5F5W A;  4YXD A;  1UUS A;  3HL6 A;  4IDP A;  5TAO A;  3UQ4 A;  2WSS V;  3PUZ F;  3IHR A;  4P0B A;  2LLY A;  3C4W A;  3AE7 A;  5FYM A;  5EK2 A;  1JNZ A;  4M1P A;  1LVF A;  4HWH A;  2XAJ B;  3QOF A;  4Z91 A;  4DR1 T;  2BVL A;  4IIJ E;  3JC6 D;  2RPA A;  2NW8 A;  4ILB A;  1D1C A;  2E2A A;  2KT9 A;  3BQK A;  2LHR A;  1MIV A;  3ETU A;  4QH5 A;  4UVB B;  4X65 T;  2CBJ A;  2UU9 T;  4IE5 A;  2A3D A;  4PFO A;  2LOP A;  2FJA A;  3UTK A;  2LE8 A;  2BG9 C;  4GK5 E;  3UU5 A;  2WBL A;  2YDQ A;  3FXE B;  3CX8 B;  2H89 A;  3LSV A;  4P1N A;  4DO0 A;  1J5E T;  2NTX A;  5AQR B;  3ZKR A;  1WLX A;  4I4T E;  3CPZ A;  2A2F X;  5JVD E;  1W09 A;  2KZ7 B;  1HG2 A;  1NAF A;  3CQC B;  4X64 T;  4DR4 T;  3ANW A;  3O1I A;  2LRL A;  5LGU B;  1WYC A;  5DQW A;  2FJD A;  1OED E;  3K3N A;  3SFD A;  3SS1 A;  3RX6 A;  3KV5 A;  4HWD A;  5FNV E;  3HR0 A;  4IST A;  2H7O A;  1KNP A;  1YD8 G;  3JC6 C;  5EK3 A;  3K3O A;  3ZMV B;  3N9N A;  4EZ4 A;  3L39 A;  2IAK A;  4L9I A;  5JDH A;  5JDM A;  5EK4 A;  2V6X A;  4ILC A;  4XAX B;  2I6H A;  2NWB A;  3OYZ A;  4I50 E;  1WR0 A;  4ISS A;  5HEJ A;  4ILU A;  4AXP A;  5LBQ B;  3PJA A;  4PJJ A;  4N78 D;  4QXH B;  2DNX A;  3NBX X;  3QUJ A;  2DHR A;  3AXJ B;  5LP6 E;  1HG5 A;  4MAL A;  4X5T A;  5JR9 A;  2FBW A;  4YHJ A;  3LBX B;  5HEH A;  4P09 A;  3ONX A;  5HXH A;  4CXY A;  2UXX B;  5AQI B;  2IUB A;  4LF7 T;  4JYA T;  2DCF A;  3LK2 B;  2JRK A;  2L8K A;  2Z6E A;  3HA4 A;  3OKQ A;  1D0Z A;  4WZX A;  4GKJ T;  4F8H A;  3FZK B;  3CWZ B;  4ZZC A;  2KMF A;  4E7S A;  5L3E B;  4LF4 T;  3PJA J;  2BS4 A;  4JUY A;  5CA1 E;  2W67 A;  1OED C;  2C5I T; 
#chains in the Genus database with same CATH homology
 2V8S V;  2QYW A;  1VCS A;  3ONJ A;  3ONL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...