3ONLC

Yeast ent3_enth-vti1p_habc complex structure
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
95
structure length
95
Chain Sequence
b'SLLISYESDFKTTLEQAKASLAEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVEVNNSIGDASERATYKAKLREWKKTIQSDIKRPLQSLVDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epsin-3
publication title Epsin N-terminal homology domains bind on opposite sides of two SNAREs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 41
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2010-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05008 V-SNARE Vesicle transport v-SNARE protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 3onlC00
2V8SV 3ONJA 2QYWA 1VCSA 3ONLC
chains in the Genus database with same CATH superfamily
4UF0A 2PG8A 3Q5EA 4TUYE 2HN1A 3OYXA 1G73A 4EZHA 4O2AE 4H63V 3ZMTB 3MA9A 3JADA 3SFEA 4LF9T 4X66T 1ZKEA 3IEEA 3HKBE 1BR4A 2VWAA 1MMDA 2J47A 2V7IA 4I50E 4GKJT 3ZMUB 3UULA 2A3DA 3KVBA 3ZCIA 4JYAT 2EHOB 3MXZA 2WDRA 3PUWF 4OK0A 3UFGA 2JMHA 3VKGA 2KSRA 3UUXB 3PUAA 4OYJA 3CPZA 4ADZA 1QUUA 4GYRA 4PK6A 2J62A 1EZ3A 4L9IA 5JDGA 3RF1A 5IYZE 2K3WA 3ZYLA 2V6YB 3AB3B 4X1YE 4X64T 5HXHA 2Q9QC 3RI5A 3G06A 3NZQA 5JR9B 3ANWB 2LOSA 3LDQB 4HKAA 3SFDA 1WLXA 4HGAA 2ACXA 5LYJE 4AQYT 4TZ4C 3PJAA 4GKKT 4K0UA 3AA0B 2ZM6T 3CX7B 1IBKT 2XQ8A 2BBHA 3NBXX 1WR6A 2VQET 3N9LA 4IL9A 2MOZA 3ZPOA 3IHRA 3AEGA 1HF8A 2X9WA 2LHRA 2UXBT 5LG3A 2G0UA 2I59A 2XAQB 5AQGB 3ONXA 2X9YA 2LM9A 3EUHA 5F8PA 4KHPT 3EABA 4YSYA 4ILBA 3LK42 3OVUA 3CVRA 4JI2T 3ONJA 4DO0A 2W4XA 1VCTA 3L8RA 1MIVA 4CI3B 2XQYA 5LHGB 4MLKA 3JC6C 3EI0A 1UX5A 3P4QA 3ZJ2A 1UURA 3I1AA 2HH7A 3OYZA 2QYWA 2RP4A 2NW9A 3N2OA 1WYCA 2VURA 3PDYA 4EZ4A 2VL8A 1HG2A 4KUMB 3F31A 4XBFB 2K9AA 1CHUA 1ZHCA 3C4XA 3UUNA 1MNEA 4PNIA 2BG9A 3CX6B 2E9XA 5DQWA 4EEBA 4EGWA 2NTYA 4DIDB 3C50A 5ABFB 5FVLA 5JDFA 3GMIA 4C91A 5KXJA 3QC9A 3EDUA 3O1HA 4DV5T 2UUBT 2V8SV 5LHIB 3H3AA 4CXWA 2VKHA 3F2EA 3AE9A 4X1KE 4KHZF 2VKOA 1XMOT 3BQKA 3QUJA 2W63A 2JRKA 1OEDB 2WDVA 3RIAA 5AQTB 1J5WA 4H9RC 2J4GA 4I0UA 4XZCA 4O4IE 3RIFA 4YJ2E 3KFWX 3AAIA 4IE5A 1KK7A 3RKGA 5JRCB 1OEDE 2DI4A 4AXPA 1HTJF 5FXZA 5AQSB 2N1GA 1I6ZA 2YKSA 3EDVA 4BJNA 2BBJA 5C8YE 4J2CA 1LRZA 2CHNA 3ZEFB 1MIWA 2J1DG 3P4PA 5AQRB 1NENA 1T8BA 3AEAA 3UT5E 5AFUL 4P1NA 3UU3A 2VASA 5JQGE 5L47A 3RYHE 3OBVE 2XSAA 2KINB 3P50A 2W2UA 4HTEA 2X0HA 4CI1B 3K8PC 1WR0A 5AQIB 3LK3B 3FB2A 3V5SA 4DV2T 4QX8B 2H89A 2UU9T 1W0BA 2UXXB 2YN6A 1KNPA 2CWYA 4HWCA 3ZMSB 2XSBA 3RLFF 1W09A 3P7IA 5C2TA 2SPCA 2X51A 1JNZA 4H9SE 3SOLA 4HEAA 4DR4T 2CBIA 4TV9E 3IF8B 4OHFA 2QRXA 1NAFA 3OJAA 2BVLA 3EAMA 4LF4T 3FHNA 5CB4E 2FBWA 4UR9A 1KNRA 5H6QB 2V26A 4UF0B 1YKHB 5TAOA 5ABHA 5C3JA 4U74A 1JNRA 1QSDA 5FXXA 3ZC0A 1IAPA 2UXCT 3FBLA 4PJLA 3D0TA 2XTLA 3ZC1A 4UV8B 5AQVB 4YSXA 1MMNA 3Q5XA 4I55E 5F3JA 1NEKA 3M65A 5HXEA 4A97A 4JI7T 4JEUB 2LKHA 4GK0E 4YJ3E 3SS1A 1ZV4X 3B13A 5BR8T 3KBTA 3CK6A 2ES0A 2DWKA 3DJBA 5LG4A 4PFPA 2XQ4A 4HE8A 2Q9QA 2JQ9A 4QH4A 4AKRB 3R6NA 4H9OC 2BS3A 4LFAT 3PU8A 4ISTA 5LBQB 3AEBA 2UUCT 5LA6E 4JUYA 2I6HA 4DR5T 2WWVA 3N9NA 1W9RA 4Q25A 3ESLA 3ZLIA 4B3TT 1D1CA 3I0OA 1YD8G 3PU3A 4MBQA 3QOFA 3TLSA 4IGUA 4O4HE 3UUMA 4U72A 3NKZA 4EXTA 1IJ5A 3P4RA 3UQ4A 4HFBA 4NUVA 4ZZBA 3TLUA 2MYSA 4GIWA 2JQKA 1CUNA 2LLYA 2AXDS 3ZN0B 4WBOA 2UXNB 2L9QA 2KWHA 5FKYA 2YDQA 4BA9A 4DNDA 5KMGP 3CQXC 2XQ3A 2CRBA 2V1DB 4KBMB 4QXBB 1NWMX 5CFBA 4HWHA 3VRBA 2BKPA 4YLHA 3E22E 3PTRB 2LJLA 5LMUT 5EK2A 2LKGA 4ZZCA 4NUUA 3UTKA 4IHJE 1B7TA 3AEDA 2Y48B 3FBZA 2LSJA 1YXRA 1I94T 2X9HA 2NW8A 2K5BB 1IZNB 2IC6A 5L3BB 4LF8T 4OX9T 2H7OA 2M6IA 2H88A 5LMNT 4M1PA 3QB5A 4QH5A 2PFVA 3PE0A 5IHYA 1L0VA 4IE7A 4GYSA 4AKLA 2VVSA 2BG9B 4YXDA 2E9XB 2RPAA 5AQUB 2B76A 4YTMA 4TX5A 4P0BA 3RYIE 2X68A 3CIRA 3RGLA 2FJBA 4G2AA 5FMNA 3U78A 4TWHA 2BG9E 4U3CA 4CQIA 4EV6A 2EHOD 2VQFT 4UELA 2WY2A 1HX1B 1WYBA 2BVMA 3AECA 2MBGA 2X66A 5FL1A 5LGTB 3R84B 3PUXF 4QX7B 2JPFA 2VK9A 5JREA 3P4WA 3KVAA 4HWFA 2RA1A 2W61A 2ZMAA 2NTXA 4QWNB 4WW0A 4KI0F 3A5XA 3H37A 4G63A 1XDPA 4ANJA 2BDEA 2WWUA 5L3GB 1V9DA 4NXNT 3AA7B 5IUXA 4OYKA 4L0RA 1XZYA 1VOMA 4LMJA 3B5MA 3T1HT 4DVDA 5LOVE 4FJOA 2LRLA 4DBQA 2VKJA 5AQKB 3MJXA 3ZT6A 3AAEB 3N9QA 4AKGA 3LBXA 4ZI3C 2IHR1 2IC9A 2PTFA 4IDZA 3PUYF 2XQ9A 3PJAJ 2IIUA 4PW8A 2K24A 4IE6A 2V7MA 4ZHQE 2DL1A 4IE4A 2XHEB 3X1DA 3C51A 4Z90A 5L3CB 4LF6T 3K3QC 2D0UA 2XASB 3MKDA 2KZ7B 3CMLA 4BAYB 3AE1A 3PV0F 1WCRA 2JJ9A 2XQ5A 4IDPA 3V5UA 1N36T 4K0KT 2XAGB 5LJMA 5LCYA 2ZM0A 3RC3A 2PBIA 1J1JA 4JBWF 2YU1A 3NRYA 4NXMT 2NP9A 2DLRA 3ZSSA 4B6XA 2WDQA 3ZMVB 4DUYT 4H9PC 3I9YA 1ZEEA 4YSZA 4JEHB 3ZN1B 2IW5B 3RRCA 5LJNA 4YT0A 1N32T 2V5CA 2WSSV 3N9OA 4QXCB 3RIUC 5L4HA 4U7YA 3RYCE 2ODVA 3C98B 3AE8A 3AAAB 2V6YA 2WBLA 4HWDA 4Z91A 3U3IA 2HPJA 3NRXA 1FJGT 1X9BA 2WP9A 4GK5E 4IDOA 3FZHB 4F8HA 4ILCA 5HEGA 5HXRA 3HA4A 3AE5A 4U2YA 4EB6E 2M67A 5KX5E 2L8KA 3EVYA 1FMWA 5J0ZA 1HNWT 3VR8A 2P9BA 2WCAA 1BR0A 3N5LA 1HFAA 2MTQA 1UGOA 2CXLA 2Q9QB 3ZJ1A 4AKHA 5CJ5A 4AQFC 4COFA 4H9NC 4U7IA 4HFDA 3JAFA 4NPPA 2WQYA 4AIUA 4EYYR 4DR7T 4PK4A 1VRBA 4A98A 2CCQA 2NOXA 4TWDA 3FZFB 4YHHT 2XM2A 1KEYA 3DTOA 2KMFA 4KMCA 2HHHT 4LMLA 1KF6A 3N9PA 5EZYE 3KV9A 1N33T 4QH1A 1D1AA 3ZYKA 5HEOA 2IDOB 2CXFA 2LSIA 2DNXA 3VRAA 5E0OA 3BK9A 3QK6A 2KWIB 5HXSA 4JI3T 4EYUA 5AQLB 3O9XA 4KP3C 1SUMB 4HN9A 3RKOA 4BJMA 4LFCT 1BR2A 3T8OA 1FIOA 3K3OA 4UVBB 1N34T 1MIYA 5BMVE 2QA7A 3AXJA 3UQ7A 4AKIA 3L3PA 2BZBA 4ZI3D 2YDRA 3TKLB 1UK5A 2EHOC 5JDLA 2B1EA 4DMWA 2MAWA 2VL0A 2W67A 5J2UE 5HAXA 3GN5A 4JV5T 4EOZB 2JQQA 4LMKA 3VKHA 2E9XC 3HKCE 4ILAA 2CA5A 3JCFA 2Y8DA 4GOUA 5LHHB 1D1BA 4EEDA 2LM2A 1LVFA 1D0ZA 1G8XA 2IUBA 4QKNA 4CN1A 4V1Av 5HEJA 2LHNA 4CI2B 2XY8B 3K3NA 2XAFB 4JI8T 1U5PA 5JR9C 3LK2B 3TLVA 3K1SA 3PUSA 2D0TA 4DV1T 2CXDA 2CWOA 2H7VC 3QB5K 2YINA 1XNQT 2XPKA 4KX6A 5AQFB 3PUGA 4B3MT 1XMQT 2VKDA 2IAKA 2JIWA 2A9UA 4I4TE 4ZOLE 2ZLYA 5DQVA 2AE9A 3ABVA 3PUVF 2WB5A 2NWBA 1HNZT 2XM1A 1LKXA 3UU4A 1U4QA 1XDOA 1HS7A 3WI3A 2M6BA 3NZPA 4JLEA 5FXWA 1BR1A 4CN6A 2KT9A 4QXHB 2LRKA 3O1IA 5LB7B 3KV5A 3P4SA 1MMAA 3QNUA 3GA8A 3OPCA 1WRDA 4TN7B 3RRWA 3E0ZA 4ZI7E 2A72A 4XAXB 4H63H 2ODUA 3HI2A 4IREA 4E7SA 5FVKA 3RHWA 2WAUA 4O4LE 4PJNA 2XAHB 2WS3A 4UVCB 5JVDE 2VVNA 3ZCJA 5CA0E 3VHLA 2FJAA 3LBXB 4DV6T 4O8SA 1T72A 1OXZA 5FYMA 4DV7T 1SHZC 2FJDA 3SRZA 2E2AA 1Y64B 5LXTE 4ZEYA 4JI5T 1OWAA 5FP3A 1KFYA 1D0YA 2LE8A 3UUBA 1VCSA 4HFHA 2CHOA 3FZKB 3TLTA 1D0XA 4NIQA 5DABA 3ZMZB 4IDNA 3EHZA 4ZI2D 3CWZB 5AQOB 1E1HB 5FL0A 2UXDT 1FEWA 4PJJA 5JDNA 3LG7A 3L09A 4TNVA 2NR4A 3OKQA 1MNDA 4LF5T 4N78D 2F4VT 3AVSA 3A7MA 3UU8A 2XJ7A 3UFEA 2CBJA 4ERRA 2YK0A 3RIUA 1OEDC 3GWHA 1Z0PA 5L3DB 4X20E 3L39A 1HNXT 4JI4T 3SWHA 5L3EB 3OTOT 2E5VA 3MZKB 2V6XA 2XQAA 1IBMT 5FXVA 2A2FX 4C90A 2NW7A 4IDQA 1GQEA 3CQCB 3Q5WA 5GONE 3AE3A 2XUEA 4F6RC 2E9XD 2V7JA 4AQGA 1US7B 5ABGA 3N2GE 2ZM2A 2YEVC 2YDSA 3C64A 1SE7A 1MMGA 2CPTA 1YQ3A 3RPUA 1HX8A 4AQFA 3KDSE 2D5UA 3H3MA 3AEEA 1ZOYA 3CKDA 2LSKA 5AQPB 2OV9A 2Y6XA 4PJMA 5FY7A 2OA5A 4ISSA 2X67A 5LBMA 4PAGA 1UX4A 5L4EA 3ETUA 1FMVA 4WNKA 5ADXL 4IE0A 2N2NA 4IT4A 5KDMC 2C5IT 1DU2A 3RYFE 2R6GF 2X9XA 1HCIA 2CLYB 4U31A 4HFCA 2E8IA 1S35A 4O4JE 3NVOA 4WBNE 2D2SA 3F57A 1XNRT 4UXNB 3RX6A 1IJ6A 4UVAB 1H7CA 2W00A 4TNWA 2X0LB 2BKOA 3O1JA 4DBRA 4X62T 4UEMA 4B3ST 3AE4A 5EK3A 4DR6T 4DV4T 5CGMA 4ZS3A 5JDQA 4DR2T 3LJCA 3IBPA 3ONLC 2EHOA 4A5XA 2WZHA 2V7KA 3NWIA 2HN2A 3J7Yq 3AE2A 4YFSA 2YU2A 4CZZB 5FY1A 5JDMA 4QHOA 3AA6B 1ZP0A 3AXJB 4TWFA 4WZXA 3MACA 1E2AA 1SA0E 2JMKA 5HEUA 3ZT7A 4DV3T 2Z6EA 4FI5A 4U2ZA 3KV4A 3MK7C 2N9DA 3WAKA 3LSVA 3GN5B 2C5JA 5JR9A 3ANWA 2QGSA 4DUZT 3HR0A 4X5TA 2UUAT 3W15B 4JI0T 1XWMA 2LOPA 4ILUA 2W0GA 2ZM8A 4JI1T 5HEHA 3TLWA 4ASKA 3ZT5A 4UIGA 2CMRA 1IBLT 3CQGB 5JTGA 5JH7E 1YQ4A 4MFRA 2LT3A 1X79A 2LEHA 4H9QC 3JAEA 2IMLA 4IIJE 1AJ3A 5LGUB 3ETVA 5JDHA 3T1YT 5FNVE 3M3ZB 2KXPB 3J9X1 3RQUA 2V7LA 5H6RB 5ABEA 3Q2MA 3UU5A 3CX8B 2CEAA 3C4ZA 1M7KA 2YOEA 3AA1B 3VU7H 2H3RA 2Q9QD 5LP6E 3A8YC 4UV9B 4ZI2C 1M62A 5AQHB 2DCFA 2QVAA 2WU5A 5HXCA 5L2LA 4EAHA 1HG5A 4I43B 4HWIB 4AI6A 1UUSA 3N9MA 3AE6A 2CM0A 3N2KE 5LNKA 3AEFA 4CN4A 5AQJB 4Z8XA 2K48A 2KLQA 3I9WA 4OFZA 5AQNB 1J5ET 5M4YA 1YKEB 3HKDE 3PUQA 3RH3A 1WFDA 1HR0T 2V5DA 5HCMA 1S94A 2XQ7A 3VR9A 3Q5DA 2KNDA 4MALA 4O2BE 2XZEA 4DMVA 4B3RT 2WMOA 3B57A 4IL4A 2BS2A 2D9DA 5LGNB 3C4WA 3LFMA 5ABFA 1LVKA 5AQMB 4PK5A 5EK4A 4PFOA 2C0SA 2DHRA 2CE7A 5HWYA 2WU2A 1Z8UA 2W66A 2BG9C 3O4XE 1T98A 4ZXLA 3AVRA 2W62A 2C5KT 3HL6A 4L5GA 5DJQC 2LSYA 3WAJA 1R8IA 5J2TE 5FY0A 2WMNA 5CA1E 5HYAA 1OEDA 3E08A 3ZKRA 5HWXA 4X1IE 3JC6D 4YHJA 5IWAT 4LF7T 2BS4A 3KINB 3FZLB 4E7ZA 2X0YA 1E7PA 2WM9A 3IA3A 5JRCA 3I0QA 4WYVA 3KBUA 3P8CD 4HFVA 2E5LT 3BQLA 5ETWA 4DR1T 3FXEB 2FUPA 4JI6T 4X65T 4DR3T 2JQHA 4HFEA 3Q9DA 4AISA 3KV6A 3FXDB 4YTNA 2GK9A 5J1GA 4P09A 4TV8E 4U33A 3ZSTA 2BKNA 3FZMB 3DP7A 4DV0T 4P0AA 2XQ6A 2LSGA 5HCJA 2ACZA 5AQQB 3RC8A 1UCUA 4LFBT 3ZYMA 5L3FB 1O3XA 1T7SA 4YY3T 1KNZA 4EIWA 1QLBA 4CXXA 2DWGA 5F5WA 4A56A 3BQIA 4ZS2A 2HPLA 5A1LA 2CLYC 4HFIA 2XAJB 4CXYA 3PURA 2WZIA 4YTPA 2FJEA 3HKEE 2VB6A 3RQWA 4MHCA 3PUZF 1Y01A 3S4UA 2PJQA 2L3LA 2OLTA 1W0AA 3UU6A 1YW0A 2MPKA 3AE7A 2I0MA
chains in the Genus database with same CATH topology
2V8SV 3ONJA 2QYWA 1VCSA 3ONLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8S V;  3ONJ A;  2QYW A;  1VCS A;  3ONL C; 
#chains in the Genus database with same CATH topology
 4UF0 A;  2PG8 A;  3Q5E A;  4TUY E;  2HN1 A;  3OYX A;  1G73 A;  4EZH A;  4O2A E;  4H63 V;  3ZMT B;  3MA9 A;  3JAD A;  3SFE A;  4LF9 T;  4X66 T;  1ZKE A;  3IEE A;  3HKB E;  1BR4 A;  2VWA A;  1MMD A;  2J47 A;  2V7I A;  4I50 E;  4GKJ T;  3ZMU B;  3UUL A;  2A3D A;  3KVB A;  3ZCI A;  4JYA T;  2EHO B;  3MXZ A;  2WDR A;  3PUW F;  4OK0 A;  3UFG A;  2JMH A;  3VKG A;  2KSR A;  3UUX B;  3PUA A;  4OYJ A;  3CPZ A;  4ADZ A;  1QUU A;  4GYR A;  4PK6 A;  2J62 A;  1EZ3 A;  4L9I A;  5JDG A;  3RF1 A;  5IYZ E;  2K3W A;  3ZYL A;  2V6Y B;  3AB3 B;  4X1Y E;  4X64 T;  5HXH A;  2Q9Q C;  3RI5 A;  3G06 A;  3NZQ A;  5JR9 B;  3ANW B;  2LOS A;  3LDQ B;  4HKA A;  3SFD A;  1WLX A;  4HGA A;  2ACX A;  5LYJ E;  4AQY T;  4TZ4 C;  3PJA A;  4GKK T;  4K0U A;  3AA0 B;  2ZM6 T;  3CX7 B;  1IBK T;  2XQ8 A;  2BBH A;  3NBX X;  1WR6 A;  2VQE T;  3N9L A;  4IL9 A;  2MOZ A;  3ZPO A;  3IHR A;  3AEG A;  1HF8 A;  2X9W A;  2LHR A;  2UXB T;  5LG3 A;  2G0U A;  2I59 A;  2XAQ B;  5AQG B;  3ONX A;  2X9Y A;  2LM9 A;  3EUH A;  5F8P A;  4KHP T;  3EAB A;  4YSY A;  4ILB A;  3LK4 2;  3OVU A;  3CVR A;  4JI2 T;  3ONJ A;  4DO0 A;  2W4X A;  1VCT A;  3L8R A;  1MIV A;  4CI3 B;  2XQY A;  5LHG B;  4MLK A;  3JC6 C;  3EI0 A;  1UX5 A;  3P4Q A;  3ZJ2 A;  1UUR A;  3I1A A;  2HH7 A;  3OYZ A;  2QYW A;  2RP4 A;  2NW9 A;  3N2O A;  1WYC A;  2VUR A;  3PDY A;  4EZ4 A;  2VL8 A;  1HG2 A;  4KUM B;  3F31 A;  4XBF B;  2K9A A;  1CHU A;  1ZHC A;  3C4X A;  3UUN A;  1MNE A;  4PNI A;  2BG9 A;  3CX6 B;  2E9X A;  5DQW A;  4EEB A;  4EGW A;  2NTY A;  4DID B;  3C50 A;  5ABF B;  5FVL A;  5JDF A;  3GMI A;  4C91 A;  5KXJ A;  3QC9 A;  3EDU A;  3O1H A;  4DV5 T;  2UUB T;  2V8S V;  5LHI B;  3H3A A;  4CXW A;  2VKH A;  3F2E A;  3AE9 A;  4X1K E;  4KHZ F;  2VKO A;  1XMO T;  3BQK A;  3QUJ A;  2W63 A;  2JRK A;  1OED B;  2WDV A;  3RIA A;  5AQT B;  1J5W A;  4H9R C;  2J4G A;  4I0U A;  4XZC A;  4O4I E;  3RIF A;  4YJ2 E;  3KFW X;  3AAI A;  4IE5 A;  1KK7 A;  3RKG A;  5JRC B;  1OED E;  2DI4 A;  4AXP A;  1HTJ F;  5FXZ A;  5AQS B;  2N1G A;  1I6Z A;  2YKS A;  3EDV A;  4BJN A;  2BBJ A;  5C8Y E;  4J2C A;  1LRZ A;  2CHN A;  3ZEF B;  1MIW A;  2J1D G;  3P4P A;  5AQR B;  1NEN A;  1T8B A;  3AEA A;  3UT5 E;  5AFU L;  4P1N A;  3UU3 A;  2VAS A;  5JQG E;  5L47 A;  3RYH E;  3OBV E;  2XSA A;  2KIN B;  3P50 A;  2W2U A;  4HTE A;  2X0H A;  4CI1 B;  3K8P C;  1WR0 A;  5AQI B;  3LK3 B;  3FB2 A;  3V5S A;  4DV2 T;  4QX8 B;  2H89 A;  2UU9 T;  1W0B A;  2UXX B;  2YN6 A;  1KNP A;  2CWY A;  4HWC A;  3ZMS B;  2XSB A;  3RLF F;  1W09 A;  3P7I A;  5C2T A;  2SPC A;  2X51 A;  1JNZ A;  4H9S E;  3SOL A;  4HEA A;  4DR4 T;  2CBI A;  4TV9 E;  3IF8 B;  4OHF A;  2QRX A;  1NAF A;  3OJA A;  2BVL A;  3EAM A;  4LF4 T;  3FHN A;  5CB4 E;  2FBW A;  4UR9 A;  1KNR A;  5H6Q B;  2V26 A;  4UF0 B;  1YKH B;  5TAO A;  5ABH A;  5C3J A;  4U74 A;  1JNR A;  1QSD A;  5FXX A;  3ZC0 A;  1IAP A;  2UXC T;  3FBL A;  4PJL A;  3D0T A;  2XTL A;  3ZC1 A;  4UV8 B;  5AQV B;  4YSX A;  1MMN A;  3Q5X A;  4I55 E;  5F3J A;  1NEK A;  3M65 A;  5HXE A;  4A97 A;  4JI7 T;  4JEU B;  2LKH A;  4GK0 E;  4YJ3 E;  3SS1 A;  1ZV4 X;  3B13 A;  5BR8 T;  3KBT A;  3CK6 A;  2ES0 A;  2DWK A;  3DJB A;  5LG4 A;  4PFP A;  2XQ4 A;  4HE8 A;  2Q9Q A;  2JQ9 A;  4QH4 A;  4AKR B;  3R6N A;  4H9O C;  2BS3 A;  4LFA T;  3PU8 A;  4IST A;  5LBQ B;  3AEB A;  2UUC T;  5LA6 E;  4JUY A;  2I6H A;  4DR5 T;  2WWV A;  3N9N A;  1W9R A;  4Q25 A;  3ESL A;  3ZLI A;  4B3T T;  1D1C A;  3I0O A;  1YD8 G;  3PU3 A;  4MBQ A;  3QOF A;  3TLS A;  4IGU A;  4O4H E;  3UUM A;  4U72 A;  3NKZ A;  4EXT A;  1IJ5 A;  3P4R A;  3UQ4 A;  4HFB A;  4NUV A;  4ZZB A;  3TLU A;  2MYS A;  4GIW A;  2JQK A;  1CUN A;  2LLY A;  2AXD S;  3ZN0 B;  4WBO A;  2UXN B;  2L9Q A;  2KWH A;  5FKY A;  2YDQ A;  4BA9 A;  4DND A;  5KMG P;  3CQX C;  2XQ3 A;  2CRB A;  2V1D B;  4KBM B;  4QXB B;  1NWM X;  5CFB A;  4HWH A;  3VRB A;  2BKP A;  4YLH A;  3E22 E;  3PTR B;  2LJL A;  5LMU T;  5EK2 A;  2LKG A;  4ZZC A;  4NUU A;  3UTK A;  4IHJ E;  1B7T A;  3AED A;  2Y48 B;  3FBZ A;  2LSJ A;  1YXR A;  1I94 T;  2X9H A;  2NW8 A;  2K5B B;  1IZN B;  2IC6 A;  5L3B B;  4LF8 T;  4OX9 T;  2H7O A;  2M6I A;  2H88 A;  5LMN T;  4M1P A;  3QB5 A;  4QH5 A;  2PFV A;  3PE0 A;  5IHY A;  1L0V A;  4IE7 A;  4GYS A;  4AKL A;  2VVS A;  2BG9 B;  4YXD A;  2E9X B;  2RPA A;  5AQU B;  2B76 A;  4YTM A;  4TX5 A;  4P0B A;  3RYI E;  2X68 A;  3CIR A;  3RGL A;  2FJB A;  4G2A A;  5FMN A;  3U78 A;  4TWH A;  2BG9 E;  4U3C A;  4CQI A;  4EV6 A;  2EHO D;  2VQF T;  4UEL A;  2WY2 A;  1HX1 B;  1WYB A;  2BVM A;  3AEC A;  2MBG A;  2X66 A;  5FL1 A;  5LGT B;  3R84 B;  3PUX F;  4QX7 B;  2JPF A;  2VK9 A;  5JRE A;  3P4W A;  3KVA A;  4HWF A;  2RA1 A;  2W61 A;  2ZMA A;  2NTX A;  4QWN B;  4WW0 A;  4KI0 F;  3A5X A;  3H37 A;  4G63 A;  1XDP A;  4ANJ A;  2BDE A;  2WWU A;  5L3G B;  1V9D A;  4NXN T;  3AA7 B;  5IUX A;  4OYK A;  4L0R A;  1XZY A;  1VOM A;  4LMJ A;  3B5M A;  3T1H T;  4DVD A;  5LOV E;  4FJO A;  2LRL A;  4DBQ A;  2VKJ A;  5AQK B;  3MJX A;  3ZT6 A;  3AAE B;  3N9Q A;  4AKG A;  3LBX A;  4ZI3 C;  2IHR 1;  2IC9 A;  2PTF A;  4IDZ A;  3PUY F;  2XQ9 A;  3PJA J;  2IIU A;  4PW8 A;  2K24 A;  4IE6 A;  2V7M A;  4ZHQ E;  2DL1 A;  4IE4 A;  2XHE B;  3X1D A;  3C51 A;  4Z90 A;  5L3C B;  4LF6 T;  3K3Q C;  2D0U A;  2XAS B;  3MKD A;  2KZ7 B;  3CML A;  4BAY B;  3AE1 A;  3PV0 F;  1WCR A;  2JJ9 A;  2XQ5 A;  4IDP A;  3V5U A;  1N36 T;  4K0K T;  2XAG B;  5LJM A;  5LCY A;  2ZM0 A;  3RC3 A;  2PBI A;  1J1J A;  4JBW F;  2YU1 A;  3NRY A;  4NXM T;  2NP9 A;  2DLR A;  3ZSS A;  4B6X A;  2WDQ A;  3ZMV B;  4DUY T;  4H9P C;  3I9Y A;  1ZEE A;  4YSZ A;  4JEH B;  3ZN1 B;  2IW5 B;  3RRC A;  5LJN A;  4YT0 A;  1N32 T;  2V5C A;  2WSS V;  3N9O A;  4QXC B;  3RIU C;  5L4H A;  4U7Y A;  3RYC E;  2ODV A;  3C98 B;  3AE8 A;  3AAA B;  2V6Y A;  2WBL A;  4HWD A;  4Z91 A;  3U3I A;  2HPJ A;  3NRX A;  1FJG T;  1X9B A;  2WP9 A;  4GK5 E;  4IDO A;  3FZH B;  4F8H A;  4ILC A;  5HEG A;  5HXR A;  3HA4 A;  3AE5 A;  4U2Y A;  4EB6 E;  2M67 A;  5KX5 E;  2L8K A;  3EVY A;  1FMW A;  5J0Z A;  1HNW T;  3VR8 A;  2P9B A;  2WCA A;  1BR0 A;  3N5L A;  1HFA A;  2MTQ A;  1UGO A;  2CXL A;  2Q9Q B;  3ZJ1 A;  4AKH A;  5CJ5 A;  4AQF C;  4COF A;  4H9N C;  4U7I A;  4HFD A;  3JAF A;  4NPP A;  2WQY A;  4AIU A;  4EYY R;  4DR7 T;  4PK4 A;  1VRB A;  4A98 A;  2CCQ A;  2NOX A;  4TWD A;  3FZF B;  4YHH T;  2XM2 A;  1KEY A;  3DTO A;  2KMF A;  4KMC A;  2HHH T;  4LML A;  1KF6 A;  3N9P A;  5EZY E;  3KV9 A;  1N33 T;  4QH1 A;  1D1A A;  3ZYK A;  5HEO A;  2IDO B;  2CXF A;  2LSI A;  2DNX A;  3VRA A;  5E0O A;  3BK9 A;  3QK6 A;  2KWI B;  5HXS A;  4JI3 T;  4EYU A;  5AQL B;  3O9X A;  4KP3 C;  1SUM B;  4HN9 A;  3RKO A;  4BJM A;  4LFC T;  1BR2 A;  3T8O A;  1FIO A;  3K3O A;  4UVB B;  1N34 T;  1MIY A;  5BMV E;  2QA7 A;  3AXJ A;  3UQ7 A;  4AKI A;  3L3P A;  2BZB A;  4ZI3 D;  2YDR A;  3TKL B;  1UK5 A;  2EHO C;  5JDL A;  2B1E A;  4DMW A;  2MAW A;  2VL0 A;  2W67 A;  5J2U E;  5HAX A;  3GN5 A;  4JV5 T;  4EOZ B;  2JQQ A;  4LMK A;  3VKH A;  2E9X C;  3HKC E;  4ILA A;  2CA5 A;  3JCF A;  2Y8D A;  4GOU A;  5LHH B;  1D1B A;  4EED A;  2LM2 A;  1LVF A;  1D0Z A;  1G8X A;  2IUB A;  4QKN A;  4CN1 A;  4V1A v;  5HEJ A;  2LHN A;  4CI2 B;  2XY8 B;  3K3N A;  2XAF B;  4JI8 T;  1U5P A;  5JR9 C;  3LK2 B;  3TLV A;  3K1S A;  3PUS A;  2D0T A;  4DV1 T;  2CXD A;  2CWO A;  2H7V C;  3QB5 K;  2YIN A;  1XNQ T;  2XPK A;  4KX6 A;  5AQF B;  3PUG A;  4B3M T;  1XMQ T;  2VKD A;  2IAK A;  2JIW A;  2A9U A;  4I4T E;  4ZOL E;  2ZLY A;  5DQV A;  2AE9 A;  3ABV A;  3PUV F;  2WB5 A;  2NWB A;  1HNZ T;  2XM1 A;  1LKX A;  3UU4 A;  1U4Q A;  1XDO A;  1HS7 A;  3WI3 A;  2M6B A;  3NZP A;  4JLE A;  5FXW A;  1BR1 A;  4CN6 A;  2KT9 A;  4QXH B;  2LRK A;  3O1I A;  5LB7 B;  3KV5 A;  3P4S A;  1MMA A;  3QNU A;  3GA8 A;  3OPC A;  1WRD A;  4TN7 B;  3RRW A;  3E0Z A;  4ZI7 E;  2A72 A;  4XAX B;  4H63 H;  2ODU A;  3HI2 A;  4IRE A;  4E7S A;  5FVK A;  3RHW A;  2WAU A;  4O4L E;  4PJN A;  2XAH B;  2WS3 A;  4UVC B;  5JVD E;  2VVN A;  3ZCJ A;  5CA0 E;  3VHL A;  2FJA A;  3LBX B;  4DV6 T;  4O8S A;  1T72 A;  1OXZ A;  5FYM A;  4DV7 T;  1SHZ C;  2FJD A;  3SRZ A;  2E2A A;  1Y64 B;  5LXT E;  4ZEY A;  4JI5 T;  1OWA A;  5FP3 A;  1KFY A;  1D0Y A;  2LE8 A;  3UUB A;  1VCS A;  4HFH A;  2CHO A;  3FZK B;  3TLT A;  1D0X A;  4NIQ A;  5DAB A;  3ZMZ B;  4IDN A;  3EHZ A;  4ZI2 D;  3CWZ B;  5AQO B;  1E1H B;  5FL0 A;  2UXD T;  1FEW A;  4PJJ A;  5JDN A;  3LG7 A;  3L09 A;  4TNV A;  2NR4 A;  3OKQ A;  1MND A;  4LF5 T;  4N78 D;  2F4V T;  3AVS A;  3A7M A;  3UU8 A;  2XJ7 A;  3UFE A;  2CBJ A;  4ERR A;  2YK0 A;  3RIU A;  1OED C;  3GWH A;  1Z0P A;  5L3D B;  4X20 E;  3L39 A;  1HNX T;  4JI4 T;  3SWH A;  5L3E B;  3OTO T;  2E5V A;  3MZK B;  2V6X A;  2XQA A;  1IBM T;  5FXV A;  2A2F X;  4C90 A;  2NW7 A;  4IDQ A;  1GQE A;  3CQC B;  3Q5W A;  5GON E;  3AE3 A;  2XUE A;  4F6R C;  2E9X D;  2V7J A;  4AQG A;  1US7 B;  5ABG A;  3N2G E;  2ZM2 A;  2YEV C;  2YDS A;  3C64 A;  1SE7 A;  1MMG A;  2CPT A;  1YQ3 A;  3RPU A;  1HX8 A;  4AQF A;  3KDS E;  2D5U A;  3H3M A;  3AEE A;  1ZOY A;  3CKD A;  2LSK A;  5AQP B;  2OV9 A;  2Y6X A;  4PJM A;  5FY7 A;  2OA5 A;  4ISS A;  2X67 A;  5LBM A;  4PAG A;  1UX4 A;  5L4E A;  3ETU A;  1FMV A;  4WNK A;  5ADX L;  4IE0 A;  2N2N A;  4IT4 A;  5KDM C;  2C5I T;  1DU2 A;  3RYF E;  2R6G F;  2X9X A;  1HCI A;  2CLY B;  4U31 A;  4HFC A;  2E8I A;  1S35 A;  4O4J E;  3NVO A;  4WBN E;  2D2S A;  3F57 A;  1XNR T;  4UXN B;  3RX6 A;  1IJ6 A;  4UVA B;  1H7C A;  2W00 A;  4TNW A;  2X0L B;  2BKO A;  3O1J A;  4DBR A;  4X62 T;  4UEM A;  4B3S T;  3AE4 A;  5EK3 A;  4DR6 T;  4DV4 T;  5CGM A;  4ZS3 A;  5JDQ A;  4DR2 T;  3LJC A;  3IBP A;  3ONL C;  2EHO A;  4A5X A;  2WZH A;  2V7K A;  3NWI A;  2HN2 A;  3J7Y q;  3AE2 A;  4YFS A;  2YU2 A;  4CZZ B;  5FY1 A;  5JDM A;  4QHO A;  3AA6 B;  1ZP0 A;  3AXJ B;  4TWF A;  4WZX A;  3MAC A;  1E2A A;  1SA0 E;  2JMK A;  5HEU A;  3ZT7 A;  4DV3 T;  2Z6E A;  4FI5 A;  4U2Z A;  3KV4 A;  3MK7 C;  2N9D A;  3WAK A;  3LSV A;  3GN5 B;  2C5J A;  5JR9 A;  3ANW A;  2QGS A;  4DUZ T;  3HR0 A;  4X5T A;  2UUA T;  3W15 B;  4JI0 T;  1XWM A;  2LOP A;  4ILU A;  2W0G A;  2ZM8 A;  4JI1 T;  5HEH A;  3TLW A;  4ASK A;  3ZT5 A;  4UIG A;  2CMR A;  1IBL T;  3CQG B;  5JTG A;  5JH7 E;  1YQ4 A;  4MFR A;  2LT3 A;  1X79 A;  2LEH A;  4H9Q C;  3JAE A;  2IML A;  4IIJ E;  1AJ3 A;  5LGU B;  3ETV A;  5JDH A;  3T1Y T;  5FNV E;  3M3Z B;  2KXP B;  3J9X 1;  3RQU A;  2V7L A;  5H6R B;  5ABE A;  3Q2M A;  3UU5 A;  3CX8 B;  2CEA A;  3C4Z A;  1M7K A;  2YOE A;  3AA1 B;  3VU7 H;  2H3R A;  2Q9Q D;  5LP6 E;  3A8Y C;  4UV9 B;  4ZI2 C;  1M62 A;  5AQH B;  2DCF A;  2QVA A;  2WU5 A;  5HXC A;  5L2L A;  4EAH A;  1HG5 A;  4I43 B;  4HWI B;  4AI6 A;  1UUS A;  3N9M A;  3AE6 A;  2CM0 A;  3N2K E;  5LNK A;  3AEF A;  4CN4 A;  5AQJ B;  4Z8X A;  2K48 A;  2KLQ A;  3I9W A;  4OFZ A;  5AQN B;  1J5E T;  5M4Y A;  1YKE B;  3HKD E;  3PUQ A;  3RH3 A;  1WFD A;  1HR0 T;  2V5D A;  5HCM A;  1S94 A;  2XQ7 A;  3VR9 A;  3Q5D A;  2KND A;  4MAL A;  4O2B E;  2XZE A;  4DMV A;  4B3R T;  2WMO A;  3B57 A;  4IL4 A;  2BS2 A;  2D9D A;  5LGN B;  3C4W A;  3LFM A;  5ABF A;  1LVK A;  5AQM B;  4PK5 A;  5EK4 A;  4PFO A;  2C0S A;  2DHR A;  2CE7 A;  5HWY A;  2WU2 A;  1Z8U A;  2W66 A;  2BG9 C;  3O4X E;  1T98 A;  4ZXL A;  3AVR A;  2W62 A;  2C5K T;  3HL6 A;  4L5G A;  5DJQ C;  2LSY A;  3WAJ A;  1R8I A;  5J2T E;  5FY0 A;  2WMN A;  5CA1 E;  5HYA A;  1OED A;  3E08 A;  3ZKR A;  5HWX A;  4X1I E;  3JC6 D;  4YHJ A;  5IWA T;  4LF7 T;  2BS4 A;  3KIN B;  3FZL B;  4E7Z A;  2X0Y A;  1E7P A;  2WM9 A;  3IA3 A;  5JRC A;  3I0Q A;  4WYV A;  3KBU A;  3P8C D;  4HFV A;  2E5L T;  3BQL A;  5ETW A;  4DR1 T;  3FXE B;  2FUP A;  4JI6 T;  4X65 T;  4DR3 T;  2JQH A;  4HFE A;  3Q9D A;  4AIS A;  3KV6 A;  3FXD B;  4YTN A;  2GK9 A;  5J1G A;  4P09 A;  4TV8 E;  4U33 A;  3ZST A;  2BKN A;  3FZM B;  3DP7 A;  4DV0 T;  4P0A A;  2XQ6 A;  2LSG A;  5HCJ A;  2ACZ A;  5AQQ B;  3RC8 A;  1UCU A;  4LFB T;  3ZYM A;  5L3F B;  1O3X A;  1T7S A;  4YY3 T;  1KNZ A;  4EIW A;  1QLB A;  4CXX A;  2DWG A;  5F5W A;  4A56 A;  3BQI A;  4ZS2 A;  2HPL A;  5A1L A;  2CLY C;  4HFI A;  2XAJ B;  4CXY A;  3PUR A;  2WZI A;  4YTP A;  2FJE A;  3HKE E;  2VB6 A;  3RQW A;  4MHC A;  3PUZ F;  1Y01 A;  3S4U A;  2PJQ A;  2L3L A;  2OLT A;  1W0A A;  3UU6 A;  1YW0 A;  2MPK A;  3AE7 A;  2I0M A; 
#chains in the Genus database with same CATH homology
 2V8S V;  3ONJ A;  2QYW A;  1VCS A;  3ONL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...