3ONLC

Yeast ent3_enth-vti1p_habc complex structure
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
95
structure length
95
Chain Sequence
SLLISYESDFKTTLEQAKASLAEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVEVNNSIGDASERATYKAKLREWKKTIQSDIKRPLQSLVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Epsin N-terminal homology domains bind on opposite sides of two SNAREs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Epsin-3
total genus 41
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2010-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05008 V-SNARE Vesicle transport v-SNARE protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 3onlC00
3ONLC 2QYWA 3ONJA 1VCSA 2V8SV
chains in the Genus database with same CATH superfamily
5JDNA 1IAPA 3FZLB 3U78A 1FMWA 1OEDC 2NW7A 4CN4A 3R84B 4EEDA 2YDRA 4HFCA 5M4YA 4EYUA 4CZZB 5F5WA 3ZCIA 2NW9A 1OEDE 3LG7A 3P4WA 4U31A 5LHGB 3RRWA 3ZT5A 3NZPA 4DV7T 2UUAT 4DV2T 3C50A 3E08A 1N33T 3AA0B 2V26A 3RIFA 4DR7T 2V7KA 4FJOA 5LGNB 3HI2A 3UU6A 4G2AA 2A9UA 2WMOA 3CX7B 5EZYE 5FNVE 5DQVA 2NW8A 2XAQB 1FJGT 2W2UA 4H9RC 4PJJA 2K48A 3HR0A 2BDEA 2CA5A 1W0BA 2RA1A 3JCFA 3V5UA 2VK9A 4XZCA 5AQKB 2FJEA 3ZN0B 5L4EA 4AI6A 4XAXB 3RQUA 3ZMSB 4YTPA 2HPLA 4AQFA 2ODUA 1QSDA 2F4VT 1WLXA 2V8SV 2SPCA 1YXRA 4O4JE 4AQGA 2CLYB 3RPUA 1HNXT 2K5BB 1W09A 2D0UA 2XQ4A 3HKEE 3KINB 3I9WA 3LJCA 3BQLA 3AE8A 2CWYA 1CUNA 2JQQA 4H9QC 5FXVA 1S94A 1DU2A 3O4XE 4HWFA 1W0AA 2WM9A 3RHWA 4CN1A 3RRCA 2X51A 3ANWA 4YSXA 2PBIA 4UELA 5CA0E 2WCAA 3A7MA 2BKNA 4JI6T 4DR4T 5JR9A 3TLWA 4YXDA 3RI5A 1HG2A 1WYBA 2C5JA 2YKSA 5FL1A 4ILCA 4IHJE 4HE8A 3RX6A 4Z8XA 4LF5T 4PJNA 3V5SA 2CCQA 4U74A 3LK42 4EYYR 5FY0A 4NPPA 5IUXA 3AE6A 4LMKA 4ZI2D 2HHHT 4DV1T 4TZ4C 3FZHB 2PG8A 4DO0A 5LCYA 3KBUA 4PJLA 5AQUB 2D0TA 1XDOA 3UQ7A 2N2NA 4GYSA 3MXZA 3F31A 2JRKA 1FIOA 2V7IA 4I55E 1MIWA 5AQJB 5AQPB 3OPCA 1YD8G 2KNDA 2XQ3A 2YEVC 3LBXA 5AQTB 4YTNA 5A1LA 5EK2A 1XNRT 2LM2A 4KBMB 3UULA 3NWIA 1MNEA 4H9PC 3S4UA 3AA6B 5DJQC 5LXTE 4JYAT 1IJ5A 3I0QA 3RIUA 3Q5XA 2YK0A 3BQKA 2BZBA 3IEEA 5AQMB 5HYAA 2VB6A 5AQFB 1SHZC 1D0YA 2EHOC 2CE7A 5FP3A 2RPAA 3F2EA 4ZI3C 4NXNT 3CMLA 4EIWA 3ZC0A 4JI8T 3VKHA 1T72A 2CHNA 2ZM2A 3JC6C 3PU3A 4P09A 4CXYA 3FB2A 4IDOA 4WYVA 3U3IA 3VKGA 4EGWA 3M65A 2CXLA 3BK9A 2QGSA 4LMJA 1E2AA 4QX7B 3AE9A 3ANWB 5LHIB 4LF6T 5L3GB 2ODVA 4IL4A 4O2AE 3N2OA 3AEEA 3QNUA 3OJAA 3ZYMA 4CXWA 2H7OA 1VOMA 2YOEA 1O3XA 2K3WA 4QXCB 2D2SA 4YJ3E 3I9YA 5FXWA 3UT5E 4A98A 3ONJA 5CFBA 3VRBA 1XZYA 3QB5A 5E0OA 3LSVA 4E7SA 3SFEA 2WAUA 2W4XA 2ZMAA 2QVAA 2WWUA 3P4SA 2LKHA 2Y6XA 3K3NA 1HX1B 4JBWF 3MJXA 5BMVE 2VVSA 2XJ7A 4YHJA 5KX5E 3PUZF 1SA0E 4PNIA 5AFUL 1WYCA 2BG9E 4X64T 1HNZT 4HEAA 3FZFB 4ILBA 2C0SA 5GONE 5TAOA 1S35A 3EUHA 3C4XA 3UTKA 5EK3A 1B7TA 1L0VA 2EHOA 2A2FX 3HA4A 4HFIA 3O1JA 3PE0A 3CQGB 4KUMB 4X1KE 3TLVA 3N9PA 4BAYB 4KI0F 3UUBA 5AQRB 5J2UE 3RIUC 2BS4A 5FYMA 2V7LA 1KEYA 3O1IA 4O4HE 5LG3A 2UU9T 3GWHA 1ZP0A 2R6GF 2VL8A 4KHPT 2E5LT 2KMFA 4IL9A 2E5VA 4IE0A 4COFA 2YU1A 2FBWA 4EV6A 3O9XA 4JI4T 5J1GA 2C5KT 2E9XD 2MPKA 4P1NA 2V7MA 1XMQT 4GKKT 4AKHA 5L3EB 3AEAA 3FZKB 2Z6EA 2YINA 1J5WA 1IBKT 2CLYC 2XSBA 3JAFA 4LF7T 4PK4A 4LFBT 2LJLA 4KX6A 2KXPB 1Y01A 2X0HA 3OTOT 2H88A 5ABFB 5AQHB 3SS1A 2XPKA 3UU3A 3AVSA 4CXXA 3RC8A 3PUWF 3FBZA 2WWVA 3TLUA 4DIDB 2V6YA 3PUGA 3IBPA 4IDNA 3AE1A 4HWCA 2WU2A 2ACZA 3I1AA 1QUUA 3UU4A 4LF8T 3RYCE 2X0YA 2X67A 3AA1B 3H37A 4JLEA 4AKRB 3QB5K 1D0ZA 2XM2A 3DP7A 3OBVE 4BJMA 3PV0F 4UV8B 4YFSA 4YY3T 4WNKA 3KVBA 1XDPA 2XTLA 3LK2B 4AISA 4DUZT 1LVKA 5FL0A 5L2LA 4EEBA 4U7IA 1SE7A 1MMNA 4A5XA 5L3BB 1UX5A 5LJMA 3AAIA 5AQLB 4PW8A 2HPJA 3AE5A 2VL0A 4YT0A 1BR1A 2OA5A 1NAFA 5L4HA 4Z90A 1OWAA 3P4RA 1HS7A 2B1EA 2VKJA 3AAEB 3KDSE 5JVDE 3GN5B 3PUYF 1E1HB 2J4GA 5JDFA 3ZKRA 5LA6E 2VVNA 3MKDA 4A56A 2CRBA 3H3AA 4FI5A 2OLTA 5LBQB 5JDMA 2H89A 5KXJA 4DUYT 1JNRA 3CWZB 1YKHB 5AQSB 1VCTA 2MAWA 1US7B 3W15B 4ZS2A 2WBLA 1WR0A 1CHUA 4JV5T 2JJ9A 2IMLA 4DV0T 5HWYA 5JH7E 2LHRA 2ZM8A 5CA1E 3K1SA 3LDQB 2BS2A 3VR8A 4L5GA 2LKGA 5AQOB 2DNXA 3VR9A 5J0ZA 2WY2A 2JPFA 4ZI2C 3CQCB 5FXXA 2WZHA 4JUYA 3EAMA 5AQVB 2E8IA 2LT3A 5FY7A 1I6ZA 5HEOA 5HXEA 2BBJA 3KV4A 3WAJA 1J1JA 3PUXF 2WDRA 5EK4A 4K0KT 2CPTA 3ONXA 2UXNB 3PUSA 1MNDA 4UEMA 5FVLA 2LSJA 4X20E 3OYZA 4H63V 1OEDB 2M6IA 2CHOA 4HFBA 5HXHA 2XQ6A 3K8PC 2N9DA 2UXXB 4IE7A 3G06A 2PJQA 3EDUA 3F57A 4WW0A 5C8YE 3UUXB 3LK3B 3ZN1B 3L3PA 3HKCE 3NRYA 3NZQA 2BKOA 4JI5T 2UXDT 2LRKA 2UXBT 4O2BE 4TV8E 1HFAA 4X66T 4MFRA 2JQHA 3QK6A 2NTYA 4B6XA 3L39A 5LB7B 4QH4A 2QA7A 3UFGA 2D9DA 4OHFA 2VURA 2WDVA 4UXNB 3RKGA 2XUEA 3R6NA 2M6BA 5LMNT 2V7JA 2I0MA 2M67A 3ABVA 2Q9QC 2XAFB 2XQ5A 4EZ4A 5F3JA 4B3TT 2XQ9A 3N2GE 4DNDA 1T98A 2DL1A 2Q9QB 2VASA 4DR2T 2IC9A 4YHHT 1N32T 3HKBE 3A8YC 3P50A 5JRCB 2XQYA 4B3ST 2LSKA 3B5MA 1IJ6A 4ZZCA 1HG5A 2LM9A 5HEHA 4KHZF 1UK5A 3UUMA 4LF4T 3WAKA 2E2AA 3PUQA 3LBXB 5HXSA 3KV5A 3C4ZA 3SRZA 4F8HA 3EVYA 5L3CB 3RYFE 3MA9A 4IE5A 4DR3T 3DTOA 4LFCT 1EZ3A 4WBNE 1FEWA 4H63H 5KDMC 1XWMA 4MLKA 5LHHB 1FMVA 2WDQA 1HTJF 3TKLB 4EB6E 3CK6A 4QXHB 4IT4A 4DMWA 4AKGA 4BA9A 4IIJE 4JI0T 2DCFA 2CEAA 4QKNA 5LBMA 3VRAA 2Y8DA 1YQ4A 2Q9QA 2WQYA 2NWBA 4NUVA 2FJDA 4TX5A 2CWOA 4PJMA 4X62T 2PTFA 2XASB 4GOUA 4HWDA 1MMDA 5FY1A 2VQET 5LMUT 3N9MA 4NXMT 1M7KA 4TV9E 4O4LE 5HXRA 1HNWT 1NENA 3FXEB 2BG9A 5LP6E 3PURA 2CM0A 3UFEA 4P0AA 2LOSA 3IA3A 2HN2A 1MIVA 3AXJA 3OYXA 3J7Yq 2IUBA 4IREA 2HH7A 1KF6A 3RLFF 5J2TE 4AQYT 2I59A 5L47A 3ZT6A 2H7VC 4ASKA 4WZXA 2A72A 5HEJA 4QXBB 2DWGA 2X66A 2KWHA 2LHNA 2FUPA 2NP9A 2V1DB 1R8IA 3Q5WA 4I0UA 4QH5A 5HEUA 3P4QA 2XY8B 4H9NC 5FXZA 2WB5A 3AE4A 3ZJ2A 3ZPOA 4DBQA 1T8BA 2DHRA 3WI3A 4ZOLE 4N78D 4TNVA 1AJ3A 1MMGA 1ZHCA 2W00A 1LVFA 2DWKA 2W62A 3SFDA 4EAHA 2XSAA 3CQXC 2VQFT 5CB4E 3T8OA 2W67A 2J62A 5JDLA 2I6HA 2WU5A 1IBMT 4PK5A 5IYZE 1QLBA 2BBHA 2FJBA 4GYRA 2EHOD 3SOLA 4ZI3D 1Z8UA 4IE6A 2IDOB 4YSYA 3Q2MA 5JR9C 3FXDB 2MBGA 4UIGA 3AE3A 3PTRB 1VRBA 3AEFA 3UUNA 3AAAB 4JI2T 2LRLA 4HN9A 2BS3A 3TLSA 2OV9A 3ZMTB 3A5XA 5ABGA 5C3JA 2X0LB 3PJAA 3AE7A 1ZOYA 4TWDA 2EHOB 4YSZA 3B13A 1V9DA 4O8SA 1D1AA 4QWNB 5ABHA 1X79A 2ACXA 4GK5E 3AVRA 3QC9A 3C51A 4MBQA 3ZSSA 2LSGA 2P9BA 4U3CA 3ZCJA 3Q9DA 4L0RA 5JTGA 1IZNB 2JIWA 3AECA 3N9OA 3OKQA 2ZM6T 4JI3T 4UVCB 1BR2A 2CXDA 2RP4A 1ZV4X 3IF8B 4M1PA 2UUBT 1H7CA 2LEHA 1SUMB 3KVAA 3ZMZB 1UCUA 4CI3B 3GN5A 4H9OC 2V5CA 2MTQA 2BVLA 2VKOA 3C4WA 5CJ5A 2LSIA 5HCMA 1XMOT 1BR0A 2IHR1 2KT9A 3UQ4A 3NRXA 3H3MA 3RYHE 2XQ8A 4KP3C 4ILUA 2MYSA 3K3QC 2XZEA 3N2KE 4JI1T 4AKLA 5LGUB 1BR4A 3AEGA 3P8CD 4UV9B 1YKEB 5BR8T 3NVOA 4ZI7E 3B57A 5DQWA 2X9YA 4UF0B 2N1GA 3SWHA 3JAEA 3BQIA 3C98B 1I94T 3N9NA 2CBIA 4OYJA 3FBLA 3AXJB 4O4IE 2FJAA 2W63A 3LFMA 4Z91A 4CQIA 5JR9B 4E7ZA 2W66A 4J2CA 2BG9B 3CKDA 4GIWA 4V1Av 4CI2B 2NR4A 5LJNA 2BG9C 2KWIB 3PUAA 4G63A 4KMCA 3MACA 2IAKA 4HWIB 4U7YA 1UGOA 5LOVE 4DVDA 4AKIA 3AEDA 4AQFC 3UU8A 1W9RA 3JC6D 1JNZA 2W0GA 3PDYA 4IE4A 4ZHQE 4UF0A 1HR0T 4OX9T 4UVAB 5JDGA 2XM1A 3AA7B 4ADZA 1UURA 2V5DA 3RC3A 5CGMA 3MK7C 1KFYA 3FZMB 4I4TE 3ZMVB 2XAJB 2X68A 2ZLYA 4PFOA 3JADA 2KZ7B 5AQNB 4HFEA 2D5UA 1NWMX 2YU2A 4ISSA 4U2YA 3ZC1A 4ILAA 4OFZA 4DV6T 1LKXA 5HAXA 2KLQA 1OXZA 4X65T 4ZS3A 3HL6A 4UVBB 3ZT7A 2UUCT 3ONLC 5L3FB 4K0UA 4X5TA 4GK0E 5H6QB 5HWXA 1KNPA 1M62A 1D1BA 1YQ3A 2JMKA 3QOFA 1VCSA 4ISTA 4MHCA 3KV6A 4QHOA 4TWFA 5ABEA 3P4PA 3ZMUB 4DV4T 4HWHA 2MOZA 1G73A 5F8PA 4JI7T 4U2ZA 1D0XA 3CX8B 4MALA 3EI0A 2H3RA 2ZM0A 2WS3A 4BJNA 4HTEA 4TNWA 4A97A 5JDHA 1N34T 1J5ET 1NEKA 3I0OA 3ZJ1A 2L9QA 3N5LA 4HFHA 4YTMA 4CN6A 5LNKA 2DLRA 1T7SA 2CMRA 1WFDA 3AEBA 3CIRA 2HN1A 4DR6T 1HX8A 1ZKEA 2A3DA 3N9LA 4DMVA 4AXPA 2Q9QD 4EZHA 3FHNA 3PU8A 2XAGB 2E9XC 1GQEA 3PJAJ 4IDZA 4OK0A 4PFPA 2NTXA 4C91A 4U72A 3GA8A 4HGAA 1HCIA 5DABA 2VKDA 3KBTA 1HF8A 4DR5T 3MZKB 4CI1B 4LMLA 2Y48B 5KMGP 4TN7B 3IHRA 4ZZBA 1ZEEA 2LLYA 1KNZA 2BKPA 1OEDA 3DJBA 3P7IA 4NUUA 4I43B 2XQ7A 4C90A 4ZEYA 5LYJE 1LRZA 4EXTA 2B76A 3C64A 2X9WA 2YN6A 5AQGB 4JEHB 5HEGA 5FKYA 3ZSTA 5L3DB 1WCRA 4QX8B 5LG4A 4DV5T 2YDSA 3AB3B 3K3OA 2JQKA 3AE2A 4ERRA 2VKHA 1KNRA 2WMNA 3EDVA 4L9IA 4PK6A 3VHLA 1MIYA 4IDPA 2QYWA 4QH1A 4ANJA 3L8RA 5JREA 4LFAT 3E0ZA 2IIUA 3CX6B 2L3LA 3RF1A 1YW0A 2JMHA 5ETWA 2V6XA 2XQAA 4TWHA 3KFWX 1UUSA 3NBXX 4U33A 5AQQB 2WP9A 3T1YT 1IBLT 3X1DA 3EABA 2K9AA 2LE8A 2E9XA 1UX4A 2DI4A 3CPZA 5H6RB 3VU7H 5JDQA 2J1DG 3T1HT 1G8XA 2J47A 1N36T 3RYIE 4YJ2E 2UXCT 2IW5B 1WRDA 2C5IT 2KINB 2AXDS 3NKZA 2WSSV 5AQIB 5ADXL 2GK9A 2JQ9A 2BVMA 4IGUA 3RH3A 4Q25A 1KK7A 4HFDA 2L8KA 2K24A 3ZYKA 3ZYLA 4X1YE 4DV3T 2PFVA 2WZIA 1U5PA 2XHEB 2YDQA 4AIUA 3RGLA 2KSRA 2LSYA 2X9HA 2AE9A 3O1HA 3J9X1 3KV9A 3RIAA 4WBOA 2CXFA 5IHYA 2QRXA 3QUJA 4IDQA 3TLTA 4X1IE 5JRCA 3ESLA 5HXCA 1Y64B 4I50E 5FMNA 3UU5A 5LGTB 1XNQT 1X9BA 2VWAA 1Z0PA 3L09A 3ETUA 3Q5EA 4H9SE 1WR6A 4ZXLA 3PUVF 4P0BA 1MMAA 3E22E 3EHZA 2W61A 3RKOA 3M3ZB 3HKDE 2X9XA 3OVUA 2CBJA 4HFVA 5C2TA 4B3MT 4JEUB 2ES0A 4TUYE 5IWAT 2G0UA 4DR1T 1U4QA 5JQGE 3ZEFB 4DBRA 3CVRA 5HCJA 4GKJT 4YLHA 2V6YB 4OYKA 3RQWA 1E7PA 4LF9T 2LOPA 2NOXA 3ZLIA 4EOZB 3D0TA 3ETVA 4HKAA 4NIQA 4UR9A 3GMIA 5ABFA 5FVKA 4B3RT 2E9XB 2XAHB 3N9QA 2IC6A 3Q5DA 4F6RC 1D1CA 4XBFB 4PAGA
chains in the Genus database with same CATH topology
3ONLC 2QYWA 3ONJA 1VCSA 2V8SV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONL C;  2QYW A;  3ONJ A;  1VCS A;  2V8S V; 
#chains in the Genus database with same CATH topology
 5JDN A;  1IAP A;  3FZL B;  3U78 A;  1FMW A;  1OED C;  2NW7 A;  4CN4 A;  3R84 B;  4EED A;  2YDR A;  4HFC A;  5M4Y A;  4EYU A;  4CZZ B;  5F5W A;  3ZCI A;  2NW9 A;  1OED E;  3LG7 A;  3P4W A;  4U31 A;  5LHG B;  3RRW A;  3ZT5 A;  3NZP A;  4DV7 T;  2UUA T;  4DV2 T;  3C50 A;  3E08 A;  1N33 T;  3AA0 B;  2V26 A;  3RIF A;  4DR7 T;  2V7K A;  4FJO A;  5LGN B;  3HI2 A;  3UU6 A;  4G2A A;  2A9U A;  2WMO A;  3CX7 B;  5EZY E;  5FNV E;  5DQV A;  2NW8 A;  2XAQ B;  1FJG T;  2W2U A;  4H9R C;  4PJJ A;  2K48 A;  3HR0 A;  2BDE A;  2CA5 A;  1W0B A;  2RA1 A;  3JCF A;  3V5U A;  2VK9 A;  4XZC A;  5AQK B;  2FJE A;  3ZN0 B;  5L4E A;  4AI6 A;  4XAX B;  3RQU A;  3ZMS B;  4YTP A;  2HPL A;  4AQF A;  2ODU A;  1QSD A;  2F4V T;  1WLX A;  2V8S V;  2SPC A;  1YXR A;  4O4J E;  4AQG A;  2CLY B;  3RPU A;  1HNX T;  2K5B B;  1W09 A;  2D0U A;  2XQ4 A;  3HKE E;  3KIN B;  3I9W A;  3LJC A;  3BQL A;  3AE8 A;  2CWY A;  1CUN A;  2JQQ A;  4H9Q C;  5FXV A;  1S94 A;  1DU2 A;  3O4X E;  4HWF A;  1W0A A;  2WM9 A;  3RHW A;  4CN1 A;  3RRC A;  2X51 A;  3ANW A;  4YSX A;  2PBI A;  4UEL A;  5CA0 E;  2WCA A;  3A7M A;  2BKN A;  4JI6 T;  4DR4 T;  5JR9 A;  3TLW A;  4YXD A;  3RI5 A;  1HG2 A;  1WYB A;  2C5J A;  2YKS A;  5FL1 A;  4ILC A;  4IHJ E;  4HE8 A;  3RX6 A;  4Z8X A;  4LF5 T;  4PJN A;  3V5S A;  2CCQ A;  4U74 A;  3LK4 2;  4EYY R;  5FY0 A;  4NPP A;  5IUX A;  3AE6 A;  4LMK A;  4ZI2 D;  2HHH T;  4DV1 T;  4TZ4 C;  3FZH B;  2PG8 A;  4DO0 A;  5LCY A;  3KBU A;  4PJL A;  5AQU B;  2D0T A;  1XDO A;  3UQ7 A;  2N2N A;  4GYS A;  3MXZ A;  3F31 A;  2JRK A;  1FIO A;  2V7I A;  4I55 E;  1MIW A;  5AQJ B;  5AQP B;  3OPC A;  1YD8 G;  2KND A;  2XQ3 A;  2YEV C;  3LBX A;  5AQT B;  4YTN A;  5A1L A;  5EK2 A;  1XNR T;  2LM2 A;  4KBM B;  3UUL A;  3NWI A;  1MNE A;  4H9P C;  3S4U A;  3AA6 B;  5DJQ C;  5LXT E;  4JYA T;  1IJ5 A;  3I0Q A;  3RIU A;  3Q5X A;  2YK0 A;  3BQK A;  2BZB A;  3IEE A;  5AQM B;  5HYA A;  2VB6 A;  5AQF B;  1SHZ C;  1D0Y A;  2EHO C;  2CE7 A;  5FP3 A;  2RPA A;  3F2E A;  4ZI3 C;  4NXN T;  3CML A;  4EIW A;  3ZC0 A;  4JI8 T;  3VKH A;  1T72 A;  2CHN A;  2ZM2 A;  3JC6 C;  3PU3 A;  4P09 A;  4CXY A;  3FB2 A;  4IDO A;  4WYV A;  3U3I A;  3VKG A;  4EGW A;  3M65 A;  2CXL A;  3BK9 A;  2QGS A;  4LMJ A;  1E2A A;  4QX7 B;  3AE9 A;  3ANW B;  5LHI B;  4LF6 T;  5L3G B;  2ODV A;  4IL4 A;  4O2A E;  3N2O A;  3AEE A;  3QNU A;  3OJA A;  3ZYM A;  4CXW A;  2H7O A;  1VOM A;  2YOE A;  1O3X A;  2K3W A;  4QXC B;  2D2S A;  4YJ3 E;  3I9Y A;  5FXW A;  3UT5 E;  4A98 A;  3ONJ A;  5CFB A;  3VRB A;  1XZY A;  3QB5 A;  5E0O A;  3LSV A;  4E7S A;  3SFE A;  2WAU A;  2W4X A;  2ZMA A;  2QVA A;  2WWU A;  3P4S A;  2LKH A;  2Y6X A;  3K3N A;  1HX1 B;  4JBW F;  3MJX A;  5BMV E;  2VVS A;  2XJ7 A;  4YHJ A;  5KX5 E;  3PUZ F;  1SA0 E;  4PNI A;  5AFU L;  1WYC A;  2BG9 E;  4X64 T;  1HNZ T;  4HEA A;  3FZF B;  4ILB A;  2C0S A;  5GON E;  5TAO A;  1S35 A;  3EUH A;  3C4X A;  3UTK A;  5EK3 A;  1B7T A;  1L0V A;  2EHO A;  2A2F X;  3HA4 A;  4HFI A;  3O1J A;  3PE0 A;  3CQG B;  4KUM B;  4X1K E;  3TLV A;  3N9P A;  4BAY B;  4KI0 F;  3UUB A;  5AQR B;  5J2U E;  3RIU C;  2BS4 A;  5FYM A;  2V7L A;  1KEY A;  3O1I A;  4O4H E;  5LG3 A;  2UU9 T;  3GWH A;  1ZP0 A;  2R6G F;  2VL8 A;  4KHP T;  2E5L T;  2KMF A;  4IL9 A;  2E5V A;  4IE0 A;  4COF A;  2YU1 A;  2FBW A;  4EV6 A;  3O9X A;  4JI4 T;  5J1G A;  2C5K T;  2E9X D;  2MPK A;  4P1N A;  2V7M A;  1XMQ T;  4GKK T;  4AKH A;  5L3E B;  3AEA A;  3FZK B;  2Z6E A;  2YIN A;  1J5W A;  1IBK T;  2CLY C;  2XSB A;  3JAF A;  4LF7 T;  4PK4 A;  4LFB T;  2LJL A;  4KX6 A;  2KXP B;  1Y01 A;  2X0H A;  3OTO T;  2H88 A;  5ABF B;  5AQH B;  3SS1 A;  2XPK A;  3UU3 A;  3AVS A;  4CXX A;  3RC8 A;  3PUW F;  3FBZ A;  2WWV A;  3TLU A;  4DID B;  2V6Y A;  3PUG A;  3IBP A;  4IDN A;  3AE1 A;  4HWC A;  2WU2 A;  2ACZ A;  3I1A A;  1QUU A;  3UU4 A;  4LF8 T;  3RYC E;  2X0Y A;  2X67 A;  3AA1 B;  3H37 A;  4JLE A;  4AKR B;  3QB5 K;  1D0Z A;  2XM2 A;  3DP7 A;  3OBV E;  4BJM A;  3PV0 F;  4UV8 B;  4YFS A;  4YY3 T;  4WNK A;  3KVB A;  1XDP A;  2XTL A;  3LK2 B;  4AIS A;  4DUZ T;  1LVK A;  5FL0 A;  5L2L A;  4EEB A;  4U7I A;  1SE7 A;  1MMN A;  4A5X A;  5L3B B;  1UX5 A;  5LJM A;  3AAI A;  5AQL B;  4PW8 A;  2HPJ A;  3AE5 A;  2VL0 A;  4YT0 A;  1BR1 A;  2OA5 A;  1NAF A;  5L4H A;  4Z90 A;  1OWA A;  3P4R A;  1HS7 A;  2B1E A;  2VKJ A;  3AAE B;  3KDS E;  5JVD E;  3GN5 B;  3PUY F;  1E1H B;  2J4G A;  5JDF A;  3ZKR A;  5LA6 E;  2VVN A;  3MKD A;  4A56 A;  2CRB A;  3H3A A;  4FI5 A;  2OLT A;  5LBQ B;  5JDM A;  2H89 A;  5KXJ A;  4DUY T;  1JNR A;  3CWZ B;  1YKH B;  5AQS B;  1VCT A;  2MAW A;  1US7 B;  3W15 B;  4ZS2 A;  2WBL A;  1WR0 A;  1CHU A;  4JV5 T;  2JJ9 A;  2IML A;  4DV0 T;  5HWY A;  5JH7 E;  2LHR A;  2ZM8 A;  5CA1 E;  3K1S A;  3LDQ B;  2BS2 A;  3VR8 A;  4L5G A;  2LKG A;  5AQO B;  2DNX A;  3VR9 A;  5J0Z A;  2WY2 A;  2JPF A;  4ZI2 C;  3CQC B;  5FXX A;  2WZH A;  4JUY A;  3EAM A;  5AQV B;  2E8I A;  2LT3 A;  5FY7 A;  1I6Z A;  5HEO A;  5HXE A;  2BBJ A;  3KV4 A;  3WAJ A;  1J1J A;  3PUX F;  2WDR A;  5EK4 A;  4K0K T;  2CPT A;  3ONX A;  2UXN B;  3PUS A;  1MND A;  4UEM A;  5FVL A;  2LSJ A;  4X20 E;  3OYZ A;  4H63 V;  1OED B;  2M6I A;  2CHO A;  4HFB A;  5HXH A;  2XQ6 A;  3K8P C;  2N9D A;  2UXX B;  4IE7 A;  3G06 A;  2PJQ A;  3EDU A;  3F57 A;  4WW0 A;  5C8Y E;  3UUX B;  3LK3 B;  3ZN1 B;  3L3P A;  3HKC E;  3NRY A;  3NZQ A;  2BKO A;  4JI5 T;  2UXD T;  2LRK A;  2UXB T;  4O2B E;  4TV8 E;  1HFA A;  4X66 T;  4MFR A;  2JQH A;  3QK6 A;  2NTY A;  4B6X A;  3L39 A;  5LB7 B;  4QH4 A;  2QA7 A;  3UFG A;  2D9D A;  4OHF A;  2VUR A;  2WDV A;  4UXN B;  3RKG A;  2XUE A;  3R6N A;  2M6B A;  5LMN T;  2V7J A;  2I0M A;  2M67 A;  3ABV A;  2Q9Q C;  2XAF B;  2XQ5 A;  4EZ4 A;  5F3J A;  4B3T T;  2XQ9 A;  3N2G E;  4DND A;  1T98 A;  2DL1 A;  2Q9Q B;  2VAS A;  4DR2 T;  2IC9 A;  4YHH T;  1N32 T;  3HKB E;  3A8Y C;  3P50 A;  5JRC B;  2XQY A;  4B3S T;  2LSK A;  3B5M A;  1IJ6 A;  4ZZC A;  1HG5 A;  2LM9 A;  5HEH A;  4KHZ F;  1UK5 A;  3UUM A;  4LF4 T;  3WAK A;  2E2A A;  3PUQ A;  3LBX B;  5HXS A;  3KV5 A;  3C4Z A;  3SRZ A;  4F8H A;  3EVY A;  5L3C B;  3RYF E;  3MA9 A;  4IE5 A;  4DR3 T;  3DTO A;  4LFC T;  1EZ3 A;  4WBN E;  1FEW A;  4H63 H;  5KDM C;  1XWM A;  4MLK A;  5LHH B;  1FMV A;  2WDQ A;  1HTJ F;  3TKL B;  4EB6 E;  3CK6 A;  4QXH B;  4IT4 A;  4DMW A;  4AKG A;  4BA9 A;  4IIJ E;  4JI0 T;  2DCF A;  2CEA A;  4QKN A;  5LBM A;  3VRA A;  2Y8D A;  1YQ4 A;  2Q9Q A;  2WQY A;  2NWB A;  4NUV A;  2FJD A;  4TX5 A;  2CWO A;  4PJM A;  4X62 T;  2PTF A;  2XAS B;  4GOU A;  4HWD A;  1MMD A;  5FY1 A;  2VQE T;  5LMU T;  3N9M A;  4NXM T;  1M7K A;  4TV9 E;  4O4L E;  5HXR A;  1HNW T;  1NEN A;  3FXE B;  2BG9 A;  5LP6 E;  3PUR A;  2CM0 A;  3UFE A;  4P0A A;  2LOS A;  3IA3 A;  2HN2 A;  1MIV A;  3AXJ A;  3OYX A;  3J7Y q;  2IUB A;  4IRE A;  2HH7 A;  1KF6 A;  3RLF F;  5J2T E;  4AQY T;  2I59 A;  5L47 A;  3ZT6 A;  2H7V C;  4ASK A;  4WZX A;  2A72 A;  5HEJ A;  4QXB B;  2DWG A;  2X66 A;  2KWH A;  2LHN A;  2FUP A;  2NP9 A;  2V1D B;  1R8I A;  3Q5W A;  4I0U A;  4QH5 A;  5HEU A;  3P4Q A;  2XY8 B;  4H9N C;  5FXZ A;  2WB5 A;  3AE4 A;  3ZJ2 A;  3ZPO A;  4DBQ A;  1T8B A;  2DHR A;  3WI3 A;  4ZOL E;  4N78 D;  4TNV A;  1AJ3 A;  1MMG A;  1ZHC A;  2W00 A;  1LVF A;  2DWK A;  2W62 A;  3SFD A;  4EAH A;  2XSA A;  3CQX C;  2VQF T;  5CB4 E;  3T8O A;  2W67 A;  2J62 A;  5JDL A;  2I6H A;  2WU5 A;  1IBM T;  4PK5 A;  5IYZ E;  1QLB A;  2BBH A;  2FJB A;  4GYR A;  2EHO D;  3SOL A;  4ZI3 D;  1Z8U A;  4IE6 A;  2IDO B;  4YSY A;  3Q2M A;  5JR9 C;  3FXD B;  2MBG A;  4UIG A;  3AE3 A;  3PTR B;  1VRB A;  3AEF A;  3UUN A;  3AAA B;  4JI2 T;  2LRL A;  4HN9 A;  2BS3 A;  3TLS A;  2OV9 A;  3ZMT B;  3A5X A;  5ABG A;  5C3J A;  2X0L B;  3PJA A;  3AE7 A;  1ZOY A;  4TWD A;  2EHO B;  4YSZ A;  3B13 A;  1V9D A;  4O8S A;  1D1A A;  4QWN B;  5ABH A;  1X79 A;  2ACX A;  4GK5 E;  3AVR A;  3QC9 A;  3C51 A;  4MBQ A;  3ZSS A;  2LSG A;  2P9B A;  4U3C A;  3ZCJ A;  3Q9D A;  4L0R A;  5JTG A;  1IZN B;  2JIW A;  3AEC A;  3N9O A;  3OKQ A;  2ZM6 T;  4JI3 T;  4UVC B;  1BR2 A;  2CXD A;  2RP4 A;  1ZV4 X;  3IF8 B;  4M1P A;  2UUB T;  1H7C A;  2LEH A;  1SUM B;  3KVA A;  3ZMZ B;  1UCU A;  4CI3 B;  3GN5 A;  4H9O C;  2V5C A;  2MTQ A;  2BVL A;  2VKO A;  3C4W A;  5CJ5 A;  2LSI A;  5HCM A;  1XMO T;  1BR0 A;  2IHR 1;  2KT9 A;  3UQ4 A;  3NRX A;  3H3M A;  3RYH E;  2XQ8 A;  4KP3 C;  4ILU A;  2MYS A;  3K3Q C;  2XZE A;  3N2K E;  4JI1 T;  4AKL A;  5LGU B;  1BR4 A;  3AEG A;  3P8C D;  4UV9 B;  1YKE B;  5BR8 T;  3NVO A;  4ZI7 E;  3B57 A;  5DQW A;  2X9Y A;  4UF0 B;  2N1G A;  3SWH A;  3JAE A;  3BQI A;  3C98 B;  1I94 T;  3N9N A;  2CBI A;  4OYJ A;  3FBL A;  3AXJ B;  4O4I E;  2FJA A;  2W63 A;  3LFM A;  4Z91 A;  4CQI A;  5JR9 B;  4E7Z A;  2W66 A;  4J2C A;  2BG9 B;  3CKD A;  4GIW A;  4V1A v;  4CI2 B;  2NR4 A;  5LJN A;  2BG9 C;  2KWI B;  3PUA A;  4G63 A;  4KMC A;  3MAC A;  2IAK A;  4HWI B;  4U7Y A;  1UGO A;  5LOV E;  4DVD A;  4AKI A;  3AED A;  4AQF C;  3UU8 A;  1W9R A;  3JC6 D;  1JNZ A;  2W0G A;  3PDY A;  4IE4 A;  4ZHQ E;  4UF0 A;  1HR0 T;  4OX9 T;  4UVA B;  5JDG A;  2XM1 A;  3AA7 B;  4ADZ A;  1UUR A;  2V5D A;  3RC3 A;  5CGM A;  3MK7 C;  1KFY A;  3FZM B;  4I4T E;  3ZMV B;  2XAJ B;  2X68 A;  2ZLY A;  4PFO A;  3JAD A;  2KZ7 B;  5AQN B;  4HFE A;  2D5U A;  1NWM X;  2YU2 A;  4ISS A;  4U2Y A;  3ZC1 A;  4ILA A;  4OFZ A;  4DV6 T;  1LKX A;  5HAX A;  2KLQ A;  1OXZ A;  4X65 T;  4ZS3 A;  3HL6 A;  4UVB B;  3ZT7 A;  2UUC T;  3ONL C;  5L3F B;  4K0U A;  4X5T A;  4GK0 E;  5H6Q B;  5HWX A;  1KNP A;  1M62 A;  1D1B A;  1YQ3 A;  2JMK A;  3QOF A;  1VCS A;  4IST A;  4MHC A;  3KV6 A;  4QHO A;  4TWF A;  5ABE A;  3P4P A;  3ZMU B;  4DV4 T;  4HWH A;  2MOZ A;  1G73 A;  5F8P A;  4JI7 T;  4U2Z A;  1D0X A;  3CX8 B;  4MAL A;  3EI0 A;  2H3R A;  2ZM0 A;  2WS3 A;  4BJN A;  4HTE A;  4TNW A;  4A97 A;  5JDH A;  1N34 T;  1J5E T;  1NEK A;  3I0O A;  3ZJ1 A;  2L9Q A;  3N5L A;  4HFH A;  4YTM A;  4CN6 A;  5LNK A;  2DLR A;  1T7S A;  2CMR A;  1WFD A;  3AEB A;  3CIR A;  2HN1 A;  4DR6 T;  1HX8 A;  1ZKE A;  2A3D A;  3N9L A;  4DMV A;  4AXP A;  2Q9Q D;  4EZH A;  3FHN A;  3PU8 A;  2XAG B;  2E9X C;  1GQE A;  3PJA J;  4IDZ A;  4OK0 A;  4PFP A;  2NTX A;  4C91 A;  4U72 A;  3GA8 A;  4HGA A;  1HCI A;  5DAB A;  2VKD A;  3KBT A;  1HF8 A;  4DR5 T;  3MZK B;  4CI1 B;  4LML A;  2Y48 B;  5KMG P;  4TN7 B;  3IHR A;  4ZZB A;  1ZEE A;  2LLY A;  1KNZ A;  2BKP A;  1OED A;  3DJB A;  3P7I A;  4NUU A;  4I43 B;  2XQ7 A;  4C90 A;  4ZEY A;  5LYJ E;  1LRZ A;  4EXT A;  2B76 A;  3C64 A;  2X9W A;  2YN6 A;  5AQG B;  4JEH B;  5HEG A;  5FKY A;  3ZST A;  5L3D B;  1WCR A;  4QX8 B;  5LG4 A;  4DV5 T;  2YDS A;  3AB3 B;  3K3O A;  2JQK A;  3AE2 A;  4ERR A;  2VKH A;  1KNR A;  2WMN A;  3EDV A;  4L9I A;  4PK6 A;  3VHL A;  1MIY A;  4IDP A;  2QYW A;  4QH1 A;  4ANJ A;  3L8R A;  5JRE A;  4LFA T;  3E0Z A;  2IIU A;  3CX6 B;  2L3L A;  3RF1 A;  1YW0 A;  2JMH A;  5ETW A;  2V6X A;  2XQA A;  4TWH A;  3KFW X;  1UUS A;  3NBX X;  4U33 A;  5AQQ B;  2WP9 A;  3T1Y T;  1IBL T;  3X1D A;  3EAB A;  2K9A A;  2LE8 A;  2E9X A;  1UX4 A;  2DI4 A;  3CPZ A;  5H6R B;  3VU7 H;  5JDQ A;  2J1D G;  3T1H T;  1G8X A;  2J47 A;  1N36 T;  3RYI E;  4YJ2 E;  2UXC T;  2IW5 B;  1WRD A;  2C5I T;  2KIN B;  2AXD S;  3NKZ A;  2WSS V;  5AQI B;  5ADX L;  2GK9 A;  2JQ9 A;  2BVM A;  4IGU A;  3RH3 A;  4Q25 A;  1KK7 A;  4HFD A;  2L8K A;  2K24 A;  3ZYK A;  3ZYL A;  4X1Y E;  4DV3 T;  2PFV A;  2WZI A;  1U5P A;  2XHE B;  2YDQ A;  4AIU A;  3RGL A;  2KSR A;  2LSY A;  2X9H A;  2AE9 A;  3O1H A;  3J9X 1;  3KV9 A;  3RIA A;  4WBO A;  2CXF A;  5IHY A;  2QRX A;  3QUJ A;  4IDQ A;  3TLT A;  4X1I E;  5JRC A;  3ESL A;  5HXC A;  1Y64 B;  4I50 E;  5FMN A;  3UU5 A;  5LGT B;  1XNQ T;  1X9B A;  2VWA A;  1Z0P A;  3L09 A;  3ETU A;  3Q5E A;  4H9S E;  1WR6 A;  4ZXL A;  3PUV F;  4P0B A;  1MMA A;  3E22 E;  3EHZ A;  2W61 A;  3RKO A;  3M3Z B;  3HKD E;  2X9X A;  3OVU A;  2CBJ A;  4HFV A;  5C2T A;  4B3M T;  4JEU B;  2ES0 A;  4TUY E;  5IWA T;  2G0U A;  4DR1 T;  1U4Q A;  5JQG E;  3ZEF B;  4DBR A;  3CVR A;  5HCJ A;  4GKJ T;  4YLH A;  2V6Y B;  4OYK A;  3RQW A;  1E7P A;  4LF9 T;  2LOP A;  2NOX A;  3ZLI A;  4EOZ B;  3D0T A;  3ETV A;  4HKA A;  4NIQ A;  4UR9 A;  3GMI A;  5ABF A;  5FVK A;  4B3R T;  2E9X B;  2XAH B;  3N9Q A;  2IC6 A;  3Q5D A;  4F6R C;  1D1C A;  4XBF B;  4PAG A; 
#chains in the Genus database with same CATH homology
 3ONL C;  2QYW A;  3ONJ A;  1VCS A;  2V8S V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...