3ONLC

Yeast ent3_enth-vti1p_habc complex structure
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
95
structure length
95
Chain Sequence
SLLISYESDFKTTLEQAKASLAEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVEVNNSIGDASERATYKAKLREWKKTIQSDIKRPLQSLVDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epsin-3
publication title Epsin N-terminal homology domains bind on opposite sides of two SNAREs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 41
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2010-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF05008 V-SNARE Vesicle transport v-SNARE protein N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.400 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 t-snare proteins 3onlC00
2V8SV 3ONJA 1VCSA 3ONLC 2QYWA
chains in the Genus database with same CATH superfamily
2DL1A 4A56A 5KDMC 2ODUA 3O4XE 2JJ9A 2CXDA 3JC6C 2VWAA 4C91A 2WAUA 1T7SA 4ZS3A 4KMCA 3RX6A 3RYCE 2D2SA 5C8YE 1U5PA 3AXJA 5HEUA 5GONE 3AA0B 4LF7T 3CIRA 1S35A 2LRLA 4NXMT 5CJ5A 5BMVE 5EZYE 4LF8T 4LMJA 5LGUB 1IBMT 5LBMA 5L3EB 2NWBA 3AE3A 2MAWA 3ZMTB 2JMHA 4QKNA 1N33T 3FZFB 5LBQB 3A7MA 4AKIA 2V7LA 2QA7A 2ZM0A 2YOEA 3UUMA 5JDQA 3HA4A 3E22E 4OYJA 3CQCB 4EZHA 1E2AA 3GMIA 1OEDE 4BA9A 3B13A 2N1GA 2QVAA 2XASB 2XSAA 2FBWA 4DV7T 3SFEA 2VK9A 2FJDA 1HG5A 4DR7T 5L4EA 4TZ4C 3AE9A 2K24A 4JYAT 3NZQA 3PUZF 3V5SA 2DWKA 4LF4T 4U7IA 4KX6A 4IDQA 3CMLA 2J47A 3ZC0A 5IUXA 4QX8B 3ONXA 1LRZA 3EUHA 1M7KA 4K0UA 3HKDE 4LFAT 3VKGA 3CX7B 1OEDC 2W62A 5AQHB 3AEBA 2WDRA 3GA8A 2YU1A 2KLQA 5E0OA 2CWYA 5FXZA 1GQEA 3TLTA 2DI4A 3ZYMA 2V7JA 2CWOA 3ZCIA 3P7IA 3P4RA 4DO0A 5ABFB 1Y01A 4V1Av 1J5WA 4YSXA 3VR9A 1D1BA 1VCSA 4JEHB 1NENA 4DUZT 4O4IE 1HX1B 4H9NC 3CX8B 5CGMA 5AQQB 3VR8A 4UXNB 2LSGA 3AB3B 2NW7A 2L8KA 4CZZB 4PJLA 5C2TA 4LF9T 2P9BA 2V8SV 2DLRA 4X66T 4NIQA 2E9XA 4KHZF 4IL4A 2FJAA 3LBXA 2ZLYA 4LMLA 1MMAA 3ZT6A 3ZN0B 4QH4A 1IBKT 2VVNA 2EHOC 3Q5WA 5HEGA 3TKLB 3ETVA 2DNXA 4HWFA 5F3JA 4DV3T 2ZM8A 3Q9DA 4AKGA 2ES0A 4YJ3E 4AISA 2Q9QB 5EK3A 4EAHA 3SFDA 3B5MA 5BR8T 2A2FX 3PUXF 2CE7A 1XNQT 3HKBE 2X51A 5LNKA 2LM2A 4X1YE 4KI0F 4X1IE 3Q5EA 2LSIA 2BG9C 4CQIA 4M1PA 4H9SE 2XPKA 3FB2A 3PU8A 5AQKB 4YSYA 2JPFA 3W15B 5DABA 3M65A 2XQ7A 2XJ7A 2LKGA 3C50A 2FJBA 3MACA 2K5BB 5HXSA 2HH7A 3UUXB 2X66A 4IE7A 3RKGA 4WYVA 2HN1A 1YQ3A 5JVDE 2FJEA 2V6YB 2XQ5A 4ZEYA 3K1SA 1MMDA 5KX5E 2NP9A 2E8IA 4Z8XA 2KT9A 4TWFA 2CHOA 3RGLA 5AQVB 1KF6A 1IBLT 4A5XA 5CB4E 1CHUA 5LYJE 4XBFB 5FY0A 3PUGA 2D0TA 5AQSB 1FIOA 2VVSA 3SS1A 3KBUA 2CHNA 3UQ7A 2CBIA 3MK7C 3A5XA 2M6BA 2PBIA 1WLXA 1LKXA 1HG2A 4NUVA 2W67A 2Q9QD 2X9WA 4ILBA 1FMVA 2XAGB 2ZMAA 3BQKA 5AQIB 4B3TT 2RPAA 2HHHT 2LOPA 3C64A 2UUBT 2M6IA 5L3BB 2ODVA 3JC6D 4F6RC 4HGAA 2H7OA 1OEDB 1H7CA 2E2AA 1J1JA 2WCAA 3KINB 3KV4A 4CI1B 4ADZA 3JCFA 2MBGA 2AE9A 4L5GA 3P50A 2LSYA 3AE1A 3KDSE 3HI2A 2XAJB 2WWUA 2I0MA 4A97A 5HXEA 1KEYA 3VRBA 1WYCA 4K0KT 4CXXA 5LJMA 2WZIA 4P1NA 4ZZBA 3PURA 5AQLB 1XMOT 4YHJA 1LVKA 4H9QC 2MOZA 2V7IA 5AQPB 4ISSA 2Y48B 4XAXB 3TLUA 4ZI2D 3RRWA 3UU6A 3ZMUB 3P4QA 1BR1A 3AAAB 2BG9A 3J9X1 4HFBA 4HN9A 3PJAJ 4C90A 1T72A 5LHGB 2CM0A 5ABHA 2PG8A 3GN5A 4UR9A 4PJMA 1VOMA 5HYAA 5AQOB 4YXDA 5LMUT 2L9QA 4ILAA 3RQUA 5IYZE 1MMNA 1JNRA 2C5JA 5HEOA 1WRDA 5LOVE 2M67A 2CA5A 4KP3C 4BAYB 4E7ZA 4UV8B 3NWIA 4HFVA 4MBQA 4U2YA 2PFVA 3PTRB 2W2UA 4I43B 2IAKA 5JR9A 2E9XC 3QK6A 3ONLC 3OPCA 4J2CA 5FL0A 1QLBA 5JRCB 3MKDA 2JQKA 2VKHA 3RI5A 4EOZB 2IC6A 2A72A 3RIAA 3UU4A 4PK4A 1W9RA 3RYFE 4ZI3C 1N34T 1KNRA 4JBWF 5FXVA 2HN2A 3AEEA 2JMKA 4O4LE 5JDGA 4YTNA 2WU5A 4GYSA 2BKNA 4TNVA 4IGUA 5FVKA 3UUNA 4AKLA 2XTLA 5ABEA 1KFYA 2CRBA 5FYMA 2HPJA 5LCYA 1HTJF 3EABA 5AQFB 4UELA 2DCFA 5LJNA 3LG7A 4LF5T 4O2AE 1FJGT 2H88A 2A9UA 2KMFA 3ZYKA 2NTYA 2VKJA 4MHCA 3EHZA 4YT0A 5H6RB 2C5KT 3N9OA 2QYWA 5JDMA 3AXJB 2EHOD 3RH3A 3AE2A 2WBLA 1YD8G 2IMLA 1Y64B 4HWHA 2WMOA 4DUYT 5JQGE 4ERRA 4DV6T 1D0ZA 5ABFA 2UUCT 5LHHB 4WBOA 4ASKA 4GK0E 2UU9T 5AQGB 1KK7A 3CPZA 3T1HT 2V5DA 3ETUA 2CXLA 4JLEA 2XAFB 4EV6A 3D0TA 3J7Yq 2KNDA 2YEVC 1ZV4X 3PE0A 2F4VT 4HFIA 1YKEB 1AJ3A 4PK6A 5F8PA 2LSJA 2VKOA 3GWHA 3KV5A 2UXDT 4NPPA 1HNZT 2N9DA 2V7MA 5LG3A 1KNZA 5FY7A 1BR0A 2Y8DA 3P4PA 3ANWA 2IDOB 2KWIB 2OLTA 5TAOA 3CQGB 1G73A 1V9DA 3FHNA 2CMRA 5HCJA 2J62A 2W66A 4DMWA 4YJ2E 4WNKA 1SE7A 2W00A 2X68A 2BS4A 4DR3T 2X67A 3LSVA 3UUBA 3LJCA 4IT4A 4TV9E 1JNZA 3ONJA 4EZ4A 3ZC1A 4UIGA 2CEAA 3BQLA 4JI8T 2A3DA 4H63H 4OFZA 3WI3A 4AIUA 3K3QC 2X9YA 1ZEEA 4O4HE 2XQAA 3NVOA 2BG9E 2FUPA 2XQ3A 2LHNA 1UX4A 4YFSA 5M4YA 1KNPA 4NUUA 2L3LA 3EI0A 4UF0A 3QUJA 1OWAA 5CA1E 4B3ST 1G8XA 2WZHA 2CLYC 3O1HA 2E5LT 3I9WA 3K3NA 1HX8A 2IIUA 2IC9A 4QH5A 3AE4A 4CI3B 4U7YA 4B6XA 1D0XA 3I0OA 1X9BA 3Q5DA 2JQ9A 3AEAA 1L0VA 4KUMB 3N9QA 3OVUA 5LA6E 5CA0E 5IWAT 2LHRA 4UVCB 2B76A 2LM9A 2WB5A 4X64T 1ZHCA 3LBXB 1N36T 4JI5T 2X0LB 4FI5A 4BJNA 4IIJE 1YKHB 3FXDB 4QWNB 4HEAA 3N9MA 1MNDA 3QB5A 2YK0A 2XQ8A 4PNIA 3ZMVB 2DHRA 3MA9A 4Z91A 1YQ4A 4JI0T 4YLHA 1W0BA 2XQYA 4JI7T 3ZT5A 3G06A 1HNWT 4IDNA 5KXJA 3L8RA 1MMGA 3AECA 5JDLA 5JR9C 1J5ET 5ADXL 3M3ZB 2X0YA 2VASA 2BS3A 3CX6B 3TLVA 5ABGA 2J1DG 2VB6A 1E7PA 1ZKEA 4QHOA 4JI2T 3C4XA 2W0GA 3ZSSA 3H37A 3B57A 3EVYA 4U72A 4G63A 5LMNT 2BVMA 2UUAT 3RIUA 4IL9A 1I6ZA 3N9PA 2W4XA 3L09A 5LXTE 2V1DB 3CKDA 2YDQA 2D9DA 3UU5A 2LKHA 3AA1B 3I1AA 4EYUA 3ZSTA 3OJAA 3EDVA 4GKJT 4HWCA 4X62T 2X0HA 2KSRA 2CPTA 4GOUA 3MJXA 4AQFA 3FZKB 4DR5T 5FNVE 2XHEB 3SOLA 2XM1A 4H9OC 1SHZC 3UU8A 4CN6A 4HFDA 5AQUB 3AEDA 3E0ZA 3CK6A 2NW8A 4WZXA 3UTKA 4H9PC 4OHFA 1BR2A 4TX5A 3CVRA 3EAMA 4DV4T 4IDOA 4COFA 4ZI3D 2LT3A 3IBPA 4X5TA 5AQTB 2HPLA 3HL6A 1X79A 1E1HB 4QX7B 3F2EA 4JI3T 3RC3A 2QRXA 3P8CD 3BQIA 2XQ6A 2BBHA 5FL1A 2UXNB 2N2NA 1NEKA 3TLWA 5J1GA 3SWHA 5J0ZA 3KV9A 1O3XA 2WY2A 1VRBA 5H6QB 3OKQA 3KVBA 2WQYA 2MPKA 1ZOYA 4IDZA 1MIWA 2AXDS 1IZNB 1W09A 4I4TE 4IE4A 2B1EA 3ZJ2A 4YTPA 2NW9A 5IHYA 3P4WA 4GKKT 4I55E 3CWZB 3IEEA 4LMKA 1IAPA 1UUSA 4DV5T 4TWHA 4IHJE 2IW5B 4DV2T 4XZCA 3OYZA 3RQWA 3PUAA 2EHOB 4B3RT 1R8IA 3FZLB 2XQ9A 3N2GE 4EEBA 2YU2A 3ABVA 2VQFT 3LFMA 4B3MT 3OTOT 2LJLA 2K9AA 1UK5A 2CLYB 2XUEA 4TN7B 3LDQB 4ISTA 3N5LA 4IE5A 2NOXA 4KBMB 5L3GB 4CXYA 3RPUA 4HFEA 3IF8B 1UCUA 2XSBA 3MZKB 4DVDA 3PUVF 4Z90A 3PUWF 4DNDA 2V7KA 3AEGA 5JDHA 3RF1A 5HXRA 4UVAB 5L2LA 4H63V 2BG9B 3PDYA 1B7TA 3QNUA 4YY3T 3GN5B 1XWMA 2LOSA 2GK9A 4ZXLA 2NR4A 2V26A 3N2KE 3QOFA 3K3OA 2JQHA 2LRKA 1WFDA 3AE5A 3JAFA 3O1IA 3PUQA 5FXXA 5FKYA 2UXCT 4CXWA 2I6HA 4EXTA 2XY8B 3ZN1B 4PAGA 4ILUA 5AQRB 3A8YC 3C98B 3NBXX 3F57A 5L4HA 2YKSA 2G0UA 5JR9B 5KMGP 3KVAA 2XQ4A 3NZPA 1T98A 4TWDA 3AAEB 2KZ7B 4U74A 3N2OA 2ACXA 5AQMB 1CUNA 3FBZA 4UVBB 5FVLA 1XDOA 4U33A 4ZZCA 5HXHA 3ZPOA 5FXWA 3HKEE 2LSKA 4HTEA 3ZJ1A 4AXPA 2D5UA 3DJBA 3AA6B 3C4ZA 4ZI2C 1YW0A 3LK3B 4JI6T 1NWMX 3QC9A 4GIWA 4ZOLE 4G2AA 5LG4A 1YXRA 2CBJA 5DQVA 5DQWA 5JDNA 3Q2MA 4KHPT 4DR4T 3H3MA 3U3IA 4OYKA 5L47A 3VU7H 3AEFA 2UXXB 4O8SA 2VKDA 4Q25A 4EYYR 2K3WA 2W61A 2I59A 3O1JA 2YDSA 4AKHA 3VRAA 3EDUA 4I50E 2H3RA 5EK2A 4AKRB 4YTMA 2BBJA 3RIUC 4TNWA 2E5VA 1IJ5A 2SPCA 3E08A 3LK2B 3O9XA 4MALA 4OK0A 4TV8E 4CI2B 2JIWA 2KXPB 3RLFF 3U78A 4AQFC 5LHIB 2CXFA 5J2TE 3UT5E 4F8HA 5JH7E 3DTOA 3KV6A 3RC8A 4I0UA 3PUYF 3V5UA 4WW0A 5HAXA 4DBRA 3RRCA 5DJQC 3IA3A 3AE6A 2K48A 2VQET 2Q9QA 3L3PA 4HWDA 1WR0A 2H89A 1MNEA 2V5CA 5EK4A 2WWVA 2X9HA 2KWHA 2LE8A 4EEDA 3N9NA 3ANWB 5JTGA 1VCTA 4LF6T 1US7B 4ILCA 4U2ZA 3OBVE 1Z8UA 2V6XA 1MIYA 3QB5K 3IHRA 1D1AA 1FMWA 3I9YA 5F5WA 5HCMA 4QXCB 2ACZA 2XM2A 1HFAA 1SA0E 3DP7A 2H7VC 4N78D 2BKPA 1QSDA 4LFBT 4IE6A 3SRZA 1I94T 5LP6E 3S4UA 3F31A 4X1KE 5L3FB 2Z6EA 2VL0A 1HNXT 2Y6XA 5LGNB 2QGSA 3AA7B 4PFPA 3PU3A 1UURA 4H9RC 5JREA 3ZLIA 2E9XB 4GYRA 4TUYE 3X1DA 1XZYA 2V6YA 3KFWX 4PFOA 3WAKA 2RA1A 4ANJA 1LVFA 3L39A 3FXEB 4LFCT 1DU2A 1ZP0A 1OXZA 5HEHA 4UF0B 1D0YA 3ZT7A 3NRXA 4UEMA 4MFRA 4PJJA 4HFCA 2D0UA 3FBLA 1IJ6A 4L0RA 4AQGA 4DBQA 5LB7B 2IHR1 2LLYA 2BKOA 4HFHA 2WDVA 3MXZA 4DIDB 4U31A 3AE7A 2DWGA 2PTFA 3RYIE 2WU2A 5AQJB 3TLSA 2JRKA 1W0AA 2IUBA 2ZM2A 3PV0F 3JADA 3VKHA 1HCIA 3UULA 4JV5T 2C0SA 3AVSA 1NAFA 4IE0A 5LGTB 3RYHE 2W63A 3AVRA 4CN4A 2ZM6T 2OA5A 5AFUL 3NKZA 3P4SA 4YSZA 3C51A 1Z0PA 3ZCJA 4HE8A 3NRYA 5JDFA 3Q5XA 1M62A 3H3AA 2VURA 1XDPA 2J4GA 3I0QA 3R6NA 1EZ3A 2OV9A 1OEDA 2BZBA 2XZEA 5J2UE 4NXNT 1SUMB 5FY1A 4A98A 4DMVA 3PJAA 2NTXA 4O2BE 2WM9A 3RHWA 4YHHT 1HF8A 1U4QA 4MLKA 4EB6E 4AQYT 1QUUA 4WBNE 5HWXA 1HR0T 1XNRT 4DR6T 3FZMB 3RKOA 4DR1T 2RP4A 2XAHB 2MYSA 5AQNB 4OX9T 3UFEA 5HEJA 2WS3A 2E9XD 3LK42 3UFGA 4QXBB 4DV1T 3RIFA 4IDPA 2WMNA 5L3CB 4P09A 1XMQT 1BR4A 2YN6A 2R6GF 4DV0T 4ZS2A 1WCRA 5A1LA 3N9LA 4JI4T 4JUYA 2XAQB 2MTQA 5FMNA 3ESLA 1HS7A 4BJMA 2BS2A 1FEWA 3BK9A 3FZHB 3WAJA 3AE8A 3ZMSB 3ZYLA 4JI1T 4FJOA 3UQ4A 3KBTA 2PJQA 4GK5E 2EHOA 2WDQA 3OYXA 2JQQA 4UV9B 5HXCA 1T8BA 4PW8A 3K8PC 5C3JA 5L3DB 5FP3A 1D1CA 4U3CA 1WYBA 3CQXC 2LEHA 4P0AA 2C5IT 1UX5A 4ZHQE 3R84B 3ZMZB 4HKAA 3ZKRA 4ZI7E 2UXBT 4EIWA 3T1YT 3HKCE 3VHLA 1N32T 4DR2T 5JRCA 3HR0A 3ZEFB 4EGWA 2KINB 3UU3A 2YINA 5HWYA 4IREA 4X65T 2WP9A 2BVLA 4QH1A 4PJNA 4X20E 2BDEA 4CN1A 2WSSV 3C4WA 2X9XA 3PUSA 1WR6A 2VL8A 4PK5A 3JAEA 5CFBA 4E7SA 4HWIB 3AAIA 4L9IA 4JEUB 4O4JE 2YDRA 2CCQA 1UGOA 1MIVA 2Q9QC 4AI6A 1S94A 4QXHB 3T8OA 5ETWA 4P0BA
chains in the Genus database with same CATH topology
2V8SV 3ONJA 1VCSA 3ONLC 2QYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8S V;  3ONJ A;  1VCS A;  3ONL C;  2QYW A; 
#chains in the Genus database with same CATH topology
 2DL1 A;  4A56 A;  5KDM C;  2ODU A;  3O4X E;  2JJ9 A;  2CXD A;  3JC6 C;  2VWA A;  4C91 A;  2WAU A;  1T7S A;  4ZS3 A;  4KMC A;  3RX6 A;  3RYC E;  2D2S A;  5C8Y E;  1U5P A;  3AXJ A;  5HEU A;  5GON E;  3AA0 B;  4LF7 T;  3CIR A;  1S35 A;  2LRL A;  4NXM T;  5CJ5 A;  5BMV E;  5EZY E;  4LF8 T;  4LMJ A;  5LGU B;  1IBM T;  5LBM A;  5L3E B;  2NWB A;  3AE3 A;  2MAW A;  3ZMT B;  2JMH A;  4QKN A;  1N33 T;  3FZF B;  5LBQ B;  3A7M A;  4AKI A;  2V7L A;  2QA7 A;  2ZM0 A;  2YOE A;  3UUM A;  5JDQ A;  3HA4 A;  3E22 E;  4OYJ A;  3CQC B;  4EZH A;  1E2A A;  3GMI A;  1OED E;  4BA9 A;  3B13 A;  2N1G A;  2QVA A;  2XAS B;  2XSA A;  2FBW A;  4DV7 T;  3SFE A;  2VK9 A;  2FJD A;  1HG5 A;  4DR7 T;  5L4E A;  4TZ4 C;  3AE9 A;  2K24 A;  4JYA T;  3NZQ A;  3PUZ F;  3V5S A;  2DWK A;  4LF4 T;  4U7I A;  4KX6 A;  4IDQ A;  3CML A;  2J47 A;  3ZC0 A;  5IUX A;  4QX8 B;  3ONX A;  1LRZ A;  3EUH A;  1M7K A;  4K0U A;  3HKD E;  4LFA T;  3VKG A;  3CX7 B;  1OED C;  2W62 A;  5AQH B;  3AEB A;  2WDR A;  3GA8 A;  2YU1 A;  2KLQ A;  5E0O A;  2CWY A;  5FXZ A;  1GQE A;  3TLT A;  2DI4 A;  3ZYM A;  2V7J A;  2CWO A;  3ZCI A;  3P7I A;  3P4R A;  4DO0 A;  5ABF B;  1Y01 A;  4V1A v;  1J5W A;  4YSX A;  3VR9 A;  1D1B A;  1VCS A;  4JEH B;  1NEN A;  4DUZ T;  4O4I E;  1HX1 B;  4H9N C;  3CX8 B;  5CGM A;  5AQQ B;  3VR8 A;  4UXN B;  2LSG A;  3AB3 B;  2NW7 A;  2L8K A;  4CZZ B;  4PJL A;  5C2T A;  4LF9 T;  2P9B A;  2V8S V;  2DLR A;  4X66 T;  4NIQ A;  2E9X A;  4KHZ F;  4IL4 A;  2FJA A;  3LBX A;  2ZLY A;  4LML A;  1MMA A;  3ZT6 A;  3ZN0 B;  4QH4 A;  1IBK T;  2VVN A;  2EHO C;  3Q5W A;  5HEG A;  3TKL B;  3ETV A;  2DNX A;  4HWF A;  5F3J A;  4DV3 T;  2ZM8 A;  3Q9D A;  4AKG A;  2ES0 A;  4YJ3 E;  4AIS A;  2Q9Q B;  5EK3 A;  4EAH A;  3SFD A;  3B5M A;  5BR8 T;  2A2F X;  3PUX F;  2CE7 A;  1XNQ T;  3HKB E;  2X51 A;  5LNK A;  2LM2 A;  4X1Y E;  4KI0 F;  4X1I E;  3Q5E A;  2LSI A;  2BG9 C;  4CQI A;  4M1P A;  4H9S E;  2XPK A;  3FB2 A;  3PU8 A;  5AQK B;  4YSY A;  2JPF A;  3W15 B;  5DAB A;  3M65 A;  2XQ7 A;  2XJ7 A;  2LKG A;  3C50 A;  2FJB A;  3MAC A;  2K5B B;  5HXS A;  2HH7 A;  3UUX B;  2X66 A;  4IE7 A;  3RKG A;  4WYV A;  2HN1 A;  1YQ3 A;  5JVD E;  2FJE A;  2V6Y B;  2XQ5 A;  4ZEY A;  3K1S A;  1MMD A;  5KX5 E;  2NP9 A;  2E8I A;  4Z8X A;  2KT9 A;  4TWF A;  2CHO A;  3RGL A;  5AQV B;  1KF6 A;  1IBL T;  4A5X A;  5CB4 E;  1CHU A;  5LYJ E;  4XBF B;  5FY0 A;  3PUG A;  2D0T A;  5AQS B;  1FIO A;  2VVS A;  3SS1 A;  3KBU A;  2CHN A;  3UQ7 A;  2CBI A;  3MK7 C;  3A5X A;  2M6B A;  2PBI A;  1WLX A;  1LKX A;  1HG2 A;  4NUV A;  2W67 A;  2Q9Q D;  2X9W A;  4ILB A;  1FMV A;  2XAG B;  2ZMA A;  3BQK A;  5AQI B;  4B3T T;  2RPA A;  2HHH T;  2LOP A;  3C64 A;  2UUB T;  2M6I A;  5L3B B;  2ODV A;  3JC6 D;  4F6R C;  4HGA A;  2H7O A;  1OED B;  1H7C A;  2E2A A;  1J1J A;  2WCA A;  3KIN B;  3KV4 A;  4CI1 B;  4ADZ A;  3JCF A;  2MBG A;  2AE9 A;  4L5G A;  3P50 A;  2LSY A;  3AE1 A;  3KDS E;  3HI2 A;  2XAJ B;  2WWU A;  2I0M A;  4A97 A;  5HXE A;  1KEY A;  3VRB A;  1WYC A;  4K0K T;  4CXX A;  5LJM A;  2WZI A;  4P1N A;  4ZZB A;  3PUR A;  5AQL B;  1XMO T;  4YHJ A;  1LVK A;  4H9Q C;  2MOZ A;  2V7I A;  5AQP B;  4ISS A;  2Y48 B;  4XAX B;  3TLU A;  4ZI2 D;  3RRW A;  3UU6 A;  3ZMU B;  3P4Q A;  1BR1 A;  3AAA B;  2BG9 A;  3J9X 1;  4HFB A;  4HN9 A;  3PJA J;  4C90 A;  1T72 A;  5LHG B;  2CM0 A;  5ABH A;  2PG8 A;  3GN5 A;  4UR9 A;  4PJM A;  1VOM A;  5HYA A;  5AQO B;  4YXD A;  5LMU T;  2L9Q A;  4ILA A;  3RQU A;  5IYZ E;  1MMN A;  1JNR A;  2C5J A;  5HEO A;  1WRD A;  5LOV E;  2M67 A;  2CA5 A;  4KP3 C;  4BAY B;  4E7Z A;  4UV8 B;  3NWI A;  4HFV A;  4MBQ A;  4U2Y A;  2PFV A;  3PTR B;  2W2U A;  4I43 B;  2IAK A;  5JR9 A;  2E9X C;  3QK6 A;  3ONL C;  3OPC A;  4J2C A;  5FL0 A;  1QLB A;  5JRC B;  3MKD A;  2JQK A;  2VKH A;  3RI5 A;  4EOZ B;  2IC6 A;  2A72 A;  3RIA A;  3UU4 A;  4PK4 A;  1W9R A;  3RYF E;  4ZI3 C;  1N34 T;  1KNR A;  4JBW F;  5FXV A;  2HN2 A;  3AEE A;  2JMK A;  4O4L E;  5JDG A;  4YTN A;  2WU5 A;  4GYS A;  2BKN A;  4TNV A;  4IGU A;  5FVK A;  3UUN A;  4AKL A;  2XTL A;  5ABE A;  1KFY A;  2CRB A;  5FYM A;  2HPJ A;  5LCY A;  1HTJ F;  3EAB A;  5AQF B;  4UEL A;  2DCF A;  5LJN A;  3LG7 A;  4LF5 T;  4O2A E;  1FJG T;  2H88 A;  2A9U A;  2KMF A;  3ZYK A;  2NTY A;  2VKJ A;  4MHC A;  3EHZ A;  4YT0 A;  5H6R B;  2C5K T;  3N9O A;  2QYW A;  5JDM A;  3AXJ B;  2EHO D;  3RH3 A;  3AE2 A;  2WBL A;  1YD8 G;  2IML A;  1Y64 B;  4HWH A;  2WMO A;  4DUY T;  5JQG E;  4ERR A;  4DV6 T;  1D0Z A;  5ABF A;  2UUC T;  5LHH B;  4WBO A;  4ASK A;  4GK0 E;  2UU9 T;  5AQG B;  1KK7 A;  3CPZ A;  3T1H T;  2V5D A;  3ETU A;  2CXL A;  4JLE A;  2XAF B;  4EV6 A;  3D0T A;  3J7Y q;  2KND A;  2YEV C;  1ZV4 X;  3PE0 A;  2F4V T;  4HFI A;  1YKE B;  1AJ3 A;  4PK6 A;  5F8P A;  2LSJ A;  2VKO A;  3GWH A;  3KV5 A;  2UXD T;  4NPP A;  1HNZ T;  2N9D A;  2V7M A;  5LG3 A;  1KNZ A;  5FY7 A;  1BR0 A;  2Y8D A;  3P4P A;  3ANW A;  2IDO B;  2KWI B;  2OLT A;  5TAO A;  3CQG B;  1G73 A;  1V9D A;  3FHN A;  2CMR A;  5HCJ A;  2J62 A;  2W66 A;  4DMW A;  4YJ2 E;  4WNK A;  1SE7 A;  2W00 A;  2X68 A;  2BS4 A;  4DR3 T;  2X67 A;  3LSV A;  3UUB A;  3LJC A;  4IT4 A;  4TV9 E;  1JNZ A;  3ONJ A;  4EZ4 A;  3ZC1 A;  4UIG A;  2CEA A;  3BQL A;  4JI8 T;  2A3D A;  4H63 H;  4OFZ A;  3WI3 A;  4AIU A;  3K3Q C;  2X9Y A;  1ZEE A;  4O4H E;  2XQA A;  3NVO A;  2BG9 E;  2FUP A;  2XQ3 A;  2LHN A;  1UX4 A;  4YFS A;  5M4Y A;  1KNP A;  4NUU A;  2L3L A;  3EI0 A;  4UF0 A;  3QUJ A;  1OWA A;  5CA1 E;  4B3S T;  1G8X A;  2WZH A;  2CLY C;  3O1H A;  2E5L T;  3I9W A;  3K3N A;  1HX8 A;  2IIU A;  2IC9 A;  4QH5 A;  3AE4 A;  4CI3 B;  4U7Y A;  4B6X A;  1D0X A;  3I0O A;  1X9B A;  3Q5D A;  2JQ9 A;  3AEA A;  1L0V A;  4KUM B;  3N9Q A;  3OVU A;  5LA6 E;  5CA0 E;  5IWA T;  2LHR A;  4UVC B;  2B76 A;  2LM9 A;  2WB5 A;  4X64 T;  1ZHC A;  3LBX B;  1N36 T;  4JI5 T;  2X0L B;  4FI5 A;  4BJN A;  4IIJ E;  1YKH B;  3FXD B;  4QWN B;  4HEA A;  3N9M A;  1MND A;  3QB5 A;  2YK0 A;  2XQ8 A;  4PNI A;  3ZMV B;  2DHR A;  3MA9 A;  4Z91 A;  1YQ4 A;  4JI0 T;  4YLH A;  1W0B A;  2XQY A;  4JI7 T;  3ZT5 A;  3G06 A;  1HNW T;  4IDN A;  5KXJ A;  3L8R A;  1MMG A;  3AEC A;  5JDL A;  5JR9 C;  1J5E T;  5ADX L;  3M3Z B;  2X0Y A;  2VAS A;  2BS3 A;  3CX6 B;  3TLV A;  5ABG A;  2J1D G;  2VB6 A;  1E7P A;  1ZKE A;  4QHO A;  4JI2 T;  3C4X A;  2W0G A;  3ZSS A;  3H37 A;  3B57 A;  3EVY A;  4U72 A;  4G63 A;  5LMN T;  2BVM A;  2UUA T;  3RIU A;  4IL9 A;  1I6Z A;  3N9P A;  2W4X A;  3L09 A;  5LXT E;  2V1D B;  3CKD A;  2YDQ A;  2D9D A;  3UU5 A;  2LKH A;  3AA1 B;  3I1A A;  4EYU A;  3ZST A;  3OJA A;  3EDV A;  4GKJ T;  4HWC A;  4X62 T;  2X0H A;  2KSR A;  2CPT A;  4GOU A;  3MJX A;  4AQF A;  3FZK B;  4DR5 T;  5FNV E;  2XHE B;  3SOL A;  2XM1 A;  4H9O C;  1SHZ C;  3UU8 A;  4CN6 A;  4HFD A;  5AQU B;  3AED A;  3E0Z A;  3CK6 A;  2NW8 A;  4WZX A;  3UTK A;  4H9P C;  4OHF A;  1BR2 A;  4TX5 A;  3CVR A;  3EAM A;  4DV4 T;  4IDO A;  4COF A;  4ZI3 D;  2LT3 A;  3IBP A;  4X5T A;  5AQT B;  2HPL A;  3HL6 A;  1X79 A;  1E1H B;  4QX7 B;  3F2E A;  4JI3 T;  3RC3 A;  2QRX A;  3P8C D;  3BQI A;  2XQ6 A;  2BBH A;  5FL1 A;  2UXN B;  2N2N A;  1NEK A;  3TLW A;  5J1G A;  3SWH A;  5J0Z A;  3KV9 A;  1O3X A;  2WY2 A;  1VRB A;  5H6Q B;  3OKQ A;  3KVB A;  2WQY A;  2MPK A;  1ZOY A;  4IDZ A;  1MIW A;  2AXD S;  1IZN B;  1W09 A;  4I4T E;  4IE4 A;  2B1E A;  3ZJ2 A;  4YTP A;  2NW9 A;  5IHY A;  3P4W A;  4GKK T;  4I55 E;  3CWZ B;  3IEE A;  4LMK A;  1IAP A;  1UUS A;  4DV5 T;  4TWH A;  4IHJ E;  2IW5 B;  4DV2 T;  4XZC A;  3OYZ A;  3RQW A;  3PUA A;  2EHO B;  4B3R T;  1R8I A;  3FZL B;  2XQ9 A;  3N2G E;  4EEB A;  2YU2 A;  3ABV A;  2VQF T;  3LFM A;  4B3M T;  3OTO T;  2LJL A;  2K9A A;  1UK5 A;  2CLY B;  2XUE A;  4TN7 B;  3LDQ B;  4IST A;  3N5L A;  4IE5 A;  2NOX A;  4KBM B;  5L3G B;  4CXY A;  3RPU A;  4HFE A;  3IF8 B;  1UCU A;  2XSB A;  3MZK B;  4DVD A;  3PUV F;  4Z90 A;  3PUW F;  4DND A;  2V7K A;  3AEG A;  5JDH A;  3RF1 A;  5HXR A;  4UVA B;  5L2L A;  4H63 V;  2BG9 B;  3PDY A;  1B7T A;  3QNU A;  4YY3 T;  3GN5 B;  1XWM A;  2LOS A;  2GK9 A;  4ZXL A;  2NR4 A;  2V26 A;  3N2K E;  3QOF A;  3K3O A;  2JQH A;  2LRK A;  1WFD A;  3AE5 A;  3JAF A;  3O1I A;  3PUQ A;  5FXX A;  5FKY A;  2UXC T;  4CXW A;  2I6H A;  4EXT A;  2XY8 B;  3ZN1 B;  4PAG A;  4ILU A;  5AQR B;  3A8Y C;  3C98 B;  3NBX X;  3F57 A;  5L4H A;  2YKS A;  2G0U A;  5JR9 B;  5KMG P;  3KVA A;  2XQ4 A;  3NZP A;  1T98 A;  4TWD A;  3AAE B;  2KZ7 B;  4U74 A;  3N2O A;  2ACX A;  5AQM B;  1CUN A;  3FBZ A;  4UVB B;  5FVL A;  1XDO A;  4U33 A;  4ZZC A;  5HXH A;  3ZPO A;  5FXW A;  3HKE E;  2LSK A;  4HTE A;  3ZJ1 A;  4AXP A;  2D5U A;  3DJB A;  3AA6 B;  3C4Z A;  4ZI2 C;  1YW0 A;  3LK3 B;  4JI6 T;  1NWM X;  3QC9 A;  4GIW A;  4ZOL E;  4G2A A;  5LG4 A;  1YXR A;  2CBJ A;  5DQV A;  5DQW A;  5JDN A;  3Q2M A;  4KHP T;  4DR4 T;  3H3M A;  3U3I A;  4OYK A;  5L47 A;  3VU7 H;  3AEF A;  2UXX B;  4O8S A;  2VKD A;  4Q25 A;  4EYY R;  2K3W A;  2W61 A;  2I59 A;  3O1J A;  2YDS A;  4AKH A;  3VRA A;  3EDU A;  4I50 E;  2H3R A;  5EK2 A;  4AKR B;  4YTM A;  2BBJ A;  3RIU C;  4TNW A;  2E5V A;  1IJ5 A;  2SPC A;  3E08 A;  3LK2 B;  3O9X A;  4MAL A;  4OK0 A;  4TV8 E;  4CI2 B;  2JIW A;  2KXP B;  3RLF F;  3U78 A;  4AQF C;  5LHI B;  2CXF A;  5J2T E;  3UT5 E;  4F8H A;  5JH7 E;  3DTO A;  3KV6 A;  3RC8 A;  4I0U A;  3PUY F;  3V5U A;  4WW0 A;  5HAX A;  4DBR A;  3RRC A;  5DJQ C;  3IA3 A;  3AE6 A;  2K48 A;  2VQE T;  2Q9Q A;  3L3P A;  4HWD A;  1WR0 A;  2H89 A;  1MNE A;  2V5C A;  5EK4 A;  2WWV A;  2X9H A;  2KWH A;  2LE8 A;  4EED A;  3N9N A;  3ANW B;  5JTG A;  1VCT A;  4LF6 T;  1US7 B;  4ILC A;  4U2Z A;  3OBV E;  1Z8U A;  2V6X A;  1MIY A;  3QB5 K;  3IHR A;  1D1A A;  1FMW A;  3I9Y A;  5F5W A;  5HCM A;  4QXC B;  2ACZ A;  2XM2 A;  1HFA A;  1SA0 E;  3DP7 A;  2H7V C;  4N78 D;  2BKP A;  1QSD A;  4LFB T;  4IE6 A;  3SRZ A;  1I94 T;  5LP6 E;  3S4U A;  3F31 A;  4X1K E;  5L3F B;  2Z6E A;  2VL0 A;  1HNX T;  2Y6X A;  5LGN B;  2QGS A;  3AA7 B;  4PFP A;  3PU3 A;  1UUR A;  4H9R C;  5JRE A;  3ZLI A;  2E9X B;  4GYR A;  4TUY E;  3X1D A;  1XZY A;  2V6Y A;  3KFW X;  4PFO A;  3WAK A;  2RA1 A;  4ANJ A;  1LVF A;  3L39 A;  3FXE B;  4LFC T;  1DU2 A;  1ZP0 A;  1OXZ A;  5HEH A;  4UF0 B;  1D0Y A;  3ZT7 A;  3NRX A;  4UEM A;  4MFR A;  4PJJ A;  4HFC A;  2D0U A;  3FBL A;  1IJ6 A;  4L0R A;  4AQG A;  4DBQ A;  5LB7 B;  2IHR 1;  2LLY A;  2BKO A;  4HFH A;  2WDV A;  3MXZ A;  4DID B;  4U31 A;  3AE7 A;  2DWG A;  2PTF A;  3RYI E;  2WU2 A;  5AQJ B;  3TLS A;  2JRK A;  1W0A A;  2IUB A;  2ZM2 A;  3PV0 F;  3JAD A;  3VKH A;  1HCI A;  3UUL A;  4JV5 T;  2C0S A;  3AVS A;  1NAF A;  4IE0 A;  5LGT B;  3RYH E;  2W63 A;  3AVR A;  4CN4 A;  2ZM6 T;  2OA5 A;  5AFU L;  3NKZ A;  3P4S A;  4YSZ A;  3C51 A;  1Z0P A;  3ZCJ A;  4HE8 A;  3NRY A;  5JDF A;  3Q5X A;  1M62 A;  3H3A A;  2VUR A;  1XDP A;  2J4G A;  3I0Q A;  3R6N A;  1EZ3 A;  2OV9 A;  1OED A;  2BZB A;  2XZE A;  5J2U E;  4NXN T;  1SUM B;  5FY1 A;  4A98 A;  4DMV A;  3PJA A;  2NTX A;  4O2B E;  2WM9 A;  3RHW A;  4YHH T;  1HF8 A;  1U4Q A;  4MLK A;  4EB6 E;  4AQY T;  1QUU A;  4WBN E;  5HWX A;  1HR0 T;  1XNR T;  4DR6 T;  3FZM B;  3RKO A;  4DR1 T;  2RP4 A;  2XAH B;  2MYS A;  5AQN B;  4OX9 T;  3UFE A;  5HEJ A;  2WS3 A;  2E9X D;  3LK4 2;  3UFG A;  4QXB B;  4DV1 T;  3RIF A;  4IDP A;  2WMN A;  5L3C B;  4P09 A;  1XMQ T;  1BR4 A;  2YN6 A;  2R6G F;  4DV0 T;  4ZS2 A;  1WCR A;  5A1L A;  3N9L A;  4JI4 T;  4JUY A;  2XAQ B;  2MTQ A;  5FMN A;  3ESL A;  1HS7 A;  4BJM A;  2BS2 A;  1FEW A;  3BK9 A;  3FZH B;  3WAJ A;  3AE8 A;  3ZMS B;  3ZYL A;  4JI1 T;  4FJO A;  3UQ4 A;  3KBT A;  2PJQ A;  4GK5 E;  2EHO A;  2WDQ A;  3OYX A;  2JQQ A;  4UV9 B;  5HXC A;  1T8B A;  4PW8 A;  3K8P C;  5C3J A;  5L3D B;  5FP3 A;  1D1C A;  4U3C A;  1WYB A;  3CQX C;  2LEH A;  4P0A A;  2C5I T;  1UX5 A;  4ZHQ E;  3R84 B;  3ZMZ B;  4HKA A;  3ZKR A;  4ZI7 E;  2UXB T;  4EIW A;  3T1Y T;  3HKC E;  3VHL A;  1N32 T;  4DR2 T;  5JRC A;  3HR0 A;  3ZEF B;  4EGW A;  2KIN B;  3UU3 A;  2YIN A;  5HWY A;  4IRE A;  4X65 T;  2WP9 A;  2BVL A;  4QH1 A;  4PJN A;  4X20 E;  2BDE A;  4CN1 A;  2WSS V;  3C4W A;  2X9X A;  3PUS A;  1WR6 A;  2VL8 A;  4PK5 A;  3JAE A;  5CFB A;  4E7S A;  4HWI B;  3AAI A;  4L9I A;  4JEU B;  4O4J E;  2YDR A;  2CCQ A;  1UGO A;  1MIV A;  2Q9Q C;  4AI6 A;  1S94 A;  4QXH B;  3T8O A;  5ETW A;  4P0B A; 
#chains in the Genus database with same CATH homology
 2V8S V;  3ONJ A;  1VCS A;  3ONL C;  2QYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...