3ONXA

Crystal structure of a domain of a protein involved in formation of actin cytoskeleton
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
125
structure length
125
Chain Sequence
b'NRMYMEKSQTELGDLSDTLLSKVDDLQDVIEIMRKDVAERRSQPAKKKLETVSKDLENAQADVLKLQEFIDTEKPHWKKTWEAELDKVCEEQQFLTLQEELILDLKEDLGKALETFDLIKLCCEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bud site selection protein 6
molecule tags Protein binding
source organism Saccharomyces cerevisiae
publication title Structure of the formin-interaction domain of the actin nucleation-promoting factor Bud6.
pubmed doi rcsb
total genus 51
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1540 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3onxA00
3ONXA 3OKQA
chains in the Genus database with same CATH superfamily
1Y01A 2XTLA 3PJAA 3OYXA 4TZ4C 2ZM8A 3LG7A 5KMGP 5JRCA 2IUBA 4WZXA 4UVCB 3L3PA 3VR9A 4Z91A 4GK5E 5M4YA 3PUVF 4OHFA 1SA0E 2YU1A 1M7KA 4UEMA 3EDVA 1OEDA 5CB4E 3RYHE 2JJ9A 3FBLA 4HFEA 4EGWA 2IDOB 2AXDS 3QK6A 4ZZCA 2YDRA 2E9XB 4YLHA 4JI5T 2V7MA 3ZT6A 5LNKA 3SFEA 3PUZF 2YN6A 4DR3T 3KDSE 2OA5A 4QKNA 4O8SA 2LSJA 1IZNB 3N9QA 5HEOA 5FVLA 5LJMA 2K3WA 2CBIA 2FUPA 2KZ7B 1KF6A 4EV6A 5J2TE 3RC8A 2XQ6A 3O4XE 2BKNA 2I59A 1UX5A 3AA7B 4JV5T 2Y48B 1WYBA 4PFOA 1ZOYA 4A5XA 2VWAA 2XY8B 3FZHB 1KK7A 2X68A 2XM2A 3DP7A 3KBTA 5L47A 4HFHA 4JI8T 2WU2A 2H7VC 4QWNB 2C5KT 4ASKA 4B3RT 3TLVA 3Q5XA 3T1YT 4ZHQE 5JDMA 3N9LA 4U2YA 3AEAA 3MJXA 2VL0A 2NTYA 3OVUA 2KWHA 2XASB 2A72A 3GN5A 1WRDA 3HA4A 3IBPA 4IE7A 5H6RB 3DTOA 4EEBA 5JDLA 2ZMAA 5FY7A 5F8PA 4X64T 3C51A 5AQQB 2VKJA 3ONLC 3PJAJ 4HFDA 4LMJA 3ZMTB 2W2UA 3UU8A 4UIGA 4DIDB 3VKGA 3RH3A 4G2AA 3GN5B 4TNWA 4ZEYA 3CQXC 3PE0A 3VU7H 4YJ2E 4O4JE 4OYJA 4GOUA 1X79A 2X0LB 3CX8B 2JQHA 3LK2B 5FXWA 4AQFC 4CQIA 3VR8A 5LXTE 1ZV4X 3N9PA 3PUYF 2V5CA 3UU3A 1UX4A 3AA0B 3O1HA 1HNXT 1MMGA 2MPKA 1U5PA 2L9QA 3FZFB 5LGNB 1O3XA 3K3QC 4WBNE 1LRZA 3FZKB 4UXNB 4N78D 3ZKRA 5AQUB 5KXJA 4C90A 3NWIA 3TLWA 2VB6A 3B57A 2YINA 3UUNA 4YT0A 2CBJA 4TV9E 4YSYA 3G06A 4LMKA 4X65T 4LF7T 4X66T 3ZSTA 2BVLA 2AE9A 2CPTA 2LOSA 1W09A 2V6YB 3MKDA 2VQET 3N9OA 2DNXA 2WCAA 4EOZB 1M62A 3F31A 5ABHA 1SUMB 5AQLB 2Y8DA 4FI5A 3TLTA 3FBZA 1SE7A 1G8XA 1EZ3A 3PU8A 4YTMA 2Q9QC 1MNDA 5DQWA 4DV3T 3PV0F 4HGAA 2VQFT 3C98B 2G0UA 2MOZA 3MACA 1CHUA 3NRYA 2QRXA 2NWBA 3AE5A 3C4WA 4YHJA 5AQHB 4ZXLA 3R84B 4CZZB 1IBLT 1MNEA 1MMNA 2V8SV 4DMVA 3ZMUB 3UQ7A 3TLSA 3ZPOA 3AE8A 4IDNA 4DNDA 2FJBA 4LF8T 3RPUA 4DV5T 2PJQA 2KXPB 2YEVC 3CMLA 2WWVA 4DV7T 1OEDB 2XSAA 2WDRA 4JI4T 3ONXA 4AIUA 2X67A 4AXPA 5L4EA 5LHGB 4KI0F 4KP3C 2ZM0A 3N5LA 3N9MA 3WAJA 5IWAT 2SPCA 3GMIA 2XQ7A 5IYZE 2CHOA 4DBQA 1UUSA 2ODVA 4DR4T 4BA9A 4H9QC 2KINB 2IHR1 3QC9A 4DMWA 3KVAA 4LFAT 4ANJA 2GK9A 2A2FX 3FXEB 1E1HB 3CX7B 4IDQA 1NENA 5AQVB 1UURA 1US7B 5FXXA 5LGTB 2UXBT 1NAFA 2HN1A 2XQ8A 5C3JA 1HCIA 1YKHB 4I50E 4P0BA 4CI2B 2BBHA 4KBMB 5FXVA 2WDVA 4B3MT 4QXCB 2DHRA 2ES0A 2DL1A 3ZJ2A 4JBWF 3E22E 5HEGA 3JAFA 3CVRA 4CXYA 2JPFA 1YXRA 3Q5DA 3LJCA 4IHJE 1J5WA 4X1IE 4TV8E 1LVKA 4PW8A 1L0VA 4EXTA 5AQKB 2VURA 4JYAT 3U3IA 5LB7B 3ZC0A 2KWIB 2N1GA 5EZYE 2UXDT 2MYSA 3AE4A 2W0GA 1HTJF 3PUSA 3ZJ1A 3CQGB 2X9XA 2R6GF 3V5SA 3HI2A 4H9NC 4EZHA 1D1AA 3OTOT 5H6QB 5LMUT 2E9XA 4X62T 4KHPT 3CQCB 5JR9A 5IUXA 1FMWA 1S35A 1HFAA 2BG9C 3I9YA 2V7LA 4O2AE 1QUUA 4P09A 2CLYB 4QH5A 4IDPA 4X5TA 4UR9A 3O1IA 4PK4A 3AAIA 2VVNA 3OBVE 5ADXL 3P4RA 3S4UA 2BDEA 2WP9A 3OYZA 2PFVA 5HXRA 2JRKA 5CGMA 3B5MA 2IW5B 4U33A 3A8YC 1YQ4A 5KDMC 3PUXF 1T8BA 1JNRA 4IDZA 4JEHB 3PTRB 3RYFE 4QXBB 4QH1A 1YW0A 3OPCA 2H89A 2NOXA 3HKCE 2N9DA 4G63A 4H9SE 4CN6A 4DUZT 2HPJA 5LMNT 3RIUA 3PDYA 4U72A 2BKPA 4MBQA 4O4HE 3UQ4A 2P9BA 2X66A 2Y6XA 1GQEA 3GA8A 3HKEE 4TX5A 5IHYA 3VRAA 5LGUB 5FL0A 5EK3A 1KEYA 3AXJA 2BBJA 3UU5A 2WS3A 3LFMA 5AQFB 5ABFA 4NXMT 2KLQA 2DCFA 4DV4T 3B13A 3GWHA 3RRWA 4UV9B 3I9WA 3NRXA 4IE6A 4ERRA 3Q2MA 5FYMA 4AQGA 2VL8A 4WYVA 3QNUA 4BJMA 4TN7B 3EABA 5EK2A 4A56A 4F6RC 2I0MA 5E0OA 4CI3B 3AA6B 4IDOA 5AQMB 1HNWT 1IJ5A 4ZS2A 4IT4A 5LG4A 4DR1T 2IMLA 4PJNA 1E7PA 3N9NA 4YXDA 3I0QA 2E2AA 4ZI7E 5JDFA 4LF6T 5F3JA 4GKKT 3AEEA 2I6HA 1R8IA 2C0SA 3EDUA 1ZKEA 2KT9A 5CJ5A 2IAKA 4WW0A 3NBXX 2ACXA 4DV1T 4MLKA 2CA5A 3L09A 2B1EA 3J7Yq 2J4GA 2XM1A 5AQIB 2K48A 4GK0E 4EYYR 5TAOA 2LSIA 1SHZC 1LKXA 4QX7B 5HXHA 4JI7T 4IL9A 4COFA 2VKHA 3IA3A 3UU4A 5AFUL 5GONE 1S94A 2CCQA 2YK0A 5LA6E 2H7OA 3K3OA 4ZOLE 2C5IT 5LYJE 3CIRA 4UF0A 1HR0T 4IE5A 4YFSA 1Z8UA 4JI6T 5HEHA 4XBFB 4I55E 5FL1A 4U31A 3X1DA 3SFDA 2LSGA 3D0TA 3EAMA 2L3LA 3LSVA 3UU6A 4HWFA 2LRLA 4DUYT 5KX5E 4XZCA 2MTQA 3K8PC 4F8HA 1LVFA 4HFBA 3FZLB 2LM9A 2XAGB 3P4QA 3ZEFB 1D0XA 2LE8A 2XAHB 3MZKB 3K1SA 5JDQA 3IEEA 1W9RA 4AQYT 3I1AA 2KNDA 5DJQC 4YY3T 4ZI2C 4PK6A 2XAJB 2UUBT 4LF5T 2ODUA 5JREA 1D1CA 3E0ZA 2D0TA 2RP4A 4DO0A 2WMNA 2LSKA 4EZ4A 5JR9B 4UVAB 2C5JA 3VRBA 2L8KA 1OEDC 4IREA 5HXCA 2CWYA 4UELA 3RIUC 3WI3A 3O9XA 1HF8A 5FMNA 2JQ9A 4ILUA 1YKEB 2V1DB 2J1DG 2NR4A 2Q9QA 3HL6A 2WB5A 4O2BE 3ANWB 4XAXB 4J2CA 4DV0T 1IAPA 4QH4A 4Z8XA 3RLFF 1G73A 2IC9A 3H3AA 3RYIE 3UUMA 1XDOA 3KFWX 4DR2T 3BK9A 1XWMA 3ZCJA 2WMOA 2UU9T 3IF8B 3SRZA 2WQYA 3KINB 1D0ZA 3I0OA 3P4SA 4CN4A 1W0BA 2CXLA 3ZN0B 2D9DA 4PNIA 3ZSSA 3VKHA 3C4ZA 3PUGA 4IIJE 5FKYA 2WM9A 3Q5EA 4ZI3D 5L3GB 1HNZT 2NW7A 4U2ZA 1KFYA 1MMDA 2FJAA 2WZIA 4NPPA 4NUVA 2ZM2A 3QOFA 5HWYA 5LOVE 3RIFA 3ZYKA 2NW8A 2V7KA 1ZHCA 3PU3A 4IE0A 4AKRB 4YSXA 4DV2T 2LKGA 3UFGA 3JCFA 4DR5T 4LMLA 5HCJA 3H3MA 4Q25A 3RX6A 2YU2A 4ISTA 2YDQA 1N33T 4TNVA 2CWOA 2FJEA 1FIOA 4K0UA 3ZMZB 3AE7A 5C2TA 3FHNA 3ETUA 1KNZA 2XQ9A 1W0AA 2XAQB 1HX1B 5L3DB 4O4LE 2E9XD 3P4WA 3FZMB 2OLTA 2QVAA 5HXEA 1FMVA 2CHNA 2UXNB 2X9WA 4ZI3C 4U3CA 1HX8A 2JIWA 1J1JA 1QLBA 3AAAB 2WSSV 2X9YA 3AE2A 3EI0A 2J47A 4KHZF 4TWFA 5ETWA 1CUNA 3ZMVB 2LRKA 4H9PC 2XAFB 1Y64B 3KVBA 4ISSA 3FB2A 2V5DA 4HWIB 3ABVA 3KV6A 5ABGA 1VCTA 2LHNA 3RGLA 5HWXA 3E08A 2W62A 2NTXA 3C4XA 2DWGA 5AQPB 2WZHA 3UUXB 1OXZA 3JC6D 5AQOB 4EYUA 3AEFA 3SWHA 4E7SA 3TLUA 3CK6A 3RKOA 1IJ6A 2VVSA 2BVMA 4OFZA 5JR9C 1NWMX 2JQKA 2W63A 2XZEA 2LT3A 5LBQB 1MIVA 4ADZA 2B76A 4JLEA 2K9AA 5JRCB 4MALA 5L3BB 2YOEA 2WBLA 3F57A 4CN1A 3ETVA 3AB3B 2MAWA 3Q9DA 3M65A 1DU2A 2CLYC 4JI2T 3N2OA 3Q5WA 2WWUA 3A5XA 3OKQA 3ZMSB 3K3NA 2YKSA 5FXZA 2E5VA 1U4QA 1WCRA 2IC6A 3BQLA 1X9BA 2M6IA 2HHHT 5EK4A 4HE8A 3WAKA 5JQGE 1ZEEA 3ONJA 4WNKA 1MMAA 4ZZBA 1E2AA 2DLRA 4CI1B 4KMCA 2UUAT 1N36T 1HG2A 2VASA 1T72A 1YD8G 2JMKA 2XQ3A 2RPAA 2MBGA 1XDPA 2E9XC 1KNRA 2QGSA 4PJMA 1BR4A 3HR0A 2BS3A 4I4TE 2K24A 2XQAA 2ZM6T 2BG9A 2DWKA 2XQYA 1WR6A 5AQTB 4HFCA 2V26A 1FJGT 5JDHA 1NEKA 5A1LA 4NIQA 5FY0A 5AQGB 3P8CD 3AXJB 2WU5A 2HPLA 2PG8A 2LLYA 3CPZA 2QYWA 3MXZA 4PAGA 5J0ZA 4B3TT 1Z0PA 5BR8T 4L5GA 4YTPA 4JI3T 2E8IA 4L9IA 3UFEA 2BS4A 4BAYB 5C8YE 1MIWA 4JUYA 1VRBA 4HEAA 5JVDE 5L3EB 2X0YA 3CWZB 4AKGA 3LK42 2LEHA 3QUJA 5HAXA 4E7ZA 5JTGA 2ZLYA 4LF4T 3BQIA 4PFPA 3RF1A 3ZN1B 3ZT7A 3M3ZB 4PK5A 2XUEA 3MA9A 3QB5K 4UVBB 5AQJB 2DI4A 3C64A 3DJBA 1WLXA 4OK0A 4QX8B 5LHIB 2Q9QD 4BJNA 4YHHT 1ZP0A 4V1Av 4OX9T 4CXXA 4K0KT 2W61A 3P7IA 4MFRA 3AVRA 4ILBA 5DABA 4EIWA 5CA1E 4UV8B 4DV6T 3AE1A 4EAHA 4AKIA 4DVDA 1J5ET 3U78A 2CXDA 2XHEB 2NP9A 2XPKA 1UGOA 4H9RC 4YSZA 2VKDA 5CFBA 5LP6E 2W00A 4NXNT 5J1GA 3UT5E 4U7YA 3AA1B 2FBWA 2CEAA 4X1YE 2CM0A 4I0UA 2VK9A 4H63H 3LDQB 3LBXB 4TWHA 3H37A 3NZQA 3SS1A 2M67A 3J9X1 1IBMT 1XMOT 1QSDA 4GIWA 4AI6A 2RA1A 4EEDA 3HKDE 4YJ3E 2LM2A 2Q9QB 2JQQA 5DQVA 5LHHB 3ZLIA 2M6BA 2XSBA 3V5UA 2E5LT 1BR0A 3EHZA 2BZBA 5LBMA 5HXSA 1XNQT 4H63V 2HH7A 4WBOA 4B6XA 4ILAA 4I43B 2PBIA 2W67A 4JI0T 1HG5A 4MHCA 2V7JA 2NW9A 1I94T 1FEWA 1XNRT 3AE3A 3RQUA 2A9UA 2CMRA 2JMHA 2WAUA 3RHWA 3SOLA 3ZYLA 1WFDA 4U74A 3CX6B 3AE6A 3NVOA 4NUUA 3RC3A 2LHRA 3UTKA 4X20E 5L2LA 2UUCT 2F4VT 3JADA 4IGUA 4P0AA 3ZYMA 1OEDE 4GYSA 4HFIA 5JDNA 3ZT5A 2J62A 3T8OA 4A98A 4GKJT 4O4IE 1HS7A 5JH7E 1IBKT 3FXDB 2XJ7A 2KMFA 4EB6E 4TUYE 2LKHA 2QA7A 5CA0E 5LJNA 3ZC1A 2V6XA 3PUQA 2HN2A 3HKBE 3OJAA 5FNVE 5FP3A 2A3DA 5L4HA 5ABEA 3N2KE 1D1BA 4DBRA 2KSRA 4PJLA 2IIUA 3W15B 5HCMA 1N34T 3T1HT 3CKDA 2YDSA 2CRBA 4IE4A 3BQKA 4AKLA 5L3CB 1KNPA 1WYCA 3A7MA 5HEUA 2EHOB 2UXXB 2V6YA 2PTFA 4QHOA 2BG9E 1V9DA 3QB5A 4FJOA 3AVSA 1D0YA 4U7IA 4UF0B 2UXCT 1XMQT 4HWHA 3C50A 4Z90A 2EHOD 4DR6T 1XZYA 1AJ3A 5AQSB 3EVYA 4PJJA 2H88A 2EHOA 3KV5A 1H7CA 3RI5A 2OV9A 3UUBA 1YQ3A 3IHRA 2BKOA 2D2SA 2X9HA 4HWCA 5F5WA 4DR7T 2LJLA 2W4XA 2X51A 1T98A 3JAEA 3KBUA 2ACZA 4QXHB 3VHLA 4CXWA 2V7IA 3ZCIA 3RQWA 4IL4A 5J2UE 4JI1T 3PUWF 3RRCA 2D5UA 3PURA 3AEGA 2K5BB 2XQ5A 3P50A 4KX6A 1N32T 2LSYA 3KV9A 5JDGA 4LF9T 2BS2A 5L3FB 3ESLA 3L39A 3NKZA 4A97A 2H3RA 3AEBA 3F2EA 1I6ZA 3PUAA 3P4PA 3NZPA 3AE9A 1VOMA 1JNZA 2WDQA 4OYKA 4HFVA 4AISA 4ZI2D 1B7TA 3ANWA 3KV4A 5AQNB 1BR1A 3TKLB 2CE7A 4AKHA 4L0RA 2XQ4A 3O1JA 1UK5A 4GYRA 4KUMB 3R6NA 2N2NA 5HYAA 5AQRB 3UULA 5BMVE 5HEJA 2CXFA 2EHOC 2W66A 3LBXA 5FY1A 4TWDA 3JC6C 2VKOA 5LG3A 1T7SA 4HWDA 3N2GE 1WR0A 3EUHA 1MIYA 4HTEA 5FVKA 3RKGA 3RYCE 4AQFA 5ABFB 4LFBT 2LOPA 3LK3B 5LCYA 2X0HA 2Z6EA 4M1PA 4C91A 3AECA 4HKAA 2WY2A 3AAEB 1VCSA 4X1KE 3L8RA 2BG9B 4YTNA 3MK7C 4H9OC 4B3ST 4HN9A 4JEUB 4ZS3A 2FJDA 1BR2A 4P1NA 1UCUA 3RIAA 4ILCA 1OWAA 3AEDA 4LFCT 2D0UA
chains in the Genus database with same CATH topology
2XTLA 4TZ4C 5KMGP 3OYXA 5JRCA 2ZM8A 3LG7A 4UVCB 3L3PA 4GK5E 5M4YA 4OHFA 1SA0E 2YU1A 4UEMA 3EDVA 5CB4E 3RYHE 2JJ9A 3FBLA 3QK6A 2E9XB 4YLHA 2V7MA 5LNKA 3KDSE 2OA5A 4QKNA 4O8SA 2LSJA 1IZNB 3N9QA 5LJMA 2KZ7B 5J2TE 3RC8A 3O4XE 2I59A 1UX5A 3AA7B 2Y48B 1WYBA 4PFOA 2VWAA 1KK7A 2X68A 3DP7A 3KBTA 4QWNB 2H7VC 4ASKA 2C5KT 3Q5XA 4ZHQE 5JDMA 3N9LA 3MJXA 2NTYA 2KWHA 2XASB 2A72A 3GN5A 1WRDA 3HA4A 3IBPA 4IE7A 5H6RB 3DTOA 5JDLA 2ZMAA 5FY7A 5F8PA 3C51A 2VKJA 3ZMTB 4UIGA 3VKGA 3RH3A 4G2AA 3GN5B 3CQXC 3PE0A 3VU7H 4YJ2E 4O4JE 4OYJA 4GOUA 1X79A 2X0LB 3CX8B 3LK2B 5FXWA 4AQFC 4CQIA 5LXTE 4XBFB 1ZV4X 3N9PA 1UX4A 3AA0B 3O1HA 1MMGA 1U5PA 2L9QA 5LGNB 1O3XA 3K3QC 4WBNE 1LRZA 4UXNB 4N78D 4C90A 2VB6A 3B57A 2YINA 3UUNA 4TV9E 2BVLA 2LOSA 3MKDA 3N9OA 2DNXA 4EOZB 3F31A 2Y8DA 4FI5A 3FBZA 1G8XA 1EZ3A 3PU8A 2Q9QC 1MNDA 5DQWA 4HGAA 3C98B 2G0UA 2MOZA 3MACA 3NRYA 2NWBA 4CZZB 3C4WA 4YHJA 3R84B 1MNEA 1MMNA 4DMVA 3ZMUB 3ZPOA 4DNDA 3RPUA 2PJQA 2KXPB 2YEVC 3CMLA 3ONXA 2X67A 4AXPA 5LHGB 4KP3C 2ZM0A 3N5LA 3N9MA 3WAJA 2SPCA 3GMIA 5IYZE 4DBQA 2ODVA 4BA9A 4H9QC 2KINB 3QC9A 4DMWA 3KVAA 4ANJA 2GK9A 2A2FX 3FXEB 1E1HB 3CX7B 1US7B 5FXXA 5LGTB 1NAFA 1HCIA 1YKHB 4I50E 4P0BA 4CI2B 4KBMB 5FXVA 4QXCB 2DHRA 2ES0A 3E22E 3CVRA 4CXYA 2JPFA 3LJCA 4IHJE 4X1IE 4TV8E 1LVKA 4PW8A 4EXTA 3U3IA 3ZC0A 2KWIB 2N1GA 5EZYE 2MYSA 3ZJ1A 2W0GA 1HTJF 3PUSA 3CQGB 2X9XA 4EZHA 3V5SA 3HI2A 4H9NC 1D1AA 5H6QB 2E9XA 3CQCB 5JR9A 1FMWA 1S35A 1HFAA 3I9YA 2V7LA 4O2AE 1QUUA 4P09A 2CLYB 3O1IA 4PK4A 3AAIA 3OBVE 5ADXL 3S4UA 2BDEA 3OYZA 2PFVA 5HXRA 2JRKA 2IW5B 5KDMC 4JEHB 3RYFE 4IDZA 3PTRB 4QXBB 1YW0A 2NOXA 3HKCE 2N9DA 4G63A 4H9SE 2HPJA 3PDYA 4U72A 4MBQA 4O4HE 2P9BA 2X66A 2Y6XA 3GA8A 4TX5A 3HKEE 5IHYA 5LGUB 5EK3A 3LFMA 2KLQA 2DCFA 3B13A 3GWHA 3RRWA 4UV9B 3I9WA 3NRXA 4IE6A 4ERRA 3Q2MA 5FYMA 4AQGA 2VL8A 4BJMA 4TN7B 5EK2A 4A56A 4F6RC 5E0OA 4CI3B 3AA6B 1IJ5A 4ZS2A 5LG4A 4PJNA 3N9NA 3I0QA 4ZI7E 5JDFA 5F3JA 2C0SA 3EDUA 1ZKEA 2KT9A 2IAKA 4WW0A 3NBXX 2ACXA 4MLKA 2CA5A 3L09A 2B1EA 3J7Yq 2K48A 4GK0E 4EYYR 5TAOA 2LSIA 1SHZC 1LKXA 4QX7B 5HXHA 2VKHA 5AFUL 5GONE 1S94A 2CCQA 2YK0A 5LA6E 2H7OA 3K3OA 4ZOLE 2C5IT 5LYJE 4UF0A 4IE5A 4YFSA 4I55E 2LSGA 3D0TA 2L3LA 5KX5E 4XZCA 2MTQA 3K8PC 1LVFA 3ZEFB 2LM9A 2XAGB 1D0XA 2LE8A 2XAHB 3MZKB 5JDQA 3IEEA 3I1AA 2KNDA 5DJQC 4ZI2C 4PK6A 2XAJB 2ODUA 5JREA 1D1CA 3E0ZA 2D0TA 2RP4A 4DO0A 2WMNA 2LSKA 4EZ4A 5JR9B 4UVAB 2C5JA 2L8KA 3O9XA 5HXCA 2CWYA 4UELA 3WI3A 1HF8A 5FMNA 4ILUA 1YKEB 2V1DB 2J1DG 2Q9QA 3HL6A 4O2BE 3ANWB 4XAXB 4J2CA 1IAPA 4Z8XA 1G73A 2IC9A 3H3AA 3RYIE 3UUMA 3KFWX 3BK9A 3ZCJA 2WMOA 3IF8B 3SRZA 3KINB 1D0ZA 3I0OA 2CXLA 3ZN0B 4PNIA 3VKHA 3C4ZA 3PUGA 4IIJE 2WM9A 4ZI3D 5L3GB 2NW7A 3ZJ2A 1MMDA 3ZYKA 4NUVA 5HWYA 2ZM2A 5LOVE 2NW8A 2V7KA 1ZHCA 3PU3A 4IE0A 4AKRB 3RX6A 2YU2A 4ISTA 2CWOA 1FIOA 4K0UA 3ZMZB 3FHNA 3ETUA 1KNZA 2XAQB 5L3DB 4O4LE 2E9XD 5HXEA 1FMVA 2UXNB 2X9WA 4ZI3C 1HX8A 3AAAB 2WSSV 2X9YA 5ETWA 3ZMVB 1CUNA 4H9PC 2XAFB 1Y64B 3KVBA 4ISSA 3FB2A 3KV6A 2LHNA 5HWXA 3E08A 2W62A 2NTXA 3C4XA 2DWGA 3UUXB 1OXZA 3JC6D 4EYUA 3SWHA 4E7SA 3RKOA 1IJ6A 5JR9C 2BVMA 4OFZA 1NWMX 2W63A 2LT3A 5LBQB 1MIVA 4ADZA 4JLEA 2K9AA 5JRCB 4MALA 5L3BB 2WBLA 3F57A 3ETVA 3AB3B 3Q9DA 3M65A 2CLYC 3N2OA 3Q5WA 2WWUA 3A5XA 3OKQA 3ZMSB 3K3NA 5FXZA 2IC6A 1U4QA 3BQLA 5EK4A 4HE8A 3WAKA 5JQGE 1ZEEA 4WNKA 1MMAA 4CI1B 2DLRA 4KMCA 1HG2A 2VASA 1YD8G 2JMKA 2MBGA 2E9XC 2QGSA 4PJMA 1BR4A 3HR0A 4I4TE 2K24A 2DWKA 2XQYA 1WR6A 2V26A 5JDHA 5A1LA 5FY0A 3P8CD 2HPLA 2PG8A 3CPZA 3MXZA 4PAGA 1Z0PA 4L5GA 2E8IA 4L9IA 3UFEA 4BAYB 5C8YE 1BR0A 1MIWA 4JUYA 1VRBA 4HEAA 5JVDE 5L3EB 4AKGA 3CWZB 3LK42 2LEHA 3QUJA 5HAXA 4E7ZA 2ZLYA 3BQIA 4PFPA 3ZN1B 4PK5A 2XUEA 3MA9A 4UVBB 2DI4A 3C64A 3DJBA 1WLXA 4OK0A 4QX8B 5LHIB 2Q9QD 4BJNA 4V1Av 4CXXA 2W61A 3P7IA 4MFRA 3AVRA 5DABA 4EIWA 5CA1E 4UV8B 4EAHA 4AKIA 4DVDA 3U78A 2CXDA 2XHEB 2NP9A 4H9RC 2VKDA 5LP6E 2W00A 5J1GA 3UT5E 3AA1B 2CEAA 4X1YE 2CM0A 2VK9A 4H63H 3LBXB 3H37A 3NZQA 3SS1A 2M67A 3J9X1 1QSDA 4GIWA 4AI6A 2RA1A 3HKDE 4YJ3E 2Q9QB 2JQQA 5DQVA 5LHHB 3ZLIA 3V5UA 5HXSA 2BZBA 5LBMA 4H63V 2HH7A 4WBOA 4B6XA 4I43B 2PBIA 1HG5A 4MHCA 2V7JA 2NW9A 1FEWA 3ZYLA 2JMHA 2CMRA 3SOLA 2WAUA 4U74A 3CX6B 3RC3A 4NUUA 5L2LA 2LHRA 3UTKA 4X20E 4P0AA 4IGUA 3ZYMA 5JDNA 4GYSA 3T8OA 1HS7A 4O4IE 5JH7E 3FXDB 4EB6E 2KMFA 4TUYE 5CA0E 2QA7A 5LJNA 3ZC1A 3PUQA 3HKBE 3OJAA 5FNVE 5FP3A 2A3DA 3N2KE 1D1BA 4DBRA 4PJLA 3W15B 3CKDA 4IE4A 5L3CB 3BQKA 4AKLA 1WYCA 2EHOB 2UXXB 4QHOA 1V9DA 4FJOA 4UF0B 3AVSA 1D0YA 3C50A 2EHOD 1AJ3A 3EVYA 4PJJA 3KV5A 2EHOA 1H7CA 3IHRA 2D2SA 2X9HA 2LJLA 3VHLA 2X51A 1T98A 3KBUA 4QXHB 4CXWA 2V7IA 3ZCIA 5J2UE 3RRCA 2D5UA 3PURA 2K5BB 2LSYA 3KV9A 5JDGA 5L3FB 3ESLA 2H3RA 3F2EA 3PUAA 3NZPA 4OYKA 1VOMA 4ZI2D 4HFVA 1B7TA 3ANWA 3KV4A 3TKLB 1BR1A 2CE7A 4AKHA 4L0RA 3O1JA 4KUMB 3R6NA 4GYRA 5HYAA 2N2NA 5BMVE 3UULA 2CXFA 2EHOC 3LBXA 5FY1A 3JC6C 2VKOA 4AQFA 3N2GE 4HTEA 3EUHA 1MIYA 3RYCE 2LOPA 3LK3B 5LCYA 2Z6EA 4M1PA 4C91A 4HKAA 3AAEB 4X1KE 3MK7C 4H9OC 4HN9A 4JEUB 4ZS3A 1BR2A 1UCUA 1OWAA 2D0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONX A;  3OKQ A; 
#chains in the Genus database with same CATH topology
 1Y01 A;  2XTL A;  3PJA A;  3OYX A;  4TZ4 C;  2ZM8 A;  3LG7 A;  5KMG P;  5JRC A;  2IUB A;  4WZX A;  4UVC B;  3L3P A;  3VR9 A;  4Z91 A;  4GK5 E;  5M4Y A;  3PUV F;  4OHF A;  1SA0 E;  2YU1 A;  1M7K A;  4UEM A;  3EDV A;  1OED A;  5CB4 E;  3RYH E;  2JJ9 A;  3FBL A;  4HFE A;  4EGW A;  2IDO B;  2AXD S;  3QK6 A;  4ZZC A;  2YDR A;  2E9X B;  4YLH A;  4JI5 T;  2V7M A;  3ZT6 A;  5LNK A;  3SFE A;  3PUZ F;  2YN6 A;  4DR3 T;  3KDS E;  2OA5 A;  4QKN A;  4O8S A;  2LSJ A;  1IZN B;  3N9Q A;  5HEO A;  5FVL A;  5LJM A;  2K3W A;  2CBI A;  2FUP A;  2KZ7 B;  1KF6 A;  4EV6 A;  5J2T E;  3RC8 A;  2XQ6 A;  3O4X E;  2BKN A;  2I59 A;  1UX5 A;  3AA7 B;  4JV5 T;  2Y48 B;  1WYB A;  4PFO A;  1ZOY A;  4A5X A;  2VWA A;  2XY8 B;  3FZH B;  1KK7 A;  2X68 A;  2XM2 A;  3DP7 A;  3KBT A;  5L47 A;  4HFH A;  4JI8 T;  2WU2 A;  2H7V C;  4QWN B;  2C5K T;  4ASK A;  4B3R T;  3TLV A;  3Q5X A;  3T1Y T;  4ZHQ E;  5JDM A;  3N9L A;  4U2Y A;  3AEA A;  3MJX A;  2VL0 A;  2NTY A;  3OVU A;  2KWH A;  2XAS B;  2A72 A;  3GN5 A;  1WRD A;  3HA4 A;  3IBP A;  4IE7 A;  5H6R B;  3DTO A;  4EEB A;  5JDL A;  2ZMA A;  5FY7 A;  5F8P A;  4X64 T;  3C51 A;  5AQQ B;  2VKJ A;  3ONL C;  3PJA J;  4HFD A;  4LMJ A;  3ZMT B;  2W2U A;  3UU8 A;  4UIG A;  4DID B;  3VKG A;  3RH3 A;  4G2A A;  3GN5 B;  4TNW A;  4ZEY A;  3CQX C;  3PE0 A;  3VU7 H;  4YJ2 E;  4O4J E;  4OYJ A;  4GOU A;  1X79 A;  2X0L B;  3CX8 B;  2JQH A;  3LK2 B;  5FXW A;  4AQF C;  4CQI A;  3VR8 A;  5LXT E;  1ZV4 X;  3N9P A;  3PUY F;  2V5C A;  3UU3 A;  1UX4 A;  3AA0 B;  3O1H A;  1HNX T;  1MMG A;  2MPK A;  1U5P A;  2L9Q A;  3FZF B;  5LGN B;  1O3X A;  3K3Q C;  4WBN E;  1LRZ A;  3FZK B;  4UXN B;  4N78 D;  3ZKR A;  5AQU B;  5KXJ A;  4C90 A;  3NWI A;  3TLW A;  2VB6 A;  3B57 A;  2YIN A;  3UUN A;  4YT0 A;  2CBJ A;  4TV9 E;  4YSY A;  3G06 A;  4LMK A;  4X65 T;  4LF7 T;  4X66 T;  3ZST A;  2BVL A;  2AE9 A;  2CPT A;  2LOS A;  1W09 A;  2V6Y B;  3MKD A;  2VQE T;  3N9O A;  2DNX A;  2WCA A;  4EOZ B;  1M62 A;  3F31 A;  5ABH A;  1SUM B;  5AQL B;  2Y8D A;  4FI5 A;  3TLT A;  3FBZ A;  1SE7 A;  1G8X A;  1EZ3 A;  3PU8 A;  4YTM A;  2Q9Q C;  1MND A;  5DQW A;  4DV3 T;  3PV0 F;  4HGA A;  2VQF T;  3C98 B;  2G0U A;  2MOZ A;  3MAC A;  1CHU A;  3NRY A;  2QRX A;  2NWB A;  3AE5 A;  3C4W A;  4YHJ A;  5AQH B;  4ZXL A;  3R84 B;  4CZZ B;  1IBL T;  1MNE A;  1MMN A;  2V8S V;  4DMV A;  3ZMU B;  3UQ7 A;  3TLS A;  3ZPO A;  3AE8 A;  4IDN A;  4DND A;  2FJB A;  4LF8 T;  3RPU A;  4DV5 T;  2PJQ A;  2KXP B;  2YEV C;  3CML A;  2WWV A;  4DV7 T;  1OED B;  2XSA A;  2WDR A;  4JI4 T;  3ONX A;  4AIU A;  2X67 A;  4AXP A;  5L4E A;  5LHG B;  4KI0 F;  4KP3 C;  2ZM0 A;  3N5L A;  3N9M A;  3WAJ A;  5IWA T;  2SPC A;  3GMI A;  2XQ7 A;  5IYZ E;  2CHO A;  4DBQ A;  1UUS A;  2ODV A;  4DR4 T;  4BA9 A;  4H9Q C;  2KIN B;  2IHR 1;  3QC9 A;  4DMW A;  3KVA A;  4LFA T;  4ANJ A;  2GK9 A;  2A2F X;  3FXE B;  1E1H B;  3CX7 B;  4IDQ A;  1NEN A;  5AQV B;  1UUR A;  1US7 B;  5FXX A;  5LGT B;  2UXB T;  1NAF A;  2HN1 A;  2XQ8 A;  5C3J A;  1HCI A;  1YKH B;  4I50 E;  4P0B A;  4CI2 B;  2BBH A;  4KBM B;  5FXV A;  2WDV A;  4B3M T;  4QXC B;  2DHR A;  2ES0 A;  2DL1 A;  3ZJ2 A;  4JBW F;  3E22 E;  5HEG A;  3JAF A;  3CVR A;  4CXY A;  2JPF A;  1YXR A;  3Q5D A;  3LJC A;  4IHJ E;  1J5W A;  4X1I E;  4TV8 E;  1LVK A;  4PW8 A;  1L0V A;  4EXT A;  5AQK B;  2VUR A;  4JYA T;  3U3I A;  5LB7 B;  3ZC0 A;  2KWI B;  2N1G A;  5EZY E;  2UXD T;  2MYS A;  3AE4 A;  2W0G A;  1HTJ F;  3PUS A;  3ZJ1 A;  3CQG B;  2X9X A;  2R6G F;  3V5S A;  3HI2 A;  4H9N C;  4EZH A;  1D1A A;  3OTO T;  5H6Q B;  5LMU T;  2E9X A;  4X62 T;  4KHP T;  3CQC B;  5JR9 A;  5IUX A;  1FMW A;  1S35 A;  1HFA A;  2BG9 C;  3I9Y A;  2V7L A;  4O2A E;  1QUU A;  4P09 A;  2CLY B;  4QH5 A;  4IDP A;  4X5T A;  4UR9 A;  3O1I A;  4PK4 A;  3AAI A;  2VVN A;  3OBV E;  5ADX L;  3P4R A;  3S4U A;  2BDE A;  2WP9 A;  3OYZ A;  2PFV A;  5HXR A;  2JRK A;  5CGM A;  3B5M A;  2IW5 B;  4U33 A;  3A8Y C;  1YQ4 A;  5KDM C;  3PUX F;  1T8B A;  1JNR A;  4IDZ A;  4JEH B;  3PTR B;  3RYF E;  4QXB B;  4QH1 A;  1YW0 A;  3OPC A;  2H89 A;  2NOX A;  3HKC E;  2N9D A;  4G63 A;  4H9S E;  4CN6 A;  4DUZ T;  2HPJ A;  5LMN T;  3RIU A;  3PDY A;  4U72 A;  2BKP A;  4MBQ A;  4O4H E;  3UQ4 A;  2P9B A;  2X66 A;  2Y6X A;  1GQE A;  3GA8 A;  3HKE E;  4TX5 A;  5IHY A;  3VRA A;  5LGU B;  5FL0 A;  5EK3 A;  1KEY A;  3AXJ A;  2BBJ A;  3UU5 A;  2WS3 A;  3LFM A;  5AQF B;  5ABF A;  4NXM T;  2KLQ A;  2DCF A;  4DV4 T;  3B13 A;  3GWH A;  3RRW A;  4UV9 B;  3I9W A;  3NRX A;  4IE6 A;  4ERR A;  3Q2M A;  5FYM A;  4AQG A;  2VL8 A;  4WYV A;  3QNU A;  4BJM A;  4TN7 B;  3EAB A;  5EK2 A;  4A56 A;  4F6R C;  2I0M A;  5E0O A;  4CI3 B;  3AA6 B;  4IDO A;  5AQM B;  1HNW T;  1IJ5 A;  4ZS2 A;  4IT4 A;  5LG4 A;  4DR1 T;  2IML A;  4PJN A;  1E7P A;  3N9N A;  4YXD A;  3I0Q A;  2E2A A;  4ZI7 E;  5JDF A;  4LF6 T;  5F3J A;  4GKK T;  3AEE A;  2I6H A;  1R8I A;  2C0S A;  3EDU A;  1ZKE A;  2KT9 A;  5CJ5 A;  2IAK A;  4WW0 A;  3NBX X;  2ACX A;  4DV1 T;  4MLK A;  2CA5 A;  3L09 A;  2B1E A;  3J7Y q;  2J4G A;  2XM1 A;  5AQI B;  2K48 A;  4GK0 E;  4EYY R;  5TAO A;  2LSI A;  1SHZ C;  1LKX A;  4QX7 B;  5HXH A;  4JI7 T;  4IL9 A;  4COF A;  2VKH A;  3IA3 A;  3UU4 A;  5AFU L;  5GON E;  1S94 A;  2CCQ A;  2YK0 A;  5LA6 E;  2H7O A;  3K3O A;  4ZOL E;  2C5I T;  5LYJ E;  3CIR A;  4UF0 A;  1HR0 T;  4IE5 A;  4YFS A;  1Z8U A;  4JI6 T;  5HEH A;  4XBF B;  4I55 E;  5FL1 A;  4U31 A;  3X1D A;  3SFD A;  2LSG A;  3D0T A;  3EAM A;  2L3L A;  3LSV A;  3UU6 A;  4HWF A;  2LRL A;  4DUY T;  5KX5 E;  4XZC A;  2MTQ A;  3K8P C;  4F8H A;  1LVF A;  4HFB A;  3FZL B;  2LM9 A;  2XAG B;  3P4Q A;  3ZEF B;  1D0X A;  2LE8 A;  2XAH B;  3MZK B;  3K1S A;  5JDQ A;  3IEE A;  1W9R A;  4AQY T;  3I1A A;  2KND A;  5DJQ C;  4YY3 T;  4ZI2 C;  4PK6 A;  2XAJ B;  2UUB T;  4LF5 T;  2ODU A;  5JRE A;  1D1C A;  3E0Z A;  2D0T A;  2RP4 A;  4DO0 A;  2WMN A;  2LSK A;  4EZ4 A;  5JR9 B;  4UVA B;  2C5J A;  3VRB A;  2L8K A;  1OED C;  4IRE A;  5HXC A;  2CWY A;  4UEL A;  3RIU C;  3WI3 A;  3O9X A;  1HF8 A;  5FMN A;  2JQ9 A;  4ILU A;  1YKE B;  2V1D B;  2J1D G;  2NR4 A;  2Q9Q A;  3HL6 A;  2WB5 A;  4O2B E;  3ANW B;  4XAX B;  4J2C A;  4DV0 T;  1IAP A;  4QH4 A;  4Z8X A;  3RLF F;  1G73 A;  2IC9 A;  3H3A A;  3RYI E;  3UUM A;  1XDO A;  3KFW X;  4DR2 T;  3BK9 A;  1XWM A;  3ZCJ A;  2WMO A;  2UU9 T;  3IF8 B;  3SRZ A;  2WQY A;  3KIN B;  1D0Z A;  3I0O A;  3P4S A;  4CN4 A;  1W0B A;  2CXL A;  3ZN0 B;  2D9D A;  4PNI A;  3ZSS A;  3VKH A;  3C4Z A;  3PUG A;  4IIJ E;  5FKY A;  2WM9 A;  3Q5E A;  4ZI3 D;  5L3G B;  1HNZ T;  2NW7 A;  4U2Z A;  1KFY A;  1MMD A;  2FJA A;  2WZI A;  4NPP A;  4NUV A;  2ZM2 A;  3QOF A;  5HWY A;  5LOV E;  3RIF A;  3ZYK A;  2NW8 A;  2V7K A;  1ZHC A;  3PU3 A;  4IE0 A;  4AKR B;  4YSX A;  4DV2 T;  2LKG A;  3UFG A;  3JCF A;  4DR5 T;  4LML A;  5HCJ A;  3H3M A;  4Q25 A;  3RX6 A;  2YU2 A;  4IST A;  2YDQ A;  1N33 T;  4TNV A;  2CWO A;  2FJE A;  1FIO A;  4K0U A;  3ZMZ B;  3AE7 A;  5C2T A;  3FHN A;  3ETU A;  1KNZ A;  2XQ9 A;  1W0A A;  2XAQ B;  1HX1 B;  5L3D B;  4O4L E;  2E9X D;  3P4W A;  3FZM B;  2OLT A;  2QVA A;  5HXE A;  1FMV A;  2CHN A;  2UXN B;  2X9W A;  4ZI3 C;  4U3C A;  1HX8 A;  2JIW A;  1J1J A;  1QLB A;  3AAA B;  2WSS V;  2X9Y A;  3AE2 A;  3EI0 A;  2J47 A;  4KHZ F;  4TWF A;  5ETW A;  1CUN A;  3ZMV B;  2LRK A;  4H9P C;  2XAF B;  1Y64 B;  3KVB A;  4ISS A;  3FB2 A;  2V5D A;  4HWI B;  3ABV A;  3KV6 A;  5ABG A;  1VCT A;  2LHN A;  3RGL A;  5HWX A;  3E08 A;  2W62 A;  2NTX A;  3C4X A;  2DWG A;  5AQP B;  2WZH A;  3UUX B;  1OXZ A;  3JC6 D;  5AQO B;  4EYU A;  3AEF A;  3SWH A;  4E7S A;  3TLU A;  3CK6 A;  3RKO A;  1IJ6 A;  2VVS A;  2BVM A;  4OFZ A;  5JR9 C;  1NWM X;  2JQK A;  2W63 A;  2XZE A;  2LT3 A;  5LBQ B;  1MIV A;  4ADZ A;  2B76 A;  4JLE A;  2K9A A;  5JRC B;  4MAL A;  5L3B B;  2YOE A;  2WBL A;  3F57 A;  4CN1 A;  3ETV A;  3AB3 B;  2MAW A;  3Q9D A;  3M65 A;  1DU2 A;  2CLY C;  4JI2 T;  3N2O A;  3Q5W A;  2WWU A;  3A5X A;  3OKQ A;  3ZMS B;  3K3N A;  2YKS A;  5FXZ A;  2E5V A;  1U4Q A;  1WCR A;  2IC6 A;  3BQL A;  1X9B A;  2M6I A;  2HHH T;  5EK4 A;  4HE8 A;  3WAK A;  5JQG E;  1ZEE A;  3ONJ A;  4WNK A;  1MMA A;  4ZZB A;  1E2A A;  2DLR A;  4CI1 B;  4KMC A;  2UUA T;  1N36 T;  1HG2 A;  2VAS A;  1T72 A;  1YD8 G;  2JMK A;  2XQ3 A;  2RPA A;  2MBG A;  1XDP A;  2E9X C;  1KNR A;  2QGS A;  4PJM A;  1BR4 A;  3HR0 A;  2BS3 A;  4I4T E;  2K24 A;  2XQA A;  2ZM6 T;  2BG9 A;  2DWK A;  2XQY A;  1WR6 A;  5AQT B;  4HFC A;  2V26 A;  1FJG T;  5JDH A;  1NEK A;  5A1L A;  4NIQ A;  5FY0 A;  5AQG B;  3P8C D;  3AXJ B;  2WU5 A;  2HPL A;  2PG8 A;  2LLY A;  3CPZ A;  2QYW A;  3MXZ A;  4PAG A;  5J0Z A;  4B3T T;  1Z0P A;  5BR8 T;  4L5G A;  4YTP A;  4JI3 T;  2E8I A;  4L9I A;  3UFE A;  2BS4 A;  4BAY B;  5C8Y E;  1MIW A;  4JUY A;  1VRB A;  4HEA A;  5JVD E;  5L3E B;  2X0Y A;  3CWZ B;  4AKG A;  3LK4 2;  2LEH A;  3QUJ A;  5HAX A;  4E7Z A;  5JTG A;  2ZLY A;  4LF4 T;  3BQI A;  4PFP A;  3RF1 A;  3ZN1 B;  3ZT7 A;  3M3Z B;  4PK5 A;  2XUE A;  3MA9 A;  3QB5 K;  4UVB B;  5AQJ B;  2DI4 A;  3C64 A;  3DJB A;  1WLX A;  4OK0 A;  4QX8 B;  5LHI B;  2Q9Q D;  4BJN A;  4YHH T;  1ZP0 A;  4V1A v;  4OX9 T;  4CXX A;  4K0K T;  2W61 A;  3P7I A;  4MFR A;  3AVR A;  4ILB A;  5DAB A;  4EIW A;  5CA1 E;  4UV8 B;  4DV6 T;  3AE1 A;  4EAH A;  4AKI A;  4DVD A;  1J5E T;  3U78 A;  2CXD A;  2XHE B;  2NP9 A;  2XPK A;  1UGO A;  4H9R C;  4YSZ A;  2VKD A;  5CFB A;  5LP6 E;  2W00 A;  4NXN T;  5J1G A;  3UT5 E;  4U7Y A;  3AA1 B;  2FBW A;  2CEA A;  4X1Y E;  2CM0 A;  4I0U A;  2VK9 A;  4H63 H;  3LDQ B;  3LBX B;  4TWH A;  3H37 A;  3NZQ A;  3SS1 A;  2M67 A;  3J9X 1;  1IBM T;  1XMO T;  1QSD A;  4GIW A;  4AI6 A;  2RA1 A;  4EED A;  3HKD E;  4YJ3 E;  2LM2 A;  2Q9Q B;  2JQQ A;  5DQV A;  5LHH B;  3ZLI A;  2M6B A;  2XSB A;  3V5U A;  2E5L T;  1BR0 A;  3EHZ A;  2BZB A;  5LBM A;  5HXS A;  1XNQ T;  4H63 V;  2HH7 A;  4WBO A;  4B6X A;  4ILA A;  4I43 B;  2PBI A;  2W67 A;  4JI0 T;  1HG5 A;  4MHC A;  2V7J A;  2NW9 A;  1I94 T;  1FEW A;  1XNR T;  3AE3 A;  3RQU A;  2A9U A;  2CMR A;  2JMH A;  2WAU A;  3RHW A;  3SOL A;  3ZYL A;  1WFD A;  4U74 A;  3CX6 B;  3AE6 A;  3NVO A;  4NUU A;  3RC3 A;  2LHR A;  3UTK A;  4X20 E;  5L2L A;  2UUC T;  2F4V T;  3JAD A;  4IGU A;  4P0A A;  3ZYM A;  1OED E;  4GYS A;  4HFI A;  5JDN A;  3ZT5 A;  2J62 A;  3T8O A;  4A98 A;  4GKJ T;  4O4I E;  1HS7 A;  5JH7 E;  1IBK T;  3FXD B;  2XJ7 A;  2KMF A;  4EB6 E;  4TUY E;  2LKH A;  2QA7 A;  5CA0 E;  5LJN A;  3ZC1 A;  2V6X A;  3PUQ A;  2HN2 A;  3HKB E;  3OJA A;  5FNV E;  5FP3 A;  2A3D A;  5L4H A;  5ABE A;  3N2K E;  1D1B A;  4DBR A;  2KSR A;  4PJL A;  2IIU A;  3W15 B;  5HCM A;  1N34 T;  3T1H T;  3CKD A;  2YDS A;  2CRB A;  4IE4 A;  3BQK A;  4AKL A;  5L3C B;  1KNP A;  1WYC A;  3A7M A;  5HEU A;  2EHO B;  2UXX B;  2V6Y A;  2PTF A;  4QHO A;  2BG9 E;  1V9D A;  3QB5 A;  4FJO A;  3AVS A;  1D0Y A;  4U7I A;  4UF0 B;  2UXC T;  1XMQ T;  4HWH A;  3C50 A;  4Z90 A;  2EHO D;  4DR6 T;  1XZY A;  1AJ3 A;  5AQS B;  3EVY A;  4PJJ A;  2H88 A;  2EHO A;  3KV5 A;  1H7C A;  3RI5 A;  2OV9 A;  3UUB A;  1YQ3 A;  3IHR A;  2BKO A;  2D2S A;  2X9H A;  4HWC A;  5F5W A;  4DR7 T;  2LJL A;  2W4X A;  2X51 A;  1T98 A;  3JAE A;  3KBU A;  2ACZ A;  4QXH B;  3VHL A;  4CXW A;  2V7I A;  3ZCI A;  3RQW A;  4IL4 A;  5J2U E;  4JI1 T;  3PUW F;  3RRC A;  2D5U A;  3PUR A;  3AEG A;  2K5B B;  2XQ5 A;  3P50 A;  4KX6 A;  1N32 T;  2LSY A;  3KV9 A;  5JDG A;  4LF9 T;  2BS2 A;  5L3F B;  3ESL A;  3L39 A;  3NKZ A;  4A97 A;  2H3R A;  3AEB A;  3F2E A;  1I6Z A;  3PUA A;  3P4P A;  3NZP A;  3AE9 A;  1VOM A;  1JNZ A;  2WDQ A;  4OYK A;  4HFV A;  4AIS A;  4ZI2 D;  1B7T A;  3ANW A;  3KV4 A;  5AQN B;  1BR1 A;  3TKL B;  2CE7 A;  4AKH A;  4L0R A;  2XQ4 A;  3O1J A;  1UK5 A;  4GYR A;  4KUM B;  3R6N A;  2N2N A;  5HYA A;  5AQR B;  3UUL A;  5BMV E;  5HEJ A;  2CXF A;  2EHO C;  2W66 A;  3LBX A;  5FY1 A;  4TWD A;  3JC6 C;  2VKO A;  5LG3 A;  1T7S A;  4HWD A;  3N2G E;  1WR0 A;  3EUH A;  1MIY A;  4HTE A;  5FVK A;  3RKG A;  3RYC E;  4AQF A;  5ABF B;  4LFB T;  2LOP A;  3LK3 B;  5LCY A;  2X0H A;  2Z6E A;  4M1P A;  4C91 A;  3AEC A;  4HKA A;  2WY2 A;  3AAE B;  1VCS A;  4X1K E;  3L8R A;  2BG9 B;  4YTN A;  3MK7 C;  4H9O C;  4B3S T;  4HN9 A;  4JEU B;  4ZS3 A;  2FJD A;  1BR2 A;  4P1N A;  1UCU A;  3RIA A;  4ILC A;  1OWA A;  3AED A;  4LFC T;  2D0U A; 
#chains in the Genus database with same CATH homology
 2XTL A;  4TZ4 C;  5KMG P;  3OYX A;  5JRC A;  2ZM8 A;  3LG7 A;  4UVC B;  3L3P A;  4GK5 E;  5M4Y A;  4OHF A;  1SA0 E;  2YU1 A;  4UEM A;  3EDV A;  5CB4 E;  3RYH E;  2JJ9 A;  3FBL A;  3QK6 A;  2E9X B;  4YLH A;  2V7M A;  5LNK A;  3KDS E;  2OA5 A;  4QKN A;  4O8S A;  2LSJ A;  1IZN B;  3N9Q A;  5LJM A;  2KZ7 B;  5J2T E;  3RC8 A;  3O4X E;  2I59 A;  1UX5 A;  3AA7 B;  2Y48 B;  1WYB A;  4PFO A;  2VWA A;  1KK7 A;  2X68 A;  3DP7 A;  3KBT A;  4QWN B;  2H7V C;  4ASK A;  2C5K T;  3Q5X A;  4ZHQ E;  5JDM A;  3N9L A;  3MJX A;  2NTY A;  2KWH A;  2XAS B;  2A72 A;  3GN5 A;  1WRD A;  3HA4 A;  3IBP A;  4IE7 A;  5H6R B;  3DTO A;  5JDL A;  2ZMA A;  5FY7 A;  5F8P A;  3C51 A;  2VKJ A;  3ZMT B;  4UIG A;  3VKG A;  3RH3 A;  4G2A A;  3GN5 B;  3CQX C;  3PE0 A;  3VU7 H;  4YJ2 E;  4O4J E;  4OYJ A;  4GOU A;  1X79 A;  2X0L B;  3CX8 B;  3LK2 B;  5FXW A;  4AQF C;  4CQI A;  5LXT E;  4XBF B;  1ZV4 X;  3N9P A;  1UX4 A;  3AA0 B;  3O1H A;  1MMG A;  1U5P A;  2L9Q A;  5LGN B;  1O3X A;  3K3Q C;  4WBN E;  1LRZ A;  4UXN B;  4N78 D;  4C90 A;  2VB6 A;  3B57 A;  2YIN A;  3UUN A;  4TV9 E;  2BVL A;  2LOS A;  3MKD A;  3N9O A;  2DNX A;  4EOZ B;  3F31 A;  2Y8D A;  4FI5 A;  3FBZ A;  1G8X A;  1EZ3 A;  3PU8 A;  2Q9Q C;  1MND A;  5DQW A;  4HGA A;  3C98 B;  2G0U A;  2MOZ A;  3MAC A;  3NRY A;  2NWB A;  4CZZ B;  3C4W A;  4YHJ A;  3R84 B;  1MNE A;  1MMN A;  4DMV A;  3ZMU B;  3ZPO A;  4DND A;  3RPU A;  2PJQ A;  2KXP B;  2YEV C;  3CML A;  3ONX A;  2X67 A;  4AXP A;  5LHG B;  4KP3 C;  2ZM0 A;  3N5L A;  3N9M A;  3WAJ A;  2SPC A;  3GMI A;  5IYZ E;  4DBQ A;  2ODV A;  4BA9 A;  4H9Q C;  2KIN B;  3QC9 A;  4DMW A;  3KVA A;  4ANJ A;  2GK9 A;  2A2F X;  3FXE B;  1E1H B;  3CX7 B;  1US7 B;  5FXX A;  5LGT B;  1NAF A;  1HCI A;  1YKH B;  4I50 E;  4P0B A;  4CI2 B;  4KBM B;  5FXV A;  4QXC B;  2DHR A;  2ES0 A;  3E22 E;  3CVR A;  4CXY A;  2JPF A;  3LJC A;  4IHJ E;  4X1I E;  4TV8 E;  1LVK A;  4PW8 A;  4EXT A;  3U3I A;  3ZC0 A;  2KWI B;  2N1G A;  5EZY E;  2MYS A;  3ZJ1 A;  2W0G A;  1HTJ F;  3PUS A;  3CQG B;  2X9X A;  4EZH A;  3V5S A;  3HI2 A;  4H9N C;  1D1A A;  5H6Q B;  2E9X A;  3CQC B;  5JR9 A;  1FMW A;  1S35 A;  1HFA A;  3I9Y A;  2V7L A;  4O2A E;  1QUU A;  4P09 A;  2CLY B;  3O1I A;  4PK4 A;  3AAI A;  3OBV E;  5ADX L;  3S4U A;  2BDE A;  3OYZ A;  2PFV A;  5HXR A;  2JRK A;  2IW5 B;  5KDM C;  4JEH B;  3RYF E;  4IDZ A;  3PTR B;  4QXB B;  1YW0 A;  2NOX A;  3HKC E;  2N9D A;  4G63 A;  4H9S E;  2HPJ A;  3PDY A;  4U72 A;  4MBQ A;  4O4H E;  2P9B A;  2X66 A;  2Y6X A;  3GA8 A;  4TX5 A;  3HKE E;  5IHY A;  5LGU B;  5EK3 A;  3LFM A;  2KLQ A;  2DCF A;  3B13 A;  3GWH A;  3RRW A;  4UV9 B;  3I9W A;  3NRX A;  4IE6 A;  4ERR A;  3Q2M A;  5FYM A;  4AQG A;  2VL8 A;  4BJM A;  4TN7 B;  5EK2 A;  4A56 A;  4F6R C;  5E0O A;  4CI3 B;  3AA6 B;  1IJ5 A;  4ZS2 A;  5LG4 A;  4PJN A;  3N9N A;  3I0Q A;  4ZI7 E;  5JDF A;  5F3J A;  2C0S A;  3EDU A;  1ZKE A;  2KT9 A;  2IAK A;  4WW0 A;  3NBX X;  2ACX A;  4MLK A;  2CA5 A;  3L09 A;  2B1E A;  3J7Y q;  2K48 A;  4GK0 E;  4EYY R;  5TAO A;  2LSI A;  1SHZ C;  1LKX A;  4QX7 B;  5HXH A;  2VKH A;  5AFU L;  5GON E;  1S94 A;  2CCQ A;  2YK0 A;  5LA6 E;  2H7O A;  3K3O A;  4ZOL E;  2C5I T;  5LYJ E;  4UF0 A;  4IE5 A;  4YFS A;  4I55 E;  2LSG A;  3D0T A;  2L3L A;  5KX5 E;  4XZC A;  2MTQ A;  3K8P C;  1LVF A;  3ZEF B;  2LM9 A;  2XAG B;  1D0X A;  2LE8 A;  2XAH B;  3MZK B;  5JDQ A;  3IEE A;  3I1A A;  2KND A;  5DJQ C;  4ZI2 C;  4PK6 A;  2XAJ B;  2ODU A;  5JRE A;  1D1C A;  3E0Z A;  2D0T A;  2RP4 A;  4DO0 A;  2WMN A;  2LSK A;  4EZ4 A;  5JR9 B;  4UVA B;  2C5J A;  2L8K A;  3O9X A;  5HXC A;  2CWY A;  4UEL A;  3WI3 A;  1HF8 A;  5FMN A;  4ILU A;  1YKE B;  2V1D B;  2J1D G;  2Q9Q A;  3HL6 A;  4O2B E;  3ANW B;  4XAX B;  4J2C A;  1IAP A;  4Z8X A;  1G73 A;  2IC9 A;  3H3A A;  3RYI E;  3UUM A;  3KFW X;  3BK9 A;  3ZCJ A;  2WMO A;  3IF8 B;  3SRZ A;  3KIN B;  1D0Z A;  3I0O A;  2CXL A;  3ZN0 B;  4PNI A;  3VKH A;  3C4Z A;  3PUG A;  4IIJ E;  2WM9 A;  4ZI3 D;  5L3G B;  2NW7 A;  3ZJ2 A;  1MMD A;  3ZYK A;  4NUV A;  5HWY A;  2ZM2 A;  5LOV E;  2NW8 A;  2V7K A;  1ZHC A;  3PU3 A;  4IE0 A;  4AKR B;  3RX6 A;  2YU2 A;  4IST A;  2CWO A;  1FIO A;  4K0U A;  3ZMZ B;  3FHN A;  3ETU A;  1KNZ A;  2XAQ B;  5L3D B;  4O4L E;  2E9X D;  5HXE A;  1FMV A;  2UXN B;  2X9W A;  4ZI3 C;  1HX8 A;  3AAA B;  2WSS V;  2X9Y A;  5ETW A;  3ZMV B;  1CUN A;  4H9P C;  2XAF B;  1Y64 B;  3KVB A;  4ISS A;  3FB2 A;  3KV6 A;  2LHN A;  5HWX A;  3E08 A;  2W62 A;  2NTX A;  3C4X A;  2DWG A;  3UUX B;  1OXZ A;  3JC6 D;  4EYU A;  3SWH A;  4E7S A;  3RKO A;  1IJ6 A;  5JR9 C;  2BVM A;  4OFZ A;  1NWM X;  2W63 A;  2LT3 A;  5LBQ B;  1MIV A;  4ADZ A;  4JLE A;  2K9A A;  5JRC B;  4MAL A;  5L3B B;  2WBL A;  3F57 A;  3ETV A;  3AB3 B;  3Q9D A;  3M65 A;  2CLY C;  3N2O A;  3Q5W A;  2WWU A;  3A5X A;  3OKQ A;  3ZMS B;  3K3N A;  5FXZ A;  2IC6 A;  1U4Q A;  3BQL A;  5EK4 A;  4HE8 A;  3WAK A;  5JQG E;  1ZEE A;  4WNK A;  1MMA A;  4CI1 B;  2DLR A;  4KMC A;  1HG2 A;  2VAS A;  1YD8 G;  2JMK A;  2MBG A;  2E9X C;  2QGS A;  4PJM A;  1BR4 A;  3HR0 A;  4I4T E;  2K24 A;  2DWK A;  2XQY A;  1WR6 A;  2V26 A;  5JDH A;  5A1L A;  5FY0 A;  3P8C D;  2HPL A;  2PG8 A;  3CPZ A;  3MXZ A;  4PAG A;  1Z0P A;  4L5G A;  2E8I A;  4L9I A;  3UFE A;  4BAY B;  5C8Y E;  1BR0 A;  1MIW A;  4JUY A;  1VRB A;  4HEA A;  5JVD E;  5L3E B;  4AKG A;  3CWZ B;  3LK4 2;  2LEH A;  3QUJ A;  5HAX A;  4E7Z A;  2ZLY A;  3BQI A;  4PFP A;  3ZN1 B;  4PK5 A;  2XUE A;  3MA9 A;  4UVB B;  2DI4 A;  3C64 A;  3DJB A;  1WLX A;  4OK0 A;  4QX8 B;  5LHI B;  2Q9Q D;  4BJN A;  4V1A v;  4CXX A;  2W61 A;  3P7I A;  4MFR A;  3AVR A;  5DAB A;  4EIW A;  5CA1 E;  4UV8 B;  4EAH A;  4AKI A;  4DVD A;  3U78 A;  2CXD A;  2XHE B;  2NP9 A;  4H9R C;  2VKD A;  5LP6 E;  2W00 A;  5J1G A;  3UT5 E;  3AA1 B;  2CEA A;  4X1Y E;  2CM0 A;  2VK9 A;  4H63 H;  3LBX B;  3H37 A;  3NZQ A;  3SS1 A;  2M67 A;  3J9X 1;  1QSD A;  4GIW A;  4AI6 A;  2RA1 A;  3HKD E;  4YJ3 E;  2Q9Q B;  2JQQ A;  5DQV A;  5LHH B;  3ZLI A;  3V5U A;  5HXS A;  2BZB A;  5LBM A;  4H63 V;  2HH7 A;  4WBO A;  4B6X A;  4I43 B;  2PBI A;  1HG5 A;  4MHC A;  2V7J A;  2NW9 A;  1FEW A;  3ZYL A;  2JMH A;  2CMR A;  3SOL A;  2WAU A;  4U74 A;  3CX6 B;  3RC3 A;  4NUU A;  5L2L A;  2LHR A;  3UTK A;  4X20 E;  4P0A A;  4IGU A;  3ZYM A;  5JDN A;  4GYS A;  3T8O A;  1HS7 A;  4O4I E;  5JH7 E;  3FXD B;  4EB6 E;  2KMF A;  4TUY E;  5CA0 E;  2QA7 A;  5LJN A;  3ZC1 A;  3PUQ A;  3HKB E;  3OJA A;  5FNV E;  5FP3 A;  2A3D A;  3N2K E;  1D1B A;  4DBR A;  4PJL A;  3W15 B;  3CKD A;  4IE4 A;  5L3C B;  3BQK A;  4AKL A;  1WYC A;  2EHO B;  2UXX B;  4QHO A;  1V9D A;  4FJO A;  4UF0 B;  3AVS A;  1D0Y A;  3C50 A;  2EHO D;  1AJ3 A;  3EVY A;  4PJJ A;  3KV5 A;  2EHO A;  1H7C A;  3IHR A;  2D2S A;  2X9H A;  2LJL A;  3VHL A;  2X51 A;  1T98 A;  3KBU A;  4QXH B;  4CXW A;  2V7I A;  3ZCI A;  5J2U E;  3RRC A;  2D5U A;  3PUR A;  2K5B B;  2LSY A;  3KV9 A;  5JDG A;  5L3F B;  3ESL A;  2H3R A;  3F2E A;  3PUA A;  3NZP A;  4OYK A;  1VOM A;  4ZI2 D;  4HFV A;  1B7T A;  3ANW A;  3KV4 A;  3TKL B;  1BR1 A;  2CE7 A;  4AKH A;  4L0R A;  3O1J A;  4KUM B;  3R6N A;  4GYR A;  5HYA A;  2N2N A;  5BMV E;  3UUL A;  2CXF A;  2EHO C;  3LBX A;  5FY1 A;  3JC6 C;  2VKO A;  4AQF A;  3N2G E;  4HTE A;  3EUH A;  1MIY A;  3RYC E;  2LOP A;  3LK3 B;  5LCY A;  2Z6E A;  4M1P A;  4C91 A;  4HKA A;  3AAE B;  4X1K E;  3MK7 C;  4H9O C;  4HN9 A;  4JEU B;  4ZS3 A;  1BR2 A;  1UCU A;  1OWA A;  2D0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...