3ONXA

Crystal structure of a domain of a protein involved in formation of actin cytoskeleton
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
125
structure length
125
Chain Sequence
NRMYMEKSQTELGDLSDTLLSKVDDLQDVIEIMRKDVAERRSQPAKKKLETVSKDLENAQADVLKLQEFIDTEKPHWKKTWEAELDKVCEEQQFLTLQEELILDLKEDLGKALETFDLIKLCCEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bud site selection protein 6
publication title Structure of the formin-interaction domain of the actin nucleation-promoting factor Bud6.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 51
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1540 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3onxA00
3ONXA 3OKQA
chains in the Genus database with same CATH superfamily
2XAJB 4YSXA 4P1NA 3ZYKA 1MIWA 5FVKA 3A8YC 4MLKA 3H3AA 3Q5EA 3B5MA 2WSSV 2EHOC 4B6XA 5F8PA 2WM9A 5LP6E 2W63A 3PE0A 2E2AA 2PJQA 4ILCA 1UCUA 4X1KE 4IL9A 3N9PA 4IE4A 3VRAA 3BQIA 3VHLA 3VR8A 5LXTE 4ILUA 3AA0B 2HN1A 4KHPT 4LF7T 4PW8A 2Q9QD 4IE7A 3RGLA 4HFDA 4JBWF 3WI3A 3N2GE 1YKHB 3C50A 4UIGA 4JUYA 5JDQA 2E5VA 4NIQA 2JMKA 3AAEB 5LG4A 5LYJE 5DJQC 3NZPA 3I0QA 4K0UA 4HE8A 2XAHB 4HWDA 5BMVE 2I0MA 2C5JA 3LJCA 4AIUA 4O2AE 2LJLA 3SS1A 1VOMA 4HTEA 2VURA 5AQKB 5CFBA 4CI3B 4TZ4C 1N33T 2Q9QA 5FKYA 3T8OA 4EB6E 5LBMA 3RYCE 3R84B 1XMOT 3PV0F 1IZNB 2CEAA 5L3FB 4N78D 3AE9A 2LOSA 2BDEA 2YU2A 2WU5A 3I9YA 3CWZB 1IAPA 4DV0T 4ISSA 2Y48B 2CWYA 3IF8B 3ANWB 4JV5T 2BVMA 1OEDB 4DV7T 1S94A 4PJJA 1UGOA 2MOZA 4PK5A 2QGSA 2HPLA 1B7TA 4DV1T 2YDRA 4OYKA 5F5WA 2C0SA 4YXDA 3UU5A 4LMLA 4ZI2D 5L4HA 3C51A 3T1YT 3KV6A 4EGWA 3AE4A 2X0HA 4HFIA 4G63A 3HKEE 4DV3T 1IBKT 2WZHA 5FY7A 3ZMSB 2CWOA 4YJ2E 5LJMA 2Y8DA 3B13A 2K48A 3M3ZB 3PJAA 3CQXC 3HR0A 2PTFA 3UULA 1WR0A 2X0LB 3IBPA 5JTGA 3QOFA 3O4XE 2KZ7B 4O2BE 4JI7T 4BAYB 3T1HT 2V8SV 4UV8B 3ETVA 1IJ6A 4YTNA 4IDZA 2K9AA 1OEDC 4DR2T 2K3WA 4TWFA 5HXEA 2LSGA 4H9PC 4WNKA 4I43B 3HKDE 3RIFA 3UU8A 2WWVA 4JI6T 1MMNA 4OX9T 5L47A 2VQFT 3EI0A 2BG9B 2W61A 3P50A 4IREA 2XAQB 4AQGA 3IHRA 4H9RC 4UELA 1E2AA 4QHOA 1MIYA 1KK7A 2IAKA 1W9RA 3PUAA 4QX7B 1XDPA 2XQ4A 3SFEA 4YJ3E 2CPTA 3KDSE 2Q9QC 2YDQA 4DVDA 3AECA 1QLBA 2BS2A 3RYIE 5L4EA 5LJNA 5L3BB 2E9XD 2IDOB 3OYXA 4DBRA 5JDNA 3P7IA 4PFPA 4BA9A 2V6XA 2YDSA 2JMHA 3RIUA 3J9X1 2VB6A 2DLRA 3TLTA 1FJGT 3JAFA 1KNZA 2BKOA 5FNVE 3N2OA 4DR5T 1D0ZA 2ZLYA 3O1JA 5HAXA 2FJBA 2X9XA 1YXRA 2D0TA 3RKOA 2IW5B 2CA5A 2V7LA 2PG8A 3I9WA 3VU7H 2XAFB 2FJEA 2W66A 2NOXA 3X1DA 4MFRA 2NW7A 2IIUA 2XQ9A 1ZEEA 5FVLA 2XQ7A 2NW8A 3SFDA 1J5ET 2DWKA 4EOZB 3Q5DA 3OBVE 4F6RC 4I50E 5CA0E 2YN6A 3JC6D 4L9IA 4YHHT 3AXJA 2XM2A 2XJ7A 2HPJA 2ZM8A 4F8HA 3MACA 2YEVC 3ZCIA 4EXTA 3OVUA 1G73A 1N32T 5JR9B 4QKNA 4HFHA 3E22E 1HNXT 4TNWA 4PNIA 5ABHA 4DR6T 3PUXF 3ZC1A 3OTOT 3ZSSA 3Q5WA 2HN2A 3DTOA 1FMWA 4AKHA 5FL0A 5KXJA 4YTMA 4C90A 3N9MA 2X9HA 4ANJA 4COFA 2DWGA 3CK6A 1V9DA 3C98B 2JQKA 1U5PA 5AQQB 5HXRA 5ABFB 4HWIB 4TUYE 3KFWX 3LBXB 4H9QC 3AXJB 4CN4A 4LF4T 4BJMA 5C2TA 4DMWA 1QSDA 3RRWA 4EZHA 2K5BB 4X65T 5LCYA 3PUZF 4TV9E 4XAXB 3RIUC 4IL4A 3FZKB 4HWHA 5AQTB 4O4IE 4IE0A 4YTPA 5J2UE 5LNKA 4A98A 3ZMVB 4DO0A 3P4QA 4NXNT 4O4LE 4DIDB 4OFZA 3QNUA 3F31A 1ZKEA 5AQSB 4YFSA 3IEEA 1UK5A 3UU6A 3KV5A 5AQVB 2XY8B 2KSRA 4DUYT 3PUWF 1X79A 4IDNA 2LRLA 2XQ6A 2E5LT 2V5DA 2XPKA 5F3JA 3UUMA 2ODVA 4KUMB 1N34T 2MTQA 3SWHA 5KMGP 4XBFB 4I55E 3ZT6A 3PUSA 5J1GA 2Z6EA 2W0GA 3KV9A 3HKCE 5A1LA 2XTLA 3EDVA 2BS3A 1HG2A 3AE5A 4JI5T 2CHOA 4H9OC 3CX8B 2LLYA 3A7MA 4BJNA 3AE3A 3CMLA 4EZ4A 1ZP0A 3Q5XA 3TKLB 2CLYC 1MMDA 3ZPOA 3AEEA 1LVFA 4L0RA 3C4XA 2UUAT 5LG3A 3CKDA 5CA1E 1HG5A 3PTRB 3U3IA 3OPCA 4QXBB 4PFOA 4B3MT 2V6YA 4ZS2A 2NTYA 4X1YE 1VRBA 5ABEA 1WCRA 4DR1T 2FJDA 4DV2T 2VVNA 3VKGA 2RP4A 4WW0A 3C4ZA 5ABGA 3P8CD 1SUMB 1T72A 3RLFF 2KINB 4DV4T 5FL1A 2W00A 1BR2A 4DMVA 1WLXA 2UXBT 3E08A 1ZHCA 2B1EA 3FXDB 4WBOA 4EAHA 2VKOA 3RYFE 1I94T 1DU2A 2M67A 5DQWA 3TLWA 2JQQA 1BR1A 4CXXA 3OJAA 3E0ZA 2DL1A 3K8PC 4HWCA 4KP3C 2J47A 2N2NA 5HXCA 2HH7A 1HX8A 4TWHA 4JI1T 4KMCA 1Z8UA 3LSVA 1XNQT 2XZEA 5AQMB 4UEMA 4PAGA 4NXMT 3MZKB 1H7CA 5FYMA 3K1SA 4LFBT 3WAJA 3FZMB 4TV8E 4OYJA 3GMIA 2I59A 2IHR1 2V5CA 5AQLB 2WZIA 3RPUA 4EEBA 1JNRA 3PUYF 4HFEA 2ODUA 2LOPA 2CCQA 5AQFB 4NPPA 2NWBA 4IDOA 2NR4A 4LFCT 4DV6T 4ADZA 4LF9T 1NEKA 3QB5A 1KNRA 4O4HE 1E7PA 2UUCT 3S4UA 2UXXB 2KWHA 3KINB 4Z91A 3ZMZB 5AQRB 2L3LA 2LSKA 3RHWA 4DR7T 3MK7C 1HS7A 2JJ9A 3UUBA 3OYZA 2M6IA 4Q25A 4ZI3D 2XSBA 3PUQA 5L3DB 4DNDA 4DR4T 3ZN1B 1CHUA 2VWAA 5KX5E 2Q9QB 1J5WA 1WYCA 3ONLC 1KNPA 2WCAA 5LGUB 1W0AA 4A97A 4YSZA 4V1Av 3ZYLA 3ZN0B 3N9OA 4P0BA 4LMKA 2CXLA 4HFVA 5LMNT 3C4WA 2BKPA 3I0OA 4UF0A 4ZZCA 3QUJA 1T98A 3AEFA 2X66A 1CUNA 4PK6A 1WYBA 3PUGA 4UVCB 3TLUA 2CRBA 4UVBB 3QC9A 1Z0PA 3ZYMA 4B3ST 1QUUA 2V1DB 2VL8A 4NUUA 4C91A 4X20E 3L39A 1SHZC 2KNDA 1WFDA 3P4RA 2I6HA 1LRZA 4O8SA 5LMUT 3L09A 5HXSA 4UV9B 1US7B 2ZM0A 1X9BA 5M4YA 5AQGB 3U78A 4HGAA 2LHNA 2H7VC 2L8KA 5H6QB 2WDVA 4DUZT 3J7Yq 5FY1A 3EUHA 5H6RB 3FXEB 3PUVF 3CQGB 4WYVA 2IUBA 2VASA 4U3CA 3KBTA 5AQIB 4ILBA 2CXDA 4L5GA 4EIWA 3EVYA 4WBNE 2V7JA 4DV5T 2V7IA 3RI5A 4JYAT 3V5UA 1J1JA 1G8XA 4EV6A 4TNVA 4H9NC 2GK9A 2ES0A 3RKGA 3EDUA 2G0UA 3CX7B 3CX6B 3PDYA 4QX8B 1IBMT 4H63V 2X51A 3GWHA 3TLSA 2LT3A 4PJMA 3AE1A 5HEJA 2E9XA 3WAKA 2WAUA 5JQGE 2W62A 2XSAA 3MA9A 1M7KA 5ADXL 4O4JE 2FBWA 4AKRB 3H37A 1D0YA 4E7ZA 3EABA 3L8RA 2EHOD 4LF8T 3PU8A 4LFAT 4P0AA 3RQUA 1XWMA 1ZOYA 4YT0A 4CI1B 3HL6A 5HEUA 4EYYR 3LK42 4ZI2C 4ASKA 4GK5E 5C3JA 2XQAA 1SA0E 3O1IA 3UU3A 1D1AA 2YOEA 4QXHB 2C5KT 1NAFA 1YKEB 4ZI3C 3BQLA 4I4TE 3MKDA 2WB5A 2CBIA 5JDMA 1S35A 4G2AA 3ZLIA 3I1AA 1HR0T 2KT9A 3A5XA 2MAWA 5TAOA 4QH1A 2A72A 2QVAA 3AAIA 3NRXA 4AKGA 3EAMA 2E9XB 4U74A 4U31A 3NVOA 3F57A 2H3RA 2V7KA 3O9XA 4QH5A 4LF5T 2WDRA 5JVDE 2M6BA 4KBMB 1FMVA 2DHRA 2JPFA 3Q9DA 2PBIA 2WBLA 3K3NA 3O1HA 3FZLB 5GONE 3C64A 3KV4A 4A56A 2AE9A 4ISTA 3RC8A 2W67A 2CLYB 5AQNB 2QYWA 3UFEA 5IYZE 4ZS3A 1MIVA 4U2YA 3AA7B 1Y01A 2VKHA 3N9QA 5JDHA 4ZZBA 1HCIA 4AXPA 4CQIA 5J0ZA 5C8YE 3LFMA 2R6GF 1UX5A 4AQYT 5FMNA 1WRDA 2X9YA 5AQHB 5AQJB 2L9QA 3JAEA 2X67A 5JREA 2CHNA 2IC9A 4U7YA 3DP7A 1YQ3A 3N9NA 4PJNA 2X0YA 4JI4T 3ETUA 2J1DG 1T7SA 2XM1A 3ZT7A 1OWAA 2E9XC 3FBZA 3MXZA 2UU9T 3ZKRA 1O3XA 2JIWA 3DJBA 2FUPA 1BR0A 3NKZA 5LHHB 4LMJA 2WP9A 2XASB 3ONJA 3LG7A 3SOLA 4HN9A 3KVAA 2FJAA 3RX6A 3ZCJA 5FP3A 5HXHA 4JEHB 5HEHA 2CMRA 4AKIA 5JH7E 4GKJT 3GN5A 5E0OA 1UX4A 4AQFA 2YKSA 3L3PA 4WZXA 4IDPA 4HKAA 4YHJA 2WS3A 2KWIB 2K24A 5AQOB 3FZHB 4DBQA 4NUVA 5BR8T 3JC6C 3ZEFB 2KXPB 2KMFA 1MMAA 5EK3A 2ACXA 2LSJA 5J2TE 3ANWA 4TN7B 4ZOLE 1OEDA 1N36T 2VL0A 3AEAA 2JRKA 3JCFA 3RYHE 2V26A 3HKBE 2D9DA 4QXCB 1NENA 2LM9A 2UUBT 3UQ7A 5JRCA 2VVSA 3H3MA 2P9BA 1HF8A 2N9DA 2ZM2A 2LHRA 2XQ3A 5L3EB 2BKNA 3QB5K 1XNRT 3GN5B 4CZZB 1T8BA 3CVRA 2J62A 5HWXA 3FBLA 3ZT5A 4KI0F 2X9WA 2V6YB 1D1CA 2XHEB 5ETWA 4IDQA 3N9LA 2CE7A 2D2SA 3UQ4A 2OA5A 4M1PA 3G06A 1KFYA 4IHJE 4ILAA 3NRYA 3SRZA 2BVLA 4IE6A 4EYUA 2B76A 5LGNB 2WMNA 4J2CA 2H7OA 3UUXB 5L3GB 3N5LA 2WU2A 4E7SA 1HFAA 4ZEYA 1YQ4A 1XMQT 2MPKA 1VCTA 5L2LA 3AEDA 4U2ZA 3AE7A 3AAAB 5L3CB 2C5IT 2H89A 5JRCB 5FY0A 3R6NA 4JEUB 1SE7A 5AQPB 3AA6B 4UXNB 5HEOA 2BG9A 3FZFB 4KX6A 2VKJA 3IA3A 2OV9A 2LRKA 5FXXA 3B57A 4ZI7E 2A3DA 1D0XA 4AQFC 3Q2MA 3K3OA 3CIRA 1YW0A 4Z90A 3RC3A 1HNWT 2UXNB 2XUEA 3P4PA 5AFUL 2PFVA 4QWNB 4X1IE 1WR6A 4IIJE 4HWFA 4CXYA 4GYSA 1R8IA 1IBLT 4X64T 2DNXA 2XQ5A 5HCJA 2SPCA 3AB3B 2BBHA 2W2UA 4K0KT 2J4GA 2V7MA 3F2EA 3V5SA 4MHCA 2OLTA 4CN6A 2BZBA 3PJAJ 5FXVA 4MALA 2HHHT 4TX5A 1JNZA 3CQCB 2LE8A 2CXFA 2E8IA 2JQHA 3UTKA 4B3RT 4MBQA 3ONXA 4FI5A 4JLEA 3UUNA 1UUSA 3MJXA 2LEHA 1KEYA 2ACZA 1AJ3A 2X68A 5LBQB 3VR9A 5JDGA 3KBUA 3KVBA 3VRBA 4HEAA 5HEGA 4JI0T 2LSYA 3NZQA 4DR3T 5IUXA 4U33A 2Y6XA 2UXDT 1BR4A 3FHNA 4HFCA 2VQET 3ESLA 3ZMTB 4PJLA 1Y64B 1NWMX 5FXWA 2RA1A 3P4WA 3AVSA 4UF0B 4Z8XA 4PK4A 3ZSTA 4X5TA 5LOVE 5FXZA 4OHFA 4GK0E 3AEBA 1FIOA 2BBJA 3GA8A 3AE2A 4AISA 5JR9A 1EZ3A 2QA7A 5HYAA 4JI2T 2MBGA 2VK9A 4JI3T 2VKDA 4IE5A 5EK2A 1D1BA 4AI6A 1W09A 2RPAA 3W15B 4P09A 2A2FX 3VKHA 3RQWA 4ERRA 4YSYA 3PU3A 5LA6E 1LKXA 1GQEA 2NP9A 2N1GA 2WDQA 3NBXX 4IT4A 1UURA 2BG9C 3AVRA 2WQYA 1MMGA 1OEDE 2XQ8A 2WY2A 2LKHA 1HNZT 5HWYA 2MYSA 3D0TA 2IMLA 1HTJF 2YINA 3LDQB 5ABFA 3OKQA 4HFBA 5EZYE 3LBXA 3RRCA 4B3TT 4X62T 4ZXLA 4GOUA 4X66T 5LGTB 4CN1A 3AA1B 5JDLA 3N2KE 2F4VT 2D5UA 5CGMA 3QK6A 2EHOA 3TLVA 4UVAB 4ZHQE 1M62A 2NTXA 4U7IA 2ZM6T 4LF6T 3EHZA 1HX1B 5KDMC 3M65A 3ZJ1A 3ZJ2A 5DABA 5CB4E 5AQUB 3ABVA 3ZMUB 5LHGB 3UU4A 1E1HB 2W4XA 3BK9A 1IJ5A 5IHYA 5EK4A 1W0BA 2DI4A 3P4SA 1I6ZA 2UXCT 4H63H 3AEGA 4U72A 4CXWA 3CPZA 2WMOA 1U4QA 1MNEA 4OK0A 4YLHA 4QH4A 3PURA 4GIWA 1XDOA 4AKLA 2H88A 3K3QC 1KF6A 2BG9E 5LB7B 2XQYA 3HA4A 1L0VA 4FJOA 2QRXA 2LKGA 5DQVA 3FB2A 2EHOB 3RH3A 2CM0A 4IGUA 2ZMAA 5CJ5A 3HI2A 4H9SE 5JR9C 2LSIA 4TWDA 2LM2A 3BQKA 2CBJA 4GKKT 4CI2B 3LK3B 4KHZF 2XAGB 2D0UA 1VCSA 1LVKA 2NW9A 2IC6A 2DCFA 4GYRA 2A9UA 1FEWA 5LHIB 1YD8G 2WWUA 1MNDA 2YU1A 5JDFA 2KLQA 4I0UA 3RF1A 2BS4A 4A5XA 4EEDA 3JADA 2JQ9A 1ZV4X 2AXDS 1OXZA 3NWIA 4YY3T 4UR9A 3UT5E 5HCMA 5IWAT 3RIAA 3ZC0A 3LK2B 4XZCA 3UFGA 3AE6A 3AE8A 2YK0A 1XZYA 4JI8T
chains in the Genus database with same CATH topology
2XAJB 5FY1A 3N5LA 3EUHA 5H6RB 3ZC1A 3ZYKA 1MIWA 3FXEB 4E7SA 3Q5WA 3CQGB 1HFAA 2VASA 3DTOA 3KBTA 4MLKA 3H3AA 1FMWA 2CXDA 4AKHA 4L5GA 4EIWA 5L2LA 3EVYA 4WBNE 2V7JA 2WSSV 3AAAB 2EHOC 4B6XA 4C90A 5F8PA 5L3CB 2V7IA 2C5IT 3N9MA 5JRCB 2WM9A 5FY0A 2X9HA 3R6NA 3V5UA 5LP6E 2W63A 1G8XA 4ANJA 3PE0A 4JEUB 2DWGA 1V9DA 3C98B 4H9NC 3AA6B 4UXNB 2GK9A 1U5PA 2VKJA 2ES0A 2PJQA 5HXRA 3EDUA 2G0UA 1UCUA 5FXXA 4TUYE 3KFWX 3CX7B 3B57A 4X1KE 4ZI7E 2A3DA 3CX6B 1D0XA 3LBXB 4H9QC 3PDYA 3N9PA 4AQFC 4IE4A 4QX8B 3BQIA 3VHLA 3Q2MA 3K3OA 4H63V 4BJMA 1YW0A 5LXTE 4ILUA 2X51A 4DMWA 1QSDA 3GWHA 3AA0B 3RRWA 3RC3A 2LT3A 4EZHA 4PJMA 2K5BB 4PW8A 2UXNB 5LCYA 2E9XA 2Q9QD 4IE7A 3WAKA 2WAUA 2XUEA 4TV9E 3WI3A 3N2GE 1YKHB 5AFUL 4XAXB 2PFVA 4QWNB 3C50A 1WR6A 4UIGA 4X1IE 2W62A 5JQGE 4JUYA 3MA9A 4IIJE 5JDQA 2JMKA 4CXYA 3AAEB 4O4IE 5LG4A 4IE0A 5J2UE 5LNKA 5ADXL 4O4JE 3ZMVB 4DO0A 5LYJE 4AKRB 3H37A 4O4LE 5DJQC 1D0YA 4E7ZA 4OFZA 4GYSA 2EHOD 1ZKEA 3F31A 3NZPA 4YFSA 3I0QA 4K0UA 2DNXA 3PU8A 4HE8A 3IEEA 2XAHB 5BMVE 4P0AA 2C5JA 2SPCA 3AB3B 3LJCA 3KV5A 4O2AE 2LJLA 4CI1B 3HL6A 3SS1A 2V7MA 1VOMA 3F2EA 4HTEA 3V5SA 4MHCA 2BZBA 5FXVA 4MALA 4EYYR 1X79A 3LK42 4TX5A 4CI3B 4ZI2C 4ASKA 3CQCB 4TZ4C 2LE8A 2Q9QA 3T8OA 4GK5E 2CXFA 4EB6E 5F3JA 2E8IA 3UUMA 1SA0E 3O1IA 5LBMA 3RYCE 2ODVA 4KUMB 3UTKA 4MBQA 3ONXA 1D1AA 4FI5A 4JLEA 3R84B 3UUNA 2MTQA 3MJXA 3SWHA 1IZNB 2LEHA 4QXHB 5KMGP 4XBFB 2CEAA 2C5KT 4I55E 5L3FB 4N78D 1NAFA 1YKEB 1AJ3A 2LOSA 2BDEA 3PUSA 4ZI3C 2X68A 2YU2A 3BQLA 5J1GA 2Z6EA 2W0GA 3I9YA 3KV9A 4I4TE 3CWZB 3HKCE 5LBQB 5A1LA 2XTLA 3MKDA 1IAPA 3EDVA 5JDGA 3KBUA 4ISSA 5JDMA 3KVBA 2Y48B 1HG2A 1S35A 2CWYA 3IF8B 4G2AA 3ANWB 4H9OC 3ZLIA 3CX8B 4HEAA 3I1AA 2BVMA 4BJNA 2KT9A 3A5XA 2LSYA 3CMLA 5TAOA 3NZQA 4EZ4A 3Q5XA 1S94A 2Y6XA 3TKLB 2A72A 3AAIA 2CLYC 1BR4A 1MMDA 3NRXA 4PJJA 4AKGA 2MOZA 3FHNA 3ZPOA 4PK5A 1LVFA 2QGSA 2E9XB 3ESLA 3ZMTB 2HPLA 1B7TA 4L0RA 4U74A 3C4XA 3F57A 4PJLA 3CKDA 5CA1E 2H3RA 1HG5A 2V7KA 3PTRB 1Y64B 4OYKA 3U3IA 3O9XA 5JVDE 4QXBB 1NWMX 4PFOA 4ZS2A 2C0SA 2NTYA 5FXWA 2RA1A 4UF0B 3AVSA 4Z8XA 4PK4A 1VRBA 4X1YE 4KBMB 1FMVA 2DHRA 4ZI2D 3C51A 2JPFA 3Q9DA 3KV6A 2PBIA 2WBLA 3K3NA 5LOVE 5FXZA 3O1HA 4OHFA 4GK0E 1FIOA 4G63A 3GA8A 3HKEE 5GONE 3VKGA 3C64A 3KV4A 5FY7A 3ZMSB 2RP4A 5JR9A 4A56A 4ISTA 1EZ3A 4WW0A 3RC8A 2CWOA 2QA7A 3C4ZA 5HYAA 4YJ2E 3P8CD 2CLYB 5LJMA 2MBGA 2Y8DA 2VK9A 3B13A 2VKDA 4IE5A 5EK2A 1D1BA 3UFEA 5IYZE 4ZS3A 4AI6A 2K48A 1MIVA 2KINB 3W15B 2W00A 3AA7B 3CQXC 3HR0A 2A2FX 1BR2A 4P09A 3VKHA 2VKHA 4DMVA 3N9QA 3UULA 1WLXA 5JDHA 4ERRA 2X0LB 1HCIA 3E08A 4AXPA 4CQIA 1ZHCA 5C8YE 3IBPA 3LFMA 2B1EA 3FXDB 4WBOA 4EAHA 3O4XE 3PU3A 2VKOA 1LKXA 5LA6E 2KZ7B 3RYFE 4O2BE 1UX5A 4BAYB 2NP9A 2N1GA 3NBXX 5FMNA 3AVRA 2M67A 4UV8B 5DQWA 1MMGA 1WRDA 3ETVA 1IJ6A 2JQQA 1BR1A 2X9YA 4CXXA 3OJAA 3E0ZA 2L9QA 5HWYA 2MYSA 2X67A 5JREA 2IC9A 3K8PC 4KP3C 3DP7A 4IDZA 2K9AA 2N2NA 3N9NA 4PJNA 3D0TA 5HXCA 2HH7A 1HX8A 1HTJF 2J1DG 3ETUA 4KMCA 5HXEA 1OWAA 2E9XC 2LSGA 3FBZA 2YINA 3MXZA 4H9PC 3OKQA 4WNKA 4I43B 3HKDE 4UEMA 4PAGA 5EZYE 1O3XA 3LBXA 3MZKB 1H7CA 5FYMA 3RRCA 3DJBA 1MMNA 1BR0A 5LHHB 3WAJA 4GOUA 2XASB 4TV8E 5LGTB 4OYJA 3AA1B 3GMIA 3LG7A 5JDLA 3N2KE 2I59A 2D5UA 3SOLA 3QK6A 2W61A 2XAQB 3KVAA 4HN9A 2EHOA 3RPUA 4AQGA 3IHRA 4UVAB 3RX6A 4ZHQE 2NTXA 4H9RC 2ODUA 4UELA 3ZCJA 4QHOA 5FP3A 5KDMC 2LOPA 2CCQA 3M65A 5HXHA 1MIYA 4JEHB 1KK7A 3ZJ1A 3ZJ2A 2IAKA 5DABA 2NWBA 3PUAA 2CMRA 4AKIA 4QX7B 5JH7E 4ADZA 5CB4E 4O4HE 3GN5A 4YJ3E 5E0OA 3ZMUB 5LHGB 3KDSE 1UX4A 2Q9QC 4AQFA 4DVDA 3S4UA 3L3PA 1E1HB 2UXXB 4HKAA 2KWHA 3RYIE 4YHJA 5LJNA 3BK9A 1IJ5A 5IHYA 5L3BB 5EK4A 3KINB 2DI4A 2E9XD 2K24A 2KWIB 3OYXA 4DBRA 3ZMZB 5JDNA 2L3LA 3P7IA 4PFPA 4BA9A 2LSKA 4DBQA 3MK7C 4H63H 2JMHA 3J9X1 4U72A 2VB6A 2DLRA 4NUVA 4CXWA 1HS7A 2JJ9A 3OYZA 3CPZA 3JC6C 4ZI3D 1KNZA 2WMOA 3ZEFB 1U4QA 3PUQA 2KXPB 5L3DB 1MNEA 4OK0A 2KMFA 1MMAA 4YLHA 4DNDA 5FNVE 3N2OA 3ZN1B 2VWAA 1D0ZA 5EK3A 2ACXA 5KX5E 2ZLYA 2Q9QB 3O1JA 3PURA 1WYCA 4GIWA 5HAXA 2LSJA 5J2TE 2X9XA 4AKLA 3ANWA 2D0TA 3RKOA 4TN7B 3K3QC 2IW5B 4ZOLE 5LGUB 2CA5A 2V7LA 2PG8A 4V1Av 2XQYA 3ZYLA 3HA4A 3I9WA 3VU7H 2XAFB 4FJOA 3ZN0B 3N9OA 4P0BA 2NOXA 4MFRA 2JRKA 5DQVA 3RYHE 3FB2A 2V26A 2EHOB 3HKBE 3RH3A 4QXCB 2CM0A 2NW7A 4IGUA 2ZMAA 2LM9A 3HI2A 4H9SE 1ZEEA 2CXLA 4HFVA 3C4WA 2NW8A 3I0OA 5JRCA 4UF0A 3QUJA 5JR9C 1T98A 2DWKA 2LSIA 2X66A 2P9BA 1HF8A 4EOZB 1CUNA 2N9DA 3BQKA 2ZM2A 2LHRA 3OBVE 4PK6A 4F6RC 4I50E 1WYBA 5CA0E 5L3EB 4CI2B 3LK3B 3PUGA 2XAGB 3GN5B 4UVCB 4CZZB 3JC6D 3CVRA 2D0UA 4L9IA 5HWXA 3FBLA 1LVKA 4UVBB 2X9WA 1D1CA 2XHEB 2NW9A 3QC9A 2IC6A 5ETWA 2DCFA 4GYRA 1Z0PA 3ZYMA 3N9LA 2CE7A 2D2SA 1FEWA 5LHIB 1QUUA 2V1DB 2VL8A 1YD8G 2OA5A 4M1PA 2WWUA 1MNDA 2YU1A 2HPJA 5JDFA 2ZM8A 2KLQA 4NUUA 4C91A 4X20E 3MACA 4IHJE 2YEVC 3ZCIA 1SHZC 3NRYA 1ZV4X 4EXTA 2KNDA 1G73A 3SRZA 1LRZA 5JR9B 4O8SA 1OXZA 4QKNA 2BVLA 3L09A 4UV9B 5HXSA 1US7B 3E22E 4IE6A 3UT5E 2ZM0A 4EYUA 5M4YA 3ZC0A 5LGNB 3LK2B 2WMNA 4J2CA 4HGAA 4XZCA 3U78A 2LHNA 4PNIA 2H7VC 2L8KA 2H7OA 5H6QB 2YK0A 3UUXB 5L3GB 3J7Yq
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONX A;  3OKQ A; 
#chains in the Genus database with same CATH topology
 2XAJ B;  4YSX A;  4P1N A;  3ZYK A;  1MIW A;  5FVK A;  3A8Y C;  4MLK A;  3H3A A;  3Q5E A;  3B5M A;  2WSS V;  2EHO C;  4B6X A;  5F8P A;  2WM9 A;  5LP6 E;  2W63 A;  3PE0 A;  2E2A A;  2PJQ A;  4ILC A;  1UCU A;  4X1K E;  4IL9 A;  3N9P A;  4IE4 A;  3VRA A;  3BQI A;  3VHL A;  3VR8 A;  5LXT E;  4ILU A;  3AA0 B;  2HN1 A;  4KHP T;  4LF7 T;  4PW8 A;  2Q9Q D;  4IE7 A;  3RGL A;  4HFD A;  4JBW F;  3WI3 A;  3N2G E;  1YKH B;  3C50 A;  4UIG A;  4JUY A;  5JDQ A;  2E5V A;  4NIQ A;  2JMK A;  3AAE B;  5LG4 A;  5LYJ E;  5DJQ C;  3NZP A;  3I0Q A;  4K0U A;  4HE8 A;  2XAH B;  4HWD A;  5BMV E;  2I0M A;  2C5J A;  3LJC A;  4AIU A;  4O2A E;  2LJL A;  3SS1 A;  1VOM A;  4HTE A;  2VUR A;  5AQK B;  5CFB A;  4CI3 B;  4TZ4 C;  1N33 T;  2Q9Q A;  5FKY A;  3T8O A;  4EB6 E;  5LBM A;  3RYC E;  3R84 B;  1XMO T;  3PV0 F;  1IZN B;  2CEA A;  5L3F B;  4N78 D;  3AE9 A;  2LOS A;  2BDE A;  2YU2 A;  2WU5 A;  3I9Y A;  3CWZ B;  1IAP A;  4DV0 T;  4ISS A;  2Y48 B;  2CWY A;  3IF8 B;  3ANW B;  4JV5 T;  2BVM A;  1OED B;  4DV7 T;  1S94 A;  4PJJ A;  1UGO A;  2MOZ A;  4PK5 A;  2QGS A;  2HPL A;  1B7T A;  4DV1 T;  2YDR A;  4OYK A;  5F5W A;  2C0S A;  4YXD A;  3UU5 A;  4LML A;  4ZI2 D;  5L4H A;  3C51 A;  3T1Y T;  3KV6 A;  4EGW A;  3AE4 A;  2X0H A;  4HFI A;  4G63 A;  3HKE E;  4DV3 T;  1IBK T;  2WZH A;  5FY7 A;  3ZMS B;  2CWO A;  4YJ2 E;  5LJM A;  2Y8D A;  3B13 A;  2K48 A;  3M3Z B;  3PJA A;  3CQX C;  3HR0 A;  2PTF A;  3UUL A;  1WR0 A;  2X0L B;  3IBP A;  5JTG A;  3QOF A;  3O4X E;  2KZ7 B;  4O2B E;  4JI7 T;  4BAY B;  3T1H T;  2V8S V;  4UV8 B;  3ETV A;  1IJ6 A;  4YTN A;  4IDZ A;  2K9A A;  1OED C;  4DR2 T;  2K3W A;  4TWF A;  5HXE A;  2LSG A;  4H9P C;  4WNK A;  4I43 B;  3HKD E;  3RIF A;  3UU8 A;  2WWV A;  4JI6 T;  1MMN A;  4OX9 T;  5L47 A;  2VQF T;  3EI0 A;  2BG9 B;  2W61 A;  3P50 A;  4IRE A;  2XAQ B;  4AQG A;  3IHR A;  4H9R C;  4UEL A;  1E2A A;  4QHO A;  1MIY A;  1KK7 A;  2IAK A;  1W9R A;  3PUA A;  4QX7 B;  1XDP A;  2XQ4 A;  3SFE A;  4YJ3 E;  2CPT A;  3KDS E;  2Q9Q C;  2YDQ A;  4DVD A;  3AEC A;  1QLB A;  2BS2 A;  3RYI E;  5L4E A;  5LJN A;  5L3B B;  2E9X D;  2IDO B;  3OYX A;  4DBR A;  5JDN A;  3P7I A;  4PFP A;  4BA9 A;  2V6X A;  2YDS A;  2JMH A;  3RIU A;  3J9X 1;  2VB6 A;  2DLR A;  3TLT A;  1FJG T;  3JAF A;  1KNZ A;  2BKO A;  5FNV E;  3N2O A;  4DR5 T;  1D0Z A;  2ZLY A;  3O1J A;  5HAX A;  2FJB A;  2X9X A;  1YXR A;  2D0T A;  3RKO A;  2IW5 B;  2CA5 A;  2V7L A;  2PG8 A;  3I9W A;  3VU7 H;  2XAF B;  2FJE A;  2W66 A;  2NOX A;  3X1D A;  4MFR A;  2NW7 A;  2IIU A;  2XQ9 A;  1ZEE A;  5FVL A;  2XQ7 A;  2NW8 A;  3SFD A;  1J5E T;  2DWK A;  4EOZ B;  3Q5D A;  3OBV E;  4F6R C;  4I50 E;  5CA0 E;  2YN6 A;  3JC6 D;  4L9I A;  4YHH T;  3AXJ A;  2XM2 A;  2XJ7 A;  2HPJ A;  2ZM8 A;  4F8H A;  3MAC A;  2YEV C;  3ZCI A;  4EXT A;  3OVU A;  1G73 A;  1N32 T;  5JR9 B;  4QKN A;  4HFH A;  3E22 E;  1HNX T;  4TNW A;  4PNI A;  5ABH A;  4DR6 T;  3PUX F;  3ZC1 A;  3OTO T;  3ZSS A;  3Q5W A;  2HN2 A;  3DTO A;  1FMW A;  4AKH A;  5FL0 A;  5KXJ A;  4YTM A;  4C90 A;  3N9M A;  2X9H A;  4ANJ A;  4COF A;  2DWG A;  3CK6 A;  1V9D A;  3C98 B;  2JQK A;  1U5P A;  5AQQ B;  5HXR A;  5ABF B;  4HWI B;  4TUY E;  3KFW X;  3LBX B;  4H9Q C;  3AXJ B;  4CN4 A;  4LF4 T;  4BJM A;  5C2T A;  4DMW A;  1QSD A;  3RRW A;  4EZH A;  2K5B B;  4X65 T;  5LCY A;  3PUZ F;  4TV9 E;  4XAX B;  3RIU C;  4IL4 A;  3FZK B;  4HWH A;  5AQT B;  4O4I E;  4IE0 A;  4YTP A;  5J2U E;  5LNK A;  4A98 A;  3ZMV B;  4DO0 A;  3P4Q A;  4NXN T;  4O4L E;  4DID B;  4OFZ A;  3QNU A;  3F31 A;  1ZKE A;  5AQS B;  4YFS A;  3IEE A;  1UK5 A;  3UU6 A;  3KV5 A;  5AQV B;  2XY8 B;  2KSR A;  4DUY T;  3PUW F;  1X79 A;  4IDN A;  2LRL A;  2XQ6 A;  2E5L T;  2V5D A;  2XPK A;  5F3J A;  3UUM A;  2ODV A;  4KUM B;  1N34 T;  2MTQ A;  3SWH A;  5KMG P;  4XBF B;  4I55 E;  3ZT6 A;  3PUS A;  5J1G A;  2Z6E A;  2W0G A;  3KV9 A;  3HKC E;  5A1L A;  2XTL A;  3EDV A;  2BS3 A;  1HG2 A;  3AE5 A;  4JI5 T;  2CHO A;  4H9O C;  3CX8 B;  2LLY A;  3A7M A;  4BJN A;  3AE3 A;  3CML A;  4EZ4 A;  1ZP0 A;  3Q5X A;  3TKL B;  2CLY C;  1MMD A;  3ZPO A;  3AEE A;  1LVF A;  4L0R A;  3C4X A;  2UUA T;  5LG3 A;  3CKD A;  5CA1 E;  1HG5 A;  3PTR B;  3U3I A;  3OPC A;  4QXB B;  4PFO A;  4B3M T;  2V6Y A;  4ZS2 A;  2NTY A;  4X1Y E;  1VRB A;  5ABE A;  1WCR A;  4DR1 T;  2FJD A;  4DV2 T;  2VVN A;  3VKG A;  2RP4 A;  4WW0 A;  3C4Z A;  5ABG A;  3P8C D;  1SUM B;  1T72 A;  3RLF F;  2KIN B;  4DV4 T;  5FL1 A;  2W00 A;  1BR2 A;  4DMV A;  1WLX A;  2UXB T;  3E08 A;  1ZHC A;  2B1E A;  3FXD B;  4WBO A;  4EAH A;  2VKO A;  3RYF E;  1I94 T;  1DU2 A;  2M67 A;  5DQW A;  3TLW A;  2JQQ A;  1BR1 A;  4CXX A;  3OJA A;  3E0Z A;  2DL1 A;  3K8P C;  4HWC A;  4KP3 C;  2J47 A;  2N2N A;  5HXC A;  2HH7 A;  1HX8 A;  4TWH A;  4JI1 T;  4KMC A;  1Z8U A;  3LSV A;  1XNQ T;  2XZE A;  5AQM B;  4UEM A;  4PAG A;  4NXM T;  3MZK B;  1H7C A;  5FYM A;  3K1S A;  4LFB T;  3WAJ A;  3FZM B;  4TV8 E;  4OYJ A;  3GMI A;  2I59 A;  2IHR 1;  2V5C A;  5AQL B;  2WZI A;  3RPU A;  4EEB A;  1JNR A;  3PUY F;  4HFE A;  2ODU A;  2LOP A;  2CCQ A;  5AQF B;  4NPP A;  2NWB A;  4IDO A;  2NR4 A;  4LFC T;  4DV6 T;  4ADZ A;  4LF9 T;  1NEK A;  3QB5 A;  1KNR A;  4O4H E;  1E7P A;  2UUC T;  3S4U A;  2UXX B;  2KWH A;  3KIN B;  4Z91 A;  3ZMZ B;  5AQR B;  2L3L A;  2LSK A;  3RHW A;  4DR7 T;  3MK7 C;  1HS7 A;  2JJ9 A;  3UUB A;  3OYZ A;  2M6I A;  4Q25 A;  4ZI3 D;  2XSB A;  3PUQ A;  5L3D B;  4DND A;  4DR4 T;  3ZN1 B;  1CHU A;  2VWA A;  5KX5 E;  2Q9Q B;  1J5W A;  1WYC A;  3ONL C;  1KNP A;  2WCA A;  5LGU B;  1W0A A;  4A97 A;  4YSZ A;  4V1A v;  3ZYL A;  3ZN0 B;  3N9O A;  4P0B A;  4LMK A;  2CXL A;  4HFV A;  5LMN T;  3C4W A;  2BKP A;  3I0O A;  4UF0 A;  4ZZC A;  3QUJ A;  1T98 A;  3AEF A;  2X66 A;  1CUN A;  4PK6 A;  1WYB A;  3PUG A;  4UVC B;  3TLU A;  2CRB A;  4UVB B;  3QC9 A;  1Z0P A;  3ZYM A;  4B3S T;  1QUU A;  2V1D B;  2VL8 A;  4NUU A;  4C91 A;  4X20 E;  3L39 A;  1SHZ C;  2KND A;  1WFD A;  3P4R A;  2I6H A;  1LRZ A;  4O8S A;  5LMU T;  3L09 A;  5HXS A;  4UV9 B;  1US7 B;  2ZM0 A;  1X9B A;  5M4Y A;  5AQG B;  3U78 A;  4HGA A;  2LHN A;  2H7V C;  2L8K A;  5H6Q B;  2WDV A;  4DUZ T;  3J7Y q;  5FY1 A;  3EUH A;  5H6R B;  3FXE B;  3PUV F;  3CQG B;  4WYV A;  2IUB A;  2VAS A;  4U3C A;  3KBT A;  5AQI B;  4ILB A;  2CXD A;  4L5G A;  4EIW A;  3EVY A;  4WBN E;  2V7J A;  4DV5 T;  2V7I A;  3RI5 A;  4JYA T;  3V5U A;  1J1J A;  1G8X A;  4EV6 A;  4TNV A;  4H9N C;  2GK9 A;  2ES0 A;  3RKG A;  3EDU A;  2G0U A;  3CX7 B;  3CX6 B;  3PDY A;  4QX8 B;  1IBM T;  4H63 V;  2X51 A;  3GWH A;  3TLS A;  2LT3 A;  4PJM A;  3AE1 A;  5HEJ A;  2E9X A;  3WAK A;  2WAU A;  5JQG E;  2W62 A;  2XSA A;  3MA9 A;  1M7K A;  5ADX L;  4O4J E;  2FBW A;  4AKR B;  3H37 A;  1D0Y A;  4E7Z A;  3EAB A;  3L8R A;  2EHO D;  4LF8 T;  3PU8 A;  4LFA T;  4P0A A;  3RQU A;  1XWM A;  1ZOY A;  4YT0 A;  4CI1 B;  3HL6 A;  5HEU A;  4EYY R;  3LK4 2;  4ZI2 C;  4ASK A;  4GK5 E;  5C3J A;  2XQA A;  1SA0 E;  3O1I A;  3UU3 A;  1D1A A;  2YOE A;  4QXH B;  2C5K T;  1NAF A;  1YKE B;  4ZI3 C;  3BQL A;  4I4T E;  3MKD A;  2WB5 A;  2CBI A;  5JDM A;  1S35 A;  4G2A A;  3ZLI A;  3I1A A;  1HR0 T;  2KT9 A;  3A5X A;  2MAW A;  5TAO A;  4QH1 A;  2A72 A;  2QVA A;  3AAI A;  3NRX A;  4AKG A;  3EAM A;  2E9X B;  4U74 A;  4U31 A;  3NVO A;  3F57 A;  2H3R A;  2V7K A;  3O9X A;  4QH5 A;  4LF5 T;  2WDR A;  5JVD E;  2M6B A;  4KBM B;  1FMV A;  2DHR A;  2JPF A;  3Q9D A;  2PBI A;  2WBL A;  3K3N A;  3O1H A;  3FZL B;  5GON E;  3C64 A;  3KV4 A;  4A56 A;  2AE9 A;  4IST A;  3RC8 A;  2W67 A;  2CLY B;  5AQN B;  2QYW A;  3UFE A;  5IYZ E;  4ZS3 A;  1MIV A;  4U2Y A;  3AA7 B;  1Y01 A;  2VKH A;  3N9Q A;  5JDH A;  4ZZB A;  1HCI A;  4AXP A;  4CQI A;  5J0Z A;  5C8Y E;  3LFM A;  2R6G F;  1UX5 A;  4AQY T;  5FMN A;  1WRD A;  2X9Y A;  5AQH B;  5AQJ B;  2L9Q A;  3JAE A;  2X67 A;  5JRE A;  2CHN A;  2IC9 A;  4U7Y A;  3DP7 A;  1YQ3 A;  3N9N A;  4PJN A;  2X0Y A;  4JI4 T;  3ETU A;  2J1D G;  1T7S A;  2XM1 A;  3ZT7 A;  1OWA A;  2E9X C;  3FBZ A;  3MXZ A;  2UU9 T;  3ZKR A;  1O3X A;  2JIW A;  3DJB A;  2FUP A;  1BR0 A;  3NKZ A;  5LHH B;  4LMJ A;  2WP9 A;  2XAS B;  3ONJ A;  3LG7 A;  3SOL A;  4HN9 A;  3KVA A;  2FJA A;  3RX6 A;  3ZCJ A;  5FP3 A;  5HXH A;  4JEH B;  5HEH A;  2CMR A;  4AKI A;  5JH7 E;  4GKJ T;  3GN5 A;  5E0O A;  1UX4 A;  4AQF A;  2YKS A;  3L3P A;  4WZX A;  4IDP A;  4HKA A;  4YHJ A;  2WS3 A;  2KWI B;  2K24 A;  5AQO B;  3FZH B;  4DBQ A;  4NUV A;  5BR8 T;  3JC6 C;  3ZEF B;  2KXP B;  2KMF A;  1MMA A;  5EK3 A;  2ACX A;  2LSJ A;  5J2T E;  3ANW A;  4TN7 B;  4ZOL E;  1OED A;  1N36 T;  2VL0 A;  3AEA A;  2JRK A;  3JCF A;  3RYH E;  2V26 A;  3HKB E;  2D9D A;  4QXC B;  1NEN A;  2LM9 A;  2UUB T;  3UQ7 A;  5JRC A;  2VVS A;  3H3M A;  2P9B A;  1HF8 A;  2N9D A;  2ZM2 A;  2LHR A;  2XQ3 A;  5L3E B;  2BKN A;  3QB5 K;  1XNR T;  3GN5 B;  4CZZ B;  1T8B A;  3CVR A;  2J62 A;  5HWX A;  3FBL A;  3ZT5 A;  4KI0 F;  2X9W A;  2V6Y B;  1D1C A;  2XHE B;  5ETW A;  4IDQ A;  3N9L A;  2CE7 A;  2D2S A;  3UQ4 A;  2OA5 A;  4M1P A;  3G06 A;  1KFY A;  4IHJ E;  4ILA A;  3NRY A;  3SRZ A;  2BVL A;  4IE6 A;  4EYU A;  2B76 A;  5LGN B;  2WMN A;  4J2C A;  2H7O A;  3UUX B;  5L3G B;  3N5L A;  2WU2 A;  4E7S A;  1HFA A;  4ZEY A;  1YQ4 A;  1XMQ T;  2MPK A;  1VCT A;  5L2L A;  3AED A;  4U2Z A;  3AE7 A;  3AAA B;  5L3C B;  2C5I T;  2H89 A;  5JRC B;  5FY0 A;  3R6N A;  4JEU B;  1SE7 A;  5AQP B;  3AA6 B;  4UXN B;  5HEO A;  2BG9 A;  3FZF B;  4KX6 A;  2VKJ A;  3IA3 A;  2OV9 A;  2LRK A;  5FXX A;  3B57 A;  4ZI7 E;  2A3D A;  1D0X A;  4AQF C;  3Q2M A;  3K3O A;  3CIR A;  1YW0 A;  4Z90 A;  3RC3 A;  1HNW T;  2UXN B;  2XUE A;  3P4P A;  5AFU L;  2PFV A;  4QWN B;  4X1I E;  1WR6 A;  4IIJ E;  4HWF A;  4CXY A;  4GYS A;  1R8I A;  1IBL T;  4X64 T;  2DNX A;  2XQ5 A;  5HCJ A;  2SPC A;  3AB3 B;  2BBH A;  2W2U A;  4K0K T;  2J4G A;  2V7M A;  3F2E A;  3V5S A;  4MHC A;  2OLT A;  4CN6 A;  2BZB A;  3PJA J;  5FXV A;  4MAL A;  2HHH T;  4TX5 A;  1JNZ A;  3CQC B;  2LE8 A;  2CXF A;  2E8I A;  2JQH A;  3UTK A;  4B3R T;  4MBQ A;  3ONX A;  4FI5 A;  4JLE A;  3UUN A;  1UUS A;  3MJX A;  2LEH A;  1KEY A;  2ACZ A;  1AJ3 A;  2X68 A;  5LBQ B;  3VR9 A;  5JDG A;  3KBU A;  3KVB A;  3VRB A;  4HEA A;  5HEG A;  4JI0 T;  2LSY A;  3NZQ A;  4DR3 T;  5IUX A;  4U33 A;  2Y6X A;  2UXD T;  1BR4 A;  3FHN A;  4HFC A;  2VQE T;  3ESL A;  3ZMT B;  4PJL A;  1Y64 B;  1NWM X;  5FXW A;  2RA1 A;  3P4W A;  3AVS A;  4UF0 B;  4Z8X A;  4PK4 A;  3ZST A;  4X5T A;  5LOV E;  5FXZ A;  4OHF A;  4GK0 E;  3AEB A;  1FIO A;  2BBJ A;  3GA8 A;  3AE2 A;  4AIS A;  5JR9 A;  1EZ3 A;  2QA7 A;  5HYA A;  4JI2 T;  2MBG A;  2VK9 A;  4JI3 T;  2VKD A;  4IE5 A;  5EK2 A;  1D1B A;  4AI6 A;  1W09 A;  2RPA A;  3W15 B;  4P09 A;  2A2F X;  3VKH A;  3RQW A;  4ERR A;  4YSY A;  3PU3 A;  5LA6 E;  1LKX A;  1GQE A;  2NP9 A;  2N1G A;  2WDQ A;  3NBX X;  4IT4 A;  1UUR A;  2BG9 C;  3AVR A;  2WQY A;  1MMG A;  1OED E;  2XQ8 A;  2WY2 A;  2LKH A;  1HNZ T;  5HWY A;  2MYS A;  3D0T A;  2IML A;  1HTJ F;  2YIN A;  3LDQ B;  5ABF A;  3OKQ A;  4HFB A;  5EZY E;  3LBX A;  3RRC A;  4B3T T;  4X62 T;  4ZXL A;  4GOU A;  4X66 T;  5LGT B;  4CN1 A;  3AA1 B;  5JDL A;  3N2K E;  2F4V T;  2D5U A;  5CGM A;  3QK6 A;  2EHO A;  3TLV A;  4UVA B;  4ZHQ E;  1M62 A;  2NTX A;  4U7I A;  2ZM6 T;  4LF6 T;  3EHZ A;  1HX1 B;  5KDM C;  3M65 A;  3ZJ1 A;  3ZJ2 A;  5DAB A;  5CB4 E;  5AQU B;  3ABV A;  3ZMU B;  5LHG B;  3UU4 A;  1E1H B;  2W4X A;  3BK9 A;  1IJ5 A;  5IHY A;  5EK4 A;  1W0B A;  2DI4 A;  3P4S A;  1I6Z A;  2UXC T;  4H63 H;  3AEG A;  4U72 A;  4CXW A;  3CPZ A;  2WMO A;  1U4Q A;  1MNE A;  4OK0 A;  4YLH A;  4QH4 A;  3PUR A;  4GIW A;  1XDO A;  4AKL A;  2H88 A;  3K3Q C;  1KF6 A;  2BG9 E;  5LB7 B;  2XQY A;  3HA4 A;  1L0V A;  4FJO A;  2QRX A;  2LKG A;  5DQV A;  3FB2 A;  2EHO B;  3RH3 A;  2CM0 A;  4IGU A;  2ZMA A;  5CJ5 A;  3HI2 A;  4H9S E;  5JR9 C;  2LSI A;  4TWD A;  2LM2 A;  3BQK A;  2CBJ A;  4GKK T;  4CI2 B;  3LK3 B;  4KHZ F;  2XAG B;  2D0U A;  1VCS A;  1LVK A;  2NW9 A;  2IC6 A;  2DCF A;  4GYR A;  2A9U A;  1FEW A;  5LHI B;  1YD8 G;  2WWU A;  1MND A;  2YU1 A;  5JDF A;  2KLQ A;  4I0U A;  3RF1 A;  2BS4 A;  4A5X A;  4EED A;  3JAD A;  2JQ9 A;  1ZV4 X;  2AXD S;  1OXZ A;  3NWI A;  4YY3 T;  4UR9 A;  3UT5 E;  5HCM A;  5IWA T;  3RIA A;  3ZC0 A;  3LK2 B;  4XZC A;  3UFG A;  3AE6 A;  3AE8 A;  2YK0 A;  1XZY A;  4JI8 T; 
#chains in the Genus database with same CATH homology
 2XAJ B;  5FY1 A;  3N5L A;  3EUH A;  5H6R B;  3ZC1 A;  3ZYK A;  1MIW A;  3FXE B;  4E7S A;  3Q5W A;  3CQG B;  1HFA A;  2VAS A;  3DTO A;  3KBT A;  4MLK A;  3H3A A;  1FMW A;  2CXD A;  4AKH A;  4L5G A;  4EIW A;  5L2L A;  3EVY A;  4WBN E;  2V7J A;  2WSS V;  3AAA B;  2EHO C;  4B6X A;  4C90 A;  5F8P A;  5L3C B;  2V7I A;  2C5I T;  3N9M A;  5JRC B;  2WM9 A;  5FY0 A;  2X9H A;  3R6N A;  3V5U A;  5LP6 E;  2W63 A;  1G8X A;  4ANJ A;  3PE0 A;  4JEU B;  2DWG A;  1V9D A;  3C98 B;  4H9N C;  3AA6 B;  4UXN B;  2GK9 A;  1U5P A;  2VKJ A;  2ES0 A;  2PJQ A;  5HXR A;  3EDU A;  2G0U A;  1UCU A;  5FXX A;  4TUY E;  3KFW X;  3CX7 B;  3B57 A;  4X1K E;  4ZI7 E;  2A3D A;  3CX6 B;  1D0X A;  3LBX B;  4H9Q C;  3PDY A;  3N9P A;  4AQF C;  4IE4 A;  4QX8 B;  3BQI A;  3VHL A;  3Q2M A;  3K3O A;  4H63 V;  4BJM A;  1YW0 A;  5LXT E;  4ILU A;  2X51 A;  4DMW A;  1QSD A;  3GWH A;  3AA0 B;  3RRW A;  3RC3 A;  2LT3 A;  4EZH A;  4PJM A;  2K5B B;  4PW8 A;  2UXN B;  5LCY A;  2E9X A;  2Q9Q D;  4IE7 A;  3WAK A;  2WAU A;  2XUE A;  4TV9 E;  3WI3 A;  3N2G E;  1YKH B;  5AFU L;  4XAX B;  2PFV A;  4QWN B;  3C50 A;  1WR6 A;  4UIG A;  4X1I E;  2W62 A;  5JQG E;  4JUY A;  3MA9 A;  4IIJ E;  5JDQ A;  2JMK A;  4CXY A;  3AAE B;  4O4I E;  5LG4 A;  4IE0 A;  5J2U E;  5LNK A;  5ADX L;  4O4J E;  3ZMV B;  4DO0 A;  5LYJ E;  4AKR B;  3H37 A;  4O4L E;  5DJQ C;  1D0Y A;  4E7Z A;  4OFZ A;  4GYS A;  2EHO D;  1ZKE A;  3F31 A;  3NZP A;  4YFS A;  3I0Q A;  4K0U A;  2DNX A;  3PU8 A;  4HE8 A;  3IEE A;  2XAH B;  5BMV E;  4P0A A;  2C5J A;  2SPC A;  3AB3 B;  3LJC A;  3KV5 A;  4O2A E;  2LJL A;  4CI1 B;  3HL6 A;  3SS1 A;  2V7M A;  1VOM A;  3F2E A;  4HTE A;  3V5S A;  4MHC A;  2BZB A;  5FXV A;  4MAL A;  4EYY R;  1X79 A;  3LK4 2;  4TX5 A;  4CI3 B;  4ZI2 C;  4ASK A;  3CQC B;  4TZ4 C;  2LE8 A;  2Q9Q A;  3T8O A;  4GK5 E;  2CXF A;  4EB6 E;  5F3J A;  2E8I A;  3UUM A;  1SA0 E;  3O1I A;  5LBM A;  3RYC E;  2ODV A;  4KUM B;  3UTK A;  4MBQ A;  3ONX A;  1D1A A;  4FI5 A;  4JLE A;  3R84 B;  3UUN A;  2MTQ A;  3MJX A;  3SWH A;  1IZN B;  2LEH A;  4QXH B;  5KMG P;  4XBF B;  2CEA A;  2C5K T;  4I55 E;  5L3F B;  4N78 D;  1NAF A;  1YKE B;  1AJ3 A;  2LOS A;  2BDE A;  3PUS A;  4ZI3 C;  2X68 A;  2YU2 A;  3BQL A;  5J1G A;  2Z6E A;  2W0G A;  3I9Y A;  3KV9 A;  4I4T E;  3CWZ B;  3HKC E;  5LBQ B;  5A1L A;  2XTL A;  3MKD A;  1IAP A;  3EDV A;  5JDG A;  3KBU A;  4ISS A;  5JDM A;  3KVB A;  2Y48 B;  1HG2 A;  1S35 A;  2CWY A;  3IF8 B;  4G2A A;  3ANW B;  4H9O C;  3ZLI A;  3CX8 B;  4HEA A;  3I1A A;  2BVM A;  4BJN A;  2KT9 A;  3A5X A;  2LSY A;  3CML A;  5TAO A;  3NZQ A;  4EZ4 A;  3Q5X A;  1S94 A;  2Y6X A;  3TKL B;  2A72 A;  3AAI A;  2CLY C;  1BR4 A;  1MMD A;  3NRX A;  4PJJ A;  4AKG A;  2MOZ A;  3FHN A;  3ZPO A;  4PK5 A;  1LVF A;  2QGS A;  2E9X B;  3ESL A;  3ZMT B;  2HPL A;  1B7T A;  4L0R A;  4U74 A;  3C4X A;  3F57 A;  4PJL A;  3CKD A;  5CA1 E;  2H3R A;  1HG5 A;  2V7K A;  3PTR B;  1Y64 B;  4OYK A;  3U3I A;  3O9X A;  5JVD E;  4QXB B;  1NWM X;  4PFO A;  4ZS2 A;  2C0S A;  2NTY A;  5FXW A;  2RA1 A;  4UF0 B;  3AVS A;  4Z8X A;  4PK4 A;  1VRB A;  4X1Y E;  4KBM B;  1FMV A;  2DHR A;  4ZI2 D;  3C51 A;  2JPF A;  3Q9D A;  3KV6 A;  2PBI A;  2WBL A;  3K3N A;  5LOV E;  5FXZ A;  3O1H A;  4OHF A;  4GK0 E;  1FIO A;  4G63 A;  3GA8 A;  3HKE E;  5GON E;  3VKG A;  3C64 A;  3KV4 A;  5FY7 A;  3ZMS B;  2RP4 A;  5JR9 A;  4A56 A;  4IST A;  1EZ3 A;  4WW0 A;  3RC8 A;  2CWO A;  2QA7 A;  3C4Z A;  5HYA A;  4YJ2 E;  3P8C D;  2CLY B;  5LJM A;  2MBG A;  2Y8D A;  2VK9 A;  3B13 A;  2VKD A;  4IE5 A;  5EK2 A;  1D1B A;  3UFE A;  5IYZ E;  4ZS3 A;  4AI6 A;  2K48 A;  1MIV A;  2KIN B;  3W15 B;  2W00 A;  3AA7 B;  3CQX C;  3HR0 A;  2A2F X;  1BR2 A;  4P09 A;  3VKH A;  2VKH A;  4DMV A;  3N9Q A;  3UUL A;  1WLX A;  5JDH A;  4ERR A;  2X0L B;  1HCI A;  3E08 A;  4AXP A;  4CQI A;  1ZHC A;  5C8Y E;  3IBP A;  3LFM A;  2B1E A;  3FXD B;  4WBO A;  4EAH A;  3O4X E;  3PU3 A;  2VKO A;  1LKX A;  5LA6 E;  2KZ7 B;  3RYF E;  4O2B E;  1UX5 A;  4BAY B;  2NP9 A;  2N1G A;  3NBX X;  5FMN A;  3AVR A;  2M67 A;  4UV8 B;  5DQW A;  1MMG A;  1WRD A;  3ETV A;  1IJ6 A;  2JQQ A;  1BR1 A;  2X9Y A;  4CXX A;  3OJA A;  3E0Z A;  2L9Q A;  5HWY A;  2MYS A;  2X67 A;  5JRE A;  2IC9 A;  3K8P C;  4KP3 C;  3DP7 A;  4IDZ A;  2K9A A;  2N2N A;  3N9N A;  4PJN A;  3D0T A;  5HXC A;  2HH7 A;  1HX8 A;  1HTJ F;  2J1D G;  3ETU A;  4KMC A;  5HXE A;  1OWA A;  2E9X C;  2LSG A;  3FBZ A;  2YIN A;  3MXZ A;  4H9P C;  3OKQ A;  4WNK A;  4I43 B;  3HKD E;  4UEM A;  4PAG A;  5EZY E;  1O3X A;  3LBX A;  3MZK B;  1H7C A;  5FYM A;  3RRC A;  3DJB A;  1MMN A;  1BR0 A;  5LHH B;  3WAJ A;  4GOU A;  2XAS B;  4TV8 E;  5LGT B;  4OYJ A;  3AA1 B;  3GMI A;  3LG7 A;  5JDL A;  3N2K E;  2I59 A;  2D5U A;  3SOL A;  3QK6 A;  2W61 A;  2XAQ B;  3KVA A;  4HN9 A;  2EHO A;  3RPU A;  4AQG A;  3IHR A;  4UVA B;  3RX6 A;  4ZHQ E;  2NTX A;  4H9R C;  2ODU A;  4UEL A;  3ZCJ A;  4QHO A;  5FP3 A;  5KDM C;  2LOP A;  2CCQ A;  3M65 A;  5HXH A;  1MIY A;  4JEH B;  1KK7 A;  3ZJ1 A;  3ZJ2 A;  2IAK A;  5DAB A;  2NWB A;  3PUA A;  2CMR A;  4AKI A;  4QX7 B;  5JH7 E;  4ADZ A;  5CB4 E;  4O4H E;  3GN5 A;  4YJ3 E;  5E0O A;  3ZMU B;  5LHG B;  3KDS E;  1UX4 A;  2Q9Q C;  4AQF A;  4DVD A;  3S4U A;  3L3P A;  1E1H B;  2UXX B;  4HKA A;  2KWH A;  3RYI E;  4YHJ A;  5LJN A;  3BK9 A;  1IJ5 A;  5IHY A;  5L3B B;  5EK4 A;  3KIN B;  2DI4 A;  2E9X D;  2K24 A;  2KWI B;  3OYX A;  4DBR A;  3ZMZ B;  5JDN A;  2L3L A;  3P7I A;  4PFP A;  4BA9 A;  2LSK A;  4DBQ A;  3MK7 C;  4H63 H;  2JMH A;  3J9X 1;  4U72 A;  2VB6 A;  2DLR A;  4NUV A;  4CXW A;  1HS7 A;  2JJ9 A;  3OYZ A;  3CPZ A;  3JC6 C;  4ZI3 D;  1KNZ A;  2WMO A;  3ZEF B;  1U4Q A;  3PUQ A;  2KXP B;  5L3D B;  1MNE A;  4OK0 A;  2KMF A;  1MMA A;  4YLH A;  4DND A;  5FNV E;  3N2O A;  3ZN1 B;  2VWA A;  1D0Z A;  5EK3 A;  2ACX A;  5KX5 E;  2ZLY A;  2Q9Q B;  3O1J A;  3PUR A;  1WYC A;  4GIW A;  5HAX A;  2LSJ A;  5J2T E;  2X9X A;  4AKL A;  3ANW A;  2D0T A;  3RKO A;  4TN7 B;  3K3Q C;  2IW5 B;  4ZOL E;  5LGU B;  2CA5 A;  2V7L A;  2PG8 A;  4V1A v;  2XQY A;  3ZYL A;  3HA4 A;  3I9W A;  3VU7 H;  2XAF B;  4FJO A;  3ZN0 B;  3N9O A;  4P0B A;  2NOX A;  4MFR A;  2JRK A;  5DQV A;  3RYH E;  3FB2 A;  2V26 A;  2EHO B;  3HKB E;  3RH3 A;  4QXC B;  2CM0 A;  2NW7 A;  4IGU A;  2ZMA A;  2LM9 A;  3HI2 A;  4H9S E;  1ZEE A;  2CXL A;  4HFV A;  3C4W A;  2NW8 A;  3I0O A;  5JRC A;  4UF0 A;  3QUJ A;  5JR9 C;  1T98 A;  2DWK A;  2LSI A;  2X66 A;  2P9B A;  1HF8 A;  4EOZ B;  1CUN A;  2N9D A;  3BQK A;  2ZM2 A;  2LHR A;  3OBV E;  4PK6 A;  4F6R C;  4I50 E;  1WYB A;  5CA0 E;  5L3E B;  4CI2 B;  3LK3 B;  3PUG A;  2XAG B;  3GN5 B;  4UVC B;  4CZZ B;  3JC6 D;  3CVR A;  2D0U A;  4L9I A;  5HWX A;  3FBL A;  1LVK A;  4UVB B;  2X9W A;  1D1C A;  2XHE B;  2NW9 A;  3QC9 A;  2IC6 A;  5ETW A;  2DCF A;  4GYR A;  1Z0P A;  3ZYM A;  3N9L A;  2CE7 A;  2D2S A;  1FEW A;  5LHI B;  1QUU A;  2V1D B;  2VL8 A;  1YD8 G;  2OA5 A;  4M1P A;  2WWU A;  1MND A;  2YU1 A;  2HPJ A;  5JDF A;  2ZM8 A;  2KLQ A;  4NUU A;  4C91 A;  4X20 E;  3MAC A;  4IHJ E;  2YEV C;  3ZCI A;  1SHZ C;  3NRY A;  1ZV4 X;  4EXT A;  2KND A;  1G73 A;  3SRZ A;  1LRZ A;  5JR9 B;  4O8S A;  1OXZ A;  4QKN A;  2BVL A;  3L09 A;  4UV9 B;  5HXS A;  1US7 B;  3E22 E;  4IE6 A;  3UT5 E;  2ZM0 A;  4EYU A;  5M4Y A;  3ZC0 A;  5LGN B;  3LK2 B;  2WMN A;  4J2C A;  4HGA A;  4XZC A;  3U78 A;  2LHN A;  4PNI A;  2H7V C;  2L8K A;  2H7O A;  5H6Q B;  2YK0 A;  3UUX B;  5L3G B;  3J7Y q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...