3ONXA

Crystal structure of a domain of a protein involved in formation of actin cytoskeleton
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
125
structure length
125
Chain Sequence
NRMYMEKSQTELGDLSDTLLSKVDDLQDVIEIMRKDVAERRSQPAKKKLETVSKDLENAQADVLKLQEFIDTEKPHWKKTWEAELDKVCEEQQFLTLQEELILDLKEDLGKALETFDLIKLCCEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the formin-interaction domain of the actin nucleation-promoting factor Bud6.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Bud site selection protein 6
total genus 51
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1540 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3onxA00
3OKQA 3ONXA
chains in the Genus database with same CATH superfamily
2UUAT 3MJXA 1MIVA 4PFOA 3JCFA 4PFPA 3RQWA 5J0ZA 2OV9A 1N32T 2PG8A 4Q25A 2ZM6T 3Q2MA 4CQIA 4XBFB 2L8KA 5HEHA 5AQHB 2UXBT 2HHHT 5EK3A 3P4QA 4BJNA 2EHOA 4GK0E 3T8OA 3EABA 2XQ9A 5ABGA 5JTGA 3C4XA 5JR9A 2KMFA 2X9WA 2QGSA 2LHRA 2CWOA 3K8PC 2W67A 1I6ZA 2KZ7B 4CI3B 3MXZA 2IIUA 3IA3A 5IYZE 3RRCA 4MBQA 5ABFA 4GOUA 4G63A 4HFEA 2J62A 3RGLA 4DBRA 2X67A 4YXDA 4ZI7E 2X9YA 2UU9T 3CK6A 3CQGB 5LGTB 3KV9A 3DJBA 2YK0A 5EK4A 1CUNA 4DNDA 2A2FX 3K3NA 2W61A 3OKQA 4CXWA 4ILCA 3VU7H 4TWFA 5CJ5A 5JRCA 3N9OA 1D1BA 4JI3T 2FJDA 3AEEA 3Q5WA 4HEAA 4ILAA 4ZI2C 2ZM0A 3C4WA 1OXZA 5FNVE 2YU2A 3ZYMA 3P50A 4DUZT 2XQ6A 3AE6A 5ABHA 2M67A 2FUPA 4PK4A 2XZEA 3FZFB 3N2KE 4U7YA 3UU6A 4M1PA 2I0MA 3RF1A 4QXHB 1IBKT 2DLRA 1VCTA 2N2NA 2WB5A 4DV0T 4TWHA 4OX9T 2I6HA 2LSIA 1Z0PA 2X9XA 3C51A 4ZZBA 2XAFB 3JADA 3N2OA 4ASKA 1T98A 3AE2A 5AQOB 2M6IA 5C3JA 3TLTA 3ABVA 4WZXA 5LXTE 1YQ3A 4B3MT 4QH1A 3U78A 4O2AE 1ZEEA 2BG9E 3CX7B 3CWZB 3UU4A 2XAQB 2C5KT 1B7TA 2VQET 3HI2A 2PFVA 4O4HE 4KHPT 1S35A 2LM9A 3AE1A 5AQSB 2WBLA 1BR4A 2NOXA 2V7LA 2WQYA 4H63V 3ZEFB 5J2TE 3N9MA 5LBMA 1X79A 2CA5A 3TLVA 5C2TA 3NKZA 5L3BB 2MPKA 2K3WA 3EI0A 3FZHB 3PUGA 4WW0A 4XZCA 5HCMA 3QOFA 2D2SA 5HWYA 5HXEA 2B76A 3RIUC 3ZPOA 3QC9A 4EV6A 4YJ2E 1T72A 2K9AA 4UVBB 2KWHA 3RC8A 5JQGE 2JMKA 2PJQA 3NZQA 3ZT6A 3PUSA 4PK5A 3QB5A 5LYJE 1Y01A 5HEOA 2XQ7A 2HPLA 4I43B 2XJ7A 2E9XB 2YDSA 3BK9A 4X1KE 5LA6E 3ZCJA 3ZYLA 3IHRA 4YY3T 5DQWA 2XUEA 1ZHCA 5HXHA 5FY0A 2JQQA 2ODVA 5L4HA 3UU5A 3ZC1A 2X0LB 4QXCB 4A5XA 4DIDB 3PUAA 4ZOLE 4P09A 3GN5A 3WAKA 1D0ZA 4U3CA 4EEBA 4UR9A 3FBZA 2CBIA 3F31A 3FZKB 3FXEB 4X64T 4EAHA 2QA7A 2C5IT 1XDOA 3AXJB 3CKDA 4GYRA 4Z90A 2RPAA 5LBQB 2V6YA 1VCSA 2C0SA 4JEHB 4DMVA 3ZCIA 3GA8A 1XWMA 2CBJA 1NAFA 4HTEA 4JYAT 4A56A 1BR2A 3PDYA 5FVKA 5ABFB 2IW5B 1H7CA 3SFEA 1T8BA 5LMUT 3PU8A 4GYSA 4AQGA 1OEDB 2D5UA 2WP9A 4HWCA 4UELA 4KBMB 3UQ4A 5IHYA 2XTLA 4UEMA 1U4QA 2UXCT 1DU2A 2NTXA 3EVYA 1E7PA 5AQVB 4EYYR 5LP6E 4QHOA 2Y6XA 1KEYA 1KNPA 5CFBA 3SS1A 1LKXA 2LLYA 4DV2T 3I9YA 2WU2A 2FJBA 3Q5EA 4YT0A 1J5WA 4I50E 4ZZCA 3PUYF 3ETVA 5M4YA 3AE5A 2IC9A 2XSBA 2MOZA 2E5VA 3EAMA 4DBQA 5L2LA 3LG7A 2HN2A 3UQ7A 1KNRA 2WZIA 1YKEB 3UFEA 4HWFA 2OLTA 2CHNA 2WU5A 1W09A 2CCQA 2XQ4A 3I1AA 4OFZA 4TX5A 3L09A 4EEDA 4EZHA 2E2AA 4EIWA 2ACZA 3RKGA 3RYHE 4DR2T 2A72A 3JC6D 2CRBA 2H7VC 3H3AA 4I55E 3ZKRA 2WS3A 3RX6A 4P0AA 4A98A 4O4LE 4OK0A 5HCJA 2BKOA 4DR6T 5JRCB 4H9OC 1D0XA 4JI5T 3FZMB 3E08A 1R8IA 5L3EB 5GONE 3N9LA 3TKLB 3V5UA 5LCYA 5JDQA 3UU8A 1MMAA 3VRAA 4LMJA 2Q9QA 2X51A 2CLYB 2BDEA 2XQ5A 3K3QC 2R6GF 3SWHA 3KV5A 2YOEA 3RIAA 4DV7T 4MFRA 3KFWX 2D0UA 1SHZC 2PBIA 1UX4A 2NW7A 5FMNA 1IJ5A 4TNWA 3F57A 2X68A 3QB5K 4DUYT 4B3ST 5AQQB 1AJ3A 3ONXA 4B3TT 3KVAA 3TLSA 3PUVF 3HL6A 3AE4A 3MK7C 2Y48B 4TV9E 5DQVA 2JIWA 4H63H 5LJNA 2HPJA 3M65A 4CZZB 5AQMB 3Q9DA 4U2YA 2E9XA 1JNZA 2NWBA 3EUHA 4YSZA 3RHWA 3UTKA 5J2UE 3V5SA 2DI4A 3MACA 3OJAA 4QX8B 2ZM2A 2V26A 1HR0T 3RPUA 3T1HT 1KK7A 3FB2A 2YINA 5KMGP 1D0YA 2YN6A 3CMLA 4IDPA 3HA4A 4O4JE 2CHOA 2CPTA 4L5GA 4JEUB 2LSJA 4U72A 4L0RA 2BBHA 4IREA 2IUBA 3ETUA 4YTMA 2WMOA 5HEJA 1M7KA 4TV8E 2KNDA 1NWMX 1OEDE 4H9RC 2RA1A 3N9PA 2CWYA 2JMHA 3KDSE 3N5LA 4JUYA 2G0UA 2WMNA 4NIQA 4DMWA 3GWHA 3ANWA 3K1SA 3LDQB 2MAWA 2D0TA 3PJAJ 4UIGA 4IIJE 4JI7T 3N9QA 4A97A 2K48A 2YDRA 3OPCA 2WDRA 4DV1T 1FEWA 5JDMA 4HE8A 3LJCA 2WZHA 4HFDA 2NR4A 2JPFA 2NP9A 5IWAT 1HNWT 3AEFA 2L9QA 3SRZA 1E1HB 2KLQA 4EOZB 4HWDA 4WYVA 3X1DA 2C5JA 4HWHA 2HH7A 3HKCE 4TN7B 4IGUA 5ADXL 1J5ET 1WFDA 4KI0F 3U3IA 4CI1B 5L3FB 3C50A 5FXXA 4DR1T 2FBWA 1HX1B 3ZMUB 4ZEYA 1LRZA 2EHOC 4G2AA 2LSYA 4B3RT 2BVLA 3CX6B 4TZ4C 1HG5A 5CA1E 4V1Av 5F3JA 3P4RA 4LF4T 4DO0A 1MNDA 4E7ZA 4YSYA 5LG3A 1IAPA 5JH7E 2LSGA 1W9RA 3VHLA 5LNKA 4NUVA 4YLHA 4ZI3D 5CGMA 3ZJ2A 4LF7T 3ONLC 4NXNT 4K0KT 3B57A 5L3DB 2VKJA 4WBNE 3BQLA 5FL1A 5LHGB 3LK3B 4IT4A 4XAXB 4ZI2D 2IMLA 2VL0A 3C98B 1HTJF 5CA0E 5JDNA 1MNEA 5BR8T 3MKDA 3H3MA 4ZXLA 4AQFC 3RC3A 1HNXT 2SPCA 3E0ZA 4QWNB 5FKYA 5L4EA 2V6YB 2LRKA 2FJEA 4IDQA 1MMDA 4IHJE 4ANJA 3OVUA 4WBOA 2W2UA 1UGOA 3AEDA 3LBXA 3OYZA 4JI1T 1WRDA 1QLBA 2VKOA 3LFMA 5JVDE 2BG9C 3P4WA 4DVDA 5L3CB 4CN1A 2VL8A 2LE8A 2V7KA 2PTFA 3VKGA 3TLUA 3A8YC 3CX8B 2K24A 3VKHA 1FMVA 5JR9C 1MMNA 1QSDA 1Z8UA 5AQTB 3PUZF 4PJMA 2E9XC 5KX5E 3C64A 2H88A 3Q5XA 5JDFA 4I0UA 1OWAA 4QX7B 1WR0A 3H37A 5FYMA 3RLFF 2WAUA 4YTNA 2DWKA 3NWIA 4CN4A 4N78D 2QVAA 4IE6A 3RQUA 4C91A 3PJAA 1KFYA 3DP7A 4X1IE 3ZJ1A 3RYCE 4JLEA 2XPKA 5LGUB 4AKGA 3LK42 3NVOA 1SA0E 3AA1B 4CI2B 3MZKB 3AAIA 3O1HA 4IL4A 2CEAA 2IDOB 3GMIA 2XM2A 3HR0A 4O8SA 1US7B 5DJQC 4GKKT 1WCRA 2Q9QC 3EDUA 2N9DA 2MTQA 2QRXA 2WM9A 4LMKA 3R84B 2L3LA 2Y8DA 2QYWA 3L3PA 4QKNA 3O4XE 5F5WA 1MIYA 4HFHA 1N34T 1FJGT 3T1YT 5FP3A 3SOLA 3AAAB 3B13A 3ZN1B 4X66T 2WDVA 4EXTA 5AQNB 2KT9A 4U33A 1QUUA 4UV8B 4DV3T 4DV6T 4LF6T 4PAGA 2VK9A 2BVMA 2VKDA 4HGAA 5ETWA 4YFSA 5AQFB 2WY2A 3PV0F 4AQYT 1O3XA 2A9UA 1NENA 3AA7B 3JAEA 4HWIB 4P0BA 2LJLA 4JI6T 2BS2A 2N1GA 2XAGB 4HFVA 1LVFA 1V9DA 1KNZA 4TWDA 5JDHA 1HX8A 2WDQA 2XQ8A 3OBVE 2XAJB 1SE7A 2UXNB 4AI6A 3Q5DA 5A1LA 3A5XA 3P4PA 5EK2A 2BZBA 4JI0T 5KXJA 4P1NA 2KSRA 5AFUL 4BA9A 4X1YE 2H7OA 1WYCA 5LGNB 2NTYA 1E2AA 2BKNA 2K5BB 2BG9A 4LMLA 3ZN0B 2UXXB 2XHEB 4AKRB 4UVCB 2W66A 2DNXA 4OYKA 2IAKA 2CXLA 1MIWA 1VOMA 3DTOA 3FZLB 4HN9A 5ABEA 4GKJT 4L9IA 4LFCT 1WLXA 5TAOA 3RI5A 3AVSA 2ZMAA 3PURA 4CN6A 4CXXA 4YTPA 5JDLA 2X0YA 3TLWA 3ZMTB 2V7JA 3AEBA 3IF8B 3QNUA 3CPZA 4ZI3C 3CIRA 5AQJB 1N36T 5FXZA 5FL0A 4O4IE 4KX6A 3F2EA 3ANWB 3AB3B 4X65T 1HFAA 2X66A 3KV4A 1L0VA 2JJ9A 2CM0A 3NRXA 1HCIA 3RIFA 3O9XA 2CXFA 3PUQA 4GIWA 5AQUB 2CE7A 1YXRA 3UULA 4F6RC 3KINB 1XZYA 2W4XA 3O1JA 2OA5A 2GK9A 4IDZA 3BQIA 5HEGA 1KF6A 4PJNA 2VASA 4CXYA 1ZKEA 1X9BA 2KINB 2AXDS 3RIUA 1J1JA 4QH4A 4TNVA 3HKEE 3LBXB 2VB6A 3M3ZB 3QUJA 4UF0B 4FJOA 3CQXC 4IDOA 3UU3A 2H3RA 2XASB 4ADZA 4LF9T 3N9NA 3ZLIA 2IC6A 3S4UA 5J1GA 2EHOD 4HFCA 3UUNA 2W0GA 1W0AA 3EDVA 4PJJA 5HYAA 4U74A 4NXMT 1G73A 2LOSA 4JV5T 2BKPA 1HS7A 1NEKA 2EHOB 5HXSA 2J1DG 3D0TA 1W0BA 1YW0A 2WWUA 2V5CA 4KHZF 2DCFA 1JNRA 3P4SA 4KP3C 5HAXA 5CB4E 4F8HA 1IBMT 4COFA 3HKDE 2Q9QD 2HN1A 2AE9A 4MHCA 4KUMB 2H89A 5JREA 1FIOA 1WYBA 2ACXA 4DV5T 3FBLA 4LF8T 2ES0A 4IE4A 5L47A 2YU1A 2E5LT 1OEDC 3G06A 3WAJA 4IL9A 2DWGA 3NZPA 1UX5A 2F4VT 4EGWA 2BS4A 5KDMC 4ZS2A 3I0QA 2BS3A 1UCUA 3KBTA 4ZS3A 3UFGA 3ZT7A 1UUSA 2WSSV 4IDNA 3AE9A 4OHFA 4EB6E 2DHRA 2W00A 2J47A 1IBLT 2E9XD 3AA0B 2Z6EA 1T7SA 1VRBA 3CQCB 1G8XA 2LOPA 2XAHB 3LK2B 4IE7A 3QK6A 4O2BE 2MBGA 2V7MA 3I0OA 4K0UA 4BAYB 5L3GB 1UURA 2XQYA 3RYIE 3E22E 4X20E 4B6XA 5DABA 3N2GE 2DL1A 2YKSA 4ILBA 4UVAB 5LB7B 4DR7T 3RYFE 2NW8A 4QXBB 3PU3A 2ODUA 5AQRB 5FXWA 4HKAA 5AQKB 3R6NA 3NRYA 3FHNA 1YQ4A 5LHHB 2VKHA 3OTOT 2A3DA 3ZYKA 5HXRA 2FJAA 4JI8T 5BMVE 1XNRT 5EZYE 4HFBA 3FXDB 5JR9B 4AQFA 2LKGA 5FVLA 3VR9A 3ZC0A 2E8IA 4DR3T 2JQHA 4LF5T 4PNIA 4PJLA 2VQFT 1CHUA 4AIUA 5LJMA 2YEVC 2ZLYA 2V1DB 2XSAA 4IE0A 4ILUA 1YKHB 3W15B 1EZ3A 2W62A 3RRWA 1LVKA 4YHHT 3PTRB 3PUWF 2J4GA 3ESLA 4X5TA 4LFAT 4UXNB 1XMQT 2X0HA 5FXVA 4AXPA 3C4ZA 3VR8A 3IBPA 2LSKA 5C8YE 1IZNB 1XMOT 4WNKA 4LFBT 3P8CD 2JQKA 3B5MA 3ZT5A 4U7IA 2LHNA 2VWAA 5AQLB 5LOVE 4PK6A 2LT3A 5AQGB 2BBJA 3KBUA 2VVSA 3EHZA 5FY7A 3RKOA 3VRBA 3UUXB 2XQAA 1UK5A 4KMCA 5HWXA 2JQ9A 2MYSA 3KV6A 1HNZT 1ZP0A 1OEDA 3AEAA 4AKHA 2LRLA 4UF0A 4QH5A 1HF8A 3AAEB 4AISA 3L39A 2LEHA 2WCAA 1GQEA 4H9PC 3AE3A 3OYXA 5H6RB 5LHIB 4Z91A 5H6QB 1U5PA 3UUMA 2P9BA 4DR5T 4ERRA 2UUBT 3LSVA 4C90A 4YHJA 2NW9A 3SFDA 4JI2T 3HKBE 3PUXF 4H9QC 4X62T 3WI3A 2VVNA 1D1AA 3AA6B 3RH3A 2LKHA 4ZHQE 1D1CA 5LG4A 3A7MA 4DV4T 2CLYC 5E0OA 1ZV4X 3AVRA 2UXDT 1S94A 1ZOYA 4J2CA 5IUXA 3ZMVB 1M62A 2KWIB 1N33T 4BJMA 2D9DA 2X9HA 4GK5E 1WR6A 2WWVA 2I59A 2M6BA 1YD8G 2ZM8A 3AEGA 5F8PA 3IEEA 3PE0A 3ZSSA 2BG9B 3K3OA 5LMNT 4E7SA 2V7IA 5AQPB 4EZ4A 2UUCT 4AKIA 3CVRA 4UV9B 2B1EA 4TUYE 1MMGA 2XY8B 4ISSA 3ONJA 2XM1A 4FI5A 4MLKA 4U2ZA 1XDPA 1I94T 1Y64B 4OYJA 5HXCA 1HG2A 3ZSTA 3MA9A 2XQ3A 4PW8A 4H9SE 4H9NC 4YJ3E 5JDGA 2W63A 2Q9QB 3AE8A 3I9WA 4JBWF 1SUMB 2VURA 3JC6C 1XNQT 3L8RA 3BQKA 3AE7A 4NUUA 1IJ6A 3J9X1 1BR0A 3GN5B 4JI4T 4EYUA 2KXPB 3P7IA 4NPPA 1FMWA 3UT5E 3J7Yq 3JAFA 2YDQA 5FY1A 2V8SV 3NBXX 4YSXA 3AXJA 3ZMSB 2CMRA 3KVBA 4DR4T 3UUBA 2LM2A 5HEUA 3AECA 3ZMZB 2V5DA 4MALA 4IE5A 2V6XA 4I4TE 3O1IA 4ISTA 4HFIA 5AQIB 4AKLA 2RP4A 2CXDA 2IHR1 1BR1A 4Z8XA 2JRKA 4U31A
chains in the Genus database with same CATH topology
3MJXA 1MIVA 4PFOA 4PFPA 2PG8A 3Q2MA 4CQIA 2L8KA 5EK3A 4BJNA 2EHOA 4GK0E 3T8OA 3C4XA 5JR9A 2KMFA 2X9WA 2QGSA 2LHRA 2CWOA 3K8PC 2KZ7B 4CI3B 3MXZA 3RRCA 5IYZE 4MBQA 4GOUA 4G63A 4DBRA 2X67A 4ZI7E 2X9YA 3CQGB 5LGTB 3KV9A 3DJBA 2YK0A 5EK4A 1CUNA 4DNDA 2A2FX 3K3NA 2W61A 3OKQA 4CXWA 3VU7H 5JRCA 3N9OA 1D1BA 4HEAA 3Q5WA 4ZI2C 2ZM0A 3C4WA 1OXZA 5FNVE 2YU2A 3ZYMA 2M67A 4PK4A 3N2KE 4M1PA 4QXHB 2DLRA 2N2NA 2X9XA 2LSIA 1Z0PA 3C51A 2XAFB 3N2OA 4ASKA 1T98A 5LXTE 3U78A 4O2AE 1ZEEA 3CX7B 3CWZB 2XAQB 2C5KT 1B7TA 3HI2A 2PFVA 4O4HE 1S35A 2LM9A 2WBLA 1BR4A 2NOXA 2V7LA 3ZEFB 4H63V 5J2TE 3N9MA 5LBMA 1X79A 2CA5A 5L3BB 3PUGA 4WW0A 4XZCA 2D2SA 5HWYA 3ZPOA 3QC9A 4YJ2E 2K9AA 4UVBB 2KWHA 2JMKA 2PJQA 3NZQA 3PUSA 4PK5A 5LYJE 2HPLA 4I43B 3ZCJA 2E9XB 3BK9A 4X1KE 3ZYLA 3IHRA 5DQWA 2XUEA 1ZHCA 5HXHA 5FY0A 2JQQA 2ODVA 3ZC1A 2X0LB 4QXCB 3PUAA 4ZOLE 4P09A 3GN5A 3WAKA 1D0ZA 3FBZA 3F31A 3FXEB 4EAHA 2QA7A 2C5IT 3CKDA 5LBQB 4DMVA 4GYRA 4JEHB 5HXEA 2C0SA 3ZCIA 3GA8A 1NAFA 4HTEA 4A56A 1BR2A 3PDYA 2IW5B 1H7CA 3PU8A 4GYSA 4AQGA 2D5UA 4UELA 4KBMB 5IHYA 2XTLA 4UEMA 1U4QA 2NTXA 3EVYA 5LP6E 4EYYR 4QHOA 2Y6XA 3SS1A 1LKXA 3I9YA 4I50E 5M4YA 3ETVA 5L2LA 2IC9A 3RC8A 2MOZA 4DBQA 3LG7A 3UFEA 1YKEB 5JQGE 4YFSA 2CCQA 4OFZA 3I1AA 4EZHA 4TX5A 3L09A 4EIWA 3RYHE 2A72A 3JC6D 4I55E 2H7VC 3H3AA 3RX6A 4P0AA 4O4LE 4OK0A 5JRCB 4H9OC 1D0XA 3E08A 5L3EB 5GONE 3N9LA 3TKLB 3V5UA 5LCYA 5JDQA 1MMAA 2Q9QA 2X51A 2CLYB 2BDEA 3K3QC 3SWHA 3KV5A 4MFRA 3KFWX 2D0UA 1SHZC 2PBIA 1UX4A 2NW7A 5FMNA 1IJ5A 3F57A 2X68A 1AJ3A 3ONXA 3KVAA 3HL6A 3MK7C 2Y48B 4TV9E 5DQVA 5LJNA 4H63H 2HPJA 3M65A 4CZZB 3Q9DA 2E9XA 2NWBA 3EUHA 3UTKA 5J2UE 3V5SA 2DI4A 3MACA 3OJAA 4QX8B 2ZM2A 2V26A 3RPUA 1KK7A 3FB2A 2YINA 5KMGP 1D0YA 3CMLA 3HA4A 4O4JE 4L5GA 4JEUB 2LSJA 4U72A 4L0RA 3ETUA 2WMOA 4TV8E 2KNDA 1NWMX 4H9RC 2RA1A 3N9PA 2CWYA 2JMHA 3KDSE 3N5LA 4JUYA 2G0UA 2WMNA 4DMWA 3GWHA 3ANWA 2D0TA 4UIGA 4IIJE 3N9QA 2K48A 1FEWA 5JDMA 4HE8A 3LJCA 2JPFA 2NP9A 2L9QA 3SRZA 1E1HB 2KLQA 4EOZB 5ADXL 2C5JA 4TN7B 2HH7A 3HKCE 4IGUA 3U3IA 4CI1B 5L3FB 3C50A 5FXXA 3ZMUB 1LRZA 2EHOC 4G2AA 2LSYA 2BVLA 3CX6B 4TZ4C 1HG5A 5CA1E 4V1Av 5F3JA 4DO0A 1MNDA 4E7ZA 1IAPA 5JH7E 2LSGA 3VHLA 5LNKA 4NUVA 4YLHA 4ZI3D 3ZJ2A 3B57A 5L3DB 2VKJA 4WBNE 3BQLA 5LHGB 3LK3B 4XAXB 4ZI2D 3C98B 1HTJF 5CA0E 5JDNA 1MNEA 3MKDA 4AQFC 3RC3A 2SPCA 3E0ZA 4QWNB 1MMDA 4IHJE 4ANJA 4WBOA 3LBXA 3OYZA 1WRDA 2VKOA 3LFMA 5JVDE 4DVDA 5L3CB 3VKGA 2VL8A 2LE8A 2V7KA 3CX8B 2K24A 3VKHA 1FMVA 5JR9C 1MMNA 1QSDA 4PJMA 2E9XC 5KX5E 3C64A 3Q5XA 5JDFA 1OWAA 4QX7B 3H37A 5FYMA 2WAUA 2DWKA 4N78D 4IE6A 4C91A 4X1IE 3DP7A 3ZJ1A 5LGUB 3RYCE 4JLEA 4AKGA 3LK42 1SA0E 3AA1B 4CI2B 3MZKB 3AAIA 3O1HA 2CEAA 3GMIA 3HR0A 4O8SA 1US7B 5DJQC 2Q9QC 3EDUA 2N9DA 2MTQA 2WM9A 3R84B 2L3LA 2Y8DA 4QKNA 3L3PA 3O4XE 1MIYA 5FP3A 3SOLA 3AAAB 3B13A 3ZN1B 4EXTA 2KT9A 4UV8B 1QUUA 4PAGA 2VK9A 2BVMA 2VKDA 4HGAA 5ETWA 1O3XA 3AA7B 4P0BA 2LJLA 2N1GA 2XAGB 4HFVA 1LVFA 1V9DA 1KNZA 5JDHA 1HX8A 3OBVE 2XAJB 2UXNB 4AI6A 5EK2A 5A1LA 3A5XA 2BZBA 5AFUL 4BA9A 4X1YE 2H7OA 1WYCA 5LGNB 2NTYA 2K5BB 3ZN0B 4AKRB 2UXXB 2XHEB 4UVCB 2DNXA 4OYKA 2IAKA 2CXLA 1MIWA 1VOMA 3DTOA 4HN9A 4L9IA 1WLXA 5TAOA 3AVSA 2ZMAA 3PURA 5JDLA 4CXXA 3ZMTB 2V7JA 3IF8B 3CPZA 4ZI3C 5FXZA 4O4IE 3F2EA 3ANWB 3AB3B 1HFAA 2X66A 3KV4A 2JJ9A 2CM0A 3NRXA 1HCIA 3O9XA 2CXFA 3PUQA 4GIWA 2CE7A 3UULA 4F6RC 3KINB 3O1JA 2OA5A 2GK9A 4IDZA 3BQIA 4CXYA 4PJNA 2VASA 1ZKEA 2KINB 3HKEE 3LBXB 2VB6A 3QUJA 4ADZA 4UF0B 4FJOA 3CQXC 2H3RA 2XASB 3N9NA 3ZLIA 2IC6A 3S4UA 5J1GA 2EHOD 3UUNA 2W0GA 3EDVA 5HYAA 4PJJA 4U74A 1G73A 2LOSA 1HS7A 2EHOB 5HXSA 2J1DG 3D0TA 1YW0A 2WWUA 2DCFA 4KP3C 5CB4E 5HAXA 3HKDE 2Q9QD 4MHCA 4KUMB 5JREA 1FIOA 1WYBA 2ACXA 3FBLA 2ES0A 4IE4A 2YU1A 3WAJA 2DWGA 3NZPA 1UX5A 5KDMC 4ZS2A 3I0QA 4ZS3A 1UCUA 3KBTA 2WSSV 4OHFA 4EB6E 2DHRA 2W00A 3AA0B 2E9XD 2Z6EA 3CQCB 1VRBA 2MBGA 1G8XA 2LOPA 2XAHB 3LK2B 4IE7A 3QK6A 4O2BE 4BAYB 2V7MA 3I0OA 4K0UA 5L3GB 1BR0A 2XQYA 3RYIE 3E22E 4X20E 4B6XA 5DABA 3N2GE 4UVAB 3RYFE 2NW8A 4QXBB 3PU3A 2ODUA 5FXWA 3R6NA 4HKAA 4E7SA 3NRYA 3FHNA 5LHHB 2VKHA 2A3DA 3ZYKA 5HXRA 5BMVE 5EZYE 3FXDB 5JR9B 4AQFA 3ZC0A 2E8IA 4PNIA 4PJLA 5LJMA 2YEVC 2ZLYA 2V1DB 4IE0A 3W15B 4ILUA 1YKHB 1EZ3A 2W62A 3RRWA 1LVKA 3PTRB 3ESLA 4UXNB 5FXVA 4AXPA 3C4ZA 3IBPA 2LSKA 5C8YE 1IZNB 4WNKA 3P8CD 2LHNA 2VWAA 5LOVE 4PK6A 2LT3A 3KBUA 5FY7A 3RKOA 3UUXB 4KMCA 5HWXA 3KV6A 2MYSA 4AKHA 4UF0A 1HF8A 3AAEB 2LEHA 4H9PC 5LHIB 3OYXA 5H6RB 5H6QB 1U5PA 3UUMA 2P9BA 4ERRA 4C90A 4YHJA 2NW9A 3HKBE 4H9QC 3WI3A 3RH3A 1D1AA 3AA6B 5LG4A 4ZHQE 1D1CA 2CLYC 5E0OA 1ZV4X 3AVRA 1S94A 4J2CA 3ZMVB 2KWIB 4BJMA 2X9HA 4GK5E 1WR6A 2I59A 5F8PA 1YD8G 2ZM8A 4XBFB 3IEEA 3PE0A 3K3OA 2V7IA 4EZ4A 4AKIA 3CVRA 4UV9B 2B1EA 4TUYE 1MMGA 4ISSA 4FI5A 4MLKA 1Y64B 4OYJA 5HXCA 1HG2A 3MA9A 4PW8A 4H9SE 4H9NC 4YJ3E 5JDGA 2W63A 2Q9QB 3I9WA 3JC6C 3BQKA 4NUUA 1IJ6A 3J9X1 3GN5B 4EYUA 2KXPB 3P7IA 1FMWA 3UT5E 3J7Yq 5FY1A 3NBXX 3ZMSB 2CMRA 3KVBA 3ZMZB 4MALA 4IE5A 4I4TE 3O1IA 4ISTA 4AKLA 2RP4A 2CXDA 5LA6E 1BR1A 2JRKA 4Z8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OKQ A;  3ONX A; 
#chains in the Genus database with same CATH topology
 2UUA T;  3MJX A;  1MIV A;  4PFO A;  3JCF A;  4PFP A;  3RQW A;  5J0Z A;  2OV9 A;  1N32 T;  2PG8 A;  4Q25 A;  2ZM6 T;  3Q2M A;  4CQI A;  4XBF B;  2L8K A;  5HEH A;  5AQH B;  2UXB T;  2HHH T;  5EK3 A;  3P4Q A;  4BJN A;  2EHO A;  4GK0 E;  3T8O A;  3EAB A;  2XQ9 A;  5ABG A;  5JTG A;  3C4X A;  5JR9 A;  2KMF A;  2X9W A;  2QGS A;  2LHR A;  2CWO A;  3K8P C;  2W67 A;  1I6Z A;  2KZ7 B;  4CI3 B;  3MXZ A;  2IIU A;  3IA3 A;  5IYZ E;  3RRC A;  4MBQ A;  5ABF A;  4GOU A;  4G63 A;  4HFE A;  2J62 A;  3RGL A;  4DBR A;  2X67 A;  4YXD A;  4ZI7 E;  2X9Y A;  2UU9 T;  3CK6 A;  3CQG B;  5LGT B;  3KV9 A;  3DJB A;  2YK0 A;  5EK4 A;  1CUN A;  4DND A;  2A2F X;  3K3N A;  2W61 A;  3OKQ A;  4CXW A;  4ILC A;  3VU7 H;  4TWF A;  5CJ5 A;  5JRC A;  3N9O A;  1D1B A;  4JI3 T;  2FJD A;  3AEE A;  3Q5W A;  4HEA A;  4ILA A;  4ZI2 C;  2ZM0 A;  3C4W A;  1OXZ A;  5FNV E;  2YU2 A;  3ZYM A;  3P50 A;  4DUZ T;  2XQ6 A;  3AE6 A;  5ABH A;  2M67 A;  2FUP A;  4PK4 A;  2XZE A;  3FZF B;  3N2K E;  4U7Y A;  3UU6 A;  4M1P A;  2I0M A;  3RF1 A;  4QXH B;  1IBK T;  2DLR A;  1VCT A;  2N2N A;  2WB5 A;  4DV0 T;  4TWH A;  4OX9 T;  2I6H A;  2LSI A;  1Z0P A;  2X9X A;  3C51 A;  4ZZB A;  2XAF B;  3JAD A;  3N2O A;  4ASK A;  1T98 A;  3AE2 A;  5AQO B;  2M6I A;  5C3J A;  3TLT A;  3ABV A;  4WZX A;  5LXT E;  1YQ3 A;  4B3M T;  4QH1 A;  3U78 A;  4O2A E;  1ZEE A;  2BG9 E;  3CX7 B;  3CWZ B;  3UU4 A;  2XAQ B;  2C5K T;  1B7T A;  2VQE T;  3HI2 A;  2PFV A;  4O4H E;  4KHP T;  1S35 A;  2LM9 A;  3AE1 A;  5AQS B;  2WBL A;  1BR4 A;  2NOX A;  2V7L A;  2WQY A;  4H63 V;  3ZEF B;  5J2T E;  3N9M A;  5LBM A;  1X79 A;  2CA5 A;  3TLV A;  5C2T A;  3NKZ A;  5L3B B;  2MPK A;  2K3W A;  3EI0 A;  3FZH B;  3PUG A;  4WW0 A;  4XZC A;  5HCM A;  3QOF A;  2D2S A;  5HWY A;  5HXE A;  2B76 A;  3RIU C;  3ZPO A;  3QC9 A;  4EV6 A;  4YJ2 E;  1T72 A;  2K9A A;  4UVB B;  2KWH A;  3RC8 A;  5JQG E;  2JMK A;  2PJQ A;  3NZQ A;  3ZT6 A;  3PUS A;  4PK5 A;  3QB5 A;  5LYJ E;  1Y01 A;  5HEO A;  2XQ7 A;  2HPL A;  4I43 B;  2XJ7 A;  2E9X B;  2YDS A;  3BK9 A;  4X1K E;  5LA6 E;  3ZCJ A;  3ZYL A;  3IHR A;  4YY3 T;  5DQW A;  2XUE A;  1ZHC A;  5HXH A;  5FY0 A;  2JQQ A;  2ODV A;  5L4H A;  3UU5 A;  3ZC1 A;  2X0L B;  4QXC B;  4A5X A;  4DID B;  3PUA A;  4ZOL E;  4P09 A;  3GN5 A;  3WAK A;  1D0Z A;  4U3C A;  4EEB A;  4UR9 A;  3FBZ A;  2CBI A;  3F31 A;  3FZK B;  3FXE B;  4X64 T;  4EAH A;  2QA7 A;  2C5I T;  1XDO A;  3AXJ B;  3CKD A;  4GYR A;  4Z90 A;  2RPA A;  5LBQ B;  2V6Y A;  1VCS A;  2C0S A;  4JEH B;  4DMV A;  3ZCI A;  3GA8 A;  1XWM A;  2CBJ A;  1NAF A;  4HTE A;  4JYA T;  4A56 A;  1BR2 A;  3PDY A;  5FVK A;  5ABF B;  2IW5 B;  1H7C A;  3SFE A;  1T8B A;  5LMU T;  3PU8 A;  4GYS A;  4AQG A;  1OED B;  2D5U A;  2WP9 A;  4HWC A;  4UEL A;  4KBM B;  3UQ4 A;  5IHY A;  2XTL A;  4UEM A;  1U4Q A;  2UXC T;  1DU2 A;  2NTX A;  3EVY A;  1E7P A;  5AQV B;  4EYY R;  5LP6 E;  4QHO A;  2Y6X A;  1KEY A;  1KNP A;  5CFB A;  3SS1 A;  1LKX A;  2LLY A;  4DV2 T;  3I9Y A;  2WU2 A;  2FJB A;  3Q5E A;  4YT0 A;  1J5W A;  4I50 E;  4ZZC A;  3PUY F;  3ETV A;  5M4Y A;  3AE5 A;  2IC9 A;  2XSB A;  2MOZ A;  2E5V A;  3EAM A;  4DBQ A;  5L2L A;  3LG7 A;  2HN2 A;  3UQ7 A;  1KNR A;  2WZI A;  1YKE B;  3UFE A;  4HWF A;  2OLT A;  2CHN A;  2WU5 A;  1W09 A;  2CCQ A;  2XQ4 A;  3I1A A;  4OFZ A;  4TX5 A;  3L09 A;  4EED A;  4EZH A;  2E2A A;  4EIW A;  2ACZ A;  3RKG A;  3RYH E;  4DR2 T;  2A72 A;  3JC6 D;  2CRB A;  2H7V C;  3H3A A;  4I55 E;  3ZKR A;  2WS3 A;  3RX6 A;  4P0A A;  4A98 A;  4O4L E;  4OK0 A;  5HCJ A;  2BKO A;  4DR6 T;  5JRC B;  4H9O C;  1D0X A;  4JI5 T;  3FZM B;  3E08 A;  1R8I A;  5L3E B;  5GON E;  3N9L A;  3TKL B;  3V5U A;  5LCY A;  5JDQ A;  3UU8 A;  1MMA A;  3VRA A;  4LMJ A;  2Q9Q A;  2X51 A;  2CLY B;  2BDE A;  2XQ5 A;  3K3Q C;  2R6G F;  3SWH A;  3KV5 A;  2YOE A;  3RIA A;  4DV7 T;  4MFR A;  3KFW X;  2D0U A;  1SHZ C;  2PBI A;  1UX4 A;  2NW7 A;  5FMN A;  1IJ5 A;  4TNW A;  3F57 A;  2X68 A;  3QB5 K;  4DUY T;  4B3S T;  5AQQ B;  1AJ3 A;  3ONX A;  4B3T T;  3KVA A;  3TLS A;  3PUV F;  3HL6 A;  3AE4 A;  3MK7 C;  2Y48 B;  4TV9 E;  5DQV A;  2JIW A;  4H63 H;  5LJN A;  2HPJ A;  3M65 A;  4CZZ B;  5AQM B;  3Q9D A;  4U2Y A;  2E9X A;  1JNZ A;  2NWB A;  3EUH A;  4YSZ A;  3RHW A;  3UTK A;  5J2U E;  3V5S A;  2DI4 A;  3MAC A;  3OJA A;  4QX8 B;  2ZM2 A;  2V26 A;  1HR0 T;  3RPU A;  3T1H T;  1KK7 A;  3FB2 A;  2YIN A;  5KMG P;  1D0Y A;  2YN6 A;  3CML A;  4IDP A;  3HA4 A;  4O4J E;  2CHO A;  2CPT A;  4L5G A;  4JEU B;  2LSJ A;  4U72 A;  4L0R A;  2BBH A;  4IRE A;  2IUB A;  3ETU A;  4YTM A;  2WMO A;  5HEJ A;  1M7K A;  4TV8 E;  2KND A;  1NWM X;  1OED E;  4H9R C;  2RA1 A;  3N9P A;  2CWY A;  2JMH A;  3KDS E;  3N5L A;  4JUY A;  2G0U A;  2WMN A;  4NIQ A;  4DMW A;  3GWH A;  3ANW A;  3K1S A;  3LDQ B;  2MAW A;  2D0T A;  3PJA J;  4UIG A;  4IIJ E;  4JI7 T;  3N9Q A;  4A97 A;  2K48 A;  2YDR A;  3OPC A;  2WDR A;  4DV1 T;  1FEW A;  5JDM A;  4HE8 A;  3LJC A;  2WZH A;  4HFD A;  2NR4 A;  2JPF A;  2NP9 A;  5IWA T;  1HNW T;  3AEF A;  2L9Q A;  3SRZ A;  1E1H B;  2KLQ A;  4EOZ B;  4HWD A;  4WYV A;  3X1D A;  2C5J A;  4HWH A;  2HH7 A;  3HKC E;  4TN7 B;  4IGU A;  5ADX L;  1J5E T;  1WFD A;  4KI0 F;  3U3I A;  4CI1 B;  5L3F B;  3C50 A;  5FXX A;  4DR1 T;  2FBW A;  1HX1 B;  3ZMU B;  4ZEY A;  1LRZ A;  2EHO C;  4G2A A;  2LSY A;  4B3R T;  2BVL A;  3CX6 B;  4TZ4 C;  1HG5 A;  5CA1 E;  4V1A v;  5F3J A;  3P4R A;  4LF4 T;  4DO0 A;  1MND A;  4E7Z A;  4YSY A;  5LG3 A;  1IAP A;  5JH7 E;  2LSG A;  1W9R A;  3VHL A;  5LNK A;  4NUV A;  4YLH A;  4ZI3 D;  5CGM A;  3ZJ2 A;  4LF7 T;  3ONL C;  4NXN T;  4K0K T;  3B57 A;  5L3D B;  2VKJ A;  4WBN E;  3BQL A;  5FL1 A;  5LHG B;  3LK3 B;  4IT4 A;  4XAX B;  4ZI2 D;  2IML A;  2VL0 A;  3C98 B;  1HTJ F;  5CA0 E;  5JDN A;  1MNE A;  5BR8 T;  3MKD A;  3H3M A;  4ZXL A;  4AQF C;  3RC3 A;  1HNX T;  2SPC A;  3E0Z A;  4QWN B;  5FKY A;  5L4E A;  2V6Y B;  2LRK A;  2FJE A;  4IDQ A;  1MMD A;  4IHJ E;  4ANJ A;  3OVU A;  4WBO A;  2W2U A;  1UGO A;  3AED A;  3LBX A;  3OYZ A;  4JI1 T;  1WRD A;  1QLB A;  2VKO A;  3LFM A;  5JVD E;  2BG9 C;  3P4W A;  4DVD A;  5L3C B;  4CN1 A;  2VL8 A;  2LE8 A;  2V7K A;  2PTF A;  3VKG A;  3TLU A;  3A8Y C;  3CX8 B;  2K24 A;  3VKH A;  1FMV A;  5JR9 C;  1MMN A;  1QSD A;  1Z8U A;  5AQT B;  3PUZ F;  4PJM A;  2E9X C;  5KX5 E;  3C64 A;  2H88 A;  3Q5X A;  5JDF A;  4I0U A;  1OWA A;  4QX7 B;  1WR0 A;  3H37 A;  5FYM A;  3RLF F;  2WAU A;  4YTN A;  2DWK A;  3NWI A;  4CN4 A;  4N78 D;  2QVA A;  4IE6 A;  3RQU A;  4C91 A;  3PJA A;  1KFY A;  3DP7 A;  4X1I E;  3ZJ1 A;  3RYC E;  4JLE A;  2XPK A;  5LGU B;  4AKG A;  3LK4 2;  3NVO A;  1SA0 E;  3AA1 B;  4CI2 B;  3MZK B;  3AAI A;  3O1H A;  4IL4 A;  2CEA A;  2IDO B;  3GMI A;  2XM2 A;  3HR0 A;  4O8S A;  1US7 B;  5DJQ C;  4GKK T;  1WCR A;  2Q9Q C;  3EDU A;  2N9D A;  2MTQ A;  2QRX A;  2WM9 A;  4LMK A;  3R84 B;  2L3L A;  2Y8D A;  2QYW A;  3L3P A;  4QKN A;  3O4X E;  5F5W A;  1MIY A;  4HFH A;  1N34 T;  1FJG T;  3T1Y T;  5FP3 A;  3SOL A;  3AAA B;  3B13 A;  3ZN1 B;  4X66 T;  2WDV A;  4EXT A;  5AQN B;  2KT9 A;  4U33 A;  1QUU A;  4UV8 B;  4DV3 T;  4DV6 T;  4LF6 T;  4PAG A;  2VK9 A;  2BVM A;  2VKD A;  4HGA A;  5ETW A;  4YFS A;  5AQF B;  2WY2 A;  3PV0 F;  4AQY T;  1O3X A;  2A9U A;  1NEN A;  3AA7 B;  3JAE A;  4HWI B;  4P0B A;  2LJL A;  4JI6 T;  2BS2 A;  2N1G A;  2XAG B;  4HFV A;  1LVF A;  1V9D A;  1KNZ A;  4TWD A;  5JDH A;  1HX8 A;  2WDQ A;  2XQ8 A;  3OBV E;  2XAJ B;  1SE7 A;  2UXN B;  4AI6 A;  3Q5D A;  5A1L A;  3A5X A;  3P4P A;  5EK2 A;  2BZB A;  4JI0 T;  5KXJ A;  4P1N A;  2KSR A;  5AFU L;  4BA9 A;  4X1Y E;  2H7O A;  1WYC A;  5LGN B;  2NTY A;  1E2A A;  2BKN A;  2K5B B;  2BG9 A;  4LML A;  3ZN0 B;  2UXX B;  2XHE B;  4AKR B;  4UVC B;  2W66 A;  2DNX A;  4OYK A;  2IAK A;  2CXL A;  1MIW A;  1VOM A;  3DTO A;  3FZL B;  4HN9 A;  5ABE A;  4GKJ T;  4L9I A;  4LFC T;  1WLX A;  5TAO A;  3RI5 A;  3AVS A;  2ZMA A;  3PUR A;  4CN6 A;  4CXX A;  4YTP A;  5JDL A;  2X0Y A;  3TLW A;  3ZMT B;  2V7J A;  3AEB A;  3IF8 B;  3QNU A;  3CPZ A;  4ZI3 C;  3CIR A;  5AQJ B;  1N36 T;  5FXZ A;  5FL0 A;  4O4I E;  4KX6 A;  3F2E A;  3ANW B;  3AB3 B;  4X65 T;  1HFA A;  2X66 A;  3KV4 A;  1L0V A;  2JJ9 A;  2CM0 A;  3NRX A;  1HCI A;  3RIF A;  3O9X A;  2CXF A;  3PUQ A;  4GIW A;  5AQU B;  2CE7 A;  1YXR A;  3UUL A;  4F6R C;  3KIN B;  1XZY A;  2W4X A;  3O1J A;  2OA5 A;  2GK9 A;  4IDZ A;  3BQI A;  5HEG A;  1KF6 A;  4PJN A;  2VAS A;  4CXY A;  1ZKE A;  1X9B A;  2KIN B;  2AXD S;  3RIU A;  1J1J A;  4QH4 A;  4TNV A;  3HKE E;  3LBX B;  2VB6 A;  3M3Z B;  3QUJ A;  4UF0 B;  4FJO A;  3CQX C;  4IDO A;  3UU3 A;  2H3R A;  2XAS B;  4ADZ A;  4LF9 T;  3N9N A;  3ZLI A;  2IC6 A;  3S4U A;  5J1G A;  2EHO D;  4HFC A;  3UUN A;  2W0G A;  1W0A A;  3EDV A;  4PJJ A;  5HYA A;  4U74 A;  4NXM T;  1G73 A;  2LOS A;  4JV5 T;  2BKP A;  1HS7 A;  1NEK A;  2EHO B;  5HXS A;  2J1D G;  3D0T A;  1W0B A;  1YW0 A;  2WWU A;  2V5C A;  4KHZ F;  2DCF A;  1JNR A;  3P4S A;  4KP3 C;  5HAX A;  5CB4 E;  4F8H A;  1IBM T;  4COF A;  3HKD E;  2Q9Q D;  2HN1 A;  2AE9 A;  4MHC A;  4KUM B;  2H89 A;  5JRE A;  1FIO A;  1WYB A;  2ACX A;  4DV5 T;  3FBL A;  4LF8 T;  2ES0 A;  4IE4 A;  5L47 A;  2YU1 A;  2E5L T;  1OED C;  3G06 A;  3WAJ A;  4IL9 A;  2DWG A;  3NZP A;  1UX5 A;  2F4V T;  4EGW A;  2BS4 A;  5KDM C;  4ZS2 A;  3I0Q A;  2BS3 A;  1UCU A;  3KBT A;  4ZS3 A;  3UFG A;  3ZT7 A;  1UUS A;  2WSS V;  4IDN A;  3AE9 A;  4OHF A;  4EB6 E;  2DHR A;  2W00 A;  2J47 A;  1IBL T;  2E9X D;  3AA0 B;  2Z6E A;  1T7S A;  1VRB A;  3CQC B;  1G8X A;  2LOP A;  2XAH B;  3LK2 B;  4IE7 A;  3QK6 A;  4O2B E;  2MBG A;  2V7M A;  3I0O A;  4K0U A;  4BAY B;  5L3G B;  1UUR A;  2XQY A;  3RYI E;  3E22 E;  4X20 E;  4B6X A;  5DAB A;  3N2G E;  2DL1 A;  2YKS A;  4ILB A;  4UVA B;  5LB7 B;  4DR7 T;  3RYF E;  2NW8 A;  4QXB B;  3PU3 A;  2ODU A;  5AQR B;  5FXW A;  4HKA A;  5AQK B;  3R6N A;  3NRY A;  3FHN A;  1YQ4 A;  5LHH B;  2VKH A;  3OTO T;  2A3D A;  3ZYK A;  5HXR A;  2FJA A;  4JI8 T;  5BMV E;  1XNR T;  5EZY E;  4HFB A;  3FXD B;  5JR9 B;  4AQF A;  2LKG A;  5FVL A;  3VR9 A;  3ZC0 A;  2E8I A;  4DR3 T;  2JQH A;  4LF5 T;  4PNI A;  4PJL A;  2VQF T;  1CHU A;  4AIU A;  5LJM A;  2YEV C;  2ZLY A;  2V1D B;  2XSA A;  4IE0 A;  4ILU A;  1YKH B;  3W15 B;  1EZ3 A;  2W62 A;  3RRW A;  1LVK A;  4YHH T;  3PTR B;  3PUW F;  2J4G A;  3ESL A;  4X5T A;  4LFA T;  4UXN B;  1XMQ T;  2X0H A;  5FXV A;  4AXP A;  3C4Z A;  3VR8 A;  3IBP A;  2LSK A;  5C8Y E;  1IZN B;  1XMO T;  4WNK A;  4LFB T;  3P8C D;  2JQK A;  3B5M A;  3ZT5 A;  4U7I A;  2LHN A;  2VWA A;  5AQL B;  5LOV E;  4PK6 A;  2LT3 A;  5AQG B;  2BBJ A;  3KBU A;  2VVS A;  3EHZ A;  5FY7 A;  3RKO A;  3VRB A;  3UUX B;  2XQA A;  1UK5 A;  4KMC A;  5HWX A;  2JQ9 A;  2MYS A;  3KV6 A;  1HNZ T;  1ZP0 A;  1OED A;  3AEA A;  4AKH A;  2LRL A;  4UF0 A;  4QH5 A;  1HF8 A;  3AAE B;  4AIS A;  3L39 A;  2LEH A;  2WCA A;  1GQE A;  4H9P C;  3AE3 A;  3OYX A;  5H6R B;  5LHI B;  4Z91 A;  5H6Q B;  1U5P A;  3UUM A;  2P9B A;  4DR5 T;  4ERR A;  2UUB T;  3LSV A;  4C90 A;  4YHJ A;  2NW9 A;  3SFD A;  4JI2 T;  3HKB E;  3PUX F;  4H9Q C;  4X62 T;  3WI3 A;  2VVN A;  1D1A A;  3AA6 B;  3RH3 A;  2LKH A;  4ZHQ E;  1D1C A;  5LG4 A;  3A7M A;  4DV4 T;  2CLY C;  5E0O A;  1ZV4 X;  3AVR A;  2UXD T;  1S94 A;  1ZOY A;  4J2C A;  5IUX A;  3ZMV B;  1M62 A;  2KWI B;  1N33 T;  4BJM A;  2D9D A;  2X9H A;  4GK5 E;  1WR6 A;  2WWV A;  2I59 A;  2M6B A;  1YD8 G;  2ZM8 A;  3AEG A;  5F8P A;  3IEE A;  3PE0 A;  3ZSS A;  2BG9 B;  3K3O A;  5LMN T;  4E7S A;  2V7I A;  5AQP B;  4EZ4 A;  2UUC T;  4AKI A;  3CVR A;  4UV9 B;  2B1E A;  4TUY E;  1MMG A;  2XY8 B;  4ISS A;  3ONJ A;  2XM1 A;  4FI5 A;  4MLK A;  4U2Z A;  1XDP A;  1I94 T;  1Y64 B;  4OYJ A;  5HXC A;  1HG2 A;  3ZST A;  3MA9 A;  2XQ3 A;  4PW8 A;  4H9S E;  4H9N C;  4YJ3 E;  5JDG A;  2W63 A;  2Q9Q B;  3AE8 A;  3I9W A;  4JBW F;  1SUM B;  2VUR A;  3JC6 C;  1XNQ T;  3L8R A;  3BQK A;  3AE7 A;  4NUU A;  1IJ6 A;  3J9X 1;  1BR0 A;  3GN5 B;  4JI4 T;  4EYU A;  2KXP B;  3P7I A;  4NPP A;  1FMW A;  3UT5 E;  3J7Y q;  3JAF A;  2YDQ A;  5FY1 A;  2V8S V;  3NBX X;  4YSX A;  3AXJ A;  3ZMS B;  2CMR A;  3KVB A;  4DR4 T;  3UUB A;  2LM2 A;  5HEU A;  3AEC A;  3ZMZ B;  2V5D A;  4MAL A;  4IE5 A;  2V6X A;  4I4T E;  3O1I A;  4IST A;  4HFI A;  5AQI B;  4AKL A;  2RP4 A;  2CXD A;  2IHR 1;  1BR1 A;  4Z8X A;  2JRK A;  4U31 A; 
#chains in the Genus database with same CATH homology
 3MJX A;  1MIV A;  4PFO A;  4PFP A;  2PG8 A;  3Q2M A;  4CQI A;  2L8K A;  5EK3 A;  4BJN A;  2EHO A;  4GK0 E;  3T8O A;  3C4X A;  5JR9 A;  2KMF A;  2X9W A;  2QGS A;  2LHR A;  2CWO A;  3K8P C;  2KZ7 B;  4CI3 B;  3MXZ A;  3RRC A;  5IYZ E;  4MBQ A;  4GOU A;  4G63 A;  4DBR A;  2X67 A;  4ZI7 E;  2X9Y A;  3CQG B;  5LGT B;  3KV9 A;  3DJB A;  2YK0 A;  5EK4 A;  1CUN A;  4DND A;  2A2F X;  3K3N A;  2W61 A;  3OKQ A;  4CXW A;  3VU7 H;  5JRC A;  3N9O A;  1D1B A;  4HEA A;  3Q5W A;  4ZI2 C;  2ZM0 A;  3C4W A;  1OXZ A;  5FNV E;  2YU2 A;  3ZYM A;  2M67 A;  4PK4 A;  3N2K E;  4M1P A;  4QXH B;  2DLR A;  2N2N A;  2X9X A;  2LSI A;  1Z0P A;  3C51 A;  2XAF B;  3N2O A;  4ASK A;  1T98 A;  5LXT E;  3U78 A;  4O2A E;  1ZEE A;  3CX7 B;  3CWZ B;  2XAQ B;  2C5K T;  1B7T A;  3HI2 A;  2PFV A;  4O4H E;  1S35 A;  2LM9 A;  2WBL A;  1BR4 A;  2NOX A;  2V7L A;  3ZEF B;  4H63 V;  5J2T E;  3N9M A;  5LBM A;  1X79 A;  2CA5 A;  5L3B B;  3PUG A;  4WW0 A;  4XZC A;  2D2S A;  5HWY A;  3ZPO A;  3QC9 A;  4YJ2 E;  2K9A A;  4UVB B;  2KWH A;  2JMK A;  2PJQ A;  3NZQ A;  3PUS A;  4PK5 A;  5LYJ E;  2HPL A;  4I43 B;  3ZCJ A;  2E9X B;  3BK9 A;  4X1K E;  3ZYL A;  3IHR A;  5DQW A;  2XUE A;  1ZHC A;  5HXH A;  5FY0 A;  2JQQ A;  2ODV A;  3ZC1 A;  2X0L B;  4QXC B;  3PUA A;  4ZOL E;  4P09 A;  3GN5 A;  3WAK A;  1D0Z A;  3FBZ A;  3F31 A;  3FXE B;  4EAH A;  2QA7 A;  2C5I T;  3CKD A;  5LBQ B;  4DMV A;  4GYR A;  4JEH B;  5HXE A;  2C0S A;  3ZCI A;  3GA8 A;  1NAF A;  4HTE A;  4A56 A;  1BR2 A;  3PDY A;  2IW5 B;  1H7C A;  3PU8 A;  4GYS A;  4AQG A;  2D5U A;  4UEL A;  4KBM B;  5IHY A;  2XTL A;  4UEM A;  1U4Q A;  2NTX A;  3EVY A;  5LP6 E;  4EYY R;  4QHO A;  2Y6X A;  3SS1 A;  1LKX A;  3I9Y A;  4I50 E;  5M4Y A;  3ETV A;  5L2L A;  2IC9 A;  3RC8 A;  2MOZ A;  4DBQ A;  3LG7 A;  3UFE A;  1YKE B;  5JQG E;  4YFS A;  2CCQ A;  4OFZ A;  3I1A A;  4EZH A;  4TX5 A;  3L09 A;  4EIW A;  3RYH E;  2A72 A;  3JC6 D;  4I55 E;  2H7V C;  3H3A A;  3RX6 A;  4P0A A;  4O4L E;  4OK0 A;  5JRC B;  4H9O C;  1D0X A;  3E08 A;  5L3E B;  5GON E;  3N9L A;  3TKL B;  3V5U A;  5LCY A;  5JDQ A;  1MMA A;  2Q9Q A;  2X51 A;  2CLY B;  2BDE A;  3K3Q C;  3SWH A;  3KV5 A;  4MFR A;  3KFW X;  2D0U A;  1SHZ C;  2PBI A;  1UX4 A;  2NW7 A;  5FMN A;  1IJ5 A;  3F57 A;  2X68 A;  1AJ3 A;  3ONX A;  3KVA A;  3HL6 A;  3MK7 C;  2Y48 B;  4TV9 E;  5DQV A;  5LJN A;  4H63 H;  2HPJ A;  3M65 A;  4CZZ B;  3Q9D A;  2E9X A;  2NWB A;  3EUH A;  3UTK A;  5J2U E;  3V5S A;  2DI4 A;  3MAC A;  3OJA A;  4QX8 B;  2ZM2 A;  2V26 A;  3RPU A;  1KK7 A;  3FB2 A;  2YIN A;  5KMG P;  1D0Y A;  3CML A;  3HA4 A;  4O4J E;  4L5G A;  4JEU B;  2LSJ A;  4U72 A;  4L0R A;  3ETU A;  2WMO A;  4TV8 E;  2KND A;  1NWM X;  4H9R C;  2RA1 A;  3N9P A;  2CWY A;  2JMH A;  3KDS E;  3N5L A;  4JUY A;  2G0U A;  2WMN A;  4DMW A;  3GWH A;  3ANW A;  2D0T A;  4UIG A;  4IIJ E;  3N9Q A;  2K48 A;  1FEW A;  5JDM A;  4HE8 A;  3LJC A;  2JPF A;  2NP9 A;  2L9Q A;  3SRZ A;  1E1H B;  2KLQ A;  4EOZ B;  5ADX L;  2C5J A;  4TN7 B;  2HH7 A;  3HKC E;  4IGU A;  3U3I A;  4CI1 B;  5L3F B;  3C50 A;  5FXX A;  3ZMU B;  1LRZ A;  2EHO C;  4G2A A;  2LSY A;  2BVL A;  3CX6 B;  4TZ4 C;  1HG5 A;  5CA1 E;  4V1A v;  5F3J A;  4DO0 A;  1MND A;  4E7Z A;  1IAP A;  5JH7 E;  2LSG A;  3VHL A;  5LNK A;  4NUV A;  4YLH A;  4ZI3 D;  3ZJ2 A;  3B57 A;  5L3D B;  2VKJ A;  4WBN E;  3BQL A;  5LHG B;  3LK3 B;  4XAX B;  4ZI2 D;  3C98 B;  1HTJ F;  5CA0 E;  5JDN A;  1MNE A;  3MKD A;  4AQF C;  3RC3 A;  2SPC A;  3E0Z A;  4QWN B;  1MMD A;  4IHJ E;  4ANJ A;  4WBO A;  3LBX A;  3OYZ A;  1WRD A;  2VKO A;  3LFM A;  5JVD E;  4DVD A;  5L3C B;  3VKG A;  2VL8 A;  2LE8 A;  2V7K A;  3CX8 B;  2K24 A;  3VKH A;  1FMV A;  5JR9 C;  1MMN A;  1QSD A;  4PJM A;  2E9X C;  5KX5 E;  3C64 A;  3Q5X A;  5JDF A;  1OWA A;  4QX7 B;  3H37 A;  5FYM A;  2WAU A;  2DWK A;  4N78 D;  4IE6 A;  4C91 A;  4X1I E;  3DP7 A;  3ZJ1 A;  5LGU B;  3RYC E;  4JLE A;  4AKG A;  3LK4 2;  1SA0 E;  3AA1 B;  4CI2 B;  3MZK B;  3AAI A;  3O1H A;  2CEA A;  3GMI A;  3HR0 A;  4O8S A;  1US7 B;  5DJQ C;  2Q9Q C;  3EDU A;  2N9D A;  2MTQ A;  2WM9 A;  3R84 B;  2L3L A;  2Y8D A;  4QKN A;  3L3P A;  3O4X E;  1MIY A;  5FP3 A;  3SOL A;  3AAA B;  3B13 A;  3ZN1 B;  4EXT A;  2KT9 A;  4UV8 B;  1QUU A;  4PAG A;  2VK9 A;  2BVM A;  2VKD A;  4HGA A;  5ETW A;  1O3X A;  3AA7 B;  4P0B A;  2LJL A;  2N1G A;  2XAG B;  4HFV A;  1LVF A;  1V9D A;  1KNZ A;  5JDH A;  1HX8 A;  3OBV E;  2XAJ B;  2UXN B;  4AI6 A;  5EK2 A;  5A1L A;  3A5X A;  2BZB A;  5AFU L;  4BA9 A;  4X1Y E;  2H7O A;  1WYC A;  5LGN B;  2NTY A;  2K5B B;  3ZN0 B;  4AKR B;  2UXX B;  2XHE B;  4UVC B;  2DNX A;  4OYK A;  2IAK A;  2CXL A;  1MIW A;  1VOM A;  3DTO A;  4HN9 A;  4L9I A;  1WLX A;  5TAO A;  3AVS A;  2ZMA A;  3PUR A;  5JDL A;  4CXX A;  3ZMT B;  2V7J A;  3IF8 B;  3CPZ A;  4ZI3 C;  5FXZ A;  4O4I E;  3F2E A;  3ANW B;  3AB3 B;  1HFA A;  2X66 A;  3KV4 A;  2JJ9 A;  2CM0 A;  3NRX A;  1HCI A;  3O9X A;  2CXF A;  3PUQ A;  4GIW A;  2CE7 A;  3UUL A;  4F6R C;  3KIN B;  3O1J A;  2OA5 A;  2GK9 A;  4IDZ A;  3BQI A;  4CXY A;  4PJN A;  2VAS A;  1ZKE A;  2KIN B;  3HKE E;  3LBX B;  2VB6 A;  3QUJ A;  4ADZ A;  4UF0 B;  4FJO A;  3CQX C;  2H3R A;  2XAS B;  3N9N A;  3ZLI A;  2IC6 A;  3S4U A;  5J1G A;  2EHO D;  3UUN A;  2W0G A;  3EDV A;  5HYA A;  4PJJ A;  4U74 A;  1G73 A;  2LOS A;  1HS7 A;  2EHO B;  5HXS A;  2J1D G;  3D0T A;  1YW0 A;  2WWU A;  2DCF A;  4KP3 C;  5CB4 E;  5HAX A;  3HKD E;  2Q9Q D;  4MHC A;  4KUM B;  5JRE A;  1FIO A;  1WYB A;  2ACX A;  3FBL A;  2ES0 A;  4IE4 A;  2YU1 A;  3WAJ A;  2DWG A;  3NZP A;  1UX5 A;  5KDM C;  4ZS2 A;  3I0Q A;  4ZS3 A;  1UCU A;  3KBT A;  2WSS V;  4OHF A;  4EB6 E;  2DHR A;  2W00 A;  3AA0 B;  2E9X D;  2Z6E A;  3CQC B;  1VRB A;  2MBG A;  1G8X A;  2LOP A;  2XAH B;  3LK2 B;  4IE7 A;  3QK6 A;  4O2B E;  4BAY B;  2V7M A;  3I0O A;  4K0U A;  5L3G B;  1BR0 A;  2XQY A;  3RYI E;  3E22 E;  4X20 E;  4B6X A;  5DAB A;  3N2G E;  4UVA B;  3RYF E;  2NW8 A;  4QXB B;  3PU3 A;  2ODU A;  5FXW A;  3R6N A;  4HKA A;  4E7S A;  3NRY A;  3FHN A;  5LHH B;  2VKH A;  2A3D A;  3ZYK A;  5HXR A;  5BMV E;  5EZY E;  3FXD B;  5JR9 B;  4AQF A;  3ZC0 A;  2E8I A;  4PNI A;  4PJL A;  5LJM A;  2YEV C;  2ZLY A;  2V1D B;  4IE0 A;  3W15 B;  4ILU A;  1YKH B;  1EZ3 A;  2W62 A;  3RRW A;  1LVK A;  3PTR B;  3ESL A;  4UXN B;  5FXV A;  4AXP A;  3C4Z A;  3IBP A;  2LSK A;  5C8Y E;  1IZN B;  4WNK A;  3P8C D;  2LHN A;  2VWA A;  5LOV E;  4PK6 A;  2LT3 A;  3KBU A;  5FY7 A;  3RKO A;  3UUX B;  4KMC A;  5HWX A;  3KV6 A;  2MYS A;  4AKH A;  4UF0 A;  1HF8 A;  3AAE B;  2LEH A;  4H9P C;  5LHI B;  3OYX A;  5H6R B;  5H6Q B;  1U5P A;  3UUM A;  2P9B A;  4ERR A;  4C90 A;  4YHJ A;  2NW9 A;  3HKB E;  4H9Q C;  3WI3 A;  3RH3 A;  1D1A A;  3AA6 B;  5LG4 A;  4ZHQ E;  1D1C A;  2CLY C;  5E0O A;  1ZV4 X;  3AVR A;  1S94 A;  4J2C A;  3ZMV B;  2KWI B;  4BJM A;  2X9H A;  4GK5 E;  1WR6 A;  2I59 A;  5F8P A;  1YD8 G;  2ZM8 A;  4XBF B;  3IEE A;  3PE0 A;  3K3O A;  2V7I A;  4EZ4 A;  4AKI A;  3CVR A;  4UV9 B;  2B1E A;  4TUY E;  1MMG A;  4ISS A;  4FI5 A;  4MLK A;  1Y64 B;  4OYJ A;  5HXC A;  1HG2 A;  3MA9 A;  4PW8 A;  4H9S E;  4H9N C;  4YJ3 E;  5JDG A;  2W63 A;  2Q9Q B;  3I9W A;  3JC6 C;  3BQK A;  4NUU A;  1IJ6 A;  3J9X 1;  3GN5 B;  4EYU A;  2KXP B;  3P7I A;  1FMW A;  3UT5 E;  3J7Y q;  5FY1 A;  3NBX X;  3ZMS B;  2CMR A;  3KVB A;  3ZMZ B;  4MAL A;  4IE5 A;  4I4T E;  3O1I A;  4IST A;  4AKL A;  2RP4 A;  2CXD A;  5LA6 E;  1BR1 A;  2JRK A;  4Z8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...