3OOCA

Crystal structure of the membrane fusion protein cusb from escherichia coli
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
297
structure length
297
Chain Sequence
TQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the membrane fusion protein CusB from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Cation efflux system protein cusB
total genus 40
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3oocA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3oocA03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3oocA01
4KN7C 2D5DA 5BN4A 5C0XH 5C0XG 1IW7C 3LNNA 4DNTB 2DNEA 2O5JC 1HPCA 1V43A 2A6ED 1O78A 1LACA 3A8JE 5A35A 2KCCA 3ND8A 3WDNA 3PUYA 3A7LA 1G291 1Q1EA 1GUTA 5BN5A 4GZYC 1LABA 2BA0A 4OO1G 3FPPA 2PPBC 3PUXA 3PUVA 3OW7A 2B8FA 2PCFB 3A7AB 4H13C 2E75C 5K36H 2D62A 1A6XA 1YNNC 1OXXK 4XTCS 3U9SA 1H9JA 1IYVA 3VR2A 4I7ZC 1OXVA 1OXUA 2Q8IB 3SDZA 4IFDG 1HTPA 1Y8OB 2NN6I 2JXMB 1B9MA 3PV0A 4G7ZC 1PMRA 2EJMA 3W3AA 3M85A 1E2ZA 2K33A 2JE6I 2IT1A 5JEAG 1K8MA 3T56B 4RCNA 1T5EA 2EJGC 4XIGS 2A6HC 4KHZA 1VCIA 3HGBA 4KMUC 1GUSA 1Q1BA 2AUKA 1FR3A 4H44C 5JEAH 3IKJA 1HCZA 3M4YA 3VA7A 1TKWB 1GUGA 1VF7A 1H9SA 2NN6G 3BG3A 3VR6A 2AWOA 1GJXA 4KI0A 3IFTA 1CI3M 3OOCA 3PUZA 1SMYC 3VR4A 1GHKA 1H9SB 2DNCA 3PUWA 1CFMA 1Q12A 3M7NA 4BA2I 4TKOB 3KLRA 4KKSA 1HQMC 4H0LC 1Y69U 3TZUA 2AUJD 3L7ZC 1GHJA 3T51B 1Z7TA 1K8OA 5KNBA 3BDOA 4JK1C 2A69D 1ZKOA 2A6EC 3A8IE 1Y8NB 3I72A 1DD2A 3H94A 1ONLA 2V4DA 1H9MA 1QJOA 2A68C 3QG1A 2L5TA 1TU2B 2KA7A 4BA1I 2YYZA 2ZT9C 3N6RA 2JEAI 1FYCA 1YNJC 4KKUA 5BN3A 2EJFC 3RLFA 1DCZA 4KN4C 1IYUA 1EWHA 4DK0A 1GUOA 1Z6HA 2PNRC 1H9KA 4DK1A 3QJYA 5K36G 2DN8A 4G7OC 1GUNA 4OO1H 2BA1A 2F1MA 3VR3A 1O7LA 4PV1C 3QIAA 3D31A 3MFYA 3I73A 2JEBI 4LJZC 2D2CC 3AB9A 1BDOA 5KNDA 4DNRB 3LWUA 3ND9A 4TQUS 3VR5A 5KNCA 2BE5D 3OPOA 2A68D 3D4RA 3DXJC 3FMCA 2K32A 3GD7A 1E2VA 4OGQC 1E2WA 4IFDH 1Q90A 2NN6H 3CRKC 2A6HD 4JBWA 1OXTA 1IW7D 2K7VA 2B8GA 2E76C 1ZYRC 1VDZA 2QF7A 3SE0A 1OXSC 3CRLC 1CTMA 1H9RA 2A69C 2CW0C 2O5IC 3T53B 1VF5C 2BE5C 2R6GA 4L8JA 3A8KE 3NE5B 2E74C 3EQLC 4G7HC 1I6VC 3I4LA 1B9NA 2LMCB 2EVBA 4IQZA 1Y8PB 3MXUA 2EDGA 1DXMA 4LK1C 1V8QA 4HR7B 3GQBA 3P20A 4KKTA 2BDOA
chains in the Genus database with same CATH superfamily
3GTMB 2B2WC 1NRKA 3N52A 2F0GA 4ZK9B 4R9WA 3HOYG 2EYPA 1FRQA 2FX3A 1O78A 3VNUA 3GDEA 3NEMA 4K2KA 5GQOA 3G4SA 2L12A 1CA6A 4DV3Q 4XLAA 2F4VQ 2K03A 3FVQA 2F0NA 3OW7A 1HNXL 4B3SL 4JV5L 2D74A 3L3OC 4BS9A 1KNAA 4DV4L 1KXLA 1SYFA 1A6XA 3A1PA 5ELDA 5JJZA 2XTIA 2G5DA 2I46A 4OIJA 4NDXA 4A3KB 2XRQD 3MHBA 3NXWA 5G3LD 1EFID 4XYQA 1ENAA 3QOJA 4HIOA 5E6TA 1V1PA 3K7AH 1G6PA 2YV5A 3KLSA 4LW1A 4KHPL 3ZBUA 2IX3A 3I4MB 1U4RA 2Z6KA 2OBRA 2Y0SG 4QJFA 4R4TA 4UPAA 1FR3A 4JCVE 5JEAH 3CQZH 1HA6A 3M4YA 1MD2D 2VS1A 2ZTCA 3S1NB 1LTBD 1JWUD 1B1ZA 1CKOA 2QA4B 1CI3M 2AMCB 5KW9A 5BR8Q 5TRDA 1K9MD 2B2UC 1PFBA 1U5KA 1I6HH 3I7FA 4C43A 5DAUA 1L0WA 2AUJD 1G51A 4XKVA 1XWEA 1ZYRD 1PH6A 3NBHA 1K8OA 3MHPA 1UD3A 1D8LA 2ZL6A 3JAML 4FN5A 3HOWH 1V5VA 4P2CB 4CHTB 3L9AX 1EU3A 1YI2A 3HOVG 4OX9L 3N6RA 1M1KC 3R6JA 3W5VA 1KDBA 1B70B 4XORA 1DCZA 1I4XA 2VNIA 2KUMA 5TR9A 3P27A 3A74A 4UDUC 4OPOA 4A3JH 1VQDA 3I4NH 1PH7A 3HFZB 2BA1A 4DAPA 1NB0A 5D14A 4CKBA 3HOVB 1Q8KA 3MFYA 1YIJA 2K5QA 1PJ5A 1W35A 2PO4A 1RTOA 3Q3AA 2N8NA 2SNMA 2XEXA 1COWA 2K5NA 2GVAA 2K7VA 2DCUA 3E5SA 1T6YA 2CW0C 1JORA 1WOOA 4PC6A 3CW2C 4DR1Q 2MNAA 1F9SA 2LMCB 4OXPA 4G7XA 2E8GA 4F7XA 3BZKA 4K8JA 4LK1C 4FXDA 2YWEA 4YY3L 1VMPA 3GVJA 4DR5L 2XGTA 3CC7B 3I55B 4QVAA 1CNFA 1U0LA 2KENA 2TSSA 1KC8C 3EN2A 5EGTA 2A6ED 4BBSG 2MP1A 1W6KA 1YHQA 3D6WA 3NSWA 1BUVT 1HNXQ 4JBJA 1LTGD 3VDYA 4TMVA 3HZXA 2C4TA 3GTKB 2CK3A 2J7KA 4KD3A 5EJWA 1SE2A 4X3SA 3SK6A 3PUVA 4OWTB 4IUNA 2C35B 2ZZEA 1X32A 3NK9A 4G7WA 4ABNA 1TVXA 1EFCA 1SROA 2GVBA 5GROA 3HOWB 5CYUA 3TBIB 4L6TB 2L15A 1CKMA 4HSVA 2VQFL 5FLMH 2VUMB 2JXMB 1B9MA 1KJZA 3W3AA 4QCLA 3C2QA 1VQ4B 5BSYA 1PTOB 4G5GA 5GADC 4A3IH 4HTHA 2WFWA 5C4XH 4B08A 3TEHB 1M1KD 4EVOA 1SE4A 5I9OA 4KMUC 1X54A 4CDEC 2JA7H 3GTLH 2PI2A 4R4QA 1SRUA 5DLQE 3VA7A 1QB5D 1OGJA 1VF7A 3OP1A 3W5UA 4LUVA 1WTQA 4PC2A 2HDMA 5C4HA 1HH2P 2EYHA 4DUYL 3HOXG 2ZTNA 1B23P 2CWPA 5JJLA 3ZYYX 1XNRL 1R5NA 2GN5A 1FNCA 3ZPNA 4M1KA 1OB2A 1VQ5A 4IFDJ 1O7IA 3GO5A 1T9HA 1D1NA 4JI5L 3VYTA 2Z1CA 4GN4B 1LT3D 1RCVD 2KA7A 4K5VA 2ZT9C 1YNJC 1QOHA 4XL9A 1HZBA 1SM4A 4DK0A 1PRTC 1H9KA 4DK1A 3J80E 4DA2A 4X65Q 3E1YE 4C3HG 2QGQA 2XWJB 3EIVA 4JI4Q 2C5CA 1YJNA 4FF1A 1H95A 1BKBA 4LJZC 4YWKA 2AHOA 2F0SA 3WYAA 1AMOA 1ENFA 5KNDA 5KNCA 2OK8A 2B3GA 2JA9A 4TQUS 3VR5A 3BS1A 1KLUD 3I3CA 1PZID 4XT3B 2F43A 5C4JH 3H3VI 1E63A 4ZKBB 2JA8G 3A0JA 3BVGA 4YWLA 1SDFA 3BCDA 4ROXA 1A62A 1RQRA 1OXSC 1RIPA 4P72A 1H9RA 4DU9A 2KVOA 3FKIB 5IYBH 1PHJA 1YVCA 2NUCA 1E62A 1UUPA 4LF5L 1ML0D 1KHIA 3MVVA 2R61A 2RHSB 2WPDA 5M5WH 1FNVA 4OELB 1K73D 1IJFA 2PW5A 2K14A 2UUAL 2B2VA 5COYA 2K50A 4YAFA 4X64L 3HAGA 3SJPA 5FL7A 4X3KA 3DHQA 5ELFA 1EIFA 3K5LA 3WNCA 3CMEA 4A3EB 2CCZA 1F60A 3FPUB 3BH4A 2JP1A 2PCFB 1VQ8B 2PLFA 4C3IH 2BDNA 4R8NA 1QVGA 2J7ZA 2K6AA 1OHHA 3KJOA 4B3MQ 3SGIA 4J8QA 2NN6I 2PZUA 4CJ0B 1STAA 1Y1WB 1EFUA 1JB7A 1YJ9A 1DGSA 2JE6I 1O7YA 4X3TA 3EA6A 1ET6A 1QVFB 4II3A 5IYBG 3GSIA 4XIGS 1MKHA 4DUYQ 3R3OA 1D7QA 1PFSA 4KD4A 4ZKCB 1HCZA 1SBBB 1E1OA 3VR6A 3GTKH 4HIZA 5C44H 3I90A 2PQEA 1NBWA 1MRZA 1E1QA 4P3IA 1JR0D 1J6QA 2ZZGA 1CKNA 1B3QA 1OTCA 3CCMA 3OFNA 2ZTGA 4TMTA 5H59A 2CW0D 4R4IA 3M7GA 4PC7A 1TWGB 1S3OA 4LFBQ 4RCYA 3CCSB 1B2RA 4WZLA 1DD2A 4EH1A 3AVWA 3RUZA 5TV2A 5LL6S 2J4XA 2MHVA 3JU4A 3A8KA 4UZEA 4BPRA 4FNFA 5EPKA 5BN3A 1OB0A 3V2TA 3GIRA 1EQTA 1EWHA 5I6YA 4BXXG 2NVXB 2YWGA 4G7OC 2V7TA 2OTJB 2KVMA 1N36Q 5LMUQ 2W6IA 4A3LH 1VQBA 4UAJA 4KY6A 3JAMc 3W1BA 4XD7A 2YU9B 4GKJQ 2ZXRA 3H15A 4LF8Q 4LNQA 5KSWB 2K32A 1E2VA 3AGPA 1TWCH 3K0XA 2N55A 1WCMG 5HGQA 4IZ8A 1EFWA 1I7PA 3CPWB 2JA6G 2A6HD 2L0CA 2KHJA 1VJSA 4DV0Q 5E1FA 1AEXA 1YIJB 1FJGQ 1NB9A 2KCTA 2DY7A 1EXMA 2RA4A 4L8JA 4HAEA 1JWSD 2WJVA 1R5OA 2IHFA 2IWHA 2X6GA 2DJGC 3GTJH 2WINB 3IFDA 3PCOB 3V76A 3DWAA 4JI2Q 3HOWG 1QZGA 2Z6BA 4EX5A 4KTAA 3HOYH 3SK8A 1IJEA 4AVZA 1IZ6A 1I6HB 4YCVA 3S14B 2GPJA 1DOKA 1TLLA 3TP5A 4II2A 1A3TA 3G71B 2Q8RE 4WFN3 4R8IA 4X64Q 3ULPA 4A93G 1PTOC 4IURA 3CCQA 5BN5A 4KV6A 1J8IA 3ISXA 1XPOA 2ZXIA 3WXMA 3MWYW 3HOUG 1KK0A 1DG1G 5J3BA 1KTVA 4IUQA 2XNAC 1X3QA 5FLMG 2E75C 3AVUA 1CHPD 2I5LX 3U2QA 4HCSA 3OMGA 4N8X1 1W34A 3PENA 1HTPA 1XMOQ 4OWWB 3A3GA 1WTXA 1PJ6A 2EYLA 4DR2L 5JVG3 2QEXB 4JOIC 4A3FB 2BM0A 1K8MA 4JI3Q 4RCNA 1XNQQ 4K1XA 4H9GA 1V1OA 2K5HA 1CQVA 1GUSA 1NUCA 4RWSC 4NP5A 3CP2A 3DUZA 4RLZA 3BG3A 1S4MA 2CHBD 2UUCQ 2EY1A 2UUBQ 2B63H 4G6IA 5I6WA 5IYWA 1KTKA 3S24A 3SKBA 3AVTA 1FNDA 1D1IA 4TN1A 2BH8A 3FDTA 2RVLA 4TKOB 1B4OA 3WNDA 3CAMA 5IGEA 1C0AA 4KK7A 3AVYA 4ACAA 1TWFB 4LBYA 2D0PA 4Z1MA 1CQXA 1HZCA 3Q6QA 4P1VA 1ELOA 1EQVA 4LBVA 2HCCA 1TU2B 2SDFA 3ZJYC 4BA1I 1DONA 3WNBA 2K5DA 3FPKA 2V7WA 5FO1A 2KHIA 3K80C 2Q6LA 3URYA 2VQEL 4UZFA 1HR0W 1ASYA 1V9PA 3TP7A 4X7EA 2F4VL 3GTOB 1JE4A 2DN8A 3RZDB 2E5LL 4PZ6A 4OO1H 4BY1B 2F0JA 3S1RH 1VLYA 4JI8Q 2HHHL 4U9UA 3QIAA 1PVOA 5IWAQ 2ZXHA 2R92B 1I94Q 3TDQA 1S0UA 3AB9A 4POFA 3HG9A 4DNRB 3OAAA 1HXYD 1PV4A 4WRDA 1XPUA 2EXZA 1QFJA 3QE2A 3C1EA 3A54A 3GV3A 5CV5A 1E2WA 4N9TA 2CRVA 3T13A 5IODA 1SNPA 2VJIA 2LFNA 3A8JA 4ZCIA 1VQEA 2VBVA 1EIGA 3NPPA 2RSOA 4H7BA 5JEAJ 5GAHC 3RZOH 2NVXH 4X07A 4IN3A 3BVZA 3MXNA 1JJGA 3NE5B 1GUWA 1O7ZA 1AP0A 5C5LA 2GJRA 1SJHD 4YEJA 1XTCD 3E9HA 4FDBA 2AQ1B 3CP0A 4X6AH 5GV8A 1WP6A 2GREA 3T1HQ 1EY4A 4LF5Q 2E2HH 1IYJB 1LV9A 4NW2A 3ERQA 3HRZC 5FLXc 3MTSA 3BC9A 3RZOB 2N78A 2KOLA 1SNCA 3H3VC 1DM0B 4OHJA 1KIXA 2B7CA 4DV3L 4HN7A 4RD3A 1VQOA 2R7DA 1TS5A 3FKIH 1NSNS 1FX0A 3BJUA 4RHSA 4XTCS 2NB0A 5EKKA 5E3FA 1QE6A 2NVYH 1YNND 4UHVA 2WAQG 2RDGA 2DETA 4GKKQ 4KY7A 1PXUA 5C3WA 3G6JB 1SE3A 2K33A 1RKNA 2LKVA 1GM5A 4WWVA 4XQFA 1Y14B 4LFCL 1I94L 2IHEA 4DR2Q 2XOKA 2I07B 3MAQA 3H0GB 2V7VA 1JWMD 2UUBL 4ME3A 1E64A 3SEBA 4C3IB 2UXCL 4HE6A 4A3EG 2EE1A 4MZ9A 2ZM6L 4XLCA 2KEDA 1GJRA 1GHKA 2DNCA 3OEHA 4BWGB 3I4MG 3VO2A 2PZWA 1GO2A 3G6EB 1Q12A 4AYBG 3M7NA 5CV8A 1I4GA 3RLNA 2YTYA 4QUCA 1GAWA 1Y1VH 1VQMA 1PH9A 1SR3A 4YALA 3U4ZA 4IPHA 1Y0RA 4FYDA 4JI0L 1S5CD 2OF1A 1JCKB 2CH4A 4AYBB 2P3MA 5FO8B 3DEPA 5M9OA 2VNKA 3VYSA 4CKCA 1BNZA 4M8AA 5IGBA 2SNSA 1DARA 1ZXTA 4LF4L 4KKUA 3GVKA 3K58A 4Y52H 1SJED 3PO3H 1VQKA 2IL8A 3PIP3 2D3LA 1GO3E 3HKZG 4GLAC 1W6JA 1PH3A 3GP7A 5I2XA 4ZCMA 1YITA 3SLDA 1VQ6A 1HR0Q 2KBNA 2JEBI 3W2DA 1D2EA 2D2CC 1YBYA 4XN3A 1S4ZA 1YJWB 1BDOA 4RKBA 1Q86D 3B6YA 5I4DA 4DR7Q 4RPDA 5EKLA 2VQFQ 3A8IA 3K0YA 1EP1B 2F0FA 1H8HA 1WCMH 1VQJA 3RZDH 1ZM3A 1Y0YA 1ESRA 2GJKA 1N08A 2MO1A 5FK9C 1BJKA 3BYTB 4B3GA 4OO1I 2Q6OA 1GKHA 3D3RA 1FD7D 2E2IH 2LSSA 4X66Q 1I6VC 1DYQA 2ENBA 3I91A 1DXMA 2EPBA 3JAME 3P20A 4P9SA 4DR6L 2YTVA 2K28A 5CGKA 5C0XG 2M9VA 2ZBVA 4NXNL 1TTTA 3I55A 2QMUA 1XTDA 2X3UA 5D65A 3RD4A 4FWTA 1JC7A 5H5JA 3NBIA 1CNEA 1II3A 5LL6X 2B63B 1VQ7A 4RMFA 1XMQL 4RCZA 1SYGA 3K8AA 1ASZA 4IUPA 1RF2D 2CW5A 3CTAA 4H13C 4QUFA 3BZDB 2YU9H 3JQRA 2RKSA 4LMQD 1H9JA 1IKMA 3VR2A 3G71A 4I7ZC 1OXUA 1VQFA 4YAOA 1MSGA 1NDHA 4O1NA 4DQLA 1A2UA 1STNA 5A88A 1PZJD 2AWNA 3Q22A 5JVH3 3C46A 2ICEC 3SXHA 3QSYA 1C9OA 1FL0A 1I5FA 2WKDA 3OZWA 1T5EA 3JAMi 1IHMA 4BY7G 4UZUA 3Q23A 4X65L 3BU2A 1VMCA 4X06A 4XONA 1QGZA 2F3IA 3HOUB 4HMIA 1A15A 4YIJA 1VQPA 3GTGH 3DM1A 3O13A 1CFMA 1I3QB 2SOBA 5K5PA 3HEJA 3EBEA 1BLIA 4OPSA 1HQMC 4M1UB 4LBWA 1I4QA 4XQQA 4DPGA 3S9WA 5M3FG 1SEBD 4A3KG 3J7AF 4JK1C 2FMMA 1EP2B 1LLRD 1KRTA 4DXFA 5FO7B 5F2DA 2CNDA 3H94A 3NP8A 1VQLA 5T1IA 1F2YA 1BOSA 1VQ6B 5E4XA 5LMNL 2MUYA 1JOQA 1FYCA 5BR8L 1NJID 1YJWA 4OOSA 4PAAA 1D5XC 4DAMA 5KRUA 4TMWA 2F0DA 4NXMQ 5JJKA 1WORA 5KEEA 4DR5Q 2ZL5A 4A3JG 4F8MA 3BZCA 1U9RA 4FXKC 4A3GB 4AQYL 2ZTDA 2WR8A 3GTQB 3KEWA 3F2DA 1C7YA 4XLFA 2L11A 1JQYD 1QUQA 4K6LA 1XE1A 2OCEA 4OGQC 3WOFA 3S2DH 4OOXA 4DXGA 3I70A 4C2MB 3C3LA 2RHQB 2BV3A 2WZNA 1OXTA 2B8GA 3FHWA 2Q6IA 2X8KA 1PTOF 3CMMA 5EPLA 3GV6A 1RD9D 4A4IA 3U6KA 1L0XB 3EROA 1B9NA 2EVBA 5M3FH 5AJ3L 1G7TA 1EIHA 1DOMA 4LF6L 2GA4B 4Z4YA 3BVMA 3IAYA 4GZYC 5NUCA 2D5DA 4JYAQ 2QDXA 1K8AC 2DNEA 2O5JC 1SLJA 1MBYA 1MIUA 4Z4UA 4AIMA 2ZITA 1NCVA 4YAWA 3QR8A 3PUYA 3A7LA 1SYBA 1N0UA 1CK1A 4NMZA 3PUMA 2ZJRA 3F8TA 4TSSA 3OHXC 5C44B 5HGTA 3KDFB 2A74C 1TY2A 2ZZFA 4LFAQ 3GTPH 2VBTA 1EOTA 4XOPA 2QTLA 3NQIA 1BCPF 4LAAA 3CQZB 4ACBA 4RGOS 3J81L 1X9NA 1UAPA 2I5MX 2UXDQ 3K7AB 2YWFA 2Y0SB 4DK6C 1ICFB 1L1OC 4RD0A 1PDQA 2XIWA 1U4PA 2K4KA 2QDLA 3ES9A 4NKLA 3K5NA 1I4HA 3TQYA 1CSQA 4GNXB 3CD6A 1W0KA 1L1OB 4O2DA 2EFGA 5FOBB 2L9HA 1YJ9B 2F0EA 1VHEA 4G1BA 3K6OA 3S2HB 3QOLA 1PYBA 3U58A 4ZGNB 1N36L 4LFCQ 1KC8D 1F20A 1K3RA 3S15B 4A3EH 1E3XA 4ZCLA 2BF4A 4DNIA 3VR4A 1XMOL 4XYOA 1TWGH 5EPJA 1Y69U 2OTLB 1PTOD 3E3XA 1LT6D 4ZRZA 4JI2L 1ZKOA 1IXRA 1EIYB 1LT5D 1G7CA 1VQIA 4JVZA 3VMFA 3H91A 3CCMB 2A68C 5IYCH 3GTLB 1LUZA 1QWYA 2WAQB 3PO3G 4LFBL 1QH0A 4JBKA 3OZVA 3AFQA 1K8GA 2X0KA 2PZTA 4HJ7A 2KEEA 5LMNQ 1D5ZC 5A8AA 2C2WA 4NB3A 1UD4A 4X7CA 1P8LA 5K36G 3EJIA 3PF4A 2HQEA 3MEHA 4LC0A 2D9UA 1IBKL 5EMNA 2F0OA 4HIDA 2F1MA 2V31A 1NMGA 1SN8A 1CZWA 3VR3A 4RAUC 1EU4A 3PUNA 3M3YB 1ZEQX 2OTJA 5C4XG 3CHBD 3OW2B 1EYDA 1ENCA 1EFRA 1JNYA 1N06A 1C4QA 3TSSA 1LTSD 4Z4WA 1NR2A 2QILA 1VQ5B 3M4QA 5LHY1 2R7ZH 1QNKA 3AVVA 4G57A 1KDAA 4X3UA 1FNWA 4ID6A 5IYNA 1N32L 2VB2X 4V0BA 2R93G 3TP8A 4XN0A 1TS4A 1BBUA 3UE0A 1K0RA 4IJHA 3S1MH 2X6WA 4PGOA 4IPDA 3CCVA 3E20A 1VQOB 1XXGA 1PJ7A 1E3ZA 2JN4A 5CBEE 4ZUJA 3LVBA 2BH2A 1V0FA 2R93B 2XNDA 1PLFA 2QN6A 2DEUA 4E6IA 4K5WA 2MO0A 2H1EA 2DJFC 3CB4A 2B39A 2N3SA 1BR9A 4Y7CA 3I56A 1R9TB 3FP9A 3D26A 4CKEA 3C2PA 1CT1D 3PUXA 1JOOA 4ZQ3A 2PPBC 4FXUA 4UAIA 4L5QA 4TMZA 1D6EC 4WZTA 3OTOL 5K36H 4YHBA 1Q9SA 1EY8A 5L37A 2QEJC 2JDIA 4C3JB 3QFCA 4PQXA 5FLXL 1EQRA 1FVIA 1VQGA 3D8GA 3OSOA 4DKAC 3I4NB 1PH5A 2R7FA 1E1RA 1XJVA 1GD7A 4J15A 3ER0A 1X3PA 1VCIA 2C78A 2Z6BD 4NNJA 2F3WA 2QW7A 4X62L 4OONA 2NN6G 4DV5Q 1HA3A 5IWAL 5E4WC 5F4MA 3V05A 4UY8C 2RSNA 5J35A 1HZAA 1H8EA 2WIIB 3PIO3 1WFQA 5ELNA 1PKVA 1WTHD 2R92G 3AEVA 4H0LC 3PIPA 1EY7A 3Q8DA 1VQNB 1YITB 2NV4A 1G6ZA 1X55A 4DV7Q 1KAWA 1LO5D 3LQEA 1Z7TA 1RQPA 5KNBA 5J1ZA 1QZHA 1FNBA 4RD1A 1NJIC 1ONLA 1HZEA 3QG1A 4NXNQ 4A93H 4NBSA 1AE3A 2UXCQ 1QG7A 5FKAC 3V7AA 5IGCA 2WSSA 4KJNA 1K3BC 4AF7A 1LT4D 2F0VA 3OW2A 4DV2Q 1Q82D 1SFOB 4OL7A 1G2TA 1UEAB 3NELA 3L2PA 4KN4C 4B3FX 2OYNA 2IY5B 1NR4A 1D1KA 4NPSA 2JJQA 5IT9c 1TWHB 1GUNA 1GAQA 4X0CA 2VNJA 2XWBB 3E0JA 4YHHL 2Q2TA 3J81k 1SYCA 4K0KL 1KK3A 4FK8A 1ILPA 3P26A 2B2YC 5KIXA 1YHAA 4PABA 3DXJC 5IYPA 1O80A 3S1QH 2V7QA 1B2TA 2IX0A 3JQQA 2DOGA 2NN6H 3CRKC 4I7AA 1IW7D 1QG0A 1VDZA 2HDLA 4C1NK 1STHA 2A69C 1TUIA 2F0UA 2V1CC 5JOBA 3T53B 2I5HA 2VW9A 2G9HD 3W2IA 4HJ5A 3J7AV 1H85A 2OBSA 1IHZA 1Y8PB 1EY5A 1J9ZA 1P16A 2CVRA 4JI1L 3MXNB 1WU8A 4A3BG 1JE5A 1VQAA 4AF6A 3SK4A 2RDFA 2C4UA 2X53S 2FINB 3CKIB 5M5YH 1YZ6A 1N34L 3VO1A 1G8ZD 3STBD 4YCWA 3MCAA 3KF6A 1HZ9A 4IOAA 5GV7A 4RHRA 2R6HA 1TWHH 2JA6B 4POGA 3LX0A 4UP9A 3ONUA 4F87A 4TRDA 1OXXK 1PRTF 2R3ZA 1RDPD 3OE7A 4DAYB 1EOVA 3OJXA 3TRZA 3RN5A 4OPVA 1B7YB 5I9PA 2BVNA 1PMRA 4WJ4A 1BBXC 3KL9A 5CBAE 3D6CA 3F2BA 2JA7G 1G7RA 3KBGA 5CMDA 2E2JB 2AUKA 4HCEA 4RDJA 2F0MA 5EQ0A 3A5UA 5IGDA 2JA5G 5C44G 2MQHA 4DV0L 1F77A 1H9SA 1XX8A 2NZOA 3PMFA 3BY2A 3H0GH 2OXPA 2RDHA 3IFTA 1EY9A 1U4LA 3CCQB 2JSOA 4DR7L 3ZZ0A 2BGJA 3OEEA 5KYIA 5HXBA 5G3LF 3TZUA 1GHJA 1IBML 4C3JG 2NVYB 3VNVA 2NVQB 4FO2A 2R92H 4BBSH 5IYQA 4DV7L 2DIEA 2A6EC 3KF8A 2EYMA 2V4DA 1STGA 3CMAB 1S5FD 2D3NA 2PE3A 2W6JA 2X6YA 1CUKA 1V1PB 1QUFA 5IP7H 2MFIA 1W3SA 1XFOA 3QJYA 1CA5A 3KOJA 5ELBA 3J7YW 3T1HL 1LM0A 2WB1E 5D3IB 5ISRA 4XOTA 3R2IA 5CV7A 3J80L 2E2HB 2OT2A 4ODGA 4EQNA 2PW7A 2Q2IA 4YELA 4MTKA 3TN2A 2R7ZG 4ILWA 4CJ2C 4L5TA 3MZ5A 4Y7NH 1UD2A 1SMXA 5CR3A 5C6AA 2R93H 4XQJA 4IFDH 2F03A 3AVXA 1PA6A 1PYSB 1NMFA 4M0LA 3ZZUA 1Y1VB 3CPFA 3TP6A 3SE0A 4LUOA 1E1TA 3W5OA 4BY7H 1QX4A 3Q39A 2XGJA 1BVSA 4QIWE 3S16H 2HHHQ 3W2HA 5LMUL 3J81j 1UD6A 4B4DA 1K8AD 3VYUA 5HZAA 2E74C 4EGVA 3CCEA 1PRTD 2ATWA 3CRZA 4TVAB 3MFGA 4YAUA 3GQBA 3DLLA 4NCNA 4A3FH 4GKKL 4Y7NB 5BN4A 1D2BA 3SR1A 4MIUA 5A89A 2K04A 4DV1L 4A3GH 3LNNA 1UEBA 4GS3A 4IUTA 4RKLA 3JQPA 3G4SB 1HPCA 5I2YA 2X69A 2Z9HA 3M3YH 4GLXA 1BX1A 2Z4HA 1DOLA 3TZDA 1PFMA 1PFNA 3WDNA 3HOXB 5C0XI 2WAQE 1Q1EA 1GUTA 2E1BA 3FPPA 1ZUNB 1HVXA 4XM3A 5HKKA 1HTLD 5C3EB 4KY5A 1IYVA 2KQ3A 3KBXA 4LWCA 1CHQD 1E43A 3E9IA 4LF9Q 2NVQH 1HUNA 3OTOQ 4IFDG 5M3FB 1EZ8A 5TSSA 1I3QH 4G7ZC 3J80i 1NE3A 4WZEA 4PMWA 1YX2A 1WJJA 2EQSA 3AQQA 3RLOA 3T56B 1EYGA 3M4OH 1RL2A 1H42A 1KD1C 2A6HC 2XNCA 4GQNA 2L1BA 5AFWA 2R9VA 1Q1BA 1G2SA 2E1RA 1IBLL 5C5MA 2B5OA 5IP9H 3PO2H 4JPBW 4A3FG 1YHQB 1NBMA 3H09A 2JA8H 2PNHA 5DM63 3TREA 4PC3A 4DF7A 3GTQH 1JB9A 4BA2I 4DV5L 4IOCA 4JC0A 1BF4A 4C2MH 3ZUGA 4IUVA 4QHYA 1ZM4A 2VZLA 1XQBA 2RBMA 3FJOA 3P75A 1XNQL 1CKNB 2PIAA 2VBSA 1BX0A 4QV2A 1QJOA 4QY7A 4GNXC 4XQNA 4IO9A 5FA6A 3HOZH 3PVDA 2XRSD 3W1GA 4DN4M 4XT1B 1SYDA 1N33Q 4ZUIA 1F9QA 1BPLA 1X6OA 3MXGA 3KUPA 2XN9C 2EOTA 2K5VA 3BDCA 3CCRA 5ELCA 5IP7G 3S17B 1QILA 3SHLA 4LF7Q 1MJCA 1Q46A 4JI5Q 1EY6A 2X6LA 1W9XA 1XNRQ 4RD6A 2CWAA 3DWPA 4RFBA 4K0KQ 4HIKA 1KMHA 4JI7Q 2HMAA 1QNUA 4DR4Q 5F4OA 4LFAL 2VJJA 4ZYSA 4Z9CB 5E7NA 4JI6L 3I56B 1TT2A 4EQOA 3PQIA 1A2TA 5FNZA 1DZ1A 1CQFA 3QFRA 2UXDL 2CKZB 1WTPA 4KLKA 3HOZB 4IQZA 2KCMA 3ICEA 3P7JA 4CBVA 5A2QL 2HDNB 3S1QB 4P71A 4DV4Q 4QFMA 3HKZB 3S2DB 3ZZTA 2BOSA 1VQKB 1W0JA 3J7ZC 1TQOA 4LF6Q 4DAVA 1PH2A 2UXBL 3HOZG 4QQBX 1X65A 1UMKA 4KJOA 2C77A 4B9WA 2NTTA 1L0YB 3A8JE 2F0WA 1TR5A 2YTXA 1XYIA 3WOEA 1G291 3HS0C 4LUZA 5IYCG 1WTOA 2UUCL 1G91A 2BA0A 3NUCA 2WYRA 1PYWD 1TY0A 4RGNA 1Q7YD 1BCPC 3PA2A 4UP7A 4DR6Q 2FXQA 5JAVA 1K9MC 4F7DA 3ASQA 3KDFA 4GOPB 3G48A 1KQSA 3QWNA 4P3YA 1EZ6A 4J0QA 2HD3A 1ET9A 2RF4A 3TS0A 4E0FA 3M9BA 4YHHQ 4Z4RA 2C5BA 1Z9FA 3A35A 1EUJA 2EJMA 2K05A 2O4XA 3OIQA 2B29A 4LF9L 2NBFA 3I2ZA 5JEAG 2EY2A 2GQFA 5M5XB 4AH6A 3Q24A 1EFTA 2PI2E 3GTGB 1VHOA 1IBKQ 4NXML 3IKJA 5EAYA 1Q81C 4HJAA 3ASTA 1S72B 2EY6A 2VL6A 3B82A 2HCJB 4P75A 4AQYQ 5M3MB 1QFZA 3PUZA 4RGMA 1VQ7B 2Y0SE 3H0GG 4M4SA 3V96A 4XKWA 5A2QE 1U2RA 2GK6A 5KGUA 4KKSA 4HJ8A 4GKJL 3CCJA 2CQAA 1HNWL 1VQ8A 2J0TD 1QGAA 4C3JH 2CBXA 3A8IE 5DEHA 3I72A 5DSZA 3BY1A 3CCUA 1ZM2A 2AQ3B 1JJCB 1TS3A 5CDFA 2JEAI 2NZ1D 3HKZE 3RN2A 3OWFA 1JOKA 3RLFA 1QVFA 2QA4A 2CFMA 2PNRC 2A8VA 5GAGC 4LF7L 3R6KA 1V1QA 1NY4A 4DR1L 1A63A 1RHPA 4DV6Q 2HT1A 3I73A 3AMUA 3AGQA 3QFSA 2JA5B 3A5ZB 1Q82C 2YWHA 4R4OA 1KK1A 1FNMA 3T4AC 1A8VA 3LWUA 2KCNA 4O0AA 3FMCA 4KHPQ 1UWVA 2F0IA 5DN6A 5LMZA 4B3TL 2NZHA 2XZLA 3KF6B 4I65A 5C3EG 1EWYA 5IT9L 4PMCA 2SEBD 2ZTEA 2XZOA 4APVA 4Z4SA 1CTMA 1AIPA 3CCSA 4GN3B 2BE5C 1I4PA 2EY5A 4IALA 3ASSA 3EQLC 3A8KE 1N32Q 1T6XA 5ELOA 5IT9E 4A3CG 3QB3A 2CC2A 2JN9A 2C5HA 2FHTA 3IL8A 4HR7B 3U6BA 5LMNW 4MHEA 1X3FA 1UE6A 2CF4A 4KN7C 2WB1B 4BY1G 2KHSA 5C0XH 3J81i 4A3IB 1SXTA 4DAYA 1C8CA 2B63G 4MTNA 2EYFA 1AH9A 3DMUA 1R5BA 1UE1A 3D4DA 4GOPA 2X85A 2EIFA 4DR3L 1LACA 5A35A 2KCCA 5EBCA 4FF3A 2VYQA 3KJPA 4UP8A 2BSAA 4TMXA 2K01A 4ASUA 1LTID 3OJWA 4B3XA 4RDLA 2BN4A 4X66L 5KNLA 4Z4TA 3CC4A 4Q0FA 4XLEA 1SMYD 1MJEA 4BXXH 2BM1A 1BCPB 2D0OA 1I18A 2UU9Q 1HA5A 1D5MC 1N34Q 3SDZA 1YI2B 2NWGA 3K5MA 3A3BA 1UD5A 4LBZA 5GAEC 1HHVA 3CESA 1WSVA 5ELEA 5IYRA 2IW3A 4OIKA 3CXCA 2C9OA 5F4JA 4L63B 4FF4A 1JJ2A 2F3VA 4OOVA 2ZJQA 4IUUA 4DK3C 4RDKA 1MI2A 5KYLA 5FO9B 1YEZA 2DUDA 4B3TQ 4XMYA 3W2FA 2AWOA 5D3DA 3CPXA 1KL9A 1HR0L 3PO2G 3BNWA 1KNEA 4QGUA 1SMYC 3ITPA 2LXJA 2Z0SA 1PTOH 2EZVA 5JPMC 3L7ZC 1C48A 2F52A 3PIOA 3S1RB 4BY1H 5FJ8G 1ESFA 2EYOA 3NWSA 4RH6A 3BDOA 1VQ4A 4C1NI 4JI8L 4OEMB 2A69D 2VY3A 2Z4IA 1WTVA 1YNJD 1V0EA 4P6YA 4B9XA 2F0KA 4A3JB 4PZ7A 2YYZA 1FGUA 1SKQA 3KLWA 3UDIA 5FIUA 2TMPA 2WZPP 3NTIA 4ME5A 4YCUA 2EJFC 4K5XA 2G9DA 2WV6D 1IYUA 3TMEA 1WVLA 3CC7A 5C4ZA 3Q6RA 2EIXA 4HEDA 2Q8TA 2ZBUA 2K5WA 3CCLA 4RM0A 1PRTB 2PQAA 3DWQA 5EBDA 3SK5A 1EYAA 2WP8J 3KFUA 1N07A 2F0TA 5M5XH 2F4NA 4X7DA 4N3GA 3AFPA 5IYDH 4N3NA 1J5EL 4C3HB 4B3RL 1BQEA 2FVGA 4EQ5A 2OTLA 1Q90A 3GVLA 2QDBA 1S40A 3ASPA 1QUEA 1WSRA 2QF7A 1GVHA 3PSIA 1B8AA 1AE2A 3WWVA 2ZJPA 1NNXA 1SFOH 1ZM9A 4G7HC 4WORA 3I4MH 3I4LA 2VQEQ 2JA7B 1V8QA 4B43A 3CC4B 4QUZA 2BDOA 4A3GG 1VQCA 3K81C 3W5HA 2VZAA 4DUZL 4AC9A 1M90D 4JOIA 4HIMA 5CV9A 2PMZE 5BSXA 1WD0A 3G7LA 1STEA 1KAAA 3G05A 1SSOA 2XVSA 4JG2A 3CD6B 2F4IA 4PG3A 4GNXA 1JA0A 2VUMH 5M3MG 4U673 2NPFA 2I1LA 4C3IG 2CQOA 2Q2HA 1HQRD 1LABA 4OO1G 3NHHA 3B8HA 3DM3A 4ALPA 3JC66 1DDGA 2RC6A 3H9NA 1SAPA 2EYJA 1IBMQ 1IL8A 1FJGL 3AU7A 1AZPA 2ZM6Q 3WQZA 4DFAA 4JYAL 2Q8IB 1VQ9B 3GTJB 2AQ2B 4YY3Q 1BBWA 1LTRD 1VQHA 3GTMH 2IX1A 5IYDG 2BGIA 3HOYB 4A3MG 1B50A 3ERSX 1VS0A 3F1ZA 2EJGC 3OKXA 1I8DA 4OWXB 4JI7L 4DR4L 2B2UA 4QVJA 1BQQT 1K28A 1BXTA 3D4WA 2HQLA 4YWMA 4J6HA 1TKWB 3ULLA 3ZIAA 1GUGA 4P74A 4FF2A 1GJXA 3HOXH 4KI0A 2AHOB 1R9TH 4K14A 2A73B 4LF4Q 3EFXD 4A76A 4HE5A 1A0IA 3NBHB 3P1HA 1Y1WH 2RC5A 1LTTD 2IJ0A 3CCRB 3PA1A 3ONAB 5HURA 2HLDA 1TWCB 3I4OA 1YLOA 1S72A 1VLOA 1F9PA 3X3MA 2LXKA 2PQAB 4FXGC 1IBLQ 3RY8A 3KK7A 3S1MB 4TT3A 1A3UA 3FKIG 3OMCA 5B6IA 4G4KA 3M4OB 4JI1Q 2IPKD 2PMZB 3DDYA 1M8AA 2XSCA 3HKSA 1K73C 2I0QA 2OWOA 4V190 4P6VF 5IK2A 3PO2B 1O7LA 1F2MA 4PV1C 3WY9A 1GVPA 3S14H 1Q8IA 4QMGA 2K1BA 1M4VA 2XNJA 4X7FA 2A68D 3DEOA 3OYYA 3GD7A 5C3EH 2VNUD 1B53A 3BCFA 2LY7A 1VQNA 3WBKA 3J80c 5FO0A 1SE8A 4O42A 1S5ED 1WOCA 2RCNA 2UUAQ 2E76C 3EVQA 1QVGB 1FNUA 2BCOA 2Q6KA 2MGSA 1VF5C 1STYA 4K2LA 1P4MA 3U50C 1F2LA 5C4JB 2R6GA 1WCMB 1EYCA 1Y1VG 2EDGA 4BBSB 3D0FA 1K0SA 1N9WA 2E5LQ 4TSFA 1IW7C 2F0PA 5IGGA 4PMBA 1Q81D 5HY6A 4DUZQ 2A5HA 2LS01 4XLHA 5AN9A 1AFPA 4FP5D 1SKYB 2XZPA 3ND8A 1SNOA 2JK8A 3J81c 1SNDA 4CDCC 1TIID 2JA8B 3QO2A 4IPCA 2E2JH 3I4NG 3NENA 3S2HH 2OQ0A 2D62A 2WACA 1HRJA 1UNSA 4ZLTF 3Q0AA 3PGZA 2F0LA 2EXDA 4C3HH 1EWIA 1FGBD 1VQLB 3CCJB 1Y8OB 3L0OA 4LF8L 3ASRA 2DGYA 4JBMA 1KD1D 3M85A 2MPMA 4A3LG 2B2TA 3VYRA 1XMQQ 1Z47A 2P5ZX 1XPRA 4H02A 5M5WB 1EEID 1T6ZA 3HP3A 5CC4A 1L1OA 4H44C 4K8IA 4A3MH 2FMCA 3RNUA 2ICIA 4EQPA 4G1VA 2JA6H 4GLVB 2M00A 3G6EA 1LTAD 3OOCA 3X3NA 4DGZA 1QUQB 5J39A 3W2GA 3KLRA 2D9RA 3U9OA 4YXWA 5CV6A 3CPWA 4A3CH 1X3EA 3FEWX 5C0XJ 1TVCA 5TY0A 2WJYA 5FJ8H 1Y1WG 4FVMA 2DY1A 3K57A 1NTGA 1H9MA 2GK7A 4QF4A 2L5TA 1E0BA 1I50H 2ZXPA 1Q3LA 1DDIA 1HFGA 4B3SQ 4JV5Q 5HZBA 3OZUA 5J3OA 2JJ2A 1JICA 3OWEB 4ULLA 5JJIA 1IL2A 1EY0A 1W87A 1GUOA 5IE8A 2JIZA 2Z6KC 2VXWA 1PH1A 3S16B 1N33L 2F0HA 1N05A 2H4OA 4P25A 3D31A 1TS2A 1K83H 3RR5A 3AYHB 4GOPC 4XR6A 1EEFD 3ND9A 4BBRH 5IOCA 3OPOA 3D4RA 3BDLA 3Q6SA 2JA5H 1ICWA 3ULJA 2FFKB 4Q5VA 3UDGA 4JBWA 4XNFA 4IJLA 4RPBA 2B7BA 1E24A 5IP9G 4JI0Q 1CM9A 2OK7A 2VNHA 2O2LD 1S5DD 3CRLC 2VB3X 3IRBA 4HMJA 4P26A 2A19A 1STBA 1YHBA 2QEXA 4JMQA 1BCPD 4L5RC 4KKTA 1KDCA 1BMFA 1F2ZA 1AN8A 5C4XB 4IW3B 5CORA 4J1MA 3HOVH 4DNTB 4A3BH 2DY8A 2OBTA 3T1YL 1HNZL 1A3VA 1WOPA 1V43A 5CV4A 1W2BA 4Z4VA 2HIXA 3CMEB 2V7XA 3TS2A 4QL5A 4CDDC 5M5YB 2CH4W 1G7SA 4Q7JB 2RCFA 1JJ2B 2M2LA 4RA8A 2HIVA 4ZGQB 1OO9B 2H5XA 5M3MH 3HOUH 1IKLA 3NQTA 1WYDA 1LTLA 4XDXA 2GJPA 4B47A 1AW7A 1R4QB 4S3SA 3LQ6A 3K7UC 2ES2A 2FJ2A 5JBQA 1KLGD 1OXVA 1X3GA 1TWFH 2KECA 4A3BB 3ZBTA 2RQXA 4R4CA 3SJZA 4B44A 2B2YA 2NYZD 4BBRG 1CSPA 2IT1A 1B3AA 4RJLA 5JPNC 4RD4A 4DQKA 4KHZA 3H6MA 1MGSA 3KLSX 4M2LA 4B3RQ 4M53A 4OP7A 4ZV4A 4IPGA 4ZCKA 1VQ9A 4CDFC 3BQJA 4IFDI 3SEJA 2PYKA 2LZJA 2QGGA 4CJ1B 3OIPA 3CW2A 4Y9UA 1TXYA 2BPOA 1U4MA 1WPCA 1E79A 3CP8A 2AKWB 2ZZQA 3CCLB 3NTHA 5IIFA 1MABA 2JJ1A 1N8RD 3VA5A 2ZXOA 2BMWA 3CC2B 2L55A 5IY0A 1K83B 1DJRD 5FLXE 1QGYA 1Y8NB 3STBC 3UI2A 4RCOA 2ASBA 1WTRA 2JQOA 1GR1A 2MJ8A 2OQKA 1OB5A 2E2IB 4KHVA 3KYHC 4C0SA 4DR3Q 1UE5A 4RG1A 4B3ML 1SNQA 1Q86C 2R7ZB 1UD8A 1Z6HA 1I50B 3NTKA 1PZKD 3E6ZX 4R71A 1N8RC 4PC1A 1EWCA 4A3IG 2X6XA 3C1FA 1EQQA 2QCPX 1HUMA 4HJ9A 2HCIA 5EKIA 2UU9L 1KRHA 1JB3A 3S1NH 3S17H 1UE7A 2A1AA 1SNMA 1WI5A 2K75A 3NWTA 1N0VC 1WTWA 1L2FA 1ZYRC 4XXEA 4Y9RA 1KRSA 2Z8LA 3PO3B 4C56C 2Q2UA 4MYUA 4PZ8A 5C3XA 4WQMA 1PH4A 2O5IC 3F2UA 4P22A 4R1JA 1JA1A 4QB4A 1W2BB 2F1LA 1RTNA 3Q38A 5J22A 4X05A 2K52A 3UDFA 1YJNB 3RMHA 4WJWA 3I8ZA 4N9PA 1T5XD 3MXUA 1CZGA 4A93B 3T16A 1TWAH 5IGFA 1Q7YC 3A56A 3W2EA 1D8TA 1JT8A 4F88A 4BY7B 1JMCA 1RODA 3T1YQ 1QCBD 1HNZQ 1SYEA 2WB1G 1AZQA 3S15H 1QFYA 1E22A 4AYBE 1A8PA 3A55A 1WOSA 4WJ3M 3MA2B 2ID0A 5THXA 2B8FA 1KK2A 4JI4L 3A7AB 4JW0A 3UDXA 1VQMB 1HJPA 2B2TC 1YNNC 4U68A 1KABA 3F2CA 2VBUA 3U9SA 1MHWC 3M4PA 4X62Q 4DV1Q 3B78A 2KJXA 2NTSA 3LGJA 3H3VH 1FRNA 1BO0A 3CCVB 1GOZA 3LWEA 3PV0A 2QKIC 1E2ZA 5DM73 4HSPA 5T1GA 5DS0A 3BYYB 3J81E 4P12A 3SVMA 2E2DC 3FRPB 5L46A 4A3DG 2DYIA 3WBJA 1GXDC 1EL0A 1K28D 3CXCB 2B2VC 3HGBA 4X8IA 3CC2A 2QTZA 5DNFA 2L4NA 2QE7A 3I1FA 4JI6Q 5H1SE 1YNXA 3R2TA 1WD1A 3U4VA 1IB0A 4DV2L 4A3DB 4WZKA 1H9SB 1OGIA 3QFTA 1QVCA 3PUWA 1WTHA 1FDRA 1X56A 4RD2A 2NVTH 3MMPA 3T51B 2ALYB 4CQJA 4RGTA 2WKCA 2N49A 1NAPA 1PH8A 4A3KH 1XB2A 4OX9Q 3LO8A 4MYTA 2UXBQ 4BBRB 1ILQA 3K59A 4B48A 4P73A 2VUMG 3KF8B 3MC0B 3ZC3A 3CMAA 4GN5A 2F0QA 3E0EA 3R8BA 4MNOA 1M90C 3ONYA 1VQPB 1HNWQ 1E3PA 2V7UA 2B2WA 3SLNA 2DERA 1MSHA 1RJTA 4QIWB 1HFNA 1TWAB 1EP3B 2PMDA 1KZLA 1F9RA 2M5SA 4ZAIA 4JI3L 5AJ3Q 4A3DH 4N8FA 3FKSA 2BE5D 1I4RA 4MN3A 1J9OA 2HUGA 4Z4ZA 1E7ZA 1LYLA 1J5EQ 2OEOA 4L5SA 2NVTB 2N88A 3MEFA 2ZL7A 3J7A5 3GTOH 4PNYA 4CGYB 4A75A 3CU7A 3R93A 3K5OA 4DV6L 3CCUB 1R4PB 3CF5A 3PF5A 2JYOA 3GTPB 3MXPA 4P2NA 3UE1A 1WDTA 4A3MB 4K6DA 1KQSB 1S5BD 1B44D 3CCEB
chains in the Genus database with same CATH topology
3GTMB 2B2WC 1NRKA 3N52A 2F0GA 4ZK9B 4R9WA 2EYPA 1O78A 4K2KA 2L12A 1CA6A 4XLAA 2K03A 3FVQA 2F0NA 3OW7A 3L3OC 4BS9A 1KNAA 1SYFA 1A6XA 5ELDA 5JJZA 4OIJA 2I46A 4NDXA 4A3KB 2XRQD 3MHBA 3NXWA 5G3LD 1EFID 4XYQA 1ENAA 3QOJA 1V1PA 3KLSA 2IX3A 3I4MB 1U4RA 1FR3A 5JEAH 1HA6A 3M4YA 1MD2D 3S1NB 1LTBD 1JWUD 1B1ZA 1CI3M 2B2UC 1PFBA 5DAUA 2AUJD 4XKVA 1XWEA 1ZYRD 3NBHA 1K8OA 1UD3A 3JAML 4P2CB 4CHTB 3L9AX 1EU3A 3N6RA 1KDBA 4XORA 1DCZA 1I4XA 2KUMA 4UDUC 2BA1A 4DAPA 5D14A 4CKBA 3HOVB 3MFYA 2K5QA 2PO4A 1RTOA 2SNMA 1COWA 2K7VA 3E5SA 2CW0C 1JORA 1F9SA 2LMCB 4G7XA 4F7XA 4K8JA 4LK1C 4FXDA 1VMPA 3GVJA 2TSSA 5EGTA 2A6ED 2MP1A 1W6KA 3D6WA 3NSWA 1BUVT 1LTGD 3HZXA 3GTKB 2CK3A 4KD3A 5EJWA 1SE2A 4X3SA 3SK6A 3PUVA 4IUNA 2ZZEA 1X32A 3NK9A 4G7WA 4ABNA 1TVXA 3HOWB 5CYUA 3TBIB 4L6TB 4HSVA 2VUMB 2JXMB 1B9MA 3W3AA 4QCLA 1PTOB 4HTHA 4B08A 4EVOA 1SE4A 5I9OA 4KMUC 3VA7A 1QB5D 1VF7A 1WTQA 2HDMA 5C4HA 2EYHA 2ZTNA 3ZYYX 3ZPNA 4IFDJ 3GO5A 3VYTA 2Z1CA 1LT3D 1RCVD 2KA7A 4K5VA 2ZT9C 1YNJC 1QOHA 4XL9A 4DK0A 1PRTC 1H9KA 4DK1A 3J80E 4DA2A 4C3HG 2XWJB 2C5CA 4FF1A 4LJZC 2F0SA 1ENFA 5KNDA 5KNCA 4TQUS 3VR5A 3BS1A 1KLUD 3I3CA 1PZID 4XT3B 2F43A 4ZKBB 3BVGA 3BCDA 1SDFA 1OXSC 4DU9A 1H9RA 2KVOA 3FKIB 2NUCA 1UUPA 1ML0D 3MVVA 2R61A 2WPDA 1FNVA 2PW5A 2B2VA 5COYA 3HAGA 5FL7A 4X3KA 3DHQA 5ELFA 3K5LA 4A3EB 3FPUB 3BH4A 2JP1A 2PCFB 2BDNA 4R8NA 2J7ZA 2K6AA 1OHHA 4J8QA 2NN6I 2PZUA 4CJ0B 1STAA 1Y1WB 2JE6I 1O7YA 4X3TA 3EA6A 1ET6A 4II3A 4XIGS 3R3OA 4KD4A 4ZKCB 1HCZA 1SBBB 3VR6A 4HIZA 3I90A 2PQEA 1E1QA 1JR0D 2ZZGA 3OFNA 2ZTGA 2CW0D 3M7GA 1TWGB 1DD2A 3RUZA 5LL6S 2J4XA 2MHVA 3JU4A 5BN3A 4FNFA 5EPKA 1OB0A 3V2TA 1EQTA 1EWHA 5I6YA 2NVXB 4G7OC 2KVMA 2W6IA 4KY6A 4XD7A 2YU9B 2ZXRA 2K32A 1E2VA 2N55A 4IZ8A 2A6HD 2L0CA 1VJSA 5E1FA 1AEXA 2DY7A 2RA4A 4L8JA 4HAEA 2WJVA 1JWSD 2IWHA 2X6GA 2WINB 3IFDA 3DWAA 4KTAA 3SK8A 4AVZA 1I6HB 3S14B 1DOKA 3TP5A 4II2A 1A3TA 2Q8RE 4WFN3 4R8IA 1PTOC 4IURA 5BN5A 4KV6A 1J8IA 2ZXIA 3MWYW 4IUQA 2XNAC 1X3QA 2E75C 1CHPD 4HCSA 3OMGA 1HTPA 3A3GA 1WTXA 2EYLA 5JVG3 4A3FB 1K8MA 4RCNA 1V1OA 1CQVA 1GUSA 1NUCA 4RWSC 4NP5A 3CP2A 3DUZA 3BG3A 2CHBD 2EY1A 4G6IA 5I6WA 1KTKA 1D1IA 3FDTA 2RVLA 4TKOB 1B4OA 5IGEA 4KK7A 1TWFB 4Z1MA 1EQVA 2HCCA 1TU2B 2SDFA 4BA1I 1DONA 2K5DA 3URYA 3TP7A 3GTOB 1JE4A 2DN8A 3RZDB 4OO1H 4BY1B 2F0JA 1VLYA 3QIAA 2ZXHA 2R92B 3TDQA 3AB9A 3HG9A 4DNRB 3OAAA 1HXYD 4WRDA 2EXZA 3C1EA 3A54A 3GV3A 5CV5A 1E2WA 4N9TA 3T13A 5IODA 1SNPA 2VJIA 2LFNA 5JEAJ 1EIGA 3NPPA 2RSOA 4H7BA 4IN3A 3BVZA 3MXNA 3NE5B 1GUWA 1O7ZA 1AP0A 5C5LA 2GJRA 1SJHD 4YEJA 1XTCD 2AQ1B 1WP6A 1EY4A 1LV9A 4NW2A 3ERQA 3HRZC 3MTSA 3BC9A 3RZOB 2KOLA 1SNCA 3H3VC 1DM0B 4OHJA 4HN7A 1TS5A 1NSNS 1FX0A 4RHSA 4XTCS 2NB0A 5EKKA 5E3FA 1QE6A 1YNND 2RDGA 4KY7A 1PXUA 5C3WA 3G6JB 1SE3A 2K33A 1RKNA 2LKVA 4XQFA 2XOKA 2I07B 3MAQA 3H0GB 1JWMD 3SEBA 4C3IB 2EE1A 4XLCA 2KEDA 1GHKA 2DNCA 3OEHA 4BWGB 2PZWA 1Q12A 3M7NA 5CV8A 1I4GA 4QUCA 4FYDA 1S5CD 2OF1A 1JCKB 4AYBB 5FO8B 3DEPA 5M9OA 1BNZA 3VYSA 4CKCA 4M8AA 5IGBA 2SNSA 1ZXTA 4KKUA 3GVKA 3K58A 1SJED 2IL8A 3PIP3 2D3LA 1W6JA 3GP7A 5I2XA 3W2DA 2JEBI 2D2CC 4XN3A 1S4ZA 1BDOA 4RKBA 5I4DA 5EKLA 3K0YA 2F0FA 1H8HA 1ESRA 2GJKA 5FK9C 3BYTB 4B3GA 4OO1I 3D3RA 1FD7D 1I6VC 1DYQA 2ENBA 3I91A 1DXMA 2EPBA 3JAME 3P20A 2K28A 5CGKA 5C0XG 2M9VA 5D65A 3RD4A 1JC7A 3NBIA 1II3A 5LL6X 2B63B 1SYGA 4IUPA 1RF2D 4H13C 4QUFA 3BZDB 2RKSA 4LMQD 1H9JA 1IKMA 3VR2A 4I7ZC 1OXUA 1MSGA 4O1NA 1A2UA 1STNA 1PZJD 2AWNA 5JVH3 3Q22A 3C46A 2ICEC 3SXHA 2WKDA 1T5EA 4UZUA 3Q23A 1VMCA 4XONA 3HOUB 4HMIA 1A15A 4YIJA 3DM1A 3O13A 1CFMA 1I3QB 2SOBA 5K5PA 3HEJA 1BLIA 1HQMC 4M1UB 1I4QA 4XQQA 3S9WA 1SEBD 3J7AF 4JK1C 2FMMA 1LLRD 4DXFA 5FO7B 5F2DA 3H94A 3NP8A 5T1IA 1F2YA 1BOSA 5E4XA 2MUYA 1JOQA 1FYCA 1D5XC 5KRUA 2F0DA 5KEEA 4F8MA 1U9RA 4FXKC 4A3GB 3GTQB 3KEWA 4XLFA 2L11A 1JQYD 4K6LA 4OGQC 3WOFA 4DXGA 3I70A 4C2MB 3C3LA 1OXTA 2B8GA 2X8KA 1PTOF 3CMMA 5EPLA 3GV6A 1RD9D 1S5BD 1L0XB 3EROA 1B9NA 2EVBA 1EIHA 1DOMA 3BVMA 3IAYA 4GZYC 5NUCA 2D5DA 2DNEA 2O5JC 1MBYA 1NCVA 3PUYA 3A7LA 1SYBA 1CK1A 4NMZA 4TSSA 3OHXC 5C44B 5HGTA 2A74C 1TY2A 2ZZFA 1EOTA 4XOPA 3NQIA 1BCPF 4LAAA 3CQZB 4RGOS 3J81L 1UAPA 3K7AB 2Y0SB 2XIWA 1PDQA 4NKLA 1U4PA 3K5NA 1I4HA 1W0KA 5FOBB 2L9HA 2F0EA 3S2HB 3K6OA 3QOLA 3S15B 1E3XA 3VR4A 4XYOA 5EPJA 1Y69U 1PTOD 1LT6D 4ZRZA 1ZKOA 1LT5D 3H91A 2A68C 3GTLB 1QWYA 2WAQB 2PZTA 2KEEA 1D5ZC 1UD4A 5K36G 3EJIA 2HQEA 3MEHA 2D9UA 2F0OA 2F1MA 2V31A 3VR3A 1CZWA 4RAUC 1EU4A 3M3YB 1ZEQX 3CHBD 1EYDA 1ENCA 1EFRA 1C4QA 3TSSA 1LTSD 1NR2A 2QILA 5LHY1 1QNKA 4G57A 1KDAA 4X3UA 1FNWA 4ID6A 2VB2X 4V0BA 3TP8A 4XN0A 1TS4A 2X6WA 1XXGA 1E3ZA 5CBEE 4ZUJA 1V0FA 2R93B 2XNDA 1PLFA 4E6IA 4K5WA 2H1EA 2B39A 1BR9A 1R9TB 4CKEA 3C2PA 1CT1D 3PUXA 1JOOA 4ZQ3A 2PPBC 4FXUA 4UAIA 1D6EC 5K36H 1EY8A 2QEJC 2JDIA 4C3JB 4PQXA 5FLXL 3D8GA 3OSOA 3I4NB 1E1RA 1X3PA 1VCIA 2Z6BD 4NNJA 2F3WA 2NN6G 5E4WC 3V05A 2RSNA 3PIO3 1H8EA 2WIIB 1PKVA 1WTHD 4H0LC 1EY7A 1G6ZA 1LO5D 1Z7TA 5KNBA 5J1ZA 1HZEA 1ONLA 3QG1A 1QG7A 5FKAC 5IGCA 2WSSA 4KJNA 1LT4D 2F0VA 1SFOB 1G2TA 4OL7A 1UEAB 4KN4C 4B3FX 1NR4A 1D1KA 1TWHB 1GUNA 2XWBB 3E0JA 1SYCA 1ILPA 2B2YC 5KIXA 3DXJC 1O80A 2V7QA 1B2TA 2IX0A 2NN6H 3CRKC 1IW7D 1VDZA 2HDLA 4C1NK 1STHA 2A69C 2F0UA 5JOBA 3T53B 2G9HD 3J7AV 1IHZA 1Y8PB 1EY5A 2CVRA 3SK4A 2RDFA 2X53S 2FINB 3CKIB 1G8ZD 4RHRA 2JA6B 3LX0A 4F87A 4TRDA 1OXXK 1PRTF 2R3ZA 1RDPD 3OE7A 5I9PA 1PMRA 1BBXC 5CBAE 3D6CA 3KBGA 5CMDA 2E2JB 2AUKA 4HCEA 2F0MA 5EQ0A 5IGDA 1F77A 1H9SA 1XX8A 3PMFA 3IFTA 2OXPA 2RDHA 1EY9A 1U4LA 2JSOA 3OEEA 5KYIA 5G3LF 3TZUA 1GHJA 4C3JG 2NVYB 2NVQB 4FO2A 2DIEA 2A6EC 3KF8A 2EYMA 2V4DA 1STGA 1S5FD 2D3NA 2W6JA 2X6YA 1V1PB 1CA5A 3QJYA 5ELBA 3J7YW 5ISRA 5D3IB 4XOTA 3R2IA 5CV7A 3J80L 2E2HB 2OT2A 4ODGA 4EQNA 2PW7A 4YELA 3TN2A 4ILWA 4CJ2C 3MZ5A 1UD2A 5CR3A 5C6AA 4XQJA 4IFDH 2F03A 1Y1VB 3TP6A 3SE0A 2XGJA 1UD6A 3VYUA 2E74C 4EGVA 1PRTD 3MFGA 3GQBA 4Y7NB 5BN4A 1D2BA 3SR1A 4MIUA 2K04A 3LNNA 4RKLA 4IUTA 1HPCA 5I2YA 2X69A 2Z4HA 1DOLA 3TZDA 1PFMA 1PFNA 3WDNA 3HOXB 5C0XI 1Q1EA 1GUTA 2E1BA 3FPPA 1HVXA 4XM3A 5HKKA 1HTLD 5C3EB 4KY5A 1IYVA 2KQ3A 3KBXA 1CHQD 1E43A 1HUNA 4IFDG 5M3FB 1EZ8A 5TSSA 4G7ZC 4PMWA 3T56B 2A6HC 4GQNA 2L1BA 5AFWA 2R9VA 1Q1BA 1G2SA 5C5MA 1NBMA 3H09A 5DM63 4DF7A 4BA2I 1BF4A 4IUVA 2RBMA 3P75A 1QJOA 4XQNA 2XRSD 4DN4M 4XT1B 1SYDA 4ZUIA 1F9QA 1BPLA 3MXGA 3KUPA 2XN9C 2EOTA 3BDCA 5ELCA 3S17B 1QILA 3SHLA 1EY6A 2X6LA 1W9XA 3DWPA 4RFBA 1KMHA 1QNUA 2VJJA 4ZYSA 4Z9CB 1TT2A 4EQOA 1A2TA 1DZ1A 1CQFA 1WTPA 3HOZB 4IQZA 3P7JA 4CBVA 5A2QL 3S1QB 3HKZB 3S2DB 2BOSA 1W0JA 1TQOA 4DAVA 4KJOA 4B9WA 2NTTA 1L0YB 3A8JE 2F0WA 1TR5A 1XYIA 3WOEA 1G291 3HS0C 1WTOA 1G91A 2BA0A 3NUCA 1TY0A 1PYWD 4RGNA 1BCPC 5JAVA 3QWNA 1EZ6A 1ET9A 4E0FA 3A35A 2EJMA 2K05A 2O4XA 3OIQA 2NBFA 5JEAG 2EY2A 5M5XB 3Q24A 3GTGB 3IKJA 2EY6A 5M3MB 3PUZA 4RGMA 5A2QE 3V96A 4XKWA 2GK6A 5KGUA 4KKSA 2CQAA 2J0TD 3A8IE 5DEHA 3I72A 2AQ3B 1TS3A 5CDFA 2JEAI 2NZ1D 3OWFA 1JOKA 3RLFA 2PNRC 1RHPA 3I73A 3AMUA 2JA5B 3T4AC 3LWUA 2KCNA 3FMCA 2F0IA 5DN6A 2XZLA 4I65A 5IT9L 4PMCA 2SEBD 2XZOA 1CTMA 4IALA 2BE5C 1I4PA 2EY5A 3EQLC 3A8KE 5IT9E 3QB3A 2FHTA 3IL8A 4HR7B 4MHEA 4KN7C 4A3IB 2WB1B 5C0XH 2KHSA 1C8CA 1SXTA 4DAYA 2EYFA 3DMUA 3D4DA 2X85A 1LACA 5A35A 2KCCA 5EBCA 4FF3A 2K01A 4ASUA 1LTID 5KNLA 4Q0FA 4XLEA 1SMYD 1BCPB 1I18A 1HA5A 1D5MC 3SDZA 2NWGA 3K5MA 3A3BA 1UD5A 1HHVA 3CESA 5ELEA 2IW3A 4OIKA 2C9OA 4FF4A 4L63B 2F3VA 4IUUA 1MI2A 5KYLA 5FO9B 4XMYA 2AWOA 5D3DA 1KNEA 1SMYC 3ITPA 1PTOH 2EZVA 5JPMC 3L7ZC 1C48A 3S1RB 1ESFA 2EYOA 3NWSA 4RH6A 3BDOA 4C1NI 2A69D 2Z4IA 1WTVA 1YNJD 1V0EA 4B9XA 2F0KA 4A3JB 2YYZA 2TMPA 2WZPP 3NTIA 4ME5A 2EJFC 4K5XA 2G9DA 2WV6D 1IYUA 3TMEA 1WVLA 5C4ZA 4HEDA 2Q8TA 2K5WA 3SK5A 1PRTB 3DWQA 5EBDA 1EYAA 2WP8J 2F0TA 4C3HB 1Q90A 3GVLA 2QDBA 2QF7A 4G7HC 4WORA 3I4LA 2JA7B 1V8QA 2BDOA 5CV9A 1WD0A 3G7LA 1STEA 1KAAA 3G05A 1SSOA 2XVSA 2F4IA 4U673 4C3IG 1HQRD 1LABA 4OO1G 3NHHA 1SAPA 2EYJA 1IL8A 3AU7A 1AZPA 3WQZA 4DFAA 2Q8IB 3GTJB 2AQ2B 1LTRD 2IX1A 3HOYB 1B50A 2EJGC 1I8DA 2B2UA 1BQQT 1BXTA 3D4WA 4J6HA 1TKWB 3ZIAA 1GUGA 4FF2A 1GJXA 4KI0A 4K14A 2A73B 3EFXD 3P1HA 1LTTD 2IJ0A 3ONAB 5HURA 2HLDA 1TWCB 1F9PA 3X3MA 4FXGC 3KK7A 3S1MB 4TT3A 1A3UA 3OMCA 4G4KA 3M4OB 2IPKD 2PMZB 3DDYA 1M8AA 2XSCA 4V190 5IK2A 3PO2B 1O7LA 1F2MA 4PV1C 1Q8IA 4QMGA 2K1BA 1M4VA 3DEOA 2A68D 3GD7A 2VNUD 1B53A 3BCFA 2LY7A 4O42A 1S5ED 2E76C 3EVQA 1FNUA 2BCOA 2MGSA 1VF5C 4K2LA 1F2LA 5C4JB 2R6GA 1WCMB 1EYCA 2EDGA 4BBSB 4TSFA 1IW7C 2F0PA 5IGGA 4PMBA 2A5HA 2LS01 4XLHA 1AFPA 4FP5D 1SKYB 2XZPA 3ND8A 1SNOA 1SNDA 1TIID 2JA8B 3QO2A 2WACA 2D62A 1HRJA 1UNSA 4ZLTF 3Q0AA 2F0LA 1FGBD 1Y8OB 3M85A 2MPMA 2B2TA 3VYRA 1Z47A 5M5WB 1EEID 3HP3A 5CC4A 4H44C 4K8IA 2FMCA 2ICIA 4EQPA 2M00A 1LTAD 3OOCA 3X3NA 4DGZA 5J39A 3KLRA 3U9OA 4YXWA 5CV6A 3FEWX 5C0XJ 2WJYA 4FVMA 3K57A 1H9MA 2GK7A 4QF4A 2L5TA 1E0BA 2ZXPA 1Q3LA 1HFGA 1JICA 2JJ2A 4ULLA 3OWEB 1EY0A 1GUOA 2JIZA 3S16B 2VXWA 2F0HA 2H4OA 3D31A 1TS2A 4XR6A 1EEFD 3ND9A 5IOCA 3OPOA 3D4RA 3BDLA 3Q6SA 1ICWA 2FFKB 4Q5VA 4JBWA 4XNFA 1CM9A 3CRLC 2O2LD 1S5DD 2VB3X 4HMJA 1STBA 4JMQA 1BCPD 4KKTA 1KDCA 1BMFA 1F2ZA 1AN8A 5C4XB 5CORA 4J1MA 4DNTB 2DY8A 1A3VA 1V43A 5CV4A 5M5YB 2M2LA 4RA8A 1OO9B 1IKLA 3NQTA 4XDXA 2GJPA 1AW7A 1R4QB 4S3SA 2FJ2A 1KLGD 1OXVA 2KECA 4A3BB 2RQXA 2B2YA 2NYZD 2IT1A 1B3AA 5JPNC 4KHZA 3H6MA 1MGSA 3KLSX 4IFDI 2PYKA 2LZJA 4CJ1B 3OIPA 1U4MA 1WPCA 1E79A 3CP8A 2ZZQA 3NTHA 5IIFA 1MABA 2JJ1A 3VA5A 2ZXOA 2L55A 1K83B 1DJRD 5FLXE 1Y8NB 3UI2A 4RCOA 1WTRA 2MJ8A 2E2IB 4KHVA 1SNQA 2R7ZB 1UD8A 1Z6HA 1I50B 3NTKA 1PZKD 3E6ZX 1EWCA 2X6XA 3C1FA 2QCPX 1HUMA 2HCIA 5EKIA 1JB3A 1SNMA 3NWTA 1WTWA 1ZYRC 4XXEA 2Z8LA 3PO3B 4C56C 2O5IC 5C3XA 3F2UA 4P22A 4QB4A 1RTNA 5J22A 3RMHA 4WJWA 3I8ZA 4N9PA 1T5XD 3MXUA 1CZGA 4A93B 3T16A 5IGFA 3A56A 4F88A 4BY7B 1RODA 1QCBD 1SYEA 1AZQA 3A55A 3MA2B 2ID0A 2B8FA 3A7AB 2B2TC 1YNNC 4U68A 1KABA 3U9SA 2KJXA 2NTSA 1BO0A 3PV0A 1GOZA 3LWEA 2QKIC 1E2ZA 5DM73 4HSPA 5T1GA 3BYYB 3J81E 3SVMA 2E2DC 3FRPB 1GXDC 1EL0A 1K28D 2B2VC 3HGBA 5DNFA 2L4NA 2QE7A 3R2TA 1WD1A 4A3DB 1H9SB 3PUWA 3T51B 4RGTA 2WKCA 1NAPA 4BBRB 1ILQA 3K59A 3MC0B 2F0QA 3R8BA 2B2WA 1MSHA 4QIWB 1RJTA 1HFNA 1TWAB 1KZLA 1F9RA 2M5SA 4ZAIA 3FKSA 2BE5D 1I4RA 4MN3A 1J9OA 2HUGA 2NVTB 2OEOA 2N88A 4PNYA 4CGYB 3CU7A 3R93A 3K5OA 1R4PB 2JYOA 3GTPB 3MXPA 4A3MB 4K6DA 1STYA 1B44D 2GA4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KN7 C;  2D5D A;  5BN4 A;  5C0X H;  5C0X G;  1IW7 C;  3LNN A;  4DNT B;  2DNE A;  2O5J C;  1HPC A;  1V43 A;  2A6E D;  1O78 A;  1LAC A;  3A8J E;  5A35 A;  2KCC A;  3ND8 A;  3WDN A;  3PUY A;  3A7L A;  1G29 1;  1Q1E A;  1GUT A;  5BN5 A;  4GZY C;  1LAB A;  2BA0 A;  4OO1 G;  3FPP A;  2PPB C;  3PUX A;  3PUV A;  3OW7 A;  2B8F A;  2PCF B;  3A7A B;  4H13 C;  2E75 C;  5K36 H;  2D62 A;  1A6X A;  1YNN C;  1OXX K;  4XTC S;  3U9S A;  1H9J A;  1IYV A;  3VR2 A;  4I7Z C;  1OXV A;  1OXU A;  2Q8I B;  3SDZ A;  4IFD G;  1HTP A;  1Y8O B;  2NN6 I;  2JXM B;  1B9M A;  3PV0 A;  4G7Z C;  1PMR A;  2EJM A;  3W3A A;  3M85 A;  1E2Z A;  2K33 A;  2JE6 I;  2IT1 A;  5JEA G;  1K8M A;  3T56 B;  4RCN A;  1T5E A;  2EJG C;  4XIG S;  2A6H C;  4KHZ A;  1VCI A;  3HGB A;  4KMU C;  1GUS A;  1Q1B A;  2AUK A;  1FR3 A;  4H44 C;  5JEA H;  3IKJ A;  1HCZ A;  3M4Y A;  3VA7 A;  1TKW B;  1GUG A;  1VF7 A;  1H9S A;  2NN6 G;  3BG3 A;  3VR6 A;  2AWO A;  1GJX A;  4KI0 A;  3IFT A;  1CI3 M;  3OOC A;  3PUZ A;  1SMY C;  3VR4 A;  1GHK A;  1H9S B;  2DNC A;  3PUW A;  1CFM A;  1Q12 A;  3M7N A;  4BA2 I;  4TKO B;  3KLR A;  4KKS A;  1HQM C;  4H0L C;  1Y69 U;  3TZU A;  2AUJ D;  3L7Z C;  1GHJ A;  3T51 B;  1Z7T A;  1K8O A;  5KNB A;  3BDO A;  4JK1 C;  2A69 D;  1ZKO A;  2A6E C;  3A8I E;  1Y8N B;  3I72 A;  1DD2 A;  3H94 A;  1ONL A;  2V4D A;  1H9M A;  1QJO A;  2A68 C;  3QG1 A;  2L5T A;  1TU2 B;  2KA7 A;  4BA1 I;  2YYZ A;  2ZT9 C;  3N6R A;  2JEA I;  1FYC A;  1YNJ C;  4KKU A;  5BN3 A;  2EJF C;  3RLF A;  1DCZ A;  4KN4 C;  1IYU A;  1EWH A;  4DK0 A;  1GUO A;  1Z6H A;  2PNR C;  1H9K A;  4DK1 A;  3QJY A;  5K36 G;  2DN8 A;  4G7O C;  1GUN A;  4OO1 H;  2BA1 A;  2F1M A;  3VR3 A;  1O7L A;  4PV1 C;  3QIA A;  3D31 A;  3MFY A;  3I73 A;  2JEB I;  4LJZ C;  2D2C C;  3AB9 A;  1BDO A;  5KND A;  4DNR B;  3LWU A;  3ND9 A;  4TQU S;  3VR5 A;  5KNC A;  2BE5 D;  3OPO A;  2A68 D;  3D4R A;  3DXJ C;  3FMC A;  2K32 A;  3GD7 A;  1E2V A;  4OGQ C;  1E2W A;  4IFD H;  1Q90 A;  2NN6 H;  3CRK C;  2A6H D;  4JBW A;  1OXT A;  1IW7 D;  2K7V A;  2B8G A;  2E76 C;  1ZYR C;  1VDZ A;  2QF7 A;  3SE0 A;  1OXS C;  3CRL C;  1CTM A;  1H9R A;  2A69 C;  2CW0 C;  2O5I C;  3T53 B;  1VF5 C;  2BE5 C;  2R6G A;  4L8J A;  3A8K E;  3NE5 B;  2E74 C;  3EQL C;  4G7H C;  1I6V C;  3I4L A;  1B9N A;  2LMC B;  2EVB A;  4IQZ A;  1Y8P B;  3MXU A;  2EDG A;  1DXM A;  4LK1 C;  1V8Q A;  4HR7 B;  3GQB A;  3P20 A;  4KKT A;  2BDO A; 
#chains in the Genus database with same CATH topology
 3GTM B;  2B2W C;  1NRK A;  3N52 A;  2F0G A;  4ZK9 B;  4R9W A;  3HOY G;  2EYP A;  1FRQ A;  2FX3 A;  1O78 A;  3VNU A;  3GDE A;  3NEM A;  4K2K A;  5GQO A;  3G4S A;  2L12 A;  1CA6 A;  4DV3 Q;  4XLA A;  2F4V Q;  2K03 A;  3FVQ A;  2F0N A;  3OW7 A;  1HNX L;  4B3S L;  4JV5 L;  2D74 A;  3L3O C;  4BS9 A;  1KNA A;  4DV4 L;  1KXL A;  1SYF A;  1A6X A;  3A1P A;  5ELD A;  5JJZ A;  2XTI A;  2G5D A;  2I46 A;  4OIJ A;  4NDX A;  4A3K B;  2XRQ D;  3MHB A;  3NXW A;  5G3L D;  1EFI D;  4XYQ A;  1ENA A;  3QOJ A;  4HIO A;  5E6T A;  1V1P A;  3K7A H;  1G6P A;  2YV5 A;  3KLS A;  4LW1 A;  4KHP L;  3ZBU A;  2IX3 A;  3I4M B;  1U4R A;  2Z6K A;  2OBR A;  2Y0S G;  4QJF A;  4R4T A;  4UPA A;  1FR3 A;  4JCV E;  5JEA H;  3CQZ H;  1HA6 A;  3M4Y A;  1MD2 D;  2VS1 A;  2ZTC A;  3S1N B;  1LTB D;  1JWU D;  1B1Z A;  1CKO A;  2QA4 B;  1CI3 M;  2AMC B;  5KW9 A;  5BR8 Q;  5TRD A;  1K9M D;  2B2U C;  1PFB A;  1U5K A;  1I6H H;  3I7F A;  4C43 A;  5DAU A;  1L0W A;  2AUJ D;  1G51 A;  4XKV A;  1XWE A;  1ZYR D;  1PH6 A;  3NBH A;  1K8O A;  3MHP A;  1UD3 A;  1D8L A;  2ZL6 A;  3JAM L;  4FN5 A;  3HOW H;  1V5V A;  4P2C B;  4CHT B;  3L9A X;  1EU3 A;  1YI2 A;  3HOV G;  4OX9 L;  3N6R A;  1M1K C;  3R6J A;  3W5V A;  1KDB A;  1B70 B;  4XOR A;  1DCZ A;  1I4X A;  2VNI A;  2KUM A;  5TR9 A;  3P27 A;  3A74 A;  4UDU C;  4OPO A;  4A3J H;  1VQD A;  3I4N H;  1PH7 A;  3HFZ B;  2BA1 A;  4DAP A;  1NB0 A;  5D14 A;  4CKB A;  3HOV B;  1Q8K A;  3MFY A;  1YIJ A;  2K5Q A;  1PJ5 A;  1W35 A;  2PO4 A;  1RTO A;  3Q3A A;  2N8N A;  2SNM A;  2XEX A;  1COW A;  2K5N A;  2GVA A;  2K7V A;  2DCU A;  3E5S A;  1T6Y A;  2CW0 C;  1JOR A;  1WOO A;  4PC6 A;  3CW2 C;  4DR1 Q;  2MNA A;  1F9S A;  2LMC B;  4OXP A;  4G7X A;  2E8G A;  4F7X A;  3BZK A;  4K8J A;  4LK1 C;  4FXD A;  2YWE A;  4YY3 L;  1VMP A;  3GVJ A;  4DR5 L;  2XGT A;  3CC7 B;  3I55 B;  4QVA A;  1CNF A;  1U0L A;  2KEN A;  2TSS A;  1KC8 C;  3EN2 A;  5EGT A;  2A6E D;  4BBS G;  2MP1 A;  1W6K A;  1YHQ A;  3D6W A;  3NSW A;  1BUV T;  1HNX Q;  4JBJ A;  1LTG D;  3VDY A;  4TMV A;  3HZX A;  2C4T A;  3GTK B;  2CK3 A;  2J7K A;  4KD3 A;  5EJW A;  1SE2 A;  4X3S A;  3SK6 A;  3PUV A;  4OWT B;  4IUN A;  2C35 B;  2ZZE A;  1X32 A;  3NK9 A;  4G7W A;  4ABN A;  1TVX A;  1EFC A;  1SRO A;  2GVB A;  5GRO A;  3HOW B;  5CYU A;  3TBI B;  4L6T B;  2L15 A;  1CKM A;  4HSV A;  2VQF L;  5FLM H;  2VUM B;  2JXM B;  1B9M A;  1KJZ A;  3W3A A;  4QCL A;  3C2Q A;  1VQ4 B;  5BSY A;  1PTO B;  4G5G A;  5GAD C;  4A3I H;  4HTH A;  2WFW A;  5C4X H;  4B08 A;  3TEH B;  1M1K D;  4EVO A;  1SE4 A;  5I9O A;  4KMU C;  1X54 A;  4CDE C;  2JA7 H;  3GTL H;  2PI2 A;  4R4Q A;  1SRU A;  5DLQ E;  3VA7 A;  1QB5 D;  1OGJ A;  1VF7 A;  3OP1 A;  3W5U A;  4LUV A;  1WTQ A;  4PC2 A;  2HDM A;  5C4H A;  1HH2 P;  2EYH A;  4DUY L;  3HOX G;  2ZTN A;  1B23 P;  2CWP A;  5JJL A;  3ZYY X;  1XNR L;  1R5N A;  2GN5 A;  1FNC A;  3ZPN A;  4M1K A;  1OB2 A;  1VQ5 A;  4IFD J;  1O7I A;  3GO5 A;  1T9H A;  1D1N A;  4JI5 L;  3VYT A;  2Z1C A;  4GN4 B;  1LT3 D;  1RCV D;  2KA7 A;  4K5V A;  2ZT9 C;  1YNJ C;  1QOH A;  4XL9 A;  1HZB A;  1SM4 A;  4DK0 A;  1PRT C;  1H9K A;  4DK1 A;  3J80 E;  4DA2 A;  4X65 Q;  3E1Y E;  4C3H G;  2QGQ A;  2XWJ B;  3EIV A;  4JI4 Q;  2C5C A;  1YJN A;  4FF1 A;  1H95 A;  1BKB A;  4LJZ C;  4YWK A;  2AHO A;  2F0S A;  3WYA A;  1AMO A;  1ENF A;  5KND A;  5KNC A;  2OK8 A;  2B3G A;  2JA9 A;  4TQU S;  3VR5 A;  3BS1 A;  1KLU D;  3I3C A;  1PZI D;  4XT3 B;  2F43 A;  5C4J H;  3H3V I;  1E63 A;  4ZKB B;  2JA8 G;  3A0J A;  3BVG A;  4YWL A;  1SDF A;  3BCD A;  4ROX A;  1A62 A;  1RQR A;  1OXS C;  1RIP A;  4P72 A;  1H9R A;  4DU9 A;  2KVO A;  3FKI B;  5IYB H;  1PHJ A;  1YVC A;  2NUC A;  1E62 A;  1UUP A;  4LF5 L;  1ML0 D;  1KHI A;  3MVV A;  2R61 A;  2RHS B;  2WPD A;  5M5W H;  1FNV A;  4OEL B;  1K73 D;  1IJF A;  2PW5 A;  2K14 A;  2UUA L;  2B2V A;  5COY A;  2K50 A;  4YAF A;  4X64 L;  3HAG A;  3SJP A;  5FL7 A;  4X3K A;  3DHQ A;  5ELF A;  1EIF A;  3K5L A;  3WNC A;  3CME A;  4A3E B;  2CCZ A;  1F60 A;  3FPU B;  3BH4 A;  2JP1 A;  2PCF B;  1VQ8 B;  2PLF A;  4C3I H;  2BDN A;  4R8N A;  1QVG A;  2J7Z A;  2K6A A;  1OHH A;  3KJO A;  4B3M Q;  3SGI A;  4J8Q A;  2NN6 I;  2PZU A;  4CJ0 B;  1STA A;  1Y1W B;  1EFU A;  1JB7 A;  1YJ9 A;  1DGS A;  2JE6 I;  1O7Y A;  4X3T A;  3EA6 A;  1ET6 A;  1QVF B;  4II3 A;  5IYB G;  3GSI A;  4XIG S;  1MKH A;  4DUY Q;  3R3O A;  1D7Q A;  1PFS A;  4KD4 A;  4ZKC B;  1HCZ A;  1SBB B;  1E1O A;  3VR6 A;  3GTK H;  4HIZ A;  5C44 H;  3I90 A;  2PQE A;  1NBW A;  1MRZ A;  1E1Q A;  4P3I A;  1JR0 D;  1J6Q A;  2ZZG A;  1CKN A;  1B3Q A;  1OTC A;  3CCM A;  3OFN A;  2ZTG A;  4TMT A;  5H59 A;  2CW0 D;  4R4I A;  3M7G A;  4PC7 A;  1TWG B;  1S3O A;  4LFB Q;  4RCY A;  3CCS B;  1B2R A;  4WZL A;  1DD2 A;  4EH1 A;  3AVW A;  3RUZ A;  5TV2 A;  5LL6 S;  2J4X A;  2MHV A;  3JU4 A;  3A8K A;  4UZE A;  4BPR A;  4FNF A;  5EPK A;  5BN3 A;  1OB0 A;  3V2T A;  3GIR A;  1EQT A;  1EWH A;  5I6Y A;  4BXX G;  2NVX B;  2YWG A;  4G7O C;  2V7T A;  2OTJ B;  2KVM A;  1N36 Q;  5LMU Q;  2W6I A;  4A3L H;  1VQB A;  4UAJ A;  4KY6 A;  3JAM c;  3W1B A;  4XD7 A;  2YU9 B;  4GKJ Q;  2ZXR A;  3H15 A;  4LF8 Q;  4LNQ A;  5KSW B;  2K32 A;  1E2V A;  3AGP A;  1TWC H;  3K0X A;  2N55 A;  1WCM G;  5HGQ A;  4IZ8 A;  1EFW A;  1I7P A;  3CPW B;  2JA6 G;  2A6H D;  2L0C A;  2KHJ A;  1VJS A;  4DV0 Q;  5E1F A;  1AEX A;  1YIJ B;  1FJG Q;  1NB9 A;  2KCT A;  2DY7 A;  1EXM A;  2RA4 A;  4L8J A;  4HAE A;  1JWS D;  2WJV A;  1R5O A;  2IHF A;  2IWH A;  2X6G A;  2DJG C;  3GTJ H;  2WIN B;  3IFD A;  3PCO B;  3V76 A;  3DWA A;  4JI2 Q;  3HOW G;  1QZG A;  2Z6B A;  4EX5 A;  4KTA A;  3HOY H;  3SK8 A;  1IJE A;  4AVZ A;  1IZ6 A;  1I6H B;  4YCV A;  3S14 B;  2GPJ A;  1DOK A;  1TLL A;  3TP5 A;  4II2 A;  1A3T A;  3G71 B;  2Q8R E;  4WFN 3;  4R8I A;  4X64 Q;  3ULP A;  4A93 G;  1PTO C;  4IUR A;  3CCQ A;  5BN5 A;  4KV6 A;  1J8I A;  3ISX A;  1XPO A;  2ZXI A;  3WXM A;  3MWY W;  3HOU G;  1KK0 A;  1DG1 G;  5J3B A;  1KTV A;  4IUQ A;  2XNA C;  1X3Q A;  5FLM G;  2E75 C;  3AVU A;  1CHP D;  2I5L X;  3U2Q A;  4HCS A;  3OMG A;  4N8X 1;  1W34 A;  3PEN A;  1HTP A;  1XMO Q;  4OWW B;  3A3G A;  1WTX A;  1PJ6 A;  2EYL A;  4DR2 L;  5JVG 3;  2QEX B;  4JOI C;  4A3F B;  2BM0 A;  1K8M A;  4JI3 Q;  4RCN A;  1XNQ Q;  4K1X A;  4H9G A;  1V1O A;  2K5H A;  1CQV A;  1GUS A;  1NUC A;  4RWS C;  4NP5 A;  3CP2 A;  3DUZ A;  4RLZ A;  3BG3 A;  1S4M A;  2CHB D;  2UUC Q;  2EY1 A;  2UUB Q;  2B63 H;  4G6I A;  5I6W A;  5IYW A;  1KTK A;  3S24 A;  3SKB A;  3AVT A;  1FND A;  1D1I A;  4TN1 A;  2BH8 A;  3FDT A;  2RVL A;  4TKO B;  1B4O A;  3WND A;  3CAM A;  5IGE A;  1C0A A;  4KK7 A;  3AVY A;  4ACA A;  1TWF B;  4LBY A;  2D0P A;  4Z1M A;  1CQX A;  1HZC A;  3Q6Q A;  4P1V A;  1ELO A;  1EQV A;  4LBV A;  2HCC A;  1TU2 B;  2SDF A;  3ZJY C;  4BA1 I;  1DON A;  3WNB A;  2K5D A;  3FPK A;  2V7W A;  5FO1 A;  2KHI A;  3K80 C;  2Q6L A;  3URY A;  2VQE L;  4UZF A;  1HR0 W;  1ASY A;  1V9P A;  3TP7 A;  4X7E A;  2F4V L;  3GTO B;  1JE4 A;  2DN8 A;  3RZD B;  2E5L L;  4PZ6 A;  4OO1 H;  4BY1 B;  2F0J A;  3S1R H;  1VLY A;  4JI8 Q;  2HHH L;  4U9U A;  3QIA A;  1PVO A;  5IWA Q;  2ZXH A;  2R92 B;  1I94 Q;  3TDQ A;  1S0U A;  3AB9 A;  4POF A;  3HG9 A;  4DNR B;  3OAA A;  1HXY D;  1PV4 A;  4WRD A;  1XPU A;  2EXZ A;  1QFJ A;  3QE2 A;  3C1E A;  3A54 A;  3GV3 A;  5CV5 A;  1E2W A;  4N9T A;  2CRV A;  3T13 A;  5IOD A;  1SNP A;  2VJI A;  2LFN A;  3A8J A;  4ZCI A;  1VQE A;  2VBV A;  1EIG A;  3NPP A;  2RSO A;  4H7B A;  5JEA J;  5GAH C;  3RZO H;  2NVX H;  4X07 A;  4IN3 A;  3BVZ A;  3MXN A;  1JJG A;  3NE5 B;  1GUW A;  1O7Z A;  1AP0 A;  5C5L A;  2GJR A;  1SJH D;  4YEJ A;  1XTC D;  3E9H A;  4FDB A;  2AQ1 B;  3CP0 A;  4X6A H;  5GV8 A;  1WP6 A;  2GRE A;  3T1H Q;  1EY4 A;  4LF5 Q;  2E2H H;  1IYJ B;  1LV9 A;  4NW2 A;  3ERQ A;  3HRZ C;  5FLX c;  3MTS A;  3BC9 A;  3RZO B;  2N78 A;  2KOL A;  1SNC A;  3H3V C;  1DM0 B;  4OHJ A;  1KIX A;  2B7C A;  4DV3 L;  4HN7 A;  4RD3 A;  1VQO A;  2R7D A;  1TS5 A;  3FKI H;  1NSN S;  1FX0 A;  3BJU A;  4RHS A;  4XTC S;  2NB0 A;  5EKK A;  5E3F A;  1QE6 A;  2NVY H;  1YNN D;  4UHV A;  2WAQ G;  2RDG A;  2DET A;  4GKK Q;  4KY7 A;  1PXU A;  5C3W A;  3G6J B;  1SE3 A;  2K33 A;  1RKN A;  2LKV A;  1GM5 A;  4WWV A;  4XQF A;  1Y14 B;  4LFC L;  1I94 L;  2IHE A;  4DR2 Q;  2XOK A;  2I07 B;  3MAQ A;  3H0G B;  2V7V A;  1JWM D;  2UUB L;  4ME3 A;  1E64 A;  3SEB A;  4C3I B;  2UXC L;  4HE6 A;  4A3E G;  2EE1 A;  4MZ9 A;  2ZM6 L;  4XLC A;  2KED A;  1GJR A;  1GHK A;  2DNC A;  3OEH A;  4BWG B;  3I4M G;  3VO2 A;  2PZW A;  1GO2 A;  3G6E B;  1Q12 A;  4AYB G;  3M7N A;  5CV8 A;  1I4G A;  3RLN A;  2YTY A;  4QUC A;  1GAW A;  1Y1V H;  1VQM A;  1PH9 A;  1SR3 A;  4YAL A;  3U4Z A;  4IPH A;  1Y0R A;  4FYD A;  4JI0 L;  1S5C D;  2OF1 A;  1JCK B;  2CH4 A;  4AYB B;  2P3M A;  5FO8 B;  3DEP A;  5M9O A;  2VNK A;  3VYS A;  4CKC A;  1BNZ A;  4M8A A;  5IGB A;  2SNS A;  1DAR A;  1ZXT A;  4LF4 L;  4KKU A;  3GVK A;  3K58 A;  4Y52 H;  1SJE D;  3PO3 H;  1VQK A;  2IL8 A;  3PIP 3;  2D3L A;  1GO3 E;  3HKZ G;  4GLA C;  1W6J A;  1PH3 A;  3GP7 A;  5I2X A;  4ZCM A;  1YIT A;  3SLD A;  1VQ6 A;  1HR0 Q;  2KBN A;  2JEB I;  3W2D A;  1D2E A;  2D2C C;  1YBY A;  4XN3 A;  1S4Z A;  1YJW B;  1BDO A;  4RKB A;  1Q86 D;  3B6Y A;  5I4D A;  4DR7 Q;  4RPD A;  5EKL A;  2VQF Q;  3A8I A;  3K0Y A;  1EP1 B;  2F0F A;  1H8H A;  1WCM H;  1VQJ A;  3RZD H;  1ZM3 A;  1Y0Y A;  1ESR A;  2GJK A;  1N08 A;  2MO1 A;  5FK9 C;  1BJK A;  3BYT B;  4B3G A;  4OO1 I;  2Q6O A;  1GKH A;  3D3R A;  1FD7 D;  2E2I H;  2LSS A;  4X66 Q;  1I6V C;  1DYQ A;  2ENB A;  3I91 A;  1DXM A;  2EPB A;  3JAM E;  3P20 A;  4P9S A;  4DR6 L;  2YTV A;  2K28 A;  5CGK A;  5C0X G;  2M9V A;  2ZBV A;  4NXN L;  1TTT A;  3I55 A;  2QMU A;  1XTD A;  2X3U A;  5D65 A;  3RD4 A;  4FWT A;  1JC7 A;  5H5J A;  3NBI A;  1CNE A;  1II3 A;  5LL6 X;  2B63 B;  1VQ7 A;  4RMF A;  1XMQ L;  4RCZ A;  1SYG A;  3K8A A;  1ASZ A;  4IUP A;  1RF2 D;  2CW5 A;  3CTA A;  4H13 C;  4QUF A;  3BZD B;  2YU9 H;  3JQR A;  2RKS A;  4LMQ D;  1H9J A;  1IKM A;  3VR2 A;  3G71 A;  4I7Z C;  1OXU A;  1VQF A;  4YAO A;  1MSG A;  1NDH A;  4O1N A;  4DQL A;  1A2U A;  1STN A;  5A88 A;  1PZJ D;  2AWN A;  3Q22 A;  5JVH 3;  3C46 A;  2ICE C;  3SXH A;  3QSY A;  1C9O A;  1FL0 A;  1I5F A;  2WKD A;  3OZW A;  1T5E A;  3JAM i;  1IHM A;  4BY7 G;  4UZU A;  3Q23 A;  4X65 L;  3BU2 A;  1VMC A;  4X06 A;  4XON A;  1QGZ A;  2F3I A;  3HOU B;  4HMI A;  1A15 A;  4YIJ A;  1VQP A;  3GTG H;  3DM1 A;  3O13 A;  1CFM A;  1I3Q B;  2SOB A;  5K5P A;  3HEJ A;  3EBE A;  1BLI A;  4OPS A;  1HQM C;  4M1U B;  4LBW A;  1I4Q A;  4XQQ A;  4DPG A;  3S9W A;  5M3F G;  1SEB D;  4A3K G;  3J7A F;  4JK1 C;  2FMM A;  1EP2 B;  1LLR D;  1KRT A;  4DXF A;  5FO7 B;  5F2D A;  2CND A;  3H94 A;  3NP8 A;  1VQL A;  5T1I A;  1F2Y A;  1BOS A;  1VQ6 B;  5E4X A;  5LMN L;  2MUY A;  1JOQ A;  1FYC A;  5BR8 L;  1NJI D;  1YJW A;  4OOS A;  4PAA A;  1D5X C;  4DAM A;  5KRU A;  4TMW A;  2F0D A;  4NXM Q;  5JJK A;  1WOR A;  5KEE A;  4DR5 Q;  2ZL5 A;  4A3J G;  4F8M A;  3BZC A;  1U9R A;  4FXK C;  4A3G B;  4AQY L;  2ZTD A;  2WR8 A;  3GTQ B;  3KEW A;  3F2D A;  1C7Y A;  4XLF A;  2L11 A;  1JQY D;  1QUQ A;  4K6L A;  1XE1 A;  2OCE A;  4OGQ C;  3WOF A;  3S2D H;  4OOX A;  4DXG A;  3I70 A;  4C2M B;  3C3L A;  2RHQ B;  2BV3 A;  2WZN A;  1OXT A;  2B8G A;  3FHW A;  2Q6I A;  2X8K A;  1PTO F;  3CMM A;  5EPL A;  3GV6 A;  1RD9 D;  4A4I A;  3U6K A;  1L0X B;  3ERO A;  1B9N A;  2EVB A;  5M3F H;  5AJ3 L;  1G7T A;  1EIH A;  1DOM A;  4LF6 L;  2GA4 B;  4Z4Y A;  3BVM A;  3IAY A;  4GZY C;  5NUC A;  2D5D A;  4JYA Q;  2QDX A;  1K8A C;  2DNE A;  2O5J C;  1SLJ A;  1MBY A;  1MIU A;  4Z4U A;  4AIM A;  2ZIT A;  1NCV A;  4YAW A;  3QR8 A;  3PUY A;  3A7L A;  1SYB A;  1N0U A;  1CK1 A;  4NMZ A;  3PUM A;  2ZJR A;  3F8T A;  4TSS A;  3OHX C;  5C44 B;  5HGT A;  3KDF B;  2A74 C;  1TY2 A;  2ZZF A;  4LFA Q;  3GTP H;  2VBT A;  1EOT A;  4XOP A;  2QTL A;  3NQI A;  1BCP F;  4LAA A;  3CQZ B;  4ACB A;  4RGO S;  3J81 L;  1X9N A;  1UAP A;  2I5M X;  2UXD Q;  3K7A B;  2YWF A;  2Y0S B;  4DK6 C;  1ICF B;  1L1O C;  4RD0 A;  1PDQ A;  2XIW A;  1U4P A;  2K4K A;  2QDL A;  3ES9 A;  4NKL A;  3K5N A;  1I4H A;  3TQY A;  1CSQ A;  4GNX B;  3CD6 A;  1W0K A;  1L1O B;  4O2D A;  2EFG A;  5FOB B;  2L9H A;  1YJ9 B;  2F0E A;  1VHE A;  4G1B A;  3K6O A;  3S2H B;  3QOL A;  1PYB A;  3U58 A;  4ZGN B;  1N36 L;  4LFC Q;  1KC8 D;  1F20 A;  1K3R A;  3S15 B;  4A3E H;  1E3X A;  4ZCL A;  2BF4 A;  4DNI A;  3VR4 A;  1XMO L;  4XYO A;  1TWG H;  5EPJ A;  1Y69 U;  2OTL B;  1PTO D;  3E3X A;  1LT6 D;  4ZRZ A;  4JI2 L;  1ZKO A;  1IXR A;  1EIY B;  1LT5 D;  1G7C A;  1VQI A;  4JVZ A;  3VMF A;  3H91 A;  3CCM B;  2A68 C;  5IYC H;  3GTL B;  1LUZ A;  1QWY A;  2WAQ B;  3PO3 G;  4LFB L;  1QH0 A;  4JBK A;  3OZV A;  3AFQ A;  1K8G A;  2X0K A;  2PZT A;  4HJ7 A;  2KEE A;  5LMN Q;  1D5Z C;  5A8A A;  2C2W A;  4NB3 A;  1UD4 A;  4X7C A;  1P8L A;  5K36 G;  3EJI A;  3PF4 A;  2HQE A;  3MEH A;  4LC0 A;  2D9U A;  1IBK L;  5EMN A;  2F0O A;  4HID A;  2F1M A;  2V31 A;  1NMG A;  1SN8 A;  1CZW A;  3VR3 A;  4RAU C;  1EU4 A;  3PUN A;  3M3Y B;  1ZEQ X;  2OTJ A;  5C4X G;  3CHB D;  3OW2 B;  1EYD A;  1ENC A;  1EFR A;  1JNY A;  1N06 A;  1C4Q A;  3TSS A;  1LTS D;  4Z4W A;  1NR2 A;  2QIL A;  1VQ5 B;  3M4Q A;  5LHY 1;  2R7Z H;  1QNK A;  3AVV A;  4G57 A;  1KDA A;  4X3U A;  1FNW A;  4ID6 A;  5IYN A;  1N32 L;  2VB2 X;  4V0B A;  2R93 G;  3TP8 A;  4XN0 A;  1TS4 A;  1BBU A;  3UE0 A;  1K0R A;  4IJH A;  3S1M H;  2X6W A;  4PGO A;  4IPD A;  3CCV A;  3E20 A;  1VQO B;  1XXG A;  1PJ7 A;  1E3Z A;  2JN4 A;  5CBE E;  4ZUJ A;  3LVB A;  2BH2 A;  1V0F A;  2R93 B;  2XND A;  1PLF A;  2QN6 A;  2DEU A;  4E6I A;  4K5W A;  2MO0 A;  2H1E A;  2DJF C;  3CB4 A;  2B39 A;  2N3S A;  1BR9 A;  4Y7C A;  3I56 A;  1R9T B;  3FP9 A;  3D26 A;  4CKE A;  3C2P A;  1CT1 D;  3PUX A;  1JOO A;  4ZQ3 A;  2PPB C;  4FXU A;  4UAI A;  4L5Q A;  4TMZ A;  1D6E C;  4WZT A;  3OTO L;  5K36 H;  4YHB A;  1Q9S A;  1EY8 A;  5L37 A;  2QEJ C;  2JDI A;  4C3J B;  3QFC A;  4PQX A;  5FLX L;  1EQR A;  1FVI A;  1VQG A;  3D8G A;  3OSO A;  4DKA C;  3I4N B;  1PH5 A;  2R7F A;  1E1R A;  1XJV A;  1GD7 A;  4J15 A;  3ER0 A;  1X3P A;  1VCI A;  2C78 A;  2Z6B D;  4NNJ A;  2F3W A;  2QW7 A;  4X62 L;  4OON A;  2NN6 G;  4DV5 Q;  1HA3 A;  5IWA L;  5E4W C;  5F4M A;  3V05 A;  4UY8 C;  2RSN A;  5J35 A;  1HZA A;  1H8E A;  2WII B;  3PIO 3;  1WFQ A;  5ELN A;  1PKV A;  1WTH D;  2R92 G;  3AEV A;  4H0L C;  3PIP A;  1EY7 A;  3Q8D A;  1VQN B;  1YIT B;  2NV4 A;  1G6Z A;  1X55 A;  4DV7 Q;  1KAW A;  1LO5 D;  3LQE A;  1Z7T A;  1RQP A;  5KNB A;  5J1Z A;  1QZH A;  1FNB A;  4RD1 A;  1NJI C;  1ONL A;  1HZE A;  3QG1 A;  4NXN Q;  4A93 H;  4NBS A;  1AE3 A;  2UXC Q;  1QG7 A;  5FKA C;  3V7A A;  5IGC A;  2WSS A;  4KJN A;  1K3B C;  4AF7 A;  1LT4 D;  2F0V A;  3OW2 A;  4DV2 Q;  1Q82 D;  1SFO B;  4OL7 A;  1G2T A;  1UEA B;  3NEL A;  3L2P A;  4KN4 C;  4B3F X;  2OYN A;  2IY5 B;  1NR4 A;  1D1K A;  4NPS A;  2JJQ A;  5IT9 c;  1TWH B;  1GUN A;  1GAQ A;  4X0C A;  2VNJ A;  2XWB B;  3E0J A;  4YHH L;  2Q2T A;  3J81 k;  1SYC A;  4K0K L;  1KK3 A;  4FK8 A;  1ILP A;  3P26 A;  2B2Y C;  5KIX A;  1YHA A;  4PAB A;  3DXJ C;  5IYP A;  1O80 A;  3S1Q H;  2V7Q A;  1B2T A;  2IX0 A;  3JQQ A;  2DOG A;  2NN6 H;  3CRK C;  4I7A A;  1IW7 D;  1QG0 A;  1VDZ A;  2HDL A;  4C1N K;  1STH A;  2A69 C;  1TUI A;  2F0U A;  2V1C C;  5JOB A;  3T53 B;  2I5H A;  2VW9 A;  2G9H D;  3W2I A;  4HJ5 A;  3J7A V;  1H85 A;  2OBS A;  1IHZ A;  1Y8P B;  1EY5 A;  1J9Z A;  1P16 A;  2CVR A;  4JI1 L;  3MXN B;  1WU8 A;  4A3B G;  1JE5 A;  1VQA A;  4AF6 A;  3SK4 A;  2RDF A;  2C4U A;  2X53 S;  2FIN B;  3CKI B;  5M5Y H;  1YZ6 A;  1N34 L;  3VO1 A;  1G8Z D;  3STB D;  4YCW A;  3MCA A;  3KF6 A;  1HZ9 A;  4IOA A;  5GV7 A;  4RHR A;  2R6H A;  1TWH H;  2JA6 B;  4POG A;  3LX0 A;  4UP9 A;  3ONU A;  4F87 A;  4TRD A;  1OXX K;  1PRT F;  2R3Z A;  1RDP D;  3OE7 A;  4DAY B;  1EOV A;  3OJX A;  3TRZ A;  3RN5 A;  4OPV A;  1B7Y B;  5I9P A;  2BVN A;  1PMR A;  4WJ4 A;  1BBX C;  3KL9 A;  5CBA E;  3D6C A;  3F2B A;  2JA7 G;  1G7R A;  3KBG A;  5CMD A;  2E2J B;  2AUK A;  4HCE A;  4RDJ A;  2F0M A;  5EQ0 A;  3A5U A;  5IGD A;  2JA5 G;  5C44 G;  2MQH A;  4DV0 L;  1F77 A;  1H9S A;  1XX8 A;  2NZO A;  3PMF A;  3BY2 A;  3H0G H;  2OXP A;  2RDH A;  3IFT A;  1EY9 A;  1U4L A;  3CCQ B;  2JSO A;  4DR7 L;  3ZZ0 A;  2BGJ A;  3OEE A;  5KYI A;  5HXB A;  5G3L F;  3TZU A;  1GHJ A;  1IBM L;  4C3J G;  2NVY B;  3VNV A;  2NVQ B;  4FO2 A;  2R92 H;  4BBS H;  5IYQ A;  4DV7 L;  2DIE A;  2A6E C;  3KF8 A;  2EYM A;  2V4D A;  1STG A;  3CMA B;  1S5F D;  2D3N A;  2PE3 A;  2W6J A;  2X6Y A;  1CUK A;  1V1P B;  1QUF A;  5IP7 H;  2MFI A;  1W3S A;  1XFO A;  3QJY A;  1CA5 A;  3KOJ A;  5ELB A;  3J7Y W;  3T1H L;  1LM0 A;  2WB1 E;  5D3I B;  5ISR A;  4XOT A;  3R2I A;  5CV7 A;  3J80 L;  2E2H B;  2OT2 A;  4ODG A;  4EQN A;  2PW7 A;  2Q2I A;  4YEL A;  4MTK A;  3TN2 A;  2R7Z G;  4ILW A;  4CJ2 C;  4L5T A;  3MZ5 A;  4Y7N H;  1UD2 A;  1SMX A;  5CR3 A;  5C6A A;  2R93 H;  4XQJ A;  4IFD H;  2F03 A;  3AVX A;  1PA6 A;  1PYS B;  1NMF A;  4M0L A;  3ZZU A;  1Y1V B;  3CPF A;  3TP6 A;  3SE0 A;  4LUO A;  1E1T A;  3W5O A;  4BY7 H;  1QX4 A;  3Q39 A;  2XGJ A;  1BVS A;  4QIW E;  3S16 H;  2HHH Q;  3W2H A;  5LMU L;  3J81 j;  1UD6 A;  4B4D A;  1K8A D;  3VYU A;  5HZA A;  2E74 C;  4EGV A;  3CCE A;  1PRT D;  2ATW A;  3CRZ A;  4TVA B;  3MFG A;  4YAU A;  3GQB A;  3DLL A;  4NCN A;  4A3F H;  4GKK L;  4Y7N B;  5BN4 A;  1D2B A;  3SR1 A;  4MIU A;  5A89 A;  2K04 A;  4DV1 L;  4A3G H;  3LNN A;  1UEB A;  4GS3 A;  4IUT A;  4RKL A;  3JQP A;  3G4S B;  1HPC A;  5I2Y A;  2X69 A;  2Z9H A;  3M3Y H;  4GLX A;  1BX1 A;  2Z4H A;  1DOL A;  3TZD A;  1PFM A;  1PFN A;  3WDN A;  3HOX B;  5C0X I;  2WAQ E;  1Q1E A;  1GUT A;  2E1B A;  3FPP A;  1ZUN B;  1HVX A;  4XM3 A;  5HKK A;  1HTL D;  5C3E B;  4KY5 A;  1IYV A;  2KQ3 A;  3KBX A;  4LWC A;  1CHQ D;  1E43 A;  3E9I A;  4LF9 Q;  2NVQ H;  1HUN A;  3OTO Q;  4IFD G;  5M3F B;  1EZ8 A;  5TSS A;  1I3Q H;  4G7Z C;  3J80 i;  1NE3 A;  4WZE A;  4PMW A;  1YX2 A;  1WJJ A;  2EQS A;  3AQQ A;  3RLO A;  3T56 B;  1EYG A;  3M4O H;  1RL2 A;  1H42 A;  1KD1 C;  2A6H C;  2XNC A;  4GQN A;  2L1B A;  5AFW A;  2R9V A;  1Q1B A;  1G2S A;  2E1R A;  1IBL L;  5C5M A;  2B5O A;  5IP9 H;  3PO2 H;  4JPB W;  4A3F G;  1YHQ B;  1NBM A;  3H09 A;  2JA8 H;  2PNH A;  5DM6 3;  3TRE A;  4PC3 A;  4DF7 A;  3GTQ H;  1JB9 A;  4BA2 I;  4DV5 L;  4IOC A;  4JC0 A;  1BF4 A;  4C2M H;  3ZUG A;  4IUV A;  4QHY A;  1ZM4 A;  2VZL A;  1XQB A;  2RBM A;  3FJO A;  3P75 A;  1XNQ L;  1CKN B;  2PIA A;  2VBS A;  1BX0 A;  4QV2 A;  1QJO A;  4QY7 A;  4GNX C;  4XQN A;  4IO9 A;  5FA6 A;  3HOZ H;  3PVD A;  2XRS D;  3W1G A;  4DN4 M;  4XT1 B;  1SYD A;  1N33 Q;  4ZUI A;  1F9Q A;  1BPL A;  1X6O A;  3MXG A;  3KUP A;  2XN9 C;  2EOT A;  2K5V A;  3BDC A;  3CCR A;  5ELC A;  5IP7 G;  3S17 B;  1QIL A;  3SHL A;  4LF7 Q;  1MJC A;  1Q46 A;  4JI5 Q;  1EY6 A;  2X6L A;  1W9X A;  1XNR Q;  4RD6 A;  2CWA A;  3DWP A;  4RFB A;  4K0K Q;  4HIK A;  1KMH A;  4JI7 Q;  2HMA A;  1QNU A;  4DR4 Q;  5F4O A;  4LFA L;  2VJJ A;  4ZYS A;  4Z9C B;  5E7N A;  4JI6 L;  3I56 B;  1TT2 A;  4EQO A;  3PQI A;  1A2T A;  5FNZ A;  1DZ1 A;  1CQF A;  3QFR A;  2UXD L;  2CKZ B;  1WTP A;  4KLK A;  3HOZ B;  4IQZ A;  2KCM A;  3ICE A;  3P7J A;  4CBV A;  5A2Q L;  2HDN B;  3S1Q B;  4P71 A;  4DV4 Q;  4QFM A;  3HKZ B;  3S2D B;  3ZZT A;  2BOS A;  1VQK B;  1W0J A;  3J7Z C;  1TQO A;  4LF6 Q;  4DAV A;  1PH2 A;  2UXB L;  3HOZ G;  4QQB X;  1X65 A;  1UMK A;  4KJO A;  2C77 A;  4B9W A;  2NTT A;  1L0Y B;  3A8J E;  2F0W A;  1TR5 A;  2YTX A;  1XYI A;  3WOE A;  1G29 1;  3HS0 C;  4LUZ A;  5IYC G;  1WTO A;  2UUC L;  1G91 A;  2BA0 A;  3NUC A;  2WYR A;  1PYW D;  1TY0 A;  4RGN A;  1Q7Y D;  1BCP C;  3PA2 A;  4UP7 A;  4DR6 Q;  2FXQ A;  5JAV A;  1K9M C;  4F7D A;  3ASQ A;  3KDF A;  4GOP B;  3G48 A;  1KQS A;  3QWN A;  4P3Y A;  1EZ6 A;  4J0Q A;  2HD3 A;  1ET9 A;  2RF4 A;  3TS0 A;  4E0F A;  3M9B A;  4YHH Q;  4Z4R A;  2C5B A;  1Z9F A;  3A35 A;  1EUJ A;  2EJM A;  2K05 A;  2O4X A;  3OIQ A;  2B29 A;  4LF9 L;  2NBF A;  3I2Z A;  5JEA G;  2EY2 A;  2GQF A;  5M5X B;  4AH6 A;  3Q24 A;  1EFT A;  2PI2 E;  3GTG B;  1VHO A;  1IBK Q;  4NXM L;  3IKJ A;  5EAY A;  1Q81 C;  4HJA A;  3AST A;  1S72 B;  2EY6 A;  2VL6 A;  3B82 A;  2HCJ B;  4P75 A;  4AQY Q;  5M3M B;  1QFZ A;  3PUZ A;  4RGM A;  1VQ7 B;  2Y0S E;  3H0G G;  4M4S A;  3V96 A;  4XKW A;  5A2Q E;  1U2R A;  2GK6 A;  5KGU A;  4KKS A;  4HJ8 A;  4GKJ L;  3CCJ A;  2CQA A;  1HNW L;  1VQ8 A;  2J0T D;  1QGA A;  4C3J H;  2CBX A;  3A8I E;  5DEH A;  3I72 A;  5DSZ A;  3BY1 A;  3CCU A;  1ZM2 A;  2AQ3 B;  1JJC B;  1TS3 A;  5CDF A;  2JEA I;  2NZ1 D;  3HKZ E;  3RN2 A;  3OWF A;  1JOK A;  3RLF A;  1QVF A;  2QA4 A;  2CFM A;  2PNR C;  2A8V A;  5GAG C;  4LF7 L;  3R6K A;  1V1Q A;  1NY4 A;  4DR1 L;  1A63 A;  1RHP A;  4DV6 Q;  2HT1 A;  3I73 A;  3AMU A;  3AGQ A;  3QFS A;  2JA5 B;  3A5Z B;  1Q82 C;  2YWH A;  4R4O A;  1KK1 A;  1FNM A;  3T4A C;  1A8V A;  3LWU A;  2KCN A;  4O0A A;  3FMC A;  4KHP Q;  1UWV A;  2F0I A;  5DN6 A;  5LMZ A;  4B3T L;  2NZH A;  2XZL A;  3KF6 B;  4I65 A;  5C3E G;  1EWY A;  5IT9 L;  4PMC A;  2SEB D;  2ZTE A;  2XZO A;  4APV A;  4Z4S A;  1CTM A;  1AIP A;  3CCS A;  4GN3 B;  2BE5 C;  1I4P A;  2EY5 A;  4IAL A;  3ASS A;  3EQL C;  3A8K E;  1N32 Q;  1T6X A;  5ELO A;  5IT9 E;  4A3C G;  3QB3 A;  2CC2 A;  2JN9 A;  2C5H A;  2FHT A;  3IL8 A;  4HR7 B;  3U6B A;  5LMN W;  4MHE A;  1X3F A;  1UE6 A;  2CF4 A;  4KN7 C;  2WB1 B;  4BY1 G;  2KHS A;  5C0X H;  3J81 i;  4A3I B;  1SXT A;  4DAY A;  1C8C A;  2B63 G;  4MTN A;  2EYF A;  1AH9 A;  3DMU A;  1R5B A;  1UE1 A;  3D4D A;  4GOP A;  2X85 A;  2EIF A;  4DR3 L;  1LAC A;  5A35 A;  2KCC A;  5EBC A;  4FF3 A;  2VYQ A;  3KJP A;  4UP8 A;  2BSA A;  4TMX A;  2K01 A;  4ASU A;  1LTI D;  3OJW A;  4B3X A;  4RDL A;  2BN4 A;  4X66 L;  5KNL A;  4Z4T A;  3CC4 A;  4Q0F A;  4XLE A;  1SMY D;  1MJE A;  4BXX H;  2BM1 A;  1BCP B;  2D0O A;  1I18 A;  2UU9 Q;  1HA5 A;  1D5M C;  1N34 Q;  3SDZ A;  1YI2 B;  2NWG A;  3K5M A;  3A3B A;  1UD5 A;  4LBZ A;  5GAE C;  1HHV A;  3CES A;  1WSV A;  5ELE A;  5IYR A;  2IW3 A;  4OIK A;  3CXC A;  2C9O A;  5F4J A;  4L63 B;  4FF4 A;  1JJ2 A;  2F3V A;  4OOV A;  2ZJQ A;  4IUU A;  4DK3 C;  4RDK A;  1MI2 A;  5KYL A;  5FO9 B;  1YEZ A;  2DUD A;  4B3T Q;  4XMY A;  3W2F A;  2AWO A;  5D3D A;  3CPX A;  1KL9 A;  1HR0 L;  3PO2 G;  3BNW A;  1KNE A;  4QGU A;  1SMY C;  3ITP A;  2LXJ A;  2Z0S A;  1PTO H;  2EZV A;  5JPM C;  3L7Z C;  1C48 A;  2F52 A;  3PIO A;  3S1R B;  4BY1 H;  5FJ8 G;  1ESF A;  2EYO A;  3NWS A;  4RH6 A;  3BDO A;  1VQ4 A;  4C1N I;  4JI8 L;  4OEM B;  2A69 D;  2VY3 A;  2Z4I A;  1WTV A;  1YNJ D;  1V0E A;  4P6Y A;  4B9X A;  2F0K A;  4A3J B;  4PZ7 A;  2YYZ A;  1FGU A;  1SKQ A;  3KLW A;  3UDI A;  5FIU A;  2TMP A;  2WZP P;  3NTI A;  4ME5 A;  4YCU A;  2EJF C;  4K5X A;  2G9D A;  2WV6 D;  1IYU A;  3TME A;  1WVL A;  3CC7 A;  5C4Z A;  3Q6R A;  2EIX A;  4HED A;  2Q8T A;  2ZBU A;  2K5W A;  3CCL A;  4RM0 A;  1PRT B;  2PQA A;  3DWQ A;  5EBD A;  3SK5 A;  1EYA A;  2WP8 J;  3KFU A;  1N07 A;  2F0T A;  5M5X H;  2F4N A;  4X7D A;  4N3G A;  3AFP A;  5IYD H;  4N3N A;  1J5E L;  4C3H B;  4B3R L;  1BQE A;  2FVG A;  4EQ5 A;  2OTL A;  1Q90 A;  3GVL A;  2QDB A;  1S40 A;  3ASP A;  1QUE A;  1WSR A;  2QF7 A;  1GVH A;  3PSI A;  1B8A A;  1AE2 A;  3WWV A;  2ZJP A;  1NNX A;  1SFO H;  1ZM9 A;  4G7H C;  4WOR A;  3I4M H;  3I4L A;  2VQE Q;  2JA7 B;  1V8Q A;  4B43 A;  3CC4 B;  4QUZ A;  2BDO A;  4A3G G;  1VQC A;  3K81 C;  3W5H A;  2VZA A;  4DUZ L;  4AC9 A;  1M90 D;  4JOI A;  4HIM A;  5CV9 A;  2PMZ E;  5BSX A;  1WD0 A;  3G7L A;  1STE A;  1KAA A;  3G05 A;  1SSO A;  2XVS A;  4JG2 A;  3CD6 B;  2F4I A;  4PG3 A;  4GNX A;  1JA0 A;  2VUM H;  5M3M G;  4U67 3;  2NPF A;  2I1L A;  4C3I G;  2CQO A;  2Q2H A;  1HQR D;  1LAB A;  4OO1 G;  3NHH A;  3B8H A;  3DM3 A;  4ALP A;  3JC6 6;  1DDG A;  2RC6 A;  3H9N A;  1SAP A;  2EYJ A;  1IBM Q;  1IL8 A;  1FJG L;  3AU7 A;  1AZP A;  2ZM6 Q;  3WQZ A;  4DFA A;  4JYA L;  2Q8I B;  1VQ9 B;  3GTJ B;  2AQ2 B;  4YY3 Q;  1BBW A;  1LTR D;  1VQH A;  3GTM H;  2IX1 A;  5IYD G;  2BGI A;  3HOY B;  4A3M G;  1B50 A;  3ERS X;  1VS0 A;  3F1Z A;  2EJG C;  3OKX A;  1I8D A;  4OWX B;  4JI7 L;  4DR4 L;  2B2U A;  4QVJ A;  1BQQ T;  1K28 A;  1BXT A;  3D4W A;  2HQL A;  4YWM A;  4J6H A;  1TKW B;  3ULL A;  3ZIA A;  1GUG A;  4P74 A;  4FF2 A;  1GJX A;  3HOX H;  4KI0 A;  2AHO B;  1R9T H;  4K14 A;  2A73 B;  4LF4 Q;  3EFX D;  4A76 A;  4HE5 A;  1A0I A;  3NBH B;  3P1H A;  1Y1W H;  2RC5 A;  1LTT D;  2IJ0 A;  3CCR B;  3PA1 A;  3ONA B;  5HUR A;  2HLD A;  1TWC B;  3I4O A;  1YLO A;  1S72 A;  1VLO A;  1F9P A;  3X3M A;  2LXK A;  2PQA B;  4FXG C;  1IBL Q;  3RY8 A;  3KK7 A;  3S1M B;  4TT3 A;  1A3U A;  3FKI G;  3OMC A;  5B6I A;  4G4K A;  3M4O B;  4JI1 Q;  2IPK D;  2PMZ B;  3DDY A;  1M8A A;  2XSC A;  3HKS A;  1K73 C;  2I0Q A;  2OWO A;  4V19 0;  4P6V F;  5IK2 A;  3PO2 B;  1O7L A;  1F2M A;  4PV1 C;  3WY9 A;  1GVP A;  3S14 H;  1Q8I A;  4QMG A;  2K1B A;  1M4V A;  2XNJ A;  4X7F A;  2A68 D;  3DEO A;  3OYY A;  3GD7 A;  5C3E H;  2VNU D;  1B53 A;  3BCF A;  2LY7 A;  1VQN A;  3WBK A;  3J80 c;  5FO0 A;  1SE8 A;  4O42 A;  1S5E D;  1WOC A;  2RCN A;  2UUA Q;  2E76 C;  3EVQ A;  1QVG B;  1FNU A;  2BCO A;  2Q6K A;  2MGS A;  1VF5 C;  1STY A;  4K2L A;  1P4M A;  3U50 C;  1F2L A;  5C4J B;  2R6G A;  1WCM B;  1EYC A;  1Y1V G;  2EDG A;  4BBS B;  3D0F A;  1K0S A;  1N9W A;  2E5L Q;  4TSF A;  1IW7 C;  2F0P A;  5IGG A;  4PMB A;  1Q81 D;  5HY6 A;  4DUZ Q;  2A5H A;  2LS0 1;  4XLH A;  5AN9 A;  1AFP A;  4FP5 D;  1SKY B;  2XZP A;  3ND8 A;  1SNO A;  2JK8 A;  3J81 c;  1SND A;  4CDC C;  1TII D;  2JA8 B;  3QO2 A;  4IPC A;  2E2J H;  3I4N G;  3NEN A;  3S2H H;  2OQ0 A;  2D62 A;  2WAC A;  1HRJ A;  1UNS A;  4ZLT F;  3Q0A A;  3PGZ A;  2F0L A;  2EXD A;  4C3H H;  1EWI A;  1FGB D;  1VQL B;  3CCJ B;  1Y8O B;  3L0O A;  4LF8 L;  3ASR A;  2DGY A;  4JBM A;  1KD1 D;  3M85 A;  2MPM A;  4A3L G;  2B2T A;  3VYR A;  1XMQ Q;  1Z47 A;  2P5Z X;  1XPR A;  4H02 A;  5M5W B;  1EEI D;  1T6Z A;  3HP3 A;  5CC4 A;  1L1O A;  4H44 C;  4K8I A;  4A3M H;  2FMC A;  3RNU A;  2ICI A;  4EQP A;  4G1V A;  2JA6 H;  4GLV B;  2M00 A;  3G6E A;  1LTA D;  3OOC A;  3X3N A;  4DGZ A;  1QUQ B;  5J39 A;  3W2G A;  3KLR A;  2D9R A;  3U9O A;  4YXW A;  5CV6 A;  3CPW A;  4A3C H;  1X3E A;  3FEW X;  5C0X J;  1TVC A;  5TY0 A;  2WJY A;  5FJ8 H;  1Y1W G;  4FVM A;  2DY1 A;  3K57 A;  1NTG A;  1H9M A;  2GK7 A;  4QF4 A;  2L5T A;  1E0B A;  1I50 H;  2ZXP A;  1Q3L A;  1DDI A;  1HFG A;  4B3S Q;  4JV5 Q;  5HZB A;  3OZU A;  5J3O A;  2JJ2 A;  1JIC A;  3OWE B;  4ULL A;  5JJI A;  1IL2 A;  1EY0 A;  1W87 A;  1GUO A;  5IE8 A;  2JIZ A;  2Z6K C;  2VXW A;  1PH1 A;  3S16 B;  1N33 L;  2F0H A;  1N05 A;  2H4O A;  4P25 A;  3D31 A;  1TS2 A;  1K83 H;  3RR5 A;  3AYH B;  4GOP C;  4XR6 A;  1EEF D;  3ND9 A;  4BBR H;  5IOC A;  3OPO A;  3D4R A;  3BDL A;  3Q6S A;  2JA5 H;  1ICW A;  3ULJ A;  2FFK B;  4Q5V A;  3UDG A;  4JBW A;  4XNF A;  4IJL A;  4RPB A;  2B7B A;  1E24 A;  5IP9 G;  4JI0 Q;  1CM9 A;  2OK7 A;  2VNH A;  2O2L D;  1S5D D;  3CRL C;  2VB3 X;  3IRB A;  4HMJ A;  4P26 A;  2A19 A;  1STB A;  1YHB A;  2QEX A;  4JMQ A;  1BCP D;  4L5R C;  4KKT A;  1KDC A;  1BMF A;  1F2Z A;  1AN8 A;  5C4X B;  4IW3 B;  5COR A;  4J1M A;  3HOV H;  4DNT B;  4A3B H;  2DY8 A;  2OBT A;  3T1Y L;  1HNZ L;  1A3V A;  1WOP A;  1V43 A;  5CV4 A;  1W2B A;  4Z4V A;  2HIX A;  3CME B;  2V7X A;  3TS2 A;  4QL5 A;  4CDD C;  5M5Y B;  2CH4 W;  1G7S A;  4Q7J B;  2RCF A;  1JJ2 B;  2M2L A;  4RA8 A;  2HIV A;  4ZGQ B;  1OO9 B;  2H5X A;  5M3M H;  3HOU H;  1IKL A;  3NQT A;  1WYD A;  1LTL A;  4XDX A;  2GJP A;  4B47 A;  1AW7 A;  1R4Q B;  4S3S A;  3LQ6 A;  3K7U C;  2ES2 A;  2FJ2 A;  5JBQ A;  1KLG D;  1OXV A;  1X3G A;  1TWF H;  2KEC A;  4A3B B;  3ZBT A;  2RQX A;  4R4C A;  3SJZ A;  4B44 A;  2B2Y A;  2NYZ D;  4BBR G;  1CSP A;  2IT1 A;  1B3A A;  4RJL A;  5JPN C;  4RD4 A;  4DQK A;  4KHZ A;  3H6M A;  1MGS A;  3KLS X;  4M2L A;  4B3R Q;  4M53 A;  4OP7 A;  4ZV4 A;  4IPG A;  4ZCK A;  1VQ9 A;  4CDF C;  3BQJ A;  4IFD I;  3SEJ A;  2PYK A;  2LZJ A;  2QGG A;  4CJ1 B;  3OIP A;  3CW2 A;  4Y9U A;  1TXY A;  2BPO A;  1U4M A;  1WPC A;  1E79 A;  3CP8 A;  2AKW B;  2ZZQ A;  3CCL B;  3NTH A;  5IIF A;  1MAB A;  2JJ1 A;  1N8R D;  3VA5 A;  2ZXO A;  2BMW A;  3CC2 B;  2L55 A;  5IY0 A;  1K83 B;  1DJR D;  5FLX E;  1QGY A;  1Y8N B;  3STB C;  3UI2 A;  4RCO A;  2ASB A;  1WTR A;  2JQO A;  1GR1 A;  2MJ8 A;  2OQK A;  1OB5 A;  2E2I B;  4KHV A;  3KYH C;  4C0S A;  4DR3 Q;  1UE5 A;  4RG1 A;  4B3M L;  1SNQ A;  1Q86 C;  2R7Z B;  1UD8 A;  1Z6H A;  1I50 B;  3NTK A;  1PZK D;  3E6Z X;  4R71 A;  1N8R C;  4PC1 A;  1EWC A;  4A3I G;  2X6X A;  3C1F A;  1EQQ A;  2QCP X;  1HUM A;  4HJ9 A;  2HCI A;  5EKI A;  2UU9 L;  1KRH A;  1JB3 A;  3S1N H;  3S17 H;  1UE7 A;  2A1A A;  1SNM A;  1WI5 A;  2K75 A;  3NWT A;  1N0V C;  1WTW A;  1L2F A;  1ZYR C;  4XXE A;  4Y9R A;  1KRS A;  2Z8L A;  3PO3 B;  4C56 C;  2Q2U A;  4MYU A;  4PZ8 A;  5C3X A;  4WQM A;  1PH4 A;  2O5I C;  3F2U A;  4P22 A;  4R1J A;  1JA1 A;  4QB4 A;  1W2B B;  2F1L A;  1RTN A;  3Q38 A;  5J22 A;  4X05 A;  2K52 A;  3UDF A;  1YJN B;  3RMH A;  4WJW A;  3I8Z A;  4N9P A;  1T5X D;  3MXU A;  1CZG A;  4A93 B;  3T16 A;  1TWA H;  5IGF A;  1Q7Y C;  3A56 A;  3W2E A;  1D8T A;  1JT8 A;  4F88 A;  4BY7 B;  1JMC A;  1ROD A;  3T1Y Q;  1QCB D;  1HNZ Q;  1SYE A;  2WB1 G;  1AZQ A;  3S15 H;  1QFY A;  1E22 A;  4AYB E;  1A8P A;  3A55 A;  1WOS A;  4WJ3 M;  3MA2 B;  2ID0 A;  5THX A;  2B8F A;  1KK2 A;  4JI4 L;  3A7A B;  4JW0 A;  3UDX A;  1VQM B;  1HJP A;  2B2T C;  1YNN C;  4U68 A;  1KAB A;  3F2C A;  2VBU A;  3U9S A;  1MHW C;  3M4P A;  4X62 Q;  4DV1 Q;  3B78 A;  2KJX A;  2NTS A;  3LGJ A;  3H3V H;  1FRN A;  1BO0 A;  3CCV B;  1GOZ A;  3LWE A;  3PV0 A;  2QKI C;  1E2Z A;  5DM7 3;  4HSP A;  5T1G A;  5DS0 A;  3BYY B;  3J81 E;  4P12 A;  3SVM A;  2E2D C;  3FRP B;  5L46 A;  4A3D G;  2DYI A;  3WBJ A;  1GXD C;  1EL0 A;  1K28 D;  3CXC B;  2B2V C;  3HGB A;  4X8I A;  3CC2 A;  2QTZ A;  5DNF A;  2L4N A;  2QE7 A;  3I1F A;  4JI6 Q;  5H1S E;  1YNX A;  3R2T A;  1WD1 A;  3U4V A;  1IB0 A;  4DV2 L;  4A3D B;  4WZK A;  1H9S B;  1OGI A;  3QFT A;  1QVC A;  3PUW A;  1WTH A;  1FDR A;  1X56 A;  4RD2 A;  2NVT H;  3MMP A;  3T51 B;  2ALY B;  4CQJ A;  4RGT A;  2WKC A;  2N49 A;  1NAP A;  1PH8 A;  4A3K H;  1XB2 A;  4OX9 Q;  3LO8 A;  4MYT A;  2UXB Q;  4BBR B;  1ILQ A;  3K59 A;  4B48 A;  4P73 A;  2VUM G;  3KF8 B;  3MC0 B;  3ZC3 A;  3CMA A;  4GN5 A;  2F0Q A;  3E0E A;  3R8B A;  4MNO A;  1M90 C;  3ONY A;  1VQP B;  1HNW Q;  1E3P A;  2V7U A;  2B2W A;  3SLN A;  2DER A;  1MSH A;  1RJT A;  4QIW B;  1HFN A;  1TWA B;  1EP3 B;  2PMD A;  1KZL A;  1F9R A;  2M5S A;  4ZAI A;  4JI3 L;  5AJ3 Q;  4A3D H;  4N8F A;  3FKS A;  2BE5 D;  1I4R A;  4MN3 A;  1J9O A;  2HUG A;  4Z4Z A;  1E7Z A;  1LYL A;  1J5E Q;  2OEO A;  4L5S A;  2NVT B;  2N88 A;  3MEF A;  2ZL7 A;  3J7A 5;  3GTO H;  4PNY A;  4CGY B;  4A75 A;  3CU7 A;  3R93 A;  3K5O A;  4DV6 L;  3CCU B;  1R4P B;  3CF5 A;  3PF5 A;  2JYO A;  3GTP B;  3MXP A;  4P2N A;  3UE1 A;  1WDT A;  4A3M B;  4K6D A;  1KQS B;  1S5B D;  1B44 D;  3CCE B; 
#chains in the Genus database with same CATH homology
 3GTM B;  2B2W C;  1NRK A;  3N52 A;  2F0G A;  4ZK9 B;  4R9W A;  2EYP A;  1O78 A;  4K2K A;  2L12 A;  1CA6 A;  4XLA A;  2K03 A;  3FVQ A;  2F0N A;  3OW7 A;  3L3O C;  4BS9 A;  1KNA A;  1SYF A;  1A6X A;  5ELD A;  5JJZ A;  4OIJ A;  2I46 A;  4NDX A;  4A3K B;  2XRQ D;  3MHB A;  3NXW A;  5G3L D;  1EFI D;  4XYQ A;  1ENA A;  3QOJ A;  1V1P A;  3KLS A;  2IX3 A;  3I4M B;  1U4R A;  1FR3 A;  5JEA H;  1HA6 A;  3M4Y A;  1MD2 D;  3S1N B;  1LTB D;  1JWU D;  1B1Z A;  1CI3 M;  2B2U C;  1PFB A;  5DAU A;  2AUJ D;  4XKV A;  1XWE A;  1ZYR D;  3NBH A;  1K8O A;  1UD3 A;  3JAM L;  4P2C B;  4CHT B;  3L9A X;  1EU3 A;  3N6R A;  1KDB A;  4XOR A;  1DCZ A;  1I4X A;  2KUM A;  4UDU C;  2BA1 A;  4DAP A;  5D14 A;  4CKB A;  3HOV B;  3MFY A;  2K5Q A;  2PO4 A;  1RTO A;  2SNM A;  1COW A;  2K7V A;  3E5S A;  2CW0 C;  1JOR A;  1F9S A;  2LMC B;  4G7X A;  4F7X A;  4K8J A;  4LK1 C;  4FXD A;  1VMP A;  3GVJ A;  2TSS A;  5EGT A;  2A6E D;  2MP1 A;  1W6K A;  3D6W A;  3NSW A;  1BUV T;  1LTG D;  3HZX A;  3GTK B;  2CK3 A;  4KD3 A;  5EJW A;  1SE2 A;  4X3S A;  3SK6 A;  3PUV A;  4IUN A;  2ZZE A;  1X32 A;  3NK9 A;  4G7W A;  4ABN A;  1TVX A;  3HOW B;  5CYU A;  3TBI B;  4L6T B;  4HSV A;  2VUM B;  2JXM B;  1B9M A;  3W3A A;  4QCL A;  1PTO B;  4HTH A;  4B08 A;  4EVO A;  1SE4 A;  5I9O A;  4KMU C;  3VA7 A;  1QB5 D;  1VF7 A;  1WTQ A;  2HDM A;  5C4H A;  2EYH A;  2ZTN A;  3ZYY X;  3ZPN A;  4IFD J;  3GO5 A;  3VYT A;  2Z1C A;  1LT3 D;  1RCV D;  2KA7 A;  4K5V A;  2ZT9 C;  1YNJ C;  1QOH A;  4XL9 A;  4DK0 A;  1PRT C;  1H9K A;  4DK1 A;  3J80 E;  4DA2 A;  4C3H G;  2XWJ B;  2C5C A;  4FF1 A;  4LJZ C;  2F0S A;  1ENF A;  5KND A;  5KNC A;  4TQU S;  3VR5 A;  3BS1 A;  1KLU D;  3I3C A;  1PZI D;  4XT3 B;  2F43 A;  4ZKB B;  3BVG A;  3BCD A;  1SDF A;  1OXS C;  4DU9 A;  1H9R A;  2KVO A;  3FKI B;  2NUC A;  1UUP A;  1ML0 D;  3MVV A;  2R61 A;  2WPD A;  1FNV A;  2PW5 A;  2B2V A;  5COY A;  3HAG A;  5FL7 A;  4X3K A;  3DHQ A;  5ELF A;  3K5L A;  4A3E B;  3FPU B;  3BH4 A;  2JP1 A;  2PCF B;  2BDN A;  4R8N A;  2J7Z A;  2K6A A;  1OHH A;  4J8Q A;  2NN6 I;  2PZU A;  4CJ0 B;  1STA A;  1Y1W B;  2JE6 I;  1O7Y A;  4X3T A;  3EA6 A;  1ET6 A;  4II3 A;  4XIG S;  3R3O A;  4KD4 A;  4ZKC B;  1HCZ A;  1SBB B;  3VR6 A;  4HIZ A;  3I90 A;  2PQE A;  1E1Q A;  1JR0 D;  2ZZG A;  3OFN A;  2ZTG A;  2CW0 D;  3M7G A;  1TWG B;  1DD2 A;  3RUZ A;  5LL6 S;  2J4X A;  2MHV A;  3JU4 A;  5BN3 A;  4FNF A;  5EPK A;  1OB0 A;  3V2T A;  1EQT A;  1EWH A;  5I6Y A;  2NVX B;  4G7O C;  2KVM A;  2W6I A;  4KY6 A;  4XD7 A;  2YU9 B;  2ZXR A;  2K32 A;  1E2V A;  2N55 A;  4IZ8 A;  2A6H D;  2L0C A;  1VJS A;  5E1F A;  1AEX A;  2DY7 A;  2RA4 A;  4L8J A;  4HAE A;  2WJV A;  1JWS D;  2IWH A;  2X6G A;  2WIN B;  3IFD A;  3DWA A;  4KTA A;  3SK8 A;  4AVZ A;  1I6H B;  3S14 B;  1DOK A;  3TP5 A;  4II2 A;  1A3T A;  2Q8R E;  4WFN 3;  4R8I A;  1PTO C;  4IUR A;  5BN5 A;  4KV6 A;  1J8I A;  2ZXI A;  3MWY W;  4IUQ A;  2XNA C;  1X3Q A;  2E75 C;  1CHP D;  4HCS A;  3OMG A;  1HTP A;  3A3G A;  1WTX A;  2EYL A;  5JVG 3;  4A3F B;  1K8M A;  4RCN A;  1V1O A;  1CQV A;  1GUS A;  1NUC A;  4RWS C;  4NP5 A;  3CP2 A;  3DUZ A;  3BG3 A;  2CHB D;  2EY1 A;  4G6I A;  5I6W A;  1KTK A;  1D1I A;  3FDT A;  2RVL A;  4TKO B;  1B4O A;  5IGE A;  4KK7 A;  1TWF B;  4Z1M A;  1EQV A;  2HCC A;  1TU2 B;  2SDF A;  4BA1 I;  1DON A;  2K5D A;  3URY A;  3TP7 A;  3GTO B;  1JE4 A;  2DN8 A;  3RZD B;  4OO1 H;  4BY1 B;  2F0J A;  1VLY A;  3QIA A;  2ZXH A;  2R92 B;  3TDQ A;  3AB9 A;  3HG9 A;  4DNR B;  3OAA A;  1HXY D;  4WRD A;  2EXZ A;  3C1E A;  3A54 A;  3GV3 A;  5CV5 A;  1E2W A;  4N9T A;  3T13 A;  5IOD A;  1SNP A;  2VJI A;  2LFN A;  5JEA J;  1EIG A;  3NPP A;  2RSO A;  4H7B A;  4IN3 A;  3BVZ A;  3MXN A;  3NE5 B;  1GUW A;  1O7Z A;  1AP0 A;  5C5L A;  2GJR A;  1SJH D;  4YEJ A;  1XTC D;  2AQ1 B;  1WP6 A;  1EY4 A;  1LV9 A;  4NW2 A;  3ERQ A;  3HRZ C;  3MTS A;  3BC9 A;  3RZO B;  2KOL A;  1SNC A;  3H3V C;  1DM0 B;  4OHJ A;  4HN7 A;  1TS5 A;  1NSN S;  1FX0 A;  4RHS A;  4XTC S;  2NB0 A;  5EKK A;  5E3F A;  1QE6 A;  1YNN D;  2RDG A;  4KY7 A;  1PXU A;  5C3W A;  3G6J B;  1SE3 A;  2K33 A;  1RKN A;  2LKV A;  4XQF A;  2XOK A;  2I07 B;  3MAQ A;  3H0G B;  1JWM D;  3SEB A;  4C3I B;  2EE1 A;  4XLC A;  2KED A;  1GHK A;  2DNC A;  3OEH A;  4BWG B;  2PZW A;  1Q12 A;  3M7N A;  5CV8 A;  1I4G A;  4QUC A;  4FYD A;  1S5C D;  2OF1 A;  1JCK B;  4AYB B;  5FO8 B;  3DEP A;  5M9O A;  1BNZ A;  3VYS A;  4CKC A;  4M8A A;  5IGB A;  2SNS A;  1ZXT A;  4KKU A;  3GVK A;  3K58 A;  1SJE D;  2IL8 A;  3PIP 3;  2D3L A;  1W6J A;  3GP7 A;  5I2X A;  3W2D A;  2JEB I;  2D2C C;  4XN3 A;  1S4Z A;  1BDO A;  4RKB A;  5I4D A;  5EKL A;  3K0Y A;  2F0F A;  1H8H A;  1ESR A;  2GJK A;  5FK9 C;  3BYT B;  4B3G A;  4OO1 I;  3D3R A;  1FD7 D;  1I6V C;  1DYQ A;  2ENB A;  3I91 A;  1DXM A;  2EPB A;  3JAM E;  3P20 A;  2K28 A;  5CGK A;  5C0X G;  2M9V A;  5D65 A;  3RD4 A;  1JC7 A;  3NBI A;  1II3 A;  5LL6 X;  2B63 B;  1SYG A;  4IUP A;  1RF2 D;  4H13 C;  4QUF A;  3BZD B;  2RKS A;  4LMQ D;  1H9J A;  1IKM A;  3VR2 A;  4I7Z C;  1OXU A;  1MSG A;  4O1N A;  1A2U A;  1STN A;  1PZJ D;  2AWN A;  5JVH 3;  3Q22 A;  3C46 A;  2ICE C;  3SXH A;  2WKD A;  1T5E A;  4UZU A;  3Q23 A;  1VMC A;  4XON A;  3HOU B;  4HMI A;  1A15 A;  4YIJ A;  3DM1 A;  3O13 A;  1CFM A;  1I3Q B;  2SOB A;  5K5P A;  3HEJ A;  1BLI A;  1HQM C;  4M1U B;  1I4Q A;  4XQQ A;  3S9W A;  1SEB D;  3J7A F;  4JK1 C;  2FMM A;  1LLR D;  4DXF A;  5FO7 B;  5F2D A;  3H94 A;  3NP8 A;  5T1I A;  1F2Y A;  1BOS A;  5E4X A;  2MUY A;  1JOQ A;  1FYC A;  1D5X C;  5KRU A;  2F0D A;  5KEE A;  4F8M A;  1U9R A;  4FXK C;  4A3G B;  3GTQ B;  3KEW A;  4XLF A;  2L11 A;  1JQY D;  4K6L A;  4OGQ C;  3WOF A;  4DXG A;  3I70 A;  4C2M B;  3C3L A;  1OXT A;  2B8G A;  2X8K A;  1PTO F;  3CMM A;  5EPL A;  3GV6 A;  1RD9 D;  1S5B D;  1L0X B;  3ERO A;  1B9N A;  2EVB A;  1EIH A;  1DOM A;  3BVM A;  3IAY A;  4GZY C;  5NUC A;  2D5D A;  2DNE A;  2O5J C;  1MBY A;  1NCV A;  3PUY A;  3A7L A;  1SYB A;  1CK1 A;  4NMZ A;  4TSS A;  3OHX C;  5C44 B;  5HGT A;  2A74 C;  1TY2 A;  2ZZF A;  1EOT A;  4XOP A;  3NQI A;  1BCP F;  4LAA A;  3CQZ B;  4RGO S;  3J81 L;  1UAP A;  3K7A B;  2Y0S B;  2XIW A;  1PDQ A;  4NKL A;  1U4P A;  3K5N A;  1I4H A;  1W0K A;  5FOB B;  2L9H A;  2F0E A;  3S2H B;  3K6O A;  3QOL A;  3S15 B;  1E3X A;  3VR4 A;  4XYO A;  5EPJ A;  1Y69 U;  1PTO D;  1LT6 D;  4ZRZ A;  1ZKO A;  1LT5 D;  3H91 A;  2A68 C;  3GTL B;  1QWY A;  2WAQ B;  2PZT A;  2KEE A;  1D5Z C;  1UD4 A;  5K36 G;  3EJI A;  2HQE A;  3MEH A;  2D9U A;  2F0O A;  2F1M A;  2V31 A;  3VR3 A;  1CZW A;  4RAU C;  1EU4 A;  3M3Y B;  1ZEQ X;  3CHB D;  1EYD A;  1ENC A;  1EFR A;  1C4Q A;  3TSS A;  1LTS D;  1NR2 A;  2QIL A;  5LHY 1;  1QNK A;  4G57 A;  1KDA A;  4X3U A;  1FNW A;  4ID6 A;  2VB2 X;  4V0B A;  3TP8 A;  4XN0 A;  1TS4 A;  2X6W A;  1XXG A;  1E3Z A;  5CBE E;  4ZUJ A;  1V0F A;  2R93 B;  2XND A;  1PLF A;  4E6I A;  4K5W A;  2H1E A;  2B39 A;  1BR9 A;  1R9T B;  4CKE A;  3C2P A;  1CT1 D;  3PUX A;  1JOO A;  4ZQ3 A;  2PPB C;  4FXU A;  4UAI A;  1D6E C;  5K36 H;  1EY8 A;  2QEJ C;  2JDI A;  4C3J B;  4PQX A;  5FLX L;  3D8G A;  3OSO A;  3I4N B;  1E1R A;  1X3P A;  1VCI A;  2Z6B D;  4NNJ A;  2F3W A;  2NN6 G;  5E4W C;  3V05 A;  2RSN A;  3PIO 3;  1H8E A;  2WII B;  1PKV A;  1WTH D;  4H0L C;  1EY7 A;  1G6Z A;  1LO5 D;  1Z7T A;  5KNB A;  5J1Z A;  1HZE A;  1ONL A;  3QG1 A;  1QG7 A;  5FKA C;  5IGC A;  2WSS A;  4KJN A;  1LT4 D;  2F0V A;  1SFO B;  1G2T A;  4OL7 A;  1UEA B;  4KN4 C;  4B3F X;  1NR4 A;  1D1K A;  1TWH B;  1GUN A;  2XWB B;  3E0J A;  1SYC A;  1ILP A;  2B2Y C;  5KIX A;  3DXJ C;  1O80 A;  2V7Q A;  1B2T A;  2IX0 A;  2NN6 H;  3CRK C;  1IW7 D;  1VDZ A;  2HDL A;  4C1N K;  1STH A;  2A69 C;  2F0U A;  5JOB A;  3T53 B;  2G9H D;  3J7A V;  1IHZ A;  1Y8P B;  1EY5 A;  2CVR A;  3SK4 A;  2RDF A;  2X53 S;  2FIN B;  3CKI B;  1G8Z D;  4RHR A;  2JA6 B;  3LX0 A;  4F87 A;  4TRD A;  1OXX K;  1PRT F;  2R3Z A;  1RDP D;  3OE7 A;  5I9P A;  1PMR A;  1BBX C;  5CBA E;  3D6C A;  3KBG A;  5CMD A;  2E2J B;  2AUK A;  4HCE A;  2F0M A;  5EQ0 A;  5IGD A;  1F77 A;  1H9S A;  1XX8 A;  3PMF A;  3IFT A;  2OXP A;  2RDH A;  1EY9 A;  1U4L A;  2JSO A;  3OEE A;  5KYI A;  5G3L F;  3TZU A;  1GHJ A;  4C3J G;  2NVY B;  2NVQ B;  4FO2 A;  2DIE A;  2A6E C;  3KF8 A;  2EYM A;  2V4D A;  1STG A;  1S5F D;  2D3N A;  2W6J A;  2X6Y A;  1V1P B;  1CA5 A;  3QJY A;  5ELB A;  3J7Y W;  5ISR A;  5D3I B;  4XOT A;  3R2I A;  5CV7 A;  3J80 L;  2E2H B;  2OT2 A;  4ODG A;  4EQN A;  2PW7 A;  4YEL A;  3TN2 A;  4ILW A;  4CJ2 C;  3MZ5 A;  1UD2 A;  5CR3 A;  5C6A A;  4XQJ A;  4IFD H;  2F03 A;  1Y1V B;  3TP6 A;  3SE0 A;  2XGJ A;  1UD6 A;  3VYU A;  2E74 C;  4EGV A;  1PRT D;  3MFG A;  3GQB A;  4Y7N B;  5BN4 A;  1D2B A;  3SR1 A;  4MIU A;  2K04 A;  3LNN A;  4RKL A;  4IUT A;  1HPC A;  5I2Y A;  2X69 A;  2Z4H A;  1DOL A;  3TZD A;  1PFM A;  1PFN A;  3WDN A;  3HOX B;  5C0X I;  1Q1E A;  1GUT A;  2E1B A;  3FPP A;  1HVX A;  4XM3 A;  5HKK A;  1HTL D;  5C3E B;  4KY5 A;  1IYV A;  2KQ3 A;  3KBX A;  1CHQ D;  1E43 A;  1HUN A;  4IFD G;  5M3F B;  1EZ8 A;  5TSS A;  4G7Z C;  4PMW A;  3T56 B;  2A6H C;  4GQN A;  2L1B A;  5AFW A;  2R9V A;  1Q1B A;  1G2S A;  5C5M A;  1NBM A;  3H09 A;  5DM6 3;  4DF7 A;  4BA2 I;  1BF4 A;  4IUV A;  2RBM A;  3P75 A;  1QJO A;  4XQN A;  2XRS D;  4DN4 M;  4XT1 B;  1SYD A;  4ZUI A;  1F9Q A;  1BPL A;  3MXG A;  3KUP A;  2XN9 C;  2EOT A;  3BDC A;  5ELC A;  3S17 B;  1QIL A;  3SHL A;  1EY6 A;  2X6L A;  1W9X A;  3DWP A;  4RFB A;  1KMH A;  1QNU A;  2VJJ A;  4ZYS A;  4Z9C B;  1TT2 A;  4EQO A;  1A2T A;  1DZ1 A;  1CQF A;  1WTP A;  3HOZ B;  4IQZ A;  3P7J A;  4CBV A;  5A2Q L;  3S1Q B;  3HKZ B;  3S2D B;  2BOS A;  1W0J A;  1TQO A;  4DAV A;  4KJO A;  4B9W A;  2NTT A;  1L0Y B;  3A8J E;  2F0W A;  1TR5 A;  1XYI A;  3WOE A;  1G29 1;  3HS0 C;  1WTO A;  1G91 A;  2BA0 A;  3NUC A;  1TY0 A;  1PYW D;  4RGN A;  1BCP C;  5JAV A;  3QWN A;  1EZ6 A;  1ET9 A;  4E0F A;  3A35 A;  2EJM A;  2K05 A;  2O4X A;  3OIQ A;  2NBF A;  5JEA G;  2EY2 A;  5M5X B;  3Q24 A;  3GTG B;  3IKJ A;  2EY6 A;  5M3M B;  3PUZ A;  4RGM A;  5A2Q E;  3V96 A;  4XKW A;  2GK6 A;  5KGU A;  4KKS A;  2CQA A;  2J0T D;  3A8I E;  5DEH A;  3I72 A;  2AQ3 B;  1TS3 A;  5CDF A;  2JEA I;  2NZ1 D;  3OWF A;  1JOK A;  3RLF A;  2PNR C;  1RHP A;  3I73 A;  3AMU A;  2JA5 B;  3T4A C;  3LWU A;  2KCN A;  3FMC A;  2F0I A;  5DN6 A;  2XZL A;  4I65 A;  5IT9 L;  4PMC A;  2SEB D;  2XZO A;  1CTM A;  4IAL A;  2BE5 C;  1I4P A;  2EY5 A;  3EQL C;  3A8K E;  5IT9 E;  3QB3 A;  2FHT A;  3IL8 A;  4HR7 B;  4MHE A;  4KN7 C;  4A3I B;  2WB1 B;  5C0X H;  2KHS A;  1C8C A;  1SXT A;  4DAY A;  2EYF A;  3DMU A;  3D4D A;  2X85 A;  1LAC A;  5A35 A;  2KCC A;  5EBC A;  4FF3 A;  2K01 A;  4ASU A;  1LTI D;  5KNL A;  4Q0F A;  4XLE A;  1SMY D;  1BCP B;  1I18 A;  1HA5 A;  1D5M C;  3SDZ A;  2NWG A;  3K5M A;  3A3B A;  1UD5 A;  1HHV A;  3CES A;  5ELE A;  2IW3 A;  4OIK A;  2C9O A;  4FF4 A;  4L63 B;  2F3V A;  4IUU A;  1MI2 A;  5KYL A;  5FO9 B;  4XMY A;  2AWO A;  5D3D A;  1KNE A;  1SMY C;  3ITP A;  1PTO H;  2EZV A;  5JPM C;  3L7Z C;  1C48 A;  3S1R B;  1ESF A;  2EYO A;  3NWS A;  4RH6 A;  3BDO A;  4C1N I;  2A69 D;  2Z4I A;  1WTV A;  1YNJ D;  1V0E A;  4B9X A;  2F0K A;  4A3J B;  2YYZ A;  2TMP A;  2WZP P;  3NTI A;  4ME5 A;  2EJF C;  4K5X A;  2G9D A;  2WV6 D;  1IYU A;  3TME A;  1WVL A;  5C4Z A;  4HED A;  2Q8T A;  2K5W A;  3SK5 A;  1PRT B;  3DWQ A;  5EBD A;  1EYA A;  2WP8 J;  2F0T A;  4C3H B;  1Q90 A;  3GVL A;  2QDB A;  2QF7 A;  4G7H C;  4WOR A;  3I4L A;  2JA7 B;  1V8Q A;  2BDO A;  5CV9 A;  1WD0 A;  3G7L A;  1STE A;  1KAA A;  3G05 A;  1SSO A;  2XVS A;  2F4I A;  4U67 3;  4C3I G;  1HQR D;  1LAB A;  4OO1 G;  3NHH A;  1SAP A;  2EYJ A;  1IL8 A;  3AU7 A;  1AZP A;  3WQZ A;  4DFA A;  2Q8I B;  3GTJ B;  2AQ2 B;  1LTR D;  2IX1 A;  3HOY B;  1B50 A;  2EJG C;  1I8D A;  2B2U A;  1BQQ T;  1BXT A;  3D4W A;  4J6H A;  1TKW B;  3ZIA A;  1GUG A;  4FF2 A;  1GJX A;  4KI0 A;  4K14 A;  2A73 B;  3EFX D;  3P1H A;  1LTT D;  2IJ0 A;  3ONA B;  5HUR A;  2HLD A;  1TWC B;  1F9P A;  3X3M A;  4FXG C;  3KK7 A;  3S1M B;  4TT3 A;  1A3U A;  3OMC A;  4G4K A;  3M4O B;  2IPK D;  2PMZ B;  3DDY A;  1M8A A;  2XSC A;  4V19 0;  5IK2 A;  3PO2 B;  1O7L A;  1F2M A;  4PV1 C;  1Q8I A;  4QMG A;  2K1B A;  1M4V A;  3DEO A;  2A68 D;  3GD7 A;  2VNU D;  1B53 A;  3BCF A;  2LY7 A;  4O42 A;  1S5E D;  2E76 C;  3EVQ A;  1FNU A;  2BCO A;  2MGS A;  1VF5 C;  4K2L A;  1F2L A;  5C4J B;  2R6G A;  1WCM B;  1EYC A;  2EDG A;  4BBS B;  4TSF A;  1IW7 C;  2F0P A;  5IGG A;  4PMB A;  2A5H A;  2LS0 1;  4XLH A;  1AFP A;  4FP5 D;  1SKY B;  2XZP A;  3ND8 A;  1SNO A;  1SND A;  1TII D;  2JA8 B;  3QO2 A;  2WAC A;  2D62 A;  1HRJ A;  1UNS A;  4ZLT F;  3Q0A A;  2F0L A;  1FGB D;  1Y8O B;  3M85 A;  2MPM A;  2B2T A;  3VYR A;  1Z47 A;  5M5W B;  1EEI D;  3HP3 A;  5CC4 A;  4H44 C;  4K8I A;  2FMC A;  2ICI A;  4EQP A;  2M00 A;  1LTA D;  3OOC A;  3X3N A;  4DGZ A;  5J39 A;  3KLR A;  3U9O A;  4YXW A;  5CV6 A;  3FEW X;  5C0X J;  2WJY A;  4FVM A;  3K57 A;  1H9M A;  2GK7 A;  4QF4 A;  2L5T A;  1E0B A;  2ZXP A;  1Q3L A;  1HFG A;  1JIC A;  2JJ2 A;  4ULL A;  3OWE B;  1EY0 A;  1GUO A;  2JIZ A;  3S16 B;  2VXW A;  2F0H A;  2H4O A;  3D31 A;  1TS2 A;  4XR6 A;  1EEF D;  3ND9 A;  5IOC A;  3OPO A;  3D4R A;  3BDL A;  3Q6S A;  1ICW A;  2FFK B;  4Q5V A;  4JBW A;  4XNF A;  1CM9 A;  3CRL C;  2O2L D;  1S5D D;  2VB3 X;  4HMJ A;  1STB A;  4JMQ A;  1BCP D;  4KKT A;  1KDC A;  1BMF A;  1F2Z A;  1AN8 A;  5C4X B;  5COR A;  4J1M A;  4DNT B;  2DY8 A;  1A3V A;  1V43 A;  5CV4 A;  5M5Y B;  2M2L A;  4RA8 A;  1OO9 B;  1IKL A;  3NQT A;  4XDX A;  2GJP A;  1AW7 A;  1R4Q B;  4S3S A;  2FJ2 A;  1KLG D;  1OXV A;  2KEC A;  4A3B B;  2RQX A;  2B2Y A;  2NYZ D;  2IT1 A;  1B3A A;  5JPN C;  4KHZ A;  3H6M A;  1MGS A;  3KLS X;  4IFD I;  2PYK A;  2LZJ A;  4CJ1 B;  3OIP A;  1U4M A;  1WPC A;  1E79 A;  3CP8 A;  2ZZQ A;  3NTH A;  5IIF A;  1MAB A;  2JJ1 A;  3VA5 A;  2ZXO A;  2L55 A;  1K83 B;  1DJR D;  5FLX E;  1Y8N B;  3UI2 A;  4RCO A;  1WTR A;  2MJ8 A;  2E2I B;  4KHV A;  1SNQ A;  2R7Z B;  1UD8 A;  1Z6H A;  1I50 B;  3NTK A;  1PZK D;  3E6Z X;  1EWC A;  2X6X A;  3C1F A;  2QCP X;  1HUM A;  2HCI A;  5EKI A;  1JB3 A;  1SNM A;  3NWT A;  1WTW A;  1ZYR C;  4XXE A;  2Z8L A;  3PO3 B;  4C56 C;  2O5I C;  5C3X A;  3F2U A;  4P22 A;  4QB4 A;  1RTN A;  5J22 A;  3RMH A;  4WJW A;  3I8Z A;  4N9P A;  1T5X D;  3MXU A;  1CZG A;  4A93 B;  3T16 A;  5IGF A;  3A56 A;  4F88 A;  4BY7 B;  1ROD A;  1QCB D;  1SYE A;  1AZQ A;  3A55 A;  3MA2 B;  2ID0 A;  2B8F A;  3A7A B;  2B2T C;  1YNN C;  4U68 A;  1KAB A;  3U9S A;  2KJX A;  2NTS A;  1BO0 A;  3PV0 A;  1GOZ A;  3LWE A;  2QKI C;  1E2Z A;  5DM7 3;  4HSP A;  5T1G A;  3BYY B;  3J81 E;  3SVM A;  2E2D C;  3FRP B;  1GXD C;  1EL0 A;  1K28 D;  2B2V C;  3HGB A;  5DNF A;  2L4N A;  2QE7 A;  3R2T A;  1WD1 A;  4A3D B;  1H9S B;  3PUW A;  3T51 B;  4RGT A;  2WKC A;  1NAP A;  4BBR B;  1ILQ A;  3K59 A;  3MC0 B;  2F0Q A;  3R8B A;  2B2W A;  1MSH A;  4QIW B;  1RJT A;  1HFN A;  1TWA B;  1KZL A;  1F9R A;  2M5S A;  4ZAI A;  3FKS A;  2BE5 D;  1I4R A;  4MN3 A;  1J9O A;  2HUG A;  2NVT B;  2OEO A;  2N88 A;  4PNY A;  4CGY B;  3CU7 A;  3R93 A;  3K5O A;  1R4P B;  2JYO A;  3GTP B;  3MXP A;  4A3M B;  4K6D A;  1STY A;  1B44 D;  2GA4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...