3OOCA

Crystal structure of the membrane fusion protein cusb from escherichia coli
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
297
structure length
297
Chain Sequence
b'TQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein cusB
molecule tags Transport protein
source organism Escherichia coli
publication title Crystal structure of the membrane fusion protein CusB from Escherichia coli.
pubmed doi rcsb
total genus 40
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3oocA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3oocA03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3oocA01
4I7ZC 4G7OC 1HQMC 1CI3M 3RLFA 1Y69U 1SMYC 2JE6I 1V43A 4TKOB 4OO1G 1G291 1HTPA 5C0XH 4KKUA 4L8JA 2O5IC 1T5EA 4KKSA 3HGBA 3PUZA 2A69C 2B8FA 3BG3A 5BN5A 2ZT9C 4KKTA 2NN6I 3D31A 2A68D 2K32A 4IQZA 1OXUA 3TZUA 3QIAA 2DN8A 3MFYA 4OGQC 1GHKA 2PCFB 1Y8NB 3P20A 1O7LA 1EWHA 3VR2A 2EJFC 1DXMA 3IFTA 2B8GA 3A8KE 1FYCA 1YNJC 3A8JE 1V8QA 2YYZA 3FMCA 3L7ZC 1A6XA 3VA7A 2K7VA 1E2ZA 1TKWB 3PUXA 5C0XG 5BN3A 3ND8A 2IT1A 1GUTA 1H9MA 1TU2B 3NE5B 3VR5A 3AB9A 1K8MA 3EQLC 1H9SA 4H44C 4GZYC 4JK1C 2D62A 3D4RA 4BA1I 3FPPA 1B9MA 5KNDA 1IYVA 2A6ED 1ONLA 1OXXK 2JEBI 2BA0A 3OPOA 1I6VC 4H13C 3OW7A 2PPBC 2D2CC 2NN6H 4IFDH 1IW7D 1GUNA 3PV0A 1DCZA 5BN4A 1H9JA 3I73A 4KN4C 2QF7A 2CW0C 4KI0A 2AUKA 1YNNC 3VR4A 1E2VA 4KN7C 2O5JC 2EVBA 1ZKOA 5A35A 4BA2I 3QJYA 3CRLC 1Q12A 1Z7TA 1HCZA 2A69D 1B9NA 2E76C 2JXMB 2V4DA 1GUSA 3A7LA 3W3AA 2BE5D 5JEAH 3GD7A 1VF5C 3T56B 1Q1EA 2Q8IB 2D5DA 1FR3A 4JBWA 1VF7A 1GHJA 3WDNA 2AUJD 1Q1BA 5JEAG 4XIGS 1K8OA 1OXSC 3U9SA 4KHZA 2EDGA 2PNRC 3A7AB 3LWUA 5KNCA 2A6HC 3SE0A 4DNRB 2E75C 2DNCA 1HPCA 1OXVA 1VCIA 2AWOA 2LMCB 1O78A 3VR6A 4IFDG 5K36G 4H0LC 1QJOA 3OOCA 3QG1A 1Y8PB 2EJMA 3I4LA 1OXTA 1Z6HA 3A8IE 2A68C 1LACA 3ND9A 2BE5C 2BA1A 3SDZA 3LNNA 4DK0A 3DXJC 1H9RA 1VDZA 1GJXA 1CTMA 4DNTB 4G7ZC 1GUOA 3H94A 3M4YA 5KNBA 2A6EC 3IKJA 1PMRA 2EJGC 3N6RA 3PUVA 1CFMA 3BDOA 3KLRA 4TQUS 3I72A 2DNEA 4RCNA 2JEAI 2A6HD 1BDOA 4DK1A 2KA7A 4LJZC 3M85A 1H9SB 1DD2A 4LK1C 2E74C 5K36H 1IW7C 4OO1H 2L5TA 2F1MA 4PV1C 1LABA 1H9KA 4XTCS 1ZYRC 2KCCA 3CRKC 2K33A 3PUYA 4HR7B 1IYUA 3PUWA 3VR3A 4G7HC 3T51B 2NN6G 3GQBA 1E2WA 2R6GA 3T53B 2BDOA 3MXUA 1Q90A 1GUGA 4KMUC 1Y8OB 3M7NA
chains in the Genus database with same CATH superfamily
4I7ZC 1PDQA 3CPWA 4RD2A 1TLLA 2JE6I 4WJWA 1X56A 3HOUB 2RDFA 4ZCLA 3A8JA 4KKSA 1U4LA 4GLAC 5ELOA 2DERA 4A3CH 1NDHA 1NY4A 2SNMA 2NN6I 4P9SA 3D31A 3NTKA 1SDFA 1KMHA 4FP5D 4XKVA 3MFYA 2X69A 2R7DA 3DWAA 4BY7H 5IYQA 2ZXIA 4A93G 1WTPA 4X3SA 2OXPA 4R4OA 4II2A 1QG0A 4RDKA 1X55A 5BN3A 2IT1A 2B39A 1ESFA 3E1YE 3U6BA 4RM0A 1KK0A 1H9SA 4R71A 3A1PA 4RFBA 1AE3A 4Z4RA 4N8FA 4JI2L 2KCTA 3LQEA 1M1KD 1EIGA 3L9AX 3OTOL 1FRQA 1HA6A 3JU4A 1TWAH 4HTHA 2D3LA 1LTRD 3SLNA 4IOAA 1EFWA 5IT9L 4RPBA 3ASQA 1BPLA 1VQ8B 2ES2A 3E5SA 2MJ8A 3ZUGA 4X66L 2N78A 1R9TH 2EYPA 1YJNA 4DV2L 4Z4ZA 3T16A 1VQJA 2NZHA 1CKNA 1SE4A 2FMCA 2PZWA 1DOMA 4K6LA 1KTKA 1GHJA 3PQIA 4RAUC 3W2EA 5CBEE 4C3JG 5C44H 3I56A 4PC6A 1VQ7B 2F03A 1W87A 1DG1G 1JJ2A 4JI4L 4H7BA 3NTHA 1HRJA 2H5XA 1J6QA 5HY6A 1W6JA 1CNFA 4DV5L 1GD7A 2QMUA 1F9PA 1XPRA 2G9DA 4E0FA 3GIRA 1OXTA 2NTTA 2WAQB 5IP7G 3LNNA 4CJ1B 1N32L 4DNTB 3CXCB 4G7ZC 3ER0A 5KNBA 4LNQA 4TQUS 2ATWA 2E1BA 5FO0A 3CKIB 3HOXG 3SXHA 1L1OC 2IHEA 1F77A 4P1VA 4OL7A 3F2BA 4RWSC 1LABA 1VQNA 1BCPC 2VNUD 3MXGA 1RQPA 2ZM6Q 1HNWQ 3CQZH 4WORA 3HOYH 1KK3A 5L37A 1YI2B 2HIVA 5L46A 1Q90A 1GUGA 1TS4A 3VR4A 4DR2Q 2OTLB 1WVLA 1V1QA 3ES9A 4G7OC 3ZYYX 3GTQB 3PO2H 5J22A 5BSYA 4O0AA 3CB4A 1SMXA 1T5EA 1BCPD 4JI1Q 1EXMA 1MSGA 4Q7JB 4BXXH 4A3KG 3OE7A 1B3QA 1GR1A 1ZEQX 2CQOA 4XQNA 2F43A 1C0AA 4U673 3OW2A 3BU2A 4A3DH 2VYQA 3NTIA 2R7ZB 4CDDC 4DR7L 2EJFC 1ENAA 3R2TA 3W5OA 3KBGA 3FMCA 2F4NA 1E24A 1KIXA 1UEBA 1C48A 4WWVA 4DV6L 3ND8A 2JJ1A 2HCJB 3AU7A 3T1YQ 4XQQA 1Q81C 1JE5A 2F0HA 4LAAA 4DR7Q 1RTNA 1LO5D 3OAAA 3FPPA 4PGOA 1B9MA 3BDLA 5KNDA 2D74A 1OXXK 4HIMA 1YIJB 4HJAA 3KLWA 5FO1A 2UUCL 1B3AA 4G57A 2F0GA 4A3FH 2D2CC 2WJVA 4B3MQ 2RC5A 3DWQA 4IUQA 1IKMA 1WJJA 3MEHA 4XDXA 1HFNA 3SEJA 4OELB 4DV6Q 1LTAD 5HXBA 2K4KA 2AHOA 1E22A 2NVQH 4RDJA 1EY5A 1N33Q 1I94Q 2A69D 3S17H 4RDLA 4XXEA 4QUCA 2BE5D 2E2DC 1Y0YA 2XN9C 4Z4SA 5CV4A 1VQ6A 4IUTA 4JBWA 4LWCA 1WOPA 4A3GB 2R7ZG 3S1MB 1KRTA 2E8GA 3HOYG 3FRPB 4A93B 1ZUNB 1QNUA 2J7KA 3EVQA 2ZXHA 2UU9L 1YNND 5JPMC 3VR6A 2E2IH 5FA6A 1SE2A 1VQ4B 5A2QL 2EY1A 3FKIB 3I1FA 3U4ZA 4DUYL 2A68C 1LACA 5CYUA 2BE5C 1R9TB 3V7AA 2F1LA 3W1GA 4G6IA 4YHBA 5EGTA 3Q38A 4OWTB 5IYCH 4DR2L 2QW7A 2WP8J 4A3KB 1KLGD 1YJWA 3G48A 4A3JH 4K2KA 2R92B 2DNEA 2JJ2A 5J3BA 3ZZTA 5M3MG 2M5SA 5GQOA 1DGSA 1EY8A 2KCCA 4A3JG 3M4OH 4PMCA 2P3MA 1STHA 4A3MB 3WNDA 3GQBA 2CQAA 1W0KA 2YU9B 3URYA 1E2VA 1UMKA 1B1ZA 3QO2A 2Z6KC 2LXJA 1LTTD 1AN8A 1HQMC 3V2TA 1X3EA 4GLXA 1JE4A 2NVXB 5C4XH 1OGIA 4DKAC 3RN2A 4DV5Q 1I4XA 1JR0D 1PTOB 4B3RL 1IHZA 4I65A 5J1ZA 4OIJA 2OTLA 1YZ6A 1JWMD 2ZXRA 1OB0A 4BBRG 1NCVA 1FNCA 1Q3LA 1PJ6A 3TZUA 4APVA 2DN8A 1GHKA 1BVSA 5EKIA 5EPLA 1TWFH 3HOWH 5BSXA 2NWGA 1CQVA 5E4XA 2E1RA 4NPSA 1JA0A 5IK2A 1KTVA 3I90A 4HEDA 2NBFA 2RBMA 3A5UA 2DETA 1BBUA 3OIQA 1FNUA 4IUPA 3HRZC 1PXUA 5FLXc 2D0PA 1NMGA 3OTOQ 3C3LA 2F3VA 4OWWB 3SKBA 2I5LX 3KF8B 1G7SA 4HJ7A 1H42A 4JBKA 4IFDH 1K3BC 2IWHA 1A15A 4DV4L 1AH9A 2HDMA 1ILQA 2F0NA 3UE1A 4DAYA 2CWAA 2AMCB 5FL7A 2L4NA 4JI7Q 3BQJA 1JB9A 2XIWA 3PF4A 3UDGA 3A7LA 1G6PA 4ACAA 5JEAH 2LS01 5H1SE 1Q1EA 3T13A 5CV9A 1VQCA 2Q8IB 4LF8L 4HE5A 2L1BA 2OEOA 3SJZA 1J8IA 4QFMA 4QIWB 4DR4Q 2HLDA 3BCDA 2A19A 2N88A 1LT4D 3P27A 3A7AB 1QVCA 2EIFA 2VNJA 5M3MB 1QJOA 4DAYB 1F2ZA 1ZM2A 3PUMA 3E3XA 4IN3A 1EQTA 4AH6A 2GJKA 2VQEL 4DK0A 1SYGA 1H9RA 2NVYB 5IYBH 4LF4L 3A74A 2IW3A 2VXWA 1HXYD 3GTGH 3E9HA 4R4CA 4JC0A 5C4ZA 4UP9A 2R93H 4XN3A 2MQHA 4B3GA 2HHHQ 4X6AH 1U9RA 3UDIA 1PHJA 3ITPA 2K33A 3A56A 5DAUA 1XJVA 2HUGA 3T51B 1VQPB 3FKIH 3SR1A 4LMQD 1WCMB 4DV7Q 1HH2P 3CD6B 2FMMA 4NMZA 3T1HL 4OX9L 1ESRA 2XVSA 1RHPA 4JI7L 3CMMA 1V43A 3RZOH 1MSHA 3WNCA 1YNXA 4FDBA 4A3JB 4CJ0B 3C2PA 4DN4M 4IURA 1FNMA 3AGQA 1Y0RA 2BOSA 1HJPA 1ZXTA 4XQJA 1KDCA 5DSZA 3GP7A 1I4GA 2EYFA 2K5NA 3CC7A 2V7VA 3D26A 1LV9A 4JBJA 1H8HA 3QIAA 1H95A 2IX3A 1Y8NB 5BR8L 1EWHA 1XE1A 2A5HA 2RDHA 3ULPA 1IBMQ 1DJRD 3PIPA 4A3IH 2N3SA 2V7WA 3S1QB 1NBWA 2NVXH 1WD1A 4CDCC 1GXDC 4JV5L 4AQYL 4DV3Q 2LXKA 4CHTB 2VL6A 2C35B 4IJLA 4KV6A 1Q46A 4N8X1 4CKBA 4XR6A 3AB9A 4ZKBB 1I3QH 4PABA 2G9HD 4R9WA 2K1BA 1PFMA 1EFCA 3W5VA 1PTOC 1LTID 5CV6A 2D0OA 4A4IA 1GAWA 4DUZQ 2MHVA 4LFCL 1HNXL 3ICEA 1K73C 3HOWB 4HCEA 4QVJA 4NDXA 5ELEA 3I55B 4F7XA 1TR5A 2CW0C 5HGQA 1II3A 1NRKA 1SKYB 1ZKOA 1QZGA 2I07B 5IGGA 3HOWG 1Z7TA 1X3QA 3BH4A 3OJWA 1S4MA 1N08A 1K8GA 5EPJA 5M9OA 4WQMA 1OO9B 3MFGA 5FLMG 2RCFA 4FXGC 1VF5C 2WZNA 2VZLA 1TY0A 4PMBA 3J80L 4NXNQ 4RH6A 4B3SL 1K9MD 2B2UC 3FKIG 2AUJD 3F2CA 2I5MX 2ZTDA 1SEBD 3B82A 5M3FB 5M5YB 3BDCA 1K73D 3OIPA 4BY1G 3LWUA 1CKMA 2B2YC 3CCMA 2GN5A 3NK9A 1QVFA 2B7BA 1KJZA 5HZBA 2E75C 4LF5L 5IYWA 1SYDA 4HCSA 5M5WB 2XOKA 3J7YW 2ZBVA 1XQBA 1B7YB 2I5HA 4AYBG 1HVXA 3A8IE 2VUMG 3ND9A 2JJQA 2BA1A 2LSSA 3HS0C 1Z47A 4X3TA 1EIFA 1K9MC 1HA3A 1HR0Q 4DXGA 1EP1B 2VB2X 2E5LQ 4C1NK 1IL8A 2A6EC 2K04A 2UUAQ 2B63B 3PO3B 1UD5A 3AYHB 3QFCA 2JEAI 1VHOA 5IGCA 1PYWD 1VLOA 1K28A 4C2MH 2JA5G 3PO3G 4CKCA 3KL9A 3TP7A 4BPRA 1EY9A 5KSWB 4J1MA 4G5GA 3NXWA 1Q8IA 1I18A 2ZXPA 1PVOA 2F0UA 1OHHA 4Z4UA 1SROA 3H0GH 1O7YA 3FHWA 1EEID 3RLNA 2RHSB 5IP7H 3E0EA 1V9PA 4TKOB 1F2LA 4DV1L 4CDFC 1WDTA 4DR1Q 1STYA 1PRTC 3TS0A 4B3ML 2X6YA 4XOPA 3Q3AA 4V190 1AE2A 1HZBA 2R6HA 2XGTA 3HKZG 4IJHA 4RGTA 1SNPA 2B8FA 5I6YA 4F8MA 1VQ8A 3UDXA 2XNCA 3G7LA 1JNYA 2K32A 2SEBD 4IQZA 1WCMH 2B2WA 1HNZQ 1CKNB 3CPXA 3HG9A 2OQKA 3HKZB 5DEHA 3EROA 2KUMA 5FK9C 1W0JA 4G7XA 2J7ZA 2NVTB 1V8QA 1KRSA 2QEXA 5AJ3Q 1ICWA 3HEJA 2FX3A 3MHPA 5KYLA 2DYIA 5JJKA 1YHAA 4ZGQB 2IPKD 4XNFA 1K8MA 4IPCA 3D4RA 1YX2A 2CRVA 4H9GA 4A3EH 1IYVA 2F0OA 1WCMG 3CPWB 2MO0A 4X65L 1EFID 2JA7G 1K83B 1EY6A 2Q6IA 3ZZUA 2PPBC 1XNRQ 3S16H 1GUNA 2YTXA 5BN4A 3FVQA 3NQTA 1QFZA 4Z4TA 3H91A 4DV0L 3P75A 2QEXB 3QWNA 1F60A 3QJYA 4DR3L 3PO2G 2QTZA 2L11A 1YJ9B 3A35A 2BF4A 2EXZA 4LUVA 4RKLA 1XMOL 2D5DA 5KEEA 1I4PA 4XORA 1ASZA 3R93A 2Z6BA 2KEDA 5JEAG 4XLHA 4NB3A 4XIGS 4YWKA 1HQRD 1RCVD 3CCRA 4IPHA 4X7FA 4TMVA 1IXRA 2B29A 5FOBB 3GTOB 5C0XJ 1G6ZA 3CXCA 3VDYA 4XLEA 1HA5A 2LMCB 4GS3A 3ASPA 4L5TA 1LTLA 3M7GA 4UHVA 3H09A 4ZKCB 4R8IA 1CSQA 1QG7A 2OF1A 2R3ZA 4ZV4A 2GA4B 5CBAE 3DXJC 4P71A 4IPGA 2BM0A 2MO1A 2KBNA 1C9OA 4MYUA 3W2GA 2PI2E 1RKNA 3AQQA 4ULLA 1CFMA 2ZL5A 3NELA 4KJOA 2BV3A 3UI2A 2Z4IA 5CC4A 4TT3A 4B3FX 1UE1A 4A3DB 1SM4A 5IYDG 4LK1C 4GOPC 5K36H 3W2FA 4TMZA 1I6HH 1B2TA 4BWGB 4YELA 4KJNA 3WOEA 1FGUA 3TP8A 3EA6A 1KXLA 1D2EA 3VR3A 2GK7A 5M5WH 5LL6X 3IRBA 1SNQA 4NXNL 3K5LA 2EIXA 1X3GA 2KHJA 2UXDQ 3S2DB 1DDIA 1FNBA 4RD1A 4X7DA 4X3KA 1TUIA 4X66Q 2VBUA 1E1QA 4LF9L 5DLQE 1HHVA 3K6OA 1SR3A 1J5EQ 1HNXQ 2ZJQA 2V1CC 1LUZA 1U4RA 4C2MB 4QIWE 4DUZL 4C3JH 4JI2Q 4QCLA 4YCWA 1PKVA 5A2QE 2F52A 4GQNA 4YAOA 2Z4HA 5ELDA 2PCFB 2SNSA 1O7LA 3S17B 1FYCA 2C5CA 1UE6A 2GPJA 1PFSA 3EIVA 3NBHB 4DR3Q 2WSSA 4YXWA 2K7VA 2N55A 2K5QA 5IGFA 2ICIA 4DV0Q 4WFN3 3S14B 2W6IA 5CV8A 3M3YB 1GUTA 1ET6A 4LW1A 1U4MA 5DN6A 3QOJA 3VR5A 2LY7A 4DAMA 4K5VA 2Y0SG 5JAVA 3D4DA 1IJEA 1AP0A 4S3SA 1N0UA 3BVZA 2EYLA 1FNVA 4AF7A 1SN8A 3ULJA 2H1EA 1PTOF 4BBSH 4A3LG 1EYGA 2B7CA 3BY2A 1YNNC 1L2FA 1X3PA 1N05A 4JYAL 4MN3A 3HOXH 2V4DA 1KDBA 3BC9A 1YJ9A 4DV7L 1S4ZA 3GV3A 5FJ8H 1PZKD 1BQEA 3PA1A 1SNOA 1VLYA 5J35A 1TTTA 4AYBB 1K8OA 1BO0A 3I4MH 3S1NB 2M9VA 2OWOA 1B8AA 2XWBB 4TSFA 2X6GA 2WJYA 4LFAQ 1EYAA 3EFXD 1HPCA 1OXVA 4M1UB 4C3HH 3H15A 4L63B 2VQFL 3WYAA 2A73B 1PH4A 3OEEA 1STBA 1YEZA 1DOLA 3GTKB 4KY6A 3ZC3A 1UD2A 1VDZA 1NTGA 5LMNL 1TWCH 1FD7D 4Y9RA 3ISXA 1EQRA 2ZTGA 3W2IA 5C3XA 4DR6L 2C4TA 4X8IA 1JCKB 3GTOH 3STBD 1UD8A 1EU4A 1PYBA 2KOLA 3J80i 3HOZH 4TMTA 3TRZA 4Z4WA 4KHPL 1VQMB 4LFBQ 1WTRA 1E2WA 2UUBL 1S5FD 4IALA 1RJTA 4R8NA 1PH1A 1A0IA 1ENCA 4RCYA 1PRTF 3A3BA 3GSIA 2VUMH 3D3RA 2HIXA 1H85A 1UEAB 4QY7A 2VBTA 4JI5L 1GO3E 1Y69U 5NUCA 1JMCA 4RGMA 2DCUA 3E6ZX 2Q2IA 1HTPA 3RMHA 2B2VC 3PUZA 2GJRA 5CORA 3S9WA 1JB3A 3GTPH 5HZAA 4RG1A 3NQIA 2K5DA 4BY7G 1TVCA 4KHVA 2ZBUA 1UWVA 1VQMA 1VQ5A 4HJ5A 3HOVB 4DPGA 5IIFA 5KRUA 1CA6A 3VR2A 4ABNA 4P6VF 3L7ZC 3J81E 3B78A 2YTVA 4KD4A 5G3LF 2LZJA 3K7UC 1BX1A 3ZZ0A 1EY0A 3B6YA 3PUXA 5IP9H 4HAEA 1WFQA 3GDEA 1O80A 4FWTA 4FYDA 4RKBA 5F4JA 3OP1A 2IHFA 3EQLC 1A63A 1VQFA 5DM73 1MABA 4LFCQ 1GOZA 4OO1I 5ELBA 5KGUA 4XYQA 1A3TA 1ONLA 4U9UA 4RD4A 3A55A 3HP3A 4P73A 4DQKA 5TRDA 2OBTA 2QN6A 4YAUA 4I7AA 1IW7D 1BXTA 1L0YB 3A54A 3GTMH 3PV0A 1FX0A 4C0SA 4KI0A 5GROA 4DV3L 4C3IB 5IGBA 4JV5Q 1YHBA 1EFUA 3S2HB 3UDFA 1HUMA 1Q12A 1KC8C 3D4WA 2Z6BD 2YWFA 1LT3D 4M8AA 5M5XB 1NMFA 4JI6Q 3TDQA 1EYCA 2JA8G 3FEWX 1FR3A 4ALPA 4II3A 2DJGC 2J0TD 2UXCQ 4GOPA 3CRZA 2BGIA 1S72B 1P16A 4JI8L 4P6YA 1SRUA 3I55A 1TY2A 3F8TA 4PG3A 2A6HC 3AFPA 1QUQB 4XD7A 1ET9A 4R1JA 1JA1A 5IT9c 2JDIA 2ICEC 1O78A 4BBSB 3W5HA 2F0TA 1W9XA 3K8AA 1M90D 1BNZA 2X3UA 1Y8PB 3I4LA 3CCJB 3CAMA 4DFAA 1WORA 4JI5Q 2XEXA 1TS2A 2F0MA 5IYCG 3KF8A 2KHSA 1CTMA 3T1HQ 4QHYA 3C1FA 1VQGA 5IYNA 4LF7Q 3GO5A 3SK8A 3LO8A 2QKIC 1VQ9A 2QEJC 1WOCA 1PH5A 2A6HD 1BDOA 1E62A 1I8DA 3MTSA 2EY6A 4K0KQ 5DM63 1QCBD 1E3XA 5GAGC 1VQOB 1E7ZA 1N34Q 4A3LH 1M90C 1IBKL 3HOUG 4FF1A 4PMWA 4KK7A 4DR6Q 4XLFA 3CCUA 5E1FA 4G7HC 1T6ZA 3OMCA 4P12A 1D8LA 2J4XA 1JQYD 3BYTB 3BZDB 5LMNW 2AQ2B 1IB0A 5F4OA 1I94L 4P3IA 5FJ8G 4GN3B 4OOSA 4L5QA 4FXDA 1WTWA 1TWCB 5THXA 3WOFA 3CMAA 3CC7B 3BZCA 1WU8A 4CJ2C 1COWA 3CQZB 2JQOA 2X85A 3I2ZA 2VQFQ 5JVH3 1GM5A 2ZTCA 4LFAL 3CD6A 2BDNA 1AFPA 2QDBA 4XM3A 4CKEA 4DR4L 5E6TA 3CCVA 1LM0A 1Q86D 2V7UA 3CCUB 1PTOD 3ASRA 2A74C 3J81j 1VQ5B 1HZ9A 4ZK9B 2JA6G 2Q6LA 2H4OA 5ELNA 2K52A 1BQQT 1CNEA 4EX5A 2AHOB 1SFOH 1JWSD 1TKWB 1PFBA 4RJLA 2XZLA 4ZCMA 2CW0D 2NUCA 2QDXA 1H8EA 3AVTA 1N36L 2ZL6A 4B3TQ 4NXMQ 4R4IA 1WTHA 1FNDA 2CFMA 2GREA 2R7ZH 2PNHA 3M4PA 1TS5A 1FRNA 4UY8C 3U6KA 1CSPA 1MKHA 1DONA 4DK3C 2JYOA 2RCNA 1C8CA 1F20A 4HSVA 1D5MC 1KDAA 4KY7A 2I46A 1TVXA 3NBIA 4TMWA 1YVCA 5EAYA 1G7RA 1BF4A 3SK5A 4A3BH 5C4XG 1YHQB 2C78A 1ZM3A 4J8QA 2X8KA 2F0DA 1VQBA 1KHIA 1QVFB 4NNJA 2L0CA 3A0JA 1A2TA 3LQ6A 1PRTB 3K7AH 1CHQD 1KZLA 2F0SA 1VF7A 2ZM6L 1HNWL 4G4KA 4RD0A 3DM1A 2NVQB 1FNWA 3NHHA 5AN9A 3X3MA 3WBJA 3I7FA 4QGUA 1PV4A 5F4MA 4OHJA 1J5EL 5K5PA 5GV8A 1MD2D 4JVZA 2VBVA 4LF9Q 3CCJA 1QWYA 2Z6KA 2Q8TA 3ONYA 1VQNB 4DU9A 2ZL7A 1XXGA 5E7NA 4P22A 1G51A 1UE5A 2XNAC 2SOBA 1WI5A 2AWNA 3D6WA 4B43A 2KJXA 3VMFA 4ZRZA 1B70B 1EWYA 1UNSA 2D9RA 4Z1MA 4DK1A 4GKJQ 4GOPB 3ONUA 2N8NA 4JI4Q 5IYDH 1PRTD 3AVVA 2NB0A 3KOJA 4JBMA 5EMNA 4RD6A 2L12A 4GKJL 4RGOS 4TMXA 1TS3A 4Q0FA 2R6GA 4FXKC 4ODGA 3KUPA 3C2QA 2YWHA 3RNUA 1VQLA 4QL5A 5IYRA 1SNCA 4DV2Q 4DXFA 3G05A 2BH8A 2OYNA 1Q8KA 3TBIB 2CWPA 3CW2C 3ONAB 1DDGA 4EH1A 4DUYQ 4A3BG 1YNJD 1IZ6A 4XYOA 1G91A 3HZXA 3Q22A 2WAQG 1K0SA 5A88A 5IODA 2XZPA 2ZJPA 1KAAA 4AYBE 1G7CA 2DUDA 2WV6D 4WZLA 3BG3A 3M9BA 4M2LA 4QJFA 5GAHC 1KQSB 2WB1E 1SSOA 3A3GA 2F0VA 3P7JA 1IYJB 4R4QA 3MXPA 4DAVA 4OGQC 2K6AA 3P20A 1ZM9A 3CP2A 4DGZA 3KJPA 2PQEA 4ZLTF 1SMYD 5FO7B 1YI2A 4QUFA 2B8GA 2L55A 1YNJC 3VO2A 1IJFA 1NR4A 4QV2A 2G5DA 2SDFA 1I4RA 2PO4A 3CHBD 4J15A 4JOIA 5CV7A 1AZQA 4QVAA 4XMYA 1G2TA 2WB1G 1LT5D 3F2UA 5BR8Q 5C4JH 1F9QA 3W1BA 3OMGA 4JPBW 4JK1C 5D14A 2UUCQ 4CQJA 1VS0A 1RODA 4LF6L 1KAWA 5B6IA 3VYTA 3J7AF 1UD6A 1W2BB 1PH8A 2XZOA 3J80E 4RPDA 3K5MA 5FO9B 1GVPA 5A89A 4YWMA 1EFRA 1C7YA 1UD4A 2Q8RE 2C4UA 2IJ0A 3MC0B 4ID6A 2Q6KA 5FIUA 5T1IA 1YHQA 1I4QA 1CUKA 2O5JC 2K01A 4M0LA 4RMFA 3CCEB 3CRLC 3AEVA 4IW3B 2BMWA 2E2HB 3J81k 5C5MA 2V31A 1SE8A 2OTJA 3NENA 4DQLA 3E20A 3MWYW 3H6MA 5IY0A 3FP9A 4OIKA 2RF4A 2EFGA 3WQZA 5LMZA 1RDPD 1SBBB 3A5ZB 3WDNA 4Y7NB 4Z4YA 1OXSC 2B2TA 2EOTA 1JJCB 2I1LA 3K58A 2FJ2A 4C43A 3L3OC 3LVBA 4G1BA 4JI1L 4BS9A 5EBDA 5C3WA 4GKKL 2DNCA 1VCIA 3J7ZC 4JMQA 3H3VC 4ZQ3A 4YY3L 1VQKB 4QMGA 1EL0A 4BBRB 5AFWA 1DARA 1QE6A 1VQDA 2HCCA 4A3FG 4P72A 2VB3X 1YJNB 4M1KA 2R61A 2AQ1B 3BJUA 4A3MG 3J81L 1TWHB 4BY7B 2KENA 2AQ3B 1E1OA 3C1EA 4A3FB 2DGYA 1PJ5A 2EPBA 4RCNA 5LHY1 3KFUA 1U0LA 4XT1B 3U50C 2PMDA 1PH9A 4NW2A 3B8HA 1WSRA 1O7IA 3R3OA 3NPPA 1N34L 1WPCA 3CRKC 1XPUA 1N06A 3PUYA 4RHSA 2F0WA 5E4WC 1IYUA 5T1GA 3KLSX 2B2UA 3JQRA 4IUVA 1TT2A 2E5LL 2UUAL 2YTYA 3M3YH 1KABA 1P4MA 1P8LA 4HIDA 4UAIA 2B2YA 4B48A 1AMOA 2ZTEA 4RD3A 2NPFA 1ZM4A 1CM9A 1YLOA 2EYJA 1SLJA 4F88A 2E2IB 1XMQL 1T9HA 4BY1H 3QB3A 2UXBQ 3I4MG 2QA4B 1HZCA 2WINB 1DYQA 2VY3A 4JI8Q 2A68D 4EQNA 3PSIA 4TN1A 4RGNA 1V1PB 3G6JB 5IGDA 2PE3A 1MGSA 1Q82C 3HOXB 2HD3A 4A3KH 1A8PA 1DXMA 1VQOA 1CQFA 1WTHD 1WOOA 4ZCIA 4LBVA 4MYTA 3LGJA 1W34A 2CHBD 5KNLA 2GVBA 4A3MH 4H44C 4L6TB 4B08A 3R2IA 2JSOA 5CMDA 3S1QH 3E9IA 2F0QA 2JEBI 2RDGA 1Q82D 1W6KA 5JEAJ 3OW7A 5DS0A 3RY8A 1BBXC 2XNJA 1DCZA 5JOBA 4LBWA 3Q24A 1R4PB 2CK3A 1PJ7A 2YWGA 4TSSA 2Y0SE 2TSSA 2ENBA 1WD0A 2GJPA 4WZEA 1CZGA 4B47A 3W3AA 4DA2A 4J6HA 1Q7YD 4KY5A 2VNKA 4PC2A 2BVNA 5LMUL 3U4VA 1JWUD 1ASYA 3UE0A 4IO9A 3U9SA 1KD1D 3U2QA 2PNRC 2PYKA 4HSPA 4ACBA 3SEBA 4L5SA 4FF2A 2BGJA 4TRDA 4M4SA 2AWOA 4O1NA 1EP3B 1QX4A 4EVOA 4UZEA 1QGAA 1NE3A 3SDZA 2OT2A 5M5YH 2E2HH 1Q7YC 2CC2A 3KYHC 1JOQA 2DIEA 3GTPB 4UPAA 2ZZGA 2OK8A 4QB4A 2EQSA 3FDTA 1EU3A 3N6RA 2RC6A 3KLRA 1OGJA 2IL8A 2K03A 2F0FA 2UU9Q 1Q81D 1IW7C 4B9XA 2HHHL 2F1MA 3SK6A 1EEFD 1N07A 2A1AA 2F0IA 1S3OA 3CPFA 1KLUD 4HR7B 3PIO3 4B9WA 1PZJD 2M2LA 1NR2A 3CC4A 3MMPA 2B63H 3T53B 1KNAA 4YAWA 1PLFA 2BDOA 4N9PA 4ME3A 3OYYA 2C2WA 1Y8OB 1EOTA 2X6LA 1UAPA 4A3GG 5HURA 1N33L 2IX1A 3OZWA 4LF4Q 2MPMA 1Q9SA 2OBSA 3AVXA 1R5BA 2VQEQ 1HUNA 5EJWA 1D7QA 3NUCA 2BH2A 1EWCA 1VQ6B 2F4VL 4KKUA 4IOCA 1QFYA 2BSAA 3CTAA 4A76A 1M8AA 1VMPA 1B53A 3P26A 1GVHA 3HAGA 3N52A 3PENA 4JCVE 4AF6A 4A3GH 1BMFA 4JI0Q 1WTOA 1FVIA 2WB1B 4RCZA 3S1MH 4YIJA 1L1OA 3KF6B 5CV5A 5JJZA 3MA2B 2R93B 1EQQA 1YJWB 3CCVB 3QFSA 1H9MA 3KDFA 2RKSA 1V1OA 3V05A 1KC8D 1TWGH 4XT3B 1VMCA 4YHHQ 3RZDB 2EZVA 2EXDA 4BA1I 1D1KA 3Q6SA 1NB9A 4X7EA 4MNOA 3TEHB 5I9PA 5KIXA 2HT1A 4LF6Q 2BA0A 1VJSA 5TSSA 3SLDA 2GQFA 4RLZA 2DJFC 3LX0A 3R8BA 1XPOA 1DZ1A 1VQPA 4XLAA 3QFRA 1QZHA 2L9HA 2F0JA 1SNMA 2JA7B 4EGVA 1R5NA 2Q2HA 4AC9A 4P25A 3CP0A 5EKKA 4YALA 3WXMA 2IY5B 3J81i 5HKKA 1GUSA 2FINB 3MCAA 4FVMA 3A8IA 1S5DD 2XSCA 1EYDA 1BOSA 2HDLA 4ROXA 1B23P 3HKZE 1I50B 3OWEB 3Q0AA 3IL8A 3DEPA 4XKWA 4X05A 3CCSA 1MJEA 3TS2A 2WKCA 2JN9A 5IYPA 1EZ8A 5KNCA 4A3IB 2R92G 4HIKA 1X3FA 3TQYA 3H9NA 3CC2B 1C4QA 3IAYA 3OZUA 4F87A 4B44A 1VQIA 4Y7CA 2WR8A 1K28D 2TMPA 5ISRA 3TP5A 1U4PA 5G3LD 1E3PA 3R6KA 3OHXC 5D3IB 2BN4A 1NNXA 1VQHA 3IFDA 3K80C 5D3DA 2OTJB 1TWFB 1X54A 4JI3Q 2LKVA 1FJGL 1QOHA 4LC0A 2EJGC 2B2WC 2ZXOA 1PYSB 4HMJA 3M85A 4POGA 3PUNA 3M4QA 4XN0A 1QH0A 4PC1A 1OTCA 1NJIC 1BJKA 3I70A 2KHIA 4P74A 4P2NA 3GVLA 2CNDA 3PUWA 2NN6G 4OONA 4CBVA 2JIZA 1IKLA 4J0QA 2CH4A 1LTBD 2DY1A 3MXUA 4LUOA 3G6EB 2P5ZX 1MI2A 4HIOA 2EY2A 2B63G 3MEFA 1B2RA 1VQ7A 2N49A 1HFGA 5M3FH 1V0EA 2RA4A 4UAJA 5TR9A 1ENFA 4K2LA 5ELFA 1D5ZC 3D8GA 1G291 1NJID 3K59A 1YBYA 4L8JA 4ZUIA 1JB7A 1JJGA 4N9TA 2GVAA 4K8IA 4RHRA 5FLXE 4YEJA 1Y1WB 1KRHA 2YWEA 3DEOA 4ZCKA 1JOOA 4YHHL 1RF2D 4TVAB 4C1NI 1XMOQ 3W5UA 2VZAA 1F2MA 3PO3H 1KNEA 4WJ3M 1L1OB 3KF6A 2MUYA 3VNVA 2YYZA 4C3JB 4MTKA 5COYA 3VA7A 3JAME 2QA4A 4GN5A 5C3EG 2VW9A 1AIPA 4K6DA 3FPUB 1E0BA 3RLOA 4P26A 5M3MH 2DEUA 3GVJA 2KCNA 3NE5B 4A3IG 2VNHA 1W3SA 4O42A 1M4VA 3ZPNA 1A3VA 3P1HA 1HZEA 1A2UA 5IE8A 3J81c 4UP7A 1QVGA 3PGZA 5I4DA 3VA5A 5DNFA 2V7XA 2Q2UA 4GN4B 5IT9E 1G8ZD 1H9JA 2NTSA 5C3EH 4B3TL 4KN4C 1N36Q 3CCRB 3GVKA 1LTSD 4KN7C 3QOLA 2JN4A 5AJ3L 4FNFA 4BA2I 4A93H 1QUQA 3RN5A 5ELCA 3CCLA 1HCZA 1CT1D 3K0XA 3WWVA 4PAAA 2JA8H 1TWGB 3RZDH 3T56B 2YV5A 4RCOA 1EIHA 4DR5L 4PC7A 3CF5A 2VJJA 3JAML 3DM3A 2RQXA 1IBKQ 1F9RA 5IGEA 3OEHA 1D8TA 1K8AD 2EDGA 2R7FA 1MJCA 3MZ5A 2PQAA 2E2JH 3KLSA 3SE0A 2NVTH 1SE3A 3CC2A 1BLIA 3S1RB 1XX8A 3PCOB 5IOCA 1S40A 2R93G 2R92H 5M3FG 4H0LC 3GTJB 4IUUA 4QF4A 4FF4A 2WYRA 2ZTNA 3I4MB 4IPDA 1N8RD 3S1NH 1GKHA 1DM0B 4A3EB 3VYRA 2XGJA 1GUOA 3L0OA 3QR8A 5IYBG 1RIPA 3BDOA 4EQ5A 2YU9H 3I72A 1BKBA 4C3IG 3ZBUA 4LJZC 3S16B 1EQVA 2PZTA 1D1NA 5C4HA 3DHQA 2WZPP 1H9KA 5TV2A 1ZYRC 3G4SA 2NZ1D 1S5CD 2C5BA 1LTGD 2UXCL 4DF7A 3Q39A 3KJOA 3G71A 1VQ4A 1N8RC 4LF7L 3VO1A 3BNWA 2JA5B 1SJHD 4N3NA 5FNZA 3TREA 3V76A 1CI3M 1VQEA 4YCVA 4C56C 1RTOA 4GNXC 1SMYC 4HN7A 1X9NA 1K0RA 1XNQL 1NUCA 4PZ6A 2O5IC 3HGBA 4LF5Q 3HFZB 1T6YA 1E63A 2VUMB 3BVGA 3NP8A 1EZ6A 5E3FA 3U58A 4ZAIA 3E0JA 3ASSA 2WPDA 1I5FA 2PMZB 3SK4A 5IWAQ 3K57A 1ML0D 1UE7A 1NSNS 4JI6L 5KYIA 3GV6A 3IFTA 3G6EA 1A6XA 4OPVA 3A8JE 4CDEC 2C9OA 2FFKB 3AMUA 2DOGA 1G7TA 2KQ3A 4XOTA 4OPOA 5FLXL 1XFOA 4AIMA 4Y7NH 1VHEA 1MIUA 5IWAL 1IHMA 2EYMA 5JPNC 4B4DA 1RQRA 1Y1WH 2A6ED 3CCEA 1WTQA 2CW5A 1D1IA 3S2DH 2UXBL 4BBRH 3CC4B 2FVGA 1GO2A 3VYSA 2X6XA 4FO2A 1XNQQ 1TWHH 2DY8A 1STAA 2EVBA 2M00A 5A35A 4UZFA 3F2DA 2VS1A 2QGQA 1J9ZA 2B5OA 2NZOA 3AGPA 3MXNA 1YIJA 2ASBA 3Q8DA 3AVUA 2ZZQA 1UUPA 1Y1WG 4ASUA 3GTMB 4OXPA 4HJ9A 1VQKA 2C77A 3Q23A 4DK6C 1M1KC 3DMUA 1JORA 2HCIA 4N3GA 4P3YA 4MZ9A 2NVYH 2XTIA 2EY5A 3S2HH 1R5OA 4NKLA 1BX0A 4X64L 2X0KA 1PH7A 5K36G 2R9VA 5C3EB 4IFDG 2O4XA 3CU7A 1CKOA 5TY0A 3S14H 3OOCA 4XL9A 1LT6D 2CF4A 2ZJRA 5CR3A 5F2DA 1J9OA 4Z4VA 1A8VA 2AKWB 2JP1A 2I0QA 1W2BA 1KK2A 4BY1B 1BCPF 3M4YA 2MGSA 1PMRA 3BYYB 3PUVA 4YY3Q 4ZGNB 4LFBL 3OFNA 2CBXA 3K0YA 4YCUA 5D65A 4GKKQ 3PIP3 3WY9A 2KCMA 2E2JB 1RL2A 2WACA 1EY7A 2L5TA 3RUZA 3J7AV 3D0FA 2F3IA 4IFDI 4WJ4A 3ULLA 2XRQD 5C44B 2QTLA 3GTJH 1GJRA 1EP2B 4A3DG 2L15A 3TP6A 2ZITA 5EPKA 2EYHA 2Y0SB 3PA2A 4IZ8A 2D3NA 5LMNQ 4L5RC 4EQPA 2F0PA 2K75A 4MTNA 4JYAQ 4P2CB 3MXNB 3RLFA 3JAMc 2C5HA 1WYDA 1CK1A 2NV4A 4FXUA 1TXYA 3DDYA 4OO1G 4DNIA 2PI2A 2Q6OA 3U9OA 3C46A 1EFTA 4C3HB 4MIUA 2WKDA 4PZ8A 4X64Q 3S24A 3CMEA 2F0KA 2V7TA 1KL9A 4PC3A 3AVYA 2ZT9C 3GTKH 3PIOA 2VNIA 3CESA 1OXUA 3EN2A 2OCEA 4X3UA 4A3EG 4QUZA 3NEMA 5GADC 3PVDA 2IX0A 3Q6RA 1K3RA 1B44D 1IBLL 2K05A 3NSWA 1BR9A 4HE6A 3ZJYC 4OPSA 5H59A 3CCSB 3GTLH 4BBSG 3S15B 5C0XG 5KW9A 1CA5A 3CCQB 3STBC 5C44G 4DV4Q 5I2XA 3GTQH 4Q5VA 3PO2B 5EKLA 3I3CA 3KK7A 2KEEA 4ME5A 3CW2A 1SFOB 4YAFA 4OP7A 4FN5A 1I6VC 2BCOA 4Z9CB 3OKXA 2LFNA 1PH2A 2V7QA 3FPKA 1KD1C 1N0VC 2VBSA 5LL6S 5I9OA 4JG2A 3Q6QA 2K5VA 1R4QB 2GK6A 1T6XA 3FJOA 4X07A 3I4OA 4K14A 1NBMA 1A62A 3HOVG 1T5XD 1GAQA 1MBYA 2JXMB 2BPOA 3TN2A 1HR0W 4X62Q 1D2BA 3BY1A 3W2DA 3HOVH 1B50A 4ZUJA 3OWFA 1Q1BA 5FLMH 4X06A 3BS1A 4JOIC 4RA8A 1S5BD 1EUJA 2EE1A 4K1XA 2XNDA 5H5JA 5EBCA 4DNRB 4B3RQ 3D6CA 3X3NA 2Z0SA 1JICA 2JK8A 3SGIA 3K7AB 1E79A 1FJGQ 3K5OA 3QG1A 1G2SA 2EJMA 2CKZB 5GAEC 1WSVA 1CHPD 4LBZA 3W2HA 4K5XA 4GNXA 2X53S 3DWPA 3CCMB 2UXDL 3AFQA 1QILA 3J80c 3IKJA 5C0XI 3OW2B 2HQEA 3SHLA 1NB0A 3DUZA 3JAMi 1SJED 1IL2A 1H9SB 1DD2A 1FGBD 2E74C 3TMEA 1JOKA 3H0GB 2RHQB 3A8KA 3ASTA 4PV1C 4OO1H 2PQAB 4C3IH 2JA6H 1QGZA 2KVMA 5M5XH 1Z9FA 3O13A 3BVMA 4KD3A 3EBEA 2PZUA 5GV7A 2QCPX 3KBXA 4KMUC 1E1TA 1XYIA 3CCLB 2WFWA 1KQSA 4FK8A 4ZYSA 3OSOA 4U68A 4EQOA 2EYOA 3RR5A 2CH4W 1SYCA 1VQ9B 2DY7A 2F0EA 3CMEB 1FL0A 2A69C 4POFA 3EJIA 3K5NA 1FDRA 1XB2A 2OK7A 3HKSA 1I4HA 1Y14B 2QGGA 3NWSA 4HIZA 2JA7H 4DR5Q 3OZVA 5I2YA 3CP8A 1SAPA 2CVRA 4NXML 1VQAA 2VJIA 3BZKA 3M4OB 4G7WA 3A8KE 2PW5A 4O2DA 4GNXB 3NWTA 5CDFA 1L0WA 1K83H 3ERQA 4E6IA 1QFJA 2A8VA 1JJ2B 1I50H 1QUFA 3LWEA 1QUEA 1Y1VG 3VNUA 4G1VA 3CCQA 1K8AC 4KLKA 4GZYC 2D62A 4OEMB 1XNRL 4QQBX 5C4XB 5C6AA 4X0CA 2HMAA 1BCPB 4X65Q 1STNA 1Y1VB 1W35A 3OPOA 3SVMA 1PTOH 4H13C 1HTLD 2NN6H 2HQLA 1PA6A 1TIID 4XQFA 2RVLA 2W6JA 3KDFB 2BM1A 4KTAA 5C4JB 4DR1L 2FXQA 3I4NB 3T1YL 2O2LD 1YITA 2QF7A 2OBRA 4C3HG 3GTLB 3S15H 4OWXB 1A3UA 2Z8LA 2E76C 1B9NA 3H0GG 2ZZEA 1JC7A 1V1PA 3GD7A 1S5ED 1ILPA 3OJXA 1N9WA 4BXXG 1D5XC 4WRDA 1STGA 1PH6A 4KHZA 4K5WA 1MHWC 1XTCD 4K0KL 4IFDJ 1XTDA 1NAPA 3I91A 4LBYA 2ALYB 4DAPA 3MAQA 4DV1Q 5CGKA 4WZTA 3JC66 1QVGB 1Z6HA 3RD4A 1HR0L 5A8AA 3J7A5 1I6HB 3TZDA 2WIIB 4X7CA 4A3CG 3KEWA 1HNZL 3TSSA 2RSOA 3HOUH 1ICFB 2QDLA 5IP9G 2XRSD 2KA7A 1S72A 1PH3A 3ZBTA 2K5HA 1F9SA 3H3VI 3V96A 3PMFA 2XWJB 4A3BB 1PZID 2PMZE 1TQOA 3ERSX 4B3XA 2PW7A 4H02A 1XWEA 5LMUQ 1MRZA 4NBSA 4AVZA 4PZ7A 2KECA 1OB2A 2D9UA 4JI3L 2QE7A 1JT8A 3M7NA 3QE2A 2Z1CA 1N32Q 3MHBA 3FKSA 2K14A 2Q2TA 4Y9UA 3G4SB 4XONA 3SJPA 5C0XH 2K50A 1LYLA 1X32A 4P75A 2B3GA 3GTGB 3JQPA 4R4TA 1EIYB 2JA6B 2ZZFA 4OOXA 5BN5A 1LLRD 4KKTA 4B3SQ 5FO8B 1TWAB 1RD9D 4PNYA 3DLLA 4X62L 3WBKA 2QILA 1VQLB 1E64A 2JA8B 1BUVT 4LUZA 1SYEA 1U2RA 2F4IA 2K28A 3I8ZA 1DOKA 3R6JA 3CMAB 1E2ZA 2B2TC 4CGYB 4NCNA 4M53A 1O7ZA 2NYZD 1IBML 2HDNB 1TU2B 3QFTA 1B4OA 1F2YA 1V5VA 2Z9HA 4PQXA 3S1RH 3RZOB 4UDUC 1QGYA 4HMIA 3T4AC 1ELOA 1AZPA 1WTXA 1HZAA 1UD3A 1XMQQ 2B2VA 5JJLA 2WAQE 4GLVB 4OOVA 3I73A 5J39A 3I56B 1WP6A 2AUKA 4AQYQ 3BCFA 4WZKA 3NBHA 3AVWA 3K81C 4HJ8A 1BBWA 1PFNA 5JBQA 5JJIA 1X65A 1EWIA 3F1ZA 1IBLQ 1KK1A 2MP1A 4OX9Q 1U5KA 5HGTA 4Y52H 5J3OA 1SNDA 5C5LA 3PF5A 2UUBQ 3JQQA 4XLCA 3ZIAA 4JI0L 2F0LA 4K8JA 2JA9A 2RSNA 4NP5A 4UP8A 5FKAC 4KHPQ 1Y1VH 1D6EC 1V0FA 3QSYA 1SKQA 4UZUA 1WTVA 2JA5H 1I3QB 1SYBA 1QB5D 3HOZG 4ILWA 3I4NH 1CQXA 4A75A 1GUWA 5EQ0A 2F4VQ 1ZYRD 3HOYB 1Q86C 3H3VH 2KVOA 1YITB 1QNKA 4FF3A 2K5WA 1I7PA 1WOSA 1EOVA 2X6WA 2FHTA 2OQ0A 3HOZB 2PLFA 1GJXA 3VYUA 3H94A 1AEXA 3G71B 1STEA 4YWLA 4JW0A 2MNAA 1E43A 2PIAA 5JVG3 2F3WA 1E3ZA 2CCZA 5I6WA 1EY4A 3I4NG 4V0BA 1OB5A 4IUNA 4F7DA 4XTCS 1X6OA 1S0UA 2ID0A 1SYFA 1CZWA 3L2PA 1L0XB 4MHEA 1AW7A 4LF8Q 3WNBA 2MFIA 1SXTA 1E1RA 3MVVA
chains in the Genus database with same CATH topology
4I7ZC 1PDQA 2JE6I 4WJWA 3HOUB 2RDFA 4KKSA 1U4LA 2SNMA 2NN6I 3D31A 3NTKA 1SDFA 1KMHA 4FP5D 4XKVA 3MFYA 2X69A 3DWAA 2ZXIA 1WTPA 4X3SA 2OXPA 4II2A 5BN3A 2IT1A 2B39A 1ESFA 1H9SA 4RFBA 1EIGA 3L9AX 1HA6A 3JU4A 4HTHA 2D3LA 1LTRD 5IT9L 1BPLA 3E5SA 2MJ8A 2EYPA 3T16A 1SE4A 2FMCA 2PZWA 1DOMA 4K6LA 1KTKA 1GHJA 4RAUC 5CBEE 4C3JG 2F03A 4H7BA 3NTHA 1HRJA 1W6JA 1F9PA 2G9DA 4E0FA 1OXTA 2NTTA 2WAQB 3LNNA 4CJ1B 4DNTB 4G7ZC 5KNBA 4TQUS 2E1BA 3CKIB 3SXHA 1F77A 4OL7A 4RWSC 1LABA 1BCPC 2VNUD 3MXGA 4WORA 1TS4A 1Q90A 1GUGA 1WVLA 3VR4A 4G7OC 3ZYYX 3GTQB 5J22A 1T5EA 1BCPD 1MSGA 3OE7A 1ZEQX 4XQNA 2F43A 4U673 3NTIA 2R7ZB 2EJFC 1ENAA 3R2TA 3KBGA 3FMCA 1C48A 3ND8A 2JJ1A 3AU7A 4XQQA 2F0HA 4LAAA 1RTNA 1LO5D 3OAAA 3FPPA 1B9MA 3BDLA 5KNDA 1OXXK 1B3AA 4G57A 2F0GA 2D2CC 2WJVA 3DWQA 4IUQA 1IKMA 3MEHA 4XDXA 1HFNA 1LTAD 1EY5A 2A69D 4XXEA 4QUCA 2BE5D 2E2DC 2XN9C 5CV4A 4IUTA 4JBWA 4A3GB 3S1MB 3FRPB 4A93B 1QNUA 3EVQA 2ZXHA 1YNND 5JPMC 3VR6A 1SE2A 5A2QL 2EY1A 3FKIB 2A68C 1LACA 5CYUA 2BE5C 1R9TB 4G6IA 5EGTA 2WP8J 4A3KB 1KLGD 4K2KA 2R92B 2DNEA 2JJ2A 2M5SA 1EY8A 2KCCA 4PMCA 1STHA 4A3MB 3GQBA 2CQAA 1W0KA 2YU9B 3URYA 1E2VA 3QO2A 1B1ZA 1LTTD 1AN8A 1HQMC 3V2TA 1JE4A 2NVXB 1I4XA 1JR0D 1PTOB 1IHZA 4I65A 5J1ZA 4OIJA 1JWMD 2ZXRA 1OB0A 1NCVA 1Q3LA 3TZUA 1GHKA 2DN8A 5EKIA 5EPLA 2NWGA 1CQVA 5E4XA 5IK2A 3I90A 4HEDA 2NBFA 2RBMA 3OIQA 1FNUA 4IUPA 3HRZC 1PXUA 3C3LA 2F3VA 4IFDH 2IWHA 1A15A 2HDMA 1ILQA 2F0NA 4DAYA 5FL7A 2L4NA 2XIWA 3A7LA 5JEAH 2LS01 1Q1EA 3T13A 5CV9A 2Q8IB 2L1BA 2OEOA 1J8IA 4QIWB 2HLDA 3BCDA 2N88A 1LT4D 3A7AB 5M3MB 1QJOA 1F2ZA 4IN3A 1EQTA 2GJKA 4DK0A 1SYGA 1H9RA 2NVYB 2IW3A 2VXWA 1HXYD 5C4ZA 4XN3A 4B3GA 1U9RA 3ITPA 2K33A 3A56A 5DAUA 2HUGA 3T51B 3SR1A 4LMQD 1WCMB 4NMZA 2FMMA 1ESRA 2XVSA 1RHPA 3CMMA 1V43A 1MSHA 4A3JB 4CJ0B 3C2PA 4DN4M 4IURA 2BOSA 1ZXTA 4XQJA 1KDCA 3GP7A 1I4GA 2EYFA 1LV9A 1H8HA 3QIAA 2IX3A 1Y8NB 1EWHA 2A5HA 2RDHA 1DJRD 3S1QB 1WD1A 1GXDC 4CHTB 4KV6A 4CKBA 4ZKBB 4XR6A 3AB9A 2G9HD 4R9WA 2K1BA 1PFMA 1PTOC 1LTID 5CV6A 2MHVA 3HOWB 4HCEA 4NDXA 5ELEA 4F7XA 1TR5A 2CW0C 1II3A 1NRKA 1SKYB 1ZKOA 2I07B 5IGGA 3BH4A 1X3QA 1Z7TA 5EPJA 5M9OA 1OO9B 3MFGA 4FXGC 1TY0A 1VF5C 4PMBA 3J80L 4RH6A 2B2UC 2AUJD 1SEBD 5M3FB 5M5YB 3BDCA 3OIPA 3LWUA 2B2YC 3NK9A 2E75C 1SYDA 4HCSA 5M5WB 2XOKA 3J7YW 1HVXA 3A8IE 3ND9A 2BA1A 3HS0C 1Z47A 4X3TA 4DXGA 2VB2X 4C1NK 1IL8A 2A6EC 2K04A 2B63B 3PO3B 1UD5A 2JEAI 5IGCA 1PYWD 4CKCA 3TP7A 1EY9A 4J1MA 3NXWA 1Q8IA 1I18A 2ZXPA 2F0UA 1OHHA 1O7YA 1EEID 4TKOB 1F2LA 1STYA 1PRTC 2X6YA 4XOPA 4V190 4RGTA 1SNPA 2B8FA 5I6YA 4F8MA 3G7LA 2K32A 2SEBD 4IQZA 2B2WA 3HG9A 3HKZB 5DEHA 3EROA 2KUMA 5FK9C 1W0JA 4G7XA 2J7ZA 2NVTB 1V8QA 1ICWA 3HEJA 5KYLA 2IPKD 4XNFA 1K8MA 3D4RA 1IYVA 2F0OA 1EFID 1K83B 1EY6A 2PPBC 1GUNA 5BN4A 3FVQA 3NQTA 3H91A 3P75A 3QWNA 3QJYA 2L11A 3A35A 2EXZA 4RKLA 2D5DA 5KEEA 1I4PA 4XORA 3R93A 2KEDA 5JEAG 4XLHA 4XIGS 1HQRD 1RCVD 5FOBB 3GTOB 5C0XJ 1G6ZA 4XLEA 1HA5A 2LMCB 3M7GA 3H09A 4ZKCB 4R8IA 1QG7A 2OF1A 2R3ZA 2GA4B 5CBAE 3DXJC 1RKNA 4ULLA 1CFMA 4KJOA 3UI2A 2Z4IA 5CC4A 4TT3A 4B3FX 4A3DB 4LK1C 5K36H 1B2TA 4BWGB 4YELA 4KJNA 3WOEA 3TP8A 3EA6A 3VR3A 2GK7A 5LL6X 1SNQA 3K5LA 3S2DB 4X3KA 1E1QA 1HHVA 3K6OA 1U4RA 4C2MB 4QCLA 1PKVA 5A2QE 4GQNA 2Z4HA 5ELDA 2PCFB 2SNSA 1O7LA 3S17B 1FYCA 2C5CA 2WSSA 4YXWA 2K7VA 2N55A 2K5QA 5IGFA 2ICIA 4WFN3 3S14B 2W6IA 5CV8A 3M3YB 1GUTA 1ET6A 1U4MA 5DN6A 3QOJA 3VR5A 2LY7A 4K5VA 5JAVA 3D4DA 1AP0A 4S3SA 3BVZA 2EYLA 1FNVA 2H1EA 1PTOF 1YNNC 1X3PA 4MN3A 2V4DA 1KDBA 3BC9A 1S4ZA 3GV3A 1PZKD 1SNOA 1VLYA 4AYBB 1K8OA 1BO0A 3S1NB 2M9VA 2XWBB 4TSFA 2X6GA 2WJYA 1EYAA 4M1UB 1HPCA 1OXVA 3EFXD 4L63B 2A73B 3OEEA 1STBA 1DOLA 3GTKB 4KY6A 1UD2A 1VDZA 1FD7D 2ZTGA 5C3XA 1JCKB 1UD8A 1EU4A 2KOLA 1WTRA 1E2WA 1S5FD 4IALA 1RJTA 4R8NA 1ENCA 1PRTF 3A3BA 3D3RA 1UEAB 1Y69U 5NUCA 4RGMA 3E6ZX 1HTPA 3RMHA 2B2VC 3PUZA 2GJRA 5CORA 3S9WA 1JB3A 3NQIA 2K5DA 4KHVA 3HOVB 5IIFA 5KRUA 1CA6A 3VR2A 4ABNA 3L7ZC 3J81E 4KD4A 5G3LF 2LZJA 1EY0A 3PUXA 4HAEA 1O80A 4FYDA 4RKBA 3EQLC 5DM73 1MABA 1GOZA 4OO1I 5ELBA 5KGUA 4XYQA 1A3TA 1ONLA 3A55A 3HP3A 1IW7D 1BXTA 1L0YB 3A54A 3PV0A 1FX0A 4KI0A 4C3IB 5IGBA 3S2HB 1HUMA 1Q12A 3D4WA 2Z6BD 1LT3D 4M8AA 5M5XB 3TDQA 1EYCA 3FEWX 1FR3A 4II3A 2J0TD 1TY2A 2A6HC 1ET9A 4XD7A 2JDIA 2ICEC 1O78A 4BBSB 2F0TA 1W9XA 1BNZA 1Y8PB 3I4LA 4DFAA 2F0MA 1TS2A 3KF8A 2KHSA 1CTMA 3C1FA 3GO5A 3SK8A 2QKIC 2QEJC 2A6HD 1BDOA 1I8DA 3MTSA 2EY6A 5DM63 1QCBD 1E3XA 4FF1A 4PMWA 4KK7A 4XLFA 5E1FA 4G7HC 3OMCA 2J4XA 1JQYD 3BYTB 3BZDB 2AQ2B 4FXDA 1WTWA 1TWCB 3WOFA 4CJ2C 1COWA 3CQZB 2X85A 5JVH3 2BDNA 1AFPA 2QDBA 4XM3A 4CKEA 1PTOD 2A74C 4ZK9B 2H4OA 1BQQT 1JWSD 2XZLA 1PFBA 1TKWB 2CW0D 2NUCA 1H8EA 1TS5A 1DONA 2JYOA 1C8CA 4HSVA 1D5MC 1KDAA 4KY7A 2I46A 1TVXA 3NBIA 1BF4A 3SK5A 4J8QA 2X8KA 2F0DA 4NNJA 2L0CA 1A2TA 1PRTB 1CHQD 1KZLA 2F0SA 1VF7A 4G4KA 3DM1A 2NVQB 1FNWA 3NHHA 3X3MA 4OHJA 5K5PA 1MD2D 1QWYA 2Q8TA 4DU9A 1XXGA 4P22A 2XNAC 2SOBA 2AWNA 3D6WA 2KJXA 4ZRZA 1UNSA 4Z1MA 4DK1A 1PRTD 2NB0A 2L12A 4RGOS 1TS3A 4Q0FA 2R6GA 4FXKC 4ODGA 3KUPA 1SNCA 4DXFA 3G05A 3TBIB 3ONAB 1G91A 1YNJD 4XYOA 3HZXA 3Q22A 5IODA 2XZPA 1KAAA 2WV6D 3BG3A 1SSOA 3A3GA 2F0VA 3P7JA 4DAVA 3MXPA 4OGQC 2K6AA 3P20A 3CP2A 4DGZA 2PQEA 4ZLTF 1SMYD 5FO7B 4QUFA 2B8GA 2L55A 1YNJC 1NR4A 2PO4A 5CV7A 2SDFA 1I4RA 3CHBD 1G2TA 1AZQA 4XMYA 1LT5D 3F2UA 1F9QA 3OMGA 4JK1C 5D14A 1RODA 3VYTA 3J7AF 1UD6A 2XZOA 3J80E 3K5MA 5FO9B 1EFRA 1UD4A 2Q8RE 2IJ0A 3MC0B 4ID6A 5T1IA 1I4QA 2O5JC 2K01A 3CRLC 2E2HB 5C5MA 2V31A 3MWYW 3H6MA 4OIKA 3WQZA 1RDPD 1SBBB 3WDNA 4Y7NB 1OXSC 2B2TA 2EOTA 3K58A 2FJ2A 3L3OC 4BS9A 5EBDA 5C3WA 2DNCA 1VCIA 4JMQA 3H3VC 4ZQ3A 4QMGA 1EL0A 4BBRB 5AFWA 1QE6A 2HCCA 2VB3X 2R61A 2AQ1B 3J81L 1TWHB 4BY7B 2AQ3B 3C1EA 4A3FB 4RCNA 2EPBA 5LHY1 4XT1B 4NW2A 3R3OA 3NPPA 1WPCA 3CRKC 4RHSA 3PUYA 5E4WC 2F0WA 1IYUA 5T1GA 3KLSX 2B2UA 4IUVA 1TT2A 1KABA 4UAIA 2B2YA 1CM9A 2EYJA 4F88A 2E2IB 3QB3A 2WINB 1DYQA 2A68D 4EQNA 4RGNA 1V1PB 3G6JB 5IGDA 1MGSA 3HOXB 1DXMA 1CQFA 1WTHD 2CHBD 5KNLA 4H44C 4L6TB 4B08A 3R2IA 2JSOA 5CMDA 2F0QA 2JEBI 2RDGA 1W6KA 5JEAJ 3OW7A 1BBXC 1DCZA 5JOBA 3Q24A 1R4PB 2CK3A 4TSSA 2TSSA 2ENBA 1WD0A 2GJPA 1CZGA 3W3AA 4DA2A 4J6HA 4KY5A 1JWUD 3U9SA 2PYKA 2PNRC 4HSPA 3SEBA 4FF2A 4TRDA 2AWOA 4O1NA 4EVOA 3SDZA 2OT2A 1JOQA 2DIEA 3GTPB 2ZZGA 4QB4A 3FDTA 1EU3A 3N6RA 3KLRA 2IL8A 2K03A 2F0FA 1IW7C 4B9XA 2F1MA 3SK6A 1EEFD 2F0IA 1KLUD 4HR7B 3PIO3 4B9WA 1PZJD 2M2LA 1NR2A 3T53B 1KNAA 1PLFA 2BDOA 4N9PA 1Y8OB 1EOTA 2X6LA 1UAPA 5HURA 2IX1A 2MPMA 1HUNA 5EJWA 3NUCA 1EWCA 4KKUA 1M8AA 1VMPA 1B53A 3HAGA 3N52A 1BMFA 1WTOA 2WB1B 4YIJA 5CV5A 5JJZA 3MA2B 2R93B 1H9MA 2RKSA 1V1OA 3V05A 4XT3B 3RZDB 2EZVA 1VMCA 4BA1I 1D1KA 3Q6SA 5I9PA 5KIXA 2BA0A 1VJSA 5TSSA 3LX0A 3R8BA 1DZ1A 4XLAA 2L9HA 2F0JA 1SNMA 2JA7B 4EGVA 5EKKA 5HKKA 1GUSA 2FINB 4FVMA 1S5DD 2XSCA 1EYDA 1BOSA 2HDLA 1I50B 3OWEB 3Q0AA 3IL8A 3DEPA 4XKWA 2WKCA 1EZ8A 5KNCA 4A3IB 3IAYA 1C4QA 4F87A 1K28D 2TMPA 5ISRA 3TP5A 1U4PA 5G3LD 3OHXC 5D3IB 3IFDA 5D3DA 1TWFB 2LKVA 1QOHA 2EJGC 2B2WC 2ZXOA 4HMJA 3M85A 4XN0A 3I70A 3GVLA 3PUWA 2NN6G 4CBVA 2JIZA 1IKLA 1LTBD 3MXUA 1MI2A 2EY2A 1HFGA 1V0EA 2RA4A 1ENFA 4K2LA 5ELFA 1D5ZC 3D8GA 1G291 3K59A 4L8JA 4ZUIA 4N9TA 4RHRA 4K8IA 5FLXE 4YEJA 1Y1WB 3DEOA 1JOOA 1RF2D 4C1NI 1F2MA 1KNEA 2MUYA 2YYZA 4C3JB 5COYA 3VA7A 3JAME 4K6DA 3FPUB 1E0BA 3GVJA 2KCNA 3NE5B 4O42A 1M4VA 3ZPNA 1A3VA 3P1HA 1HZEA 1A2UA 5I4DA 3VA5A 5DNFA 5IT9E 1G8ZD 1H9JA 2NTSA 4KN4C 3GVKA 1LTSD 4KN7C 3QOLA 4FNFA 4BA2I 5ELCA 1HCZA 1CT1D 1TWGB 1EIHA 3T56B 4RCOA 2VJJA 3JAML 2RQXA 1F9RA 5IGEA 3OEHA 3MZ5A 2EDGA 3KLSA 3SE0A 1SE3A 1BLIA 3S1RB 1XX8A 5IOCA 4H0LC 3GTJB 4IUUA 4QF4A 4FF4A 2ZTNA 3I4MB 1DM0B 4A3EB 3VYRA 2XGJA 1GUOA 3BDOA 3I72A 4C3IG 4LJZC 3S16B 1EQVA 2PZTA 5C4HA 3DHQA 2WZPP 1H9KA 1ZYRC 2NZ1D 1S5CD 1LTGD 4DF7A 2JA5B 1SJHD 1CI3M 4C56C 1RTOA 1SMYC 4HN7A 1NUCA 2O5IC 3HGBA 2VUMB 3BVGA 3NP8A 1EZ6A 5E3FA 4ZAIA 3E0JA 2WPDA 2PMZB 3SK4A 3K57A 1ML0D 1NSNS 5KYIA 3GV6A 3IFTA 1A6XA 3A8JE 2C9OA 2FFKB 3AMUA 2KQ3A 4XOTA 5FLXL 2EYMA 5JPNC 2A6ED 1WTQA 1D1IA 3VYSA 2X6XA 4FO2A 2DY8A 1STAA 2EVBA 2M00A 5A35A 3MXNA 2ZZQA 1UUPA 4ASUA 3GTMB 3Q23A 1JORA 3DMUA 2HCIA 2EY5A 4NKLA 5K36G 2R9VA 5C3EB 4IFDG 2O4XA 3CU7A 3OOCA 4XL9A 1LT6D 5CR3A 5F2DA 1J9OA 2JP1A 4BY1B 1BCPF 3M4YA 2MGSA 1PMRA 3BYYB 3PUVA 3OFNA 3K0YA 5D65A 3PIP3 2E2JB 2WACA 1EY7A 2L5TA 3RUZA 3J7AV 4IFDI 2XRQD 5C44B 3TP6A 5EPKA 2EYHA 2Y0SB 4IZ8A 2D3NA 4EQPA 2F0PA 4P2CB 3RLFA 1CK1A 4FXUA 3DDYA 4OO1G 3U9OA 3C46A 4C3HB 4MIUA 2WKDA 2F0KA 2ZT9C 3CESA 1OXUA 4X3UA 2IX0A 1B44D 2K05A 3NSWA 1BR9A 3S15B 5C0XG 1CA5A 5I2XA 4Q5VA 3PO2B 5EKLA 3I3CA 3KK7A 2KEEA 4ME5A 1SFOB 1I6VC 4Z9CB 2BCOA 2LFNA 2V7QA 5LL6S 5I9OA 1R4QB 2GK6A 4K14A 1NBMA 1T5XD 1MBYA 2JXMB 3TN2A 1D2BA 3W2DA 1B50A 4ZUJA 3OWFA 1Q1BA 3BS1A 4RA8A 1S5BD 2EE1A 2XNDA 5EBCA 4DNRB 3D6CA 3X3NA 1JICA 3K7AB 1E79A 3K5OA 3QG1A 1G2SA 2EJMA 1CHPD 4K5XA 2X53S 3DWPA 1QILA 3IKJA 5C0XI 2HQEA 3SHLA 3DUZA 1SJED 1H9SB 1DD2A 1FGBD 2E74C 3TMEA 1JOKA 3H0GB 4OO1H 4PV1C 2KVMA 3O13A 4KD3A 3BVMA 2PZUA 3KBXA 2QCPX 4KMUC 1XYIA 4ZYSA 3OSOA 4U68A 4EQOA 2EYOA 1SYCA 2DY7A 2F0EA 2A69C 3EJIA 3K5NA 1I4HA 3NWSA 4HIZA 5I2YA 3CP8A 1SAPA 2CVRA 2VJIA 3M4OB 4G7WA 3A8KE 2PW5A 3NWTA 5CDFA 3ERQA 4E6IA 3LWEA 4GZYC 2D62A 5C4XB 5C6AA 1BCPB 1STNA 1Y1VB 3OPOA 3SVMA 1PTOH 4H13C 1HTLD 2NN6H 1TIID 4XQFA 2RVLA 2W6JA 5C4JB 4KTAA 3I4NB 2O2LD 2QF7A 4C3HG 3GTLB 1A3UA 2Z8LA 2E76C 1B9NA 2ZZEA 1JC7A 1V1PA 3GD7A 1S5ED 1ILPA 1D5XC 4WRDA 1STGA 4KHZA 4K5WA 1XTCD 4IFDJ 1NAPA 3I91A 4DAPA 3MAQA 5CGKA 1Z6HA 3RD4A 1I6HB 3TZDA 2WIIB 3KEWA 3TSSA 2RSOA 2XRSD 2KA7A 1F9SA 3V96A 3PMFA 2XWJB 4A3BB 1PZID 1TQOA 2PW7A 1XWEA 4AVZA 2KECA 2D9UA 2QE7A 3M7NA 2Z1CA 3MHBA 3FKSA 4XONA 5C0XH 1X32A 3GTGB 2JA6B 2ZZFA 5BN5A 1LLRD 4KKTA 5FO8B 1TWAB 1RD9D 4PNYA 2QILA 2JA8B 1BUVT 1SYEA 2F4IA 2K28A 3I8ZA 1DOKA 1E2ZA 2B2TC 4CGYB 1O7ZA 2NYZD 1TU2B 1B4OA 1F2YA 4PQXA 3RZOB 4UDUC 4HMIA 3T4AC 1AZPA 1WTXA 1UD3A 2B2VA 3I73A 5J39A 2AUKA 1WP6A 3BCFA 3NBHA 1PFNA 2MP1A 5HGTA 1SNDA 5C5LA 4XLCA 3ZIAA 2F0LA 4K8JA 2RSNA 4NP5A 5FKAC 1D6EC 1V0FA 4UZUA 1WTVA 1I3QB 1SYBA 1QB5D 4ILWA 1GUWA 5EQ0A 1ZYRD 3HOYB 2KVOA 1QNKA 4FF3A 2K5WA 2X6WA 2FHTA 3HOZB 1GJXA 3VYUA 3H94A 1AEXA 1STEA 1E43A 5JVG3 2F3WA 1E3ZA 5I6WA 1EY4A 4V0BA 4IUNA 4XTCS 2ID0A 1SYFA 1CZWA 1L0XB 4MHEA 1AW7A 1SXTA 1E1RA 3MVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I7Z C;  4G7O C;  1HQM C;  1CI3 M;  3RLF A;  1Y69 U;  1SMY C;  2JE6 I;  1V43 A;  4TKO B;  4OO1 G;  1G29 1;  1HTP A;  5C0X H;  4KKU A;  4L8J A;  2O5I C;  1T5E A;  4KKS A;  3HGB A;  3PUZ A;  2A69 C;  2B8F A;  3BG3 A;  5BN5 A;  2ZT9 C;  4KKT A;  2NN6 I;  3D31 A;  2A68 D;  2K32 A;  4IQZ A;  1OXU A;  3TZU A;  3QIA A;  2DN8 A;  3MFY A;  4OGQ C;  1GHK A;  2PCF B;  1Y8N B;  3P20 A;  1O7L A;  1EWH A;  3VR2 A;  2EJF C;  1DXM A;  3IFT A;  2B8G A;  3A8K E;  1FYC A;  1YNJ C;  3A8J E;  1V8Q A;  2YYZ A;  3FMC A;  3L7Z C;  1A6X A;  3VA7 A;  2K7V A;  1E2Z A;  1TKW B;  3PUX A;  5C0X G;  5BN3 A;  3ND8 A;  2IT1 A;  1GUT A;  1H9M A;  1TU2 B;  3NE5 B;  3VR5 A;  3AB9 A;  1K8M A;  3EQL C;  1H9S A;  4H44 C;  4GZY C;  4JK1 C;  2D62 A;  3D4R A;  4BA1 I;  3FPP A;  1B9M A;  5KND A;  1IYV A;  2A6E D;  1ONL A;  1OXX K;  2JEB I;  2BA0 A;  3OPO A;  1I6V C;  4H13 C;  3OW7 A;  2PPB C;  2D2C C;  2NN6 H;  4IFD H;  1IW7 D;  1GUN A;  3PV0 A;  1DCZ A;  5BN4 A;  1H9J A;  3I73 A;  4KN4 C;  2QF7 A;  2CW0 C;  4KI0 A;  2AUK A;  1YNN C;  3VR4 A;  1E2V A;  4KN7 C;  2O5J C;  2EVB A;  1ZKO A;  5A35 A;  4BA2 I;  3QJY A;  3CRL C;  1Q12 A;  1Z7T A;  1HCZ A;  2A69 D;  1B9N A;  2E76 C;  2JXM B;  2V4D A;  1GUS A;  3A7L A;  3W3A A;  2BE5 D;  5JEA H;  3GD7 A;  1VF5 C;  3T56 B;  1Q1E A;  2Q8I B;  2D5D A;  1FR3 A;  4JBW A;  1VF7 A;  1GHJ A;  3WDN A;  2AUJ D;  1Q1B A;  5JEA G;  4XIG S;  1K8O A;  1OXS C;  3U9S A;  4KHZ A;  2EDG A;  2PNR C;  3A7A B;  3LWU A;  5KNC A;  2A6H C;  3SE0 A;  4DNR B;  2E75 C;  2DNC A;  1HPC A;  1OXV A;  1VCI A;  2AWO A;  2LMC B;  1O78 A;  3VR6 A;  4IFD G;  5K36 G;  4H0L C;  1QJO A;  3OOC A;  3QG1 A;  1Y8P B;  2EJM A;  3I4L A;  1OXT A;  1Z6H A;  3A8I E;  2A68 C;  1LAC A;  3ND9 A;  2BE5 C;  2BA1 A;  3SDZ A;  3LNN A;  4DK0 A;  3DXJ C;  1H9R A;  1VDZ A;  1GJX A;  1CTM A;  4DNT B;  4G7Z C;  1GUO A;  3H94 A;  3M4Y A;  5KNB A;  2A6E C;  3IKJ A;  1PMR A;  2EJG C;  3N6R A;  3PUV A;  1CFM A;  3BDO A;  3KLR A;  4TQU S;  3I72 A;  2DNE A;  4RCN A;  2JEA I;  2A6H D;  1BDO A;  4DK1 A;  2KA7 A;  4LJZ C;  3M85 A;  1H9S B;  1DD2 A;  4LK1 C;  2E74 C;  5K36 H;  1IW7 C;  4OO1 H;  2L5T A;  2F1M A;  4PV1 C;  1LAB A;  1H9K A;  4XTC S;  1ZYR C;  2KCC A;  3CRK C;  2K33 A;  3PUY A;  4HR7 B;  1IYU A;  3PUW A;  3VR3 A;  4G7H C;  3T51 B;  2NN6 G;  3GQB A;  1E2W A;  2R6G A;  3T53 B;  2BDO A;  3MXU A;  1Q90 A;  1GUG A;  4KMU C;  1Y8O B;  3M7N A; 
#chains in the Genus database with same CATH topology
 4I7Z C;  1PDQ A;  3CPW A;  4RD2 A;  1TLL A;  2JE6 I;  4WJW A;  1X56 A;  3HOU B;  2RDF A;  4ZCL A;  3A8J A;  4KKS A;  1U4L A;  4GLA C;  5ELO A;  2DER A;  4A3C H;  1NDH A;  1NY4 A;  2SNM A;  2NN6 I;  4P9S A;  3D31 A;  3NTK A;  1SDF A;  1KMH A;  4FP5 D;  4XKV A;  3MFY A;  2X69 A;  2R7D A;  3DWA A;  4BY7 H;  5IYQ A;  2ZXI A;  4A93 G;  1WTP A;  4X3S A;  2OXP A;  4R4O A;  4II2 A;  1QG0 A;  4RDK A;  1X55 A;  5BN3 A;  2IT1 A;  2B39 A;  1ESF A;  3E1Y E;  3U6B A;  4RM0 A;  1KK0 A;  1H9S A;  4R71 A;  3A1P A;  4RFB A;  1AE3 A;  4Z4R A;  4N8F A;  4JI2 L;  2KCT A;  3LQE A;  1M1K D;  1EIG A;  3L9A X;  3OTO L;  1FRQ A;  1HA6 A;  3JU4 A;  1TWA H;  4HTH A;  2D3L A;  1LTR D;  3SLN A;  4IOA A;  1EFW A;  5IT9 L;  4RPB A;  3ASQ A;  1BPL A;  1VQ8 B;  2ES2 A;  3E5S A;  2MJ8 A;  3ZUG A;  4X66 L;  2N78 A;  1R9T H;  2EYP A;  1YJN A;  4DV2 L;  4Z4Z A;  3T16 A;  1VQJ A;  2NZH A;  1CKN A;  1SE4 A;  2FMC A;  2PZW A;  1DOM A;  4K6L A;  1KTK A;  1GHJ A;  3PQI A;  4RAU C;  3W2E A;  5CBE E;  4C3J G;  5C44 H;  3I56 A;  4PC6 A;  1VQ7 B;  2F03 A;  1W87 A;  1DG1 G;  1JJ2 A;  4JI4 L;  4H7B A;  3NTH A;  1HRJ A;  2H5X A;  1J6Q A;  5HY6 A;  1W6J A;  1CNF A;  4DV5 L;  1GD7 A;  2QMU A;  1F9P A;  1XPR A;  2G9D A;  4E0F A;  3GIR A;  1OXT A;  2NTT A;  2WAQ B;  5IP7 G;  3LNN A;  4CJ1 B;  1N32 L;  4DNT B;  3CXC B;  4G7Z C;  3ER0 A;  5KNB A;  4LNQ A;  4TQU S;  2ATW A;  2E1B A;  5FO0 A;  3CKI B;  3HOX G;  3SXH A;  1L1O C;  2IHE A;  1F77 A;  4P1V A;  4OL7 A;  3F2B A;  4RWS C;  1LAB A;  1VQN A;  1BCP C;  2VNU D;  3MXG A;  1RQP A;  2ZM6 Q;  1HNW Q;  3CQZ H;  4WOR A;  3HOY H;  1KK3 A;  5L37 A;  1YI2 B;  2HIV A;  5L46 A;  1Q90 A;  1GUG A;  1TS4 A;  3VR4 A;  4DR2 Q;  2OTL B;  1WVL A;  1V1Q A;  3ES9 A;  4G7O C;  3ZYY X;  3GTQ B;  3PO2 H;  5J22 A;  5BSY A;  4O0A A;  3CB4 A;  1SMX A;  1T5E A;  1BCP D;  4JI1 Q;  1EXM A;  1MSG A;  4Q7J B;  4BXX H;  4A3K G;  3OE7 A;  1B3Q A;  1GR1 A;  1ZEQ X;  2CQO A;  4XQN A;  2F43 A;  1C0A A;  4U67 3;  3OW2 A;  3BU2 A;  4A3D H;  2VYQ A;  3NTI A;  2R7Z B;  4CDD C;  4DR7 L;  2EJF C;  1ENA A;  3R2T A;  3W5O A;  3KBG A;  3FMC A;  2F4N A;  1E24 A;  1KIX A;  1UEB A;  1C48 A;  4WWV A;  4DV6 L;  3ND8 A;  2JJ1 A;  2HCJ B;  3AU7 A;  3T1Y Q;  4XQQ A;  1Q81 C;  1JE5 A;  2F0H A;  4LAA A;  4DR7 Q;  1RTN A;  1LO5 D;  3OAA A;  3FPP A;  4PGO A;  1B9M A;  3BDL A;  5KND A;  2D74 A;  1OXX K;  4HIM A;  1YIJ B;  4HJA A;  3KLW A;  5FO1 A;  2UUC L;  1B3A A;  4G57 A;  2F0G A;  4A3F H;  2D2C C;  2WJV A;  4B3M Q;  2RC5 A;  3DWQ A;  4IUQ A;  1IKM A;  1WJJ A;  3MEH A;  4XDX A;  1HFN A;  3SEJ A;  4OEL B;  4DV6 Q;  1LTA D;  5HXB A;  2K4K A;  2AHO A;  1E22 A;  2NVQ H;  4RDJ A;  1EY5 A;  1N33 Q;  1I94 Q;  2A69 D;  3S17 H;  4RDL A;  4XXE A;  4QUC A;  2BE5 D;  2E2D C;  1Y0Y A;  2XN9 C;  4Z4S A;  5CV4 A;  1VQ6 A;  4IUT A;  4JBW A;  4LWC A;  1WOP A;  4A3G B;  2R7Z G;  3S1M B;  1KRT A;  2E8G A;  3HOY G;  3FRP B;  4A93 B;  1ZUN B;  1QNU A;  2J7K A;  3EVQ A;  2ZXH A;  2UU9 L;  1YNN D;  5JPM C;  3VR6 A;  2E2I H;  5FA6 A;  1SE2 A;  1VQ4 B;  5A2Q L;  2EY1 A;  3FKI B;  3I1F A;  3U4Z A;  4DUY L;  2A68 C;  1LAC A;  5CYU A;  2BE5 C;  1R9T B;  3V7A A;  2F1L A;  3W1G A;  4G6I A;  4YHB A;  5EGT A;  3Q38 A;  4OWT B;  5IYC H;  4DR2 L;  2QW7 A;  2WP8 J;  4A3K B;  1KLG D;  1YJW A;  3G48 A;  4A3J H;  4K2K A;  2R92 B;  2DNE A;  2JJ2 A;  5J3B A;  3ZZT A;  5M3M G;  2M5S A;  5GQO A;  1DGS A;  1EY8 A;  2KCC A;  4A3J G;  3M4O H;  4PMC A;  2P3M A;  1STH A;  4A3M B;  3WND A;  3GQB A;  2CQA A;  1W0K A;  2YU9 B;  3URY A;  1E2V A;  1UMK A;  1B1Z A;  3QO2 A;  2Z6K C;  2LXJ A;  1LTT D;  1AN8 A;  1HQM C;  3V2T A;  1X3E A;  4GLX A;  1JE4 A;  2NVX B;  5C4X H;  1OGI A;  4DKA C;  3RN2 A;  4DV5 Q;  1I4X A;  1JR0 D;  1PTO B;  4B3R L;  1IHZ A;  4I65 A;  5J1Z A;  4OIJ A;  2OTL A;  1YZ6 A;  1JWM D;  2ZXR A;  1OB0 A;  4BBR G;  1NCV A;  1FNC A;  1Q3L A;  1PJ6 A;  3TZU A;  4APV A;  2DN8 A;  1GHK A;  1BVS A;  5EKI A;  5EPL A;  1TWF H;  3HOW H;  5BSX A;  2NWG A;  1CQV A;  5E4X A;  2E1R A;  4NPS A;  1JA0 A;  5IK2 A;  1KTV A;  3I90 A;  4HED A;  2NBF A;  2RBM A;  3A5U A;  2DET A;  1BBU A;  3OIQ A;  1FNU A;  4IUP A;  3HRZ C;  1PXU A;  5FLX c;  2D0P A;  1NMG A;  3OTO Q;  3C3L A;  2F3V A;  4OWW B;  3SKB A;  2I5L X;  3KF8 B;  1G7S A;  4HJ7 A;  1H42 A;  4JBK A;  4IFD H;  1K3B C;  2IWH A;  1A15 A;  4DV4 L;  1AH9 A;  2HDM A;  1ILQ A;  2F0N A;  3UE1 A;  4DAY A;  2CWA A;  2AMC B;  5FL7 A;  2L4N A;  4JI7 Q;  3BQJ A;  1JB9 A;  2XIW A;  3PF4 A;  3UDG A;  3A7L A;  1G6P A;  4ACA A;  5JEA H;  2LS0 1;  5H1S E;  1Q1E A;  3T13 A;  5CV9 A;  1VQC A;  2Q8I B;  4LF8 L;  4HE5 A;  2L1B A;  2OEO A;  3SJZ A;  1J8I A;  4QFM A;  4QIW B;  4DR4 Q;  2HLD A;  3BCD A;  2A19 A;  2N88 A;  1LT4 D;  3P27 A;  3A7A B;  1QVC A;  2EIF A;  2VNJ A;  5M3M B;  1QJO A;  4DAY B;  1F2Z A;  1ZM2 A;  3PUM A;  3E3X A;  4IN3 A;  1EQT A;  4AH6 A;  2GJK A;  2VQE L;  4DK0 A;  1SYG A;  1H9R A;  2NVY B;  5IYB H;  4LF4 L;  3A74 A;  2IW3 A;  2VXW A;  1HXY D;  3GTG H;  3E9H A;  4R4C A;  4JC0 A;  5C4Z A;  4UP9 A;  2R93 H;  4XN3 A;  2MQH A;  4B3G A;  2HHH Q;  4X6A H;  1U9R A;  3UDI A;  1PHJ A;  3ITP A;  2K33 A;  3A56 A;  5DAU A;  1XJV A;  2HUG A;  3T51 B;  1VQP B;  3FKI H;  3SR1 A;  4LMQ D;  1WCM B;  4DV7 Q;  1HH2 P;  3CD6 B;  2FMM A;  4NMZ A;  3T1H L;  4OX9 L;  1ESR A;  2XVS A;  1RHP A;  4JI7 L;  3CMM A;  1V43 A;  3RZO H;  1MSH A;  3WNC A;  1YNX A;  4FDB A;  4A3J B;  4CJ0 B;  3C2P A;  4DN4 M;  4IUR A;  1FNM A;  3AGQ A;  1Y0R A;  2BOS A;  1HJP A;  1ZXT A;  4XQJ A;  1KDC A;  5DSZ A;  3GP7 A;  1I4G A;  2EYF A;  2K5N A;  3CC7 A;  2V7V A;  3D26 A;  1LV9 A;  4JBJ A;  1H8H A;  3QIA A;  1H95 A;  2IX3 A;  1Y8N B;  5BR8 L;  1EWH A;  1XE1 A;  2A5H A;  2RDH A;  3ULP A;  1IBM Q;  1DJR D;  3PIP A;  4A3I H;  2N3S A;  2V7W A;  3S1Q B;  1NBW A;  2NVX H;  1WD1 A;  4CDC C;  1GXD C;  4JV5 L;  4AQY L;  4DV3 Q;  2LXK A;  4CHT B;  2VL6 A;  2C35 B;  4IJL A;  4KV6 A;  1Q46 A;  4N8X 1;  4CKB A;  4XR6 A;  3AB9 A;  4ZKB B;  1I3Q H;  4PAB A;  2G9H D;  4R9W A;  2K1B A;  1PFM A;  1EFC A;  3W5V A;  1PTO C;  1LTI D;  5CV6 A;  2D0O A;  4A4I A;  1GAW A;  4DUZ Q;  2MHV A;  4LFC L;  1HNX L;  3ICE A;  1K73 C;  3HOW B;  4HCE A;  4QVJ A;  4NDX A;  5ELE A;  3I55 B;  4F7X A;  1TR5 A;  2CW0 C;  5HGQ A;  1II3 A;  1NRK A;  1SKY B;  1ZKO A;  1QZG A;  2I07 B;  5IGG A;  3HOW G;  1Z7T A;  1X3Q A;  3BH4 A;  3OJW A;  1S4M A;  1N08 A;  1K8G A;  5EPJ A;  5M9O A;  4WQM A;  1OO9 B;  3MFG A;  5FLM G;  2RCF A;  4FXG C;  1VF5 C;  2WZN A;  2VZL A;  1TY0 A;  4PMB A;  3J80 L;  4NXN Q;  4RH6 A;  4B3S L;  1K9M D;  2B2U C;  3FKI G;  2AUJ D;  3F2C A;  2I5M X;  2ZTD A;  1SEB D;  3B82 A;  5M3F B;  5M5Y B;  3BDC A;  1K73 D;  3OIP A;  4BY1 G;  3LWU A;  1CKM A;  2B2Y C;  3CCM A;  2GN5 A;  3NK9 A;  1QVF A;  2B7B A;  1KJZ A;  5HZB A;  2E75 C;  4LF5 L;  5IYW A;  1SYD A;  4HCS A;  5M5W B;  2XOK A;  3J7Y W;  2ZBV A;  1XQB A;  1B7Y B;  2I5H A;  4AYB G;  1HVX A;  3A8I E;  2VUM G;  3ND9 A;  2JJQ A;  2BA1 A;  2LSS A;  3HS0 C;  1Z47 A;  4X3T A;  1EIF A;  1K9M C;  1HA3 A;  1HR0 Q;  4DXG A;  1EP1 B;  2VB2 X;  2E5L Q;  4C1N K;  1IL8 A;  2A6E C;  2K04 A;  2UUA Q;  2B63 B;  3PO3 B;  1UD5 A;  3AYH B;  3QFC A;  2JEA I;  1VHO A;  5IGC A;  1PYW D;  1VLO A;  1K28 A;  4C2M H;  2JA5 G;  3PO3 G;  4CKC A;  3KL9 A;  3TP7 A;  4BPR A;  1EY9 A;  5KSW B;  4J1M A;  4G5G A;  3NXW A;  1Q8I A;  1I18 A;  2ZXP A;  1PVO A;  2F0U A;  1OHH A;  4Z4U A;  1SRO A;  3H0G H;  1O7Y A;  3FHW A;  1EEI D;  3RLN A;  2RHS B;  5IP7 H;  3E0E A;  1V9P A;  4TKO B;  1F2L A;  4DV1 L;  4CDF C;  1WDT A;  4DR1 Q;  1STY A;  1PRT C;  3TS0 A;  4B3M L;  2X6Y A;  4XOP A;  3Q3A A;  4V19 0;  1AE2 A;  1HZB A;  2R6H A;  2XGT A;  3HKZ G;  4IJH A;  4RGT A;  1SNP A;  2B8F A;  5I6Y A;  4F8M A;  1VQ8 A;  3UDX A;  2XNC A;  3G7L A;  1JNY A;  2K32 A;  2SEB D;  4IQZ A;  1WCM H;  2B2W A;  1HNZ Q;  1CKN B;  3CPX A;  3HG9 A;  2OQK A;  3HKZ B;  5DEH A;  3ERO A;  2KUM A;  5FK9 C;  1W0J A;  4G7X A;  2J7Z A;  2NVT B;  1V8Q A;  1KRS A;  2QEX A;  5AJ3 Q;  1ICW A;  3HEJ A;  2FX3 A;  3MHP A;  5KYL A;  2DYI A;  5JJK A;  1YHA A;  4ZGQ B;  2IPK D;  4XNF A;  1K8M A;  4IPC A;  3D4R A;  1YX2 A;  2CRV A;  4H9G A;  4A3E H;  1IYV A;  2F0O A;  1WCM G;  3CPW B;  2MO0 A;  4X65 L;  1EFI D;  2JA7 G;  1K83 B;  1EY6 A;  2Q6I A;  3ZZU A;  2PPB C;  1XNR Q;  3S16 H;  1GUN A;  2YTX A;  5BN4 A;  3FVQ A;  3NQT A;  1QFZ A;  4Z4T A;  3H91 A;  4DV0 L;  3P75 A;  2QEX B;  3QWN A;  1F60 A;  3QJY A;  4DR3 L;  3PO2 G;  2QTZ A;  2L11 A;  1YJ9 B;  3A35 A;  2BF4 A;  2EXZ A;  4LUV A;  4RKL A;  1XMO L;  2D5D A;  5KEE A;  1I4P A;  4XOR A;  1ASZ A;  3R93 A;  2Z6B A;  2KED A;  5JEA G;  4XLH A;  4NB3 A;  4XIG S;  4YWK A;  1HQR D;  1RCV D;  3CCR A;  4IPH A;  4X7F A;  4TMV A;  1IXR A;  2B29 A;  5FOB B;  3GTO B;  5C0X J;  1G6Z A;  3CXC A;  3VDY A;  4XLE A;  1HA5 A;  2LMC B;  4GS3 A;  3ASP A;  4L5T A;  1LTL A;  3M7G A;  4UHV A;  3H09 A;  4ZKC B;  4R8I A;  1CSQ A;  1QG7 A;  2OF1 A;  2R3Z A;  4ZV4 A;  2GA4 B;  5CBA E;  3DXJ C;  4P71 A;  4IPG A;  2BM0 A;  2MO1 A;  2KBN A;  1C9O A;  4MYU A;  3W2G A;  2PI2 E;  1RKN A;  3AQQ A;  4ULL A;  1CFM A;  2ZL5 A;  3NEL A;  4KJO A;  2BV3 A;  3UI2 A;  2Z4I A;  5CC4 A;  4TT3 A;  4B3F X;  1UE1 A;  4A3D B;  1SM4 A;  5IYD G;  4LK1 C;  4GOP C;  5K36 H;  3W2F A;  4TMZ A;  1I6H H;  1B2T A;  4BWG B;  4YEL A;  4KJN A;  3WOE A;  1FGU A;  3TP8 A;  3EA6 A;  1KXL A;  1D2E A;  3VR3 A;  2GK7 A;  5M5W H;  5LL6 X;  3IRB A;  1SNQ A;  4NXN L;  3K5L A;  2EIX A;  1X3G A;  2KHJ A;  2UXD Q;  3S2D B;  1DDI A;  1FNB A;  4RD1 A;  4X7D A;  4X3K A;  1TUI A;  4X66 Q;  2VBU A;  1E1Q A;  4LF9 L;  5DLQ E;  1HHV A;  3K6O A;  1SR3 A;  1J5E Q;  1HNX Q;  2ZJQ A;  2V1C C;  1LUZ A;  1U4R A;  4C2M B;  4QIW E;  4DUZ L;  4C3J H;  4JI2 Q;  4QCL A;  4YCW A;  1PKV A;  5A2Q E;  2F52 A;  4GQN A;  4YAO A;  2Z4H A;  5ELD A;  2PCF B;  2SNS A;  1O7L A;  3S17 B;  1FYC A;  2C5C A;  1UE6 A;  2GPJ A;  1PFS A;  3EIV A;  3NBH B;  4DR3 Q;  2WSS A;  4YXW A;  2K7V A;  2N55 A;  2K5Q A;  5IGF A;  2ICI A;  4DV0 Q;  4WFN 3;  3S14 B;  2W6I A;  5CV8 A;  3M3Y B;  1GUT A;  1ET6 A;  4LW1 A;  1U4M A;  5DN6 A;  3QOJ A;  3VR5 A;  2LY7 A;  4DAM A;  4K5V A;  2Y0S G;  5JAV A;  3D4D A;  1IJE A;  1AP0 A;  4S3S A;  1N0U A;  3BVZ A;  2EYL A;  1FNV A;  4AF7 A;  1SN8 A;  3ULJ A;  2H1E A;  1PTO F;  4BBS H;  4A3L G;  1EYG A;  2B7C A;  3BY2 A;  1YNN C;  1L2F A;  1X3P A;  1N05 A;  4JYA L;  4MN3 A;  3HOX H;  2V4D A;  1KDB A;  3BC9 A;  1YJ9 A;  4DV7 L;  1S4Z A;  3GV3 A;  5FJ8 H;  1PZK D;  1BQE A;  3PA1 A;  1SNO A;  1VLY A;  5J35 A;  1TTT A;  4AYB B;  1K8O A;  1BO0 A;  3I4M H;  3S1N B;  2M9V A;  2OWO A;  1B8A A;  2XWB B;  4TSF A;  2X6G A;  2WJY A;  4LFA Q;  1EYA A;  3EFX D;  1HPC A;  1OXV A;  4M1U B;  4C3H H;  3H15 A;  4L63 B;  2VQF L;  3WYA A;  2A73 B;  1PH4 A;  3OEE A;  1STB A;  1YEZ A;  1DOL A;  3GTK B;  4KY6 A;  3ZC3 A;  1UD2 A;  1VDZ A;  1NTG A;  5LMN L;  1TWC H;  1FD7 D;  4Y9R A;  3ISX A;  1EQR A;  2ZTG A;  3W2I A;  5C3X A;  4DR6 L;  2C4T A;  4X8I A;  1JCK B;  3GTO H;  3STB D;  1UD8 A;  1EU4 A;  1PYB A;  2KOL A;  3J80 i;  3HOZ H;  4TMT A;  3TRZ A;  4Z4W A;  4KHP L;  1VQM B;  4LFB Q;  1WTR A;  1E2W A;  2UUB L;  1S5F D;  4IAL A;  1RJT A;  4R8N A;  1PH1 A;  1A0I A;  1ENC A;  4RCY A;  1PRT F;  3A3B A;  3GSI A;  2VUM H;  3D3R A;  2HIX A;  1H85 A;  1UEA B;  4QY7 A;  2VBT A;  4JI5 L;  1GO3 E;  1Y69 U;  5NUC A;  1JMC A;  4RGM A;  2DCU A;  3E6Z X;  2Q2I A;  1HTP A;  3RMH A;  2B2V C;  3PUZ A;  2GJR A;  5COR A;  3S9W A;  1JB3 A;  3GTP H;  5HZA A;  4RG1 A;  3NQI A;  2K5D A;  4BY7 G;  1TVC A;  4KHV A;  2ZBU A;  1UWV A;  1VQM A;  1VQ5 A;  4HJ5 A;  3HOV B;  4DPG A;  5IIF A;  5KRU A;  1CA6 A;  3VR2 A;  4ABN A;  4P6V F;  3L7Z C;  3J81 E;  3B78 A;  2YTV A;  4KD4 A;  5G3L F;  2LZJ A;  3K7U C;  1BX1 A;  3ZZ0 A;  1EY0 A;  3B6Y A;  3PUX A;  5IP9 H;  4HAE A;  1WFQ A;  3GDE A;  1O80 A;  4FWT A;  4FYD A;  4RKB A;  5F4J A;  3OP1 A;  2IHF A;  3EQL C;  1A63 A;  1VQF A;  5DM7 3;  1MAB A;  4LFC Q;  1GOZ A;  4OO1 I;  5ELB A;  5KGU A;  4XYQ A;  1A3T A;  1ONL A;  4U9U A;  4RD4 A;  3A55 A;  3HP3 A;  4P73 A;  4DQK A;  5TRD A;  2OBT A;  2QN6 A;  4YAU A;  4I7A A;  1IW7 D;  1BXT A;  1L0Y B;  3A54 A;  3GTM H;  3PV0 A;  1FX0 A;  4C0S A;  4KI0 A;  5GRO A;  4DV3 L;  4C3I B;  5IGB A;  4JV5 Q;  1YHB A;  1EFU A;  3S2H B;  3UDF A;  1HUM A;  1Q12 A;  1KC8 C;  3D4W A;  2Z6B D;  2YWF A;  1LT3 D;  4M8A A;  5M5X B;  1NMF A;  4JI6 Q;  3TDQ A;  1EYC A;  2JA8 G;  3FEW X;  1FR3 A;  4ALP A;  4II3 A;  2DJG C;  2J0T D;  2UXC Q;  4GOP A;  3CRZ A;  2BGI A;  1S72 B;  1P16 A;  4JI8 L;  4P6Y A;  1SRU A;  3I55 A;  1TY2 A;  3F8T A;  4PG3 A;  2A6H C;  3AFP A;  1QUQ B;  4XD7 A;  1ET9 A;  4R1J A;  1JA1 A;  5IT9 c;  2JDI A;  2ICE C;  1O78 A;  4BBS B;  3W5H A;  2F0T A;  1W9X A;  3K8A A;  1M90 D;  1BNZ A;  2X3U A;  1Y8P B;  3I4L A;  3CCJ B;  3CAM A;  4DFA A;  1WOR A;  4JI5 Q;  2XEX A;  1TS2 A;  2F0M A;  5IYC G;  3KF8 A;  2KHS A;  1CTM A;  3T1H Q;  4QHY A;  3C1F A;  1VQG A;  5IYN A;  4LF7 Q;  3GO5 A;  3SK8 A;  3LO8 A;  2QKI C;  1VQ9 A;  2QEJ C;  1WOC A;  1PH5 A;  2A6H D;  1BDO A;  1E62 A;  1I8D A;  3MTS A;  2EY6 A;  4K0K Q;  5DM6 3;  1QCB D;  1E3X A;  5GAG C;  1VQO B;  1E7Z A;  1N34 Q;  4A3L H;  1M90 C;  1IBK L;  3HOU G;  4FF1 A;  4PMW A;  4KK7 A;  4DR6 Q;  4XLF A;  3CCU A;  5E1F A;  4G7H C;  1T6Z A;  3OMC A;  4P12 A;  1D8L A;  2J4X A;  1JQY D;  3BYT B;  3BZD B;  5LMN W;  2AQ2 B;  1IB0 A;  5F4O A;  1I94 L;  4P3I A;  5FJ8 G;  4GN3 B;  4OOS A;  4L5Q A;  4FXD A;  1WTW A;  1TWC B;  5THX A;  3WOF A;  3CMA A;  3CC7 B;  3BZC A;  1WU8 A;  4CJ2 C;  1COW A;  3CQZ B;  2JQO A;  2X85 A;  3I2Z A;  2VQF Q;  5JVH 3;  1GM5 A;  2ZTC A;  4LFA L;  3CD6 A;  2BDN A;  1AFP A;  2QDB A;  4XM3 A;  4CKE A;  4DR4 L;  5E6T A;  3CCV A;  1LM0 A;  1Q86 D;  2V7U A;  3CCU B;  1PTO D;  3ASR A;  2A74 C;  3J81 j;  1VQ5 B;  1HZ9 A;  4ZK9 B;  2JA6 G;  2Q6L A;  2H4O A;  5ELN A;  2K52 A;  1BQQ T;  1CNE A;  4EX5 A;  2AHO B;  1SFO H;  1JWS D;  1TKW B;  1PFB A;  4RJL A;  2XZL A;  4ZCM A;  2CW0 D;  2NUC A;  2QDX A;  1H8E A;  3AVT A;  1N36 L;  2ZL6 A;  4B3T Q;  4NXM Q;  4R4I A;  1WTH A;  1FND A;  2CFM A;  2GRE A;  2R7Z H;  2PNH A;  3M4P A;  1TS5 A;  1FRN A;  4UY8 C;  3U6K A;  1CSP A;  1MKH A;  1DON A;  4DK3 C;  2JYO A;  2RCN A;  1C8C A;  1F20 A;  4HSV A;  1D5M C;  1KDA A;  4KY7 A;  2I46 A;  1TVX A;  3NBI A;  4TMW A;  1YVC A;  5EAY A;  1G7R A;  1BF4 A;  3SK5 A;  4A3B H;  5C4X G;  1YHQ B;  2C78 A;  1ZM3 A;  4J8Q A;  2X8K A;  2F0D A;  1VQB A;  1KHI A;  1QVF B;  4NNJ A;  2L0C A;  3A0J A;  1A2T A;  3LQ6 A;  1PRT B;  3K7A H;  1CHQ D;  1KZL A;  2F0S A;  1VF7 A;  2ZM6 L;  1HNW L;  4G4K A;  4RD0 A;  3DM1 A;  2NVQ B;  1FNW A;  3NHH A;  5AN9 A;  3X3M A;  3WBJ A;  3I7F A;  4QGU A;  1PV4 A;  5F4M A;  4OHJ A;  1J5E L;  5K5P A;  5GV8 A;  1MD2 D;  4JVZ A;  2VBV A;  4LF9 Q;  3CCJ A;  1QWY A;  2Z6K A;  2Q8T A;  3ONY A;  1VQN B;  4DU9 A;  2ZL7 A;  1XXG A;  5E7N A;  4P22 A;  1G51 A;  1UE5 A;  2XNA C;  2SOB A;  1WI5 A;  2AWN A;  3D6W A;  4B43 A;  2KJX A;  3VMF A;  4ZRZ A;  1B70 B;  1EWY A;  1UNS A;  2D9R A;  4Z1M A;  4DK1 A;  4GKJ Q;  4GOP B;  3ONU A;  2N8N A;  4JI4 Q;  5IYD H;  1PRT D;  3AVV A;  2NB0 A;  3KOJ A;  4JBM A;  5EMN A;  4RD6 A;  2L12 A;  4GKJ L;  4RGO S;  4TMX A;  1TS3 A;  4Q0F A;  2R6G A;  4FXK C;  4ODG A;  3KUP A;  3C2Q A;  2YWH A;  3RNU A;  1VQL A;  4QL5 A;  5IYR A;  1SNC A;  4DV2 Q;  4DXF A;  3G05 A;  2BH8 A;  2OYN A;  1Q8K A;  3TBI B;  2CWP A;  3CW2 C;  3ONA B;  1DDG A;  4EH1 A;  4DUY Q;  4A3B G;  1YNJ D;  1IZ6 A;  4XYO A;  1G91 A;  3HZX A;  3Q22 A;  2WAQ G;  1K0S A;  5A88 A;  5IOD A;  2XZP A;  2ZJP A;  1KAA A;  4AYB E;  1G7C A;  2DUD A;  2WV6 D;  4WZL A;  3BG3 A;  3M9B A;  4M2L A;  4QJF A;  5GAH C;  1KQS B;  2WB1 E;  1SSO A;  3A3G A;  2F0V A;  3P7J A;  1IYJ B;  4R4Q A;  3MXP A;  4DAV A;  4OGQ C;  2K6A A;  3P20 A;  1ZM9 A;  3CP2 A;  4DGZ A;  3KJP A;  2PQE A;  4ZLT F;  1SMY D;  5FO7 B;  1YI2 A;  4QUF A;  2B8G A;  2L55 A;  1YNJ C;  3VO2 A;  1IJF A;  1NR4 A;  4QV2 A;  2G5D A;  2SDF A;  1I4R A;  2PO4 A;  3CHB D;  4J15 A;  4JOI A;  5CV7 A;  1AZQ A;  4QVA A;  4XMY A;  1G2T A;  2WB1 G;  1LT5 D;  3F2U A;  5BR8 Q;  5C4J H;  1F9Q A;  3W1B A;  3OMG A;  4JPB W;  4JK1 C;  5D14 A;  2UUC Q;  4CQJ A;  1VS0 A;  1ROD A;  4LF6 L;  1KAW A;  5B6I A;  3VYT A;  3J7A F;  1UD6 A;  1W2B B;  1PH8 A;  2XZO A;  3J80 E;  4RPD A;  3K5M A;  5FO9 B;  1GVP A;  5A89 A;  4YWM A;  1EFR A;  1C7Y A;  1UD4 A;  2Q8R E;  2C4U A;  2IJ0 A;  3MC0 B;  4ID6 A;  2Q6K A;  5FIU A;  5T1I A;  1YHQ A;  1I4Q A;  1CUK A;  2O5J C;  2K01 A;  4M0L A;  4RMF A;  3CCE B;  3CRL C;  3AEV A;  4IW3 B;  2BMW A;  2E2H B;  3J81 k;  5C5M A;  2V31 A;  1SE8 A;  2OTJ A;  3NEN A;  4DQL A;  3E20 A;  3MWY W;  3H6M A;  5IY0 A;  3FP9 A;  4OIK A;  2RF4 A;  2EFG A;  3WQZ A;  5LMZ A;  1RDP D;  1SBB B;  3A5Z B;  3WDN A;  4Y7N B;  4Z4Y A;  1OXS C;  2B2T A;  2EOT A;  1JJC B;  2I1L A;  3K58 A;  2FJ2 A;  4C43 A;  3L3O C;  3LVB A;  4G1B A;  4JI1 L;  4BS9 A;  5EBD A;  5C3W A;  4GKK L;  2DNC A;  1VCI A;  3J7Z C;  4JMQ A;  3H3V C;  4ZQ3 A;  4YY3 L;  1VQK B;  4QMG A;  1EL0 A;  4BBR B;  5AFW A;  1DAR A;  1QE6 A;  1VQD A;  2HCC A;  4A3F G;  4P72 A;  2VB3 X;  1YJN B;  4M1K A;  2R61 A;  2AQ1 B;  3BJU A;  4A3M G;  3J81 L;  1TWH B;  4BY7 B;  2KEN A;  2AQ3 B;  1E1O A;  3C1E A;  4A3F B;  2DGY A;  1PJ5 A;  2EPB A;  4RCN A;  5LHY 1;  3KFU A;  1U0L A;  4XT1 B;  3U50 C;  2PMD A;  1PH9 A;  4NW2 A;  3B8H A;  1WSR A;  1O7I A;  3R3O A;  3NPP A;  1N34 L;  1WPC A;  3CRK C;  1XPU A;  1N06 A;  3PUY A;  4RHS A;  2F0W A;  5E4W C;  1IYU A;  5T1G A;  3KLS X;  2B2U A;  3JQR A;  4IUV A;  1TT2 A;  2E5L L;  2UUA L;  2YTY A;  3M3Y H;  1KAB A;  1P4M A;  1P8L A;  4HID A;  4UAI A;  2B2Y A;  4B48 A;  1AMO A;  2ZTE A;  4RD3 A;  2NPF A;  1ZM4 A;  1CM9 A;  1YLO A;  2EYJ A;  1SLJ A;  4F88 A;  2E2I B;  1XMQ L;  1T9H A;  4BY1 H;  3QB3 A;  2UXB Q;  3I4M G;  2QA4 B;  1HZC A;  2WIN B;  1DYQ A;  2VY3 A;  4JI8 Q;  2A68 D;  4EQN A;  3PSI A;  4TN1 A;  4RGN A;  1V1P B;  3G6J B;  5IGD A;  2PE3 A;  1MGS A;  1Q82 C;  3HOX B;  2HD3 A;  4A3K H;  1A8P A;  1DXM A;  1VQO A;  1CQF A;  1WTH D;  1WOO A;  4ZCI A;  4LBV A;  4MYT A;  3LGJ A;  1W34 A;  2CHB D;  5KNL A;  2GVB A;  4A3M H;  4H44 C;  4L6T B;  4B08 A;  3R2I A;  2JSO A;  5CMD A;  3S1Q H;  3E9I A;  2F0Q A;  2JEB I;  2RDG A;  1Q82 D;  1W6K A;  5JEA J;  3OW7 A;  5DS0 A;  3RY8 A;  1BBX C;  2XNJ A;  1DCZ A;  5JOB A;  4LBW A;  3Q24 A;  1R4P B;  2CK3 A;  1PJ7 A;  2YWG A;  4TSS A;  2Y0S E;  2TSS A;  2ENB A;  1WD0 A;  2GJP A;  4WZE A;  1CZG A;  4B47 A;  3W3A A;  4DA2 A;  4J6H A;  1Q7Y D;  4KY5 A;  2VNK A;  4PC2 A;  2BVN A;  5LMU L;  3U4V A;  1JWU D;  1ASY A;  3UE0 A;  4IO9 A;  3U9S A;  1KD1 D;  3U2Q A;  2PNR C;  2PYK A;  4HSP A;  4ACB A;  3SEB A;  4L5S A;  4FF2 A;  2BGJ A;  4TRD A;  4M4S A;  2AWO A;  4O1N A;  1EP3 B;  1QX4 A;  4EVO A;  4UZE A;  1QGA A;  1NE3 A;  3SDZ A;  2OT2 A;  5M5Y H;  2E2H H;  1Q7Y C;  2CC2 A;  3KYH C;  1JOQ A;  2DIE A;  3GTP B;  4UPA A;  2ZZG A;  2OK8 A;  4QB4 A;  2EQS A;  3FDT A;  1EU3 A;  3N6R A;  2RC6 A;  3KLR A;  1OGJ A;  2IL8 A;  2K03 A;  2F0F A;  2UU9 Q;  1Q81 D;  1IW7 C;  4B9X A;  2HHH L;  2F1M A;  3SK6 A;  1EEF D;  1N07 A;  2A1A A;  2F0I A;  1S3O A;  3CPF A;  1KLU D;  4HR7 B;  3PIO 3;  4B9W A;  1PZJ D;  2M2L A;  1NR2 A;  3CC4 A;  3MMP A;  2B63 H;  3T53 B;  1KNA A;  4YAW A;  1PLF A;  2BDO A;  4N9P A;  4ME3 A;  3OYY A;  2C2W A;  1Y8O B;  1EOT A;  2X6L A;  1UAP A;  4A3G G;  5HUR A;  1N33 L;  2IX1 A;  3OZW A;  4LF4 Q;  2MPM A;  1Q9S A;  2OBS A;  3AVX A;  1R5B A;  2VQE Q;  1HUN A;  5EJW A;  1D7Q A;  3NUC A;  2BH2 A;  1EWC A;  1VQ6 B;  2F4V L;  4KKU A;  4IOC A;  1QFY A;  2BSA A;  3CTA A;  4A76 A;  1M8A A;  1VMP A;  1B53 A;  3P26 A;  1GVH A;  3HAG A;  3N52 A;  3PEN A;  4JCV E;  4AF6 A;  4A3G H;  1BMF A;  4JI0 Q;  1WTO A;  1FVI A;  2WB1 B;  4RCZ A;  3S1M H;  4YIJ A;  1L1O A;  3KF6 B;  5CV5 A;  5JJZ A;  3MA2 B;  2R93 B;  1EQQ A;  1YJW B;  3CCV B;  3QFS A;  1H9M A;  3KDF A;  2RKS A;  1V1O A;  3V05 A;  1KC8 D;  1TWG H;  4XT3 B;  1VMC A;  4YHH Q;  3RZD B;  2EZV A;  2EXD A;  4BA1 I;  1D1K A;  3Q6S A;  1NB9 A;  4X7E A;  4MNO A;  3TEH B;  5I9P A;  5KIX A;  2HT1 A;  4LF6 Q;  2BA0 A;  1VJS A;  5TSS A;  3SLD A;  2GQF A;  4RLZ A;  2DJF C;  3LX0 A;  3R8B A;  1XPO A;  1DZ1 A;  1VQP A;  4XLA A;  3QFR A;  1QZH A;  2L9H A;  2F0J A;  1SNM A;  2JA7 B;  4EGV A;  1R5N A;  2Q2H A;  4AC9 A;  4P25 A;  3CP0 A;  5EKK A;  4YAL A;  3WXM A;  2IY5 B;  3J81 i;  5HKK A;  1GUS A;  2FIN B;  3MCA A;  4FVM A;  3A8I A;  1S5D D;  2XSC A;  1EYD A;  1BOS A;  2HDL A;  4ROX A;  1B23 P;  3HKZ E;  1I50 B;  3OWE B;  3Q0A A;  3IL8 A;  3DEP A;  4XKW A;  4X05 A;  3CCS A;  1MJE A;  3TS2 A;  2WKC A;  2JN9 A;  5IYP A;  1EZ8 A;  5KNC A;  4A3I B;  2R92 G;  4HIK A;  1X3F A;  3TQY A;  3H9N A;  3CC2 B;  1C4Q A;  3IAY A;  3OZU A;  4F87 A;  4B44 A;  1VQI A;  4Y7C A;  2WR8 A;  1K28 D;  2TMP A;  5ISR A;  3TP5 A;  1U4P A;  5G3L D;  1E3P A;  3R6K A;  3OHX C;  5D3I B;  2BN4 A;  1NNX A;  1VQH A;  3IFD A;  3K80 C;  5D3D A;  2OTJ B;  1TWF B;  1X54 A;  4JI3 Q;  2LKV A;  1FJG L;  1QOH A;  4LC0 A;  2EJG C;  2B2W C;  2ZXO A;  1PYS B;  4HMJ A;  3M85 A;  4POG A;  3PUN A;  3M4Q A;  4XN0 A;  1QH0 A;  4PC1 A;  1OTC A;  1NJI C;  1BJK A;  3I70 A;  2KHI A;  4P74 A;  4P2N A;  3GVL A;  2CND A;  3PUW A;  2NN6 G;  4OON A;  4CBV A;  2JIZ A;  1IKL A;  4J0Q A;  2CH4 A;  1LTB D;  2DY1 A;  3MXU A;  4LUO A;  3G6E B;  2P5Z X;  1MI2 A;  4HIO A;  2EY2 A;  2B63 G;  3MEF A;  1B2R A;  1VQ7 A;  2N49 A;  1HFG A;  5M3F H;  1V0E A;  2RA4 A;  4UAJ A;  5TR9 A;  1ENF A;  4K2L A;  5ELF A;  1D5Z C;  3D8G A;  1G29 1;  1NJI D;  3K59 A;  1YBY A;  4L8J A;  4ZUI A;  1JB7 A;  1JJG A;  4N9T A;  2GVA A;  4K8I A;  4RHR A;  5FLX E;  4YEJ A;  1Y1W B;  1KRH A;  2YWE A;  3DEO A;  4ZCK A;  1JOO A;  4YHH L;  1RF2 D;  4TVA B;  4C1N I;  1XMO Q;  3W5U A;  2VZA A;  1F2M A;  3PO3 H;  1KNE A;  4WJ3 M;  1L1O B;  3KF6 A;  2MUY A;  3VNV A;  2YYZ A;  4C3J B;  4MTK A;  5COY A;  3VA7 A;  3JAM E;  2QA4 A;  4GN5 A;  5C3E G;  2VW9 A;  1AIP A;  4K6D A;  3FPU B;  1E0B A;  3RLO A;  4P26 A;  5M3M H;  2DEU A;  3GVJ A;  2KCN A;  3NE5 B;  4A3I G;  2VNH A;  1W3S A;  4O42 A;  1M4V A;  3ZPN A;  1A3V A;  3P1H A;  1HZE A;  1A2U A;  5IE8 A;  3J81 c;  4UP7 A;  1QVG A;  3PGZ A;  5I4D A;  3VA5 A;  5DNF A;  2V7X A;  2Q2U A;  4GN4 B;  5IT9 E;  1G8Z D;  1H9J A;  2NTS A;  5C3E H;  4B3T L;  4KN4 C;  1N36 Q;  3CCR B;  3GVK A;  1LTS D;  4KN7 C;  3QOL A;  2JN4 A;  5AJ3 L;  4FNF A;  4BA2 I;  4A93 H;  1QUQ A;  3RN5 A;  5ELC A;  3CCL A;  1HCZ A;  1CT1 D;  3K0X A;  3WWV A;  4PAA A;  2JA8 H;  1TWG B;  3RZD H;  3T56 B;  2YV5 A;  4RCO A;  1EIH A;  4DR5 L;  4PC7 A;  3CF5 A;  2VJJ A;  3JAM L;  3DM3 A;  2RQX A;  1IBK Q;  1F9R A;  5IGE A;  3OEH A;  1D8T A;  1K8A D;  2EDG A;  2R7F A;  1MJC A;  3MZ5 A;  2PQA A;  2E2J H;  3KLS A;  3SE0 A;  2NVT H;  1SE3 A;  3CC2 A;  1BLI A;  3S1R B;  1XX8 A;  3PCO B;  5IOC A;  1S40 A;  2R93 G;  2R92 H;  5M3F G;  4H0L C;  3GTJ B;  4IUU A;  4QF4 A;  4FF4 A;  2WYR A;  2ZTN A;  3I4M B;  4IPD A;  1N8R D;  3S1N H;  1GKH A;  1DM0 B;  4A3E B;  3VYR A;  2XGJ A;  1GUO A;  3L0O A;  3QR8 A;  5IYB G;  1RIP A;  3BDO A;  4EQ5 A;  2YU9 H;  3I72 A;  1BKB A;  4C3I G;  3ZBU A;  4LJZ C;  3S16 B;  1EQV A;  2PZT A;  1D1N A;  5C4H A;  3DHQ A;  2WZP P;  1H9K A;  5TV2 A;  1ZYR C;  3G4S A;  2NZ1 D;  1S5C D;  2C5B A;  1LTG D;  2UXC L;  4DF7 A;  3Q39 A;  3KJO A;  3G71 A;  1VQ4 A;  1N8R C;  4LF7 L;  3VO1 A;  3BNW A;  2JA5 B;  1SJH D;  4N3N A;  5FNZ A;  3TRE A;  3V76 A;  1CI3 M;  1VQE A;  4YCV A;  4C56 C;  1RTO A;  4GNX C;  1SMY C;  4HN7 A;  1X9N A;  1K0R A;  1XNQ L;  1NUC A;  4PZ6 A;  2O5I C;  3HGB A;  4LF5 Q;  3HFZ B;  1T6Y A;  1E63 A;  2VUM B;  3BVG A;  3NP8 A;  1EZ6 A;  5E3F A;  3U58 A;  4ZAI A;  3E0J A;  3ASS A;  2WPD A;  1I5F A;  2PMZ B;  3SK4 A;  5IWA Q;  3K57 A;  1ML0 D;  1UE7 A;  1NSN S;  4JI6 L;  5KYI A;  3GV6 A;  3IFT A;  3G6E A;  1A6X A;  4OPV A;  3A8J E;  4CDE C;  2C9O A;  2FFK B;  3AMU A;  2DOG A;  1G7T A;  2KQ3 A;  4XOT A;  4OPO A;  5FLX L;  1XFO A;  4AIM A;  4Y7N H;  1VHE A;  1MIU A;  5IWA L;  1IHM A;  2EYM A;  5JPN C;  4B4D A;  1RQR A;  1Y1W H;  2A6E D;  3CCE A;  1WTQ A;  2CW5 A;  1D1I A;  3S2D H;  2UXB L;  4BBR H;  3CC4 B;  2FVG A;  1GO2 A;  3VYS A;  2X6X A;  4FO2 A;  1XNQ Q;  1TWH H;  2DY8 A;  1STA A;  2EVB A;  2M00 A;  5A35 A;  4UZF A;  3F2D A;  2VS1 A;  2QGQ A;  1J9Z A;  2B5O A;  2NZO A;  3AGP A;  3MXN A;  1YIJ A;  2ASB A;  3Q8D A;  3AVU A;  2ZZQ A;  1UUP A;  1Y1W G;  4ASU A;  3GTM B;  4OXP A;  4HJ9 A;  1VQK A;  2C77 A;  3Q23 A;  4DK6 C;  1M1K C;  3DMU A;  1JOR A;  2HCI A;  4N3G A;  4P3Y A;  4MZ9 A;  2NVY H;  2XTI A;  2EY5 A;  3S2H H;  1R5O A;  4NKL A;  1BX0 A;  4X64 L;  2X0K A;  1PH7 A;  5K36 G;  2R9V A;  5C3E B;  4IFD G;  2O4X A;  3CU7 A;  1CKO A;  5TY0 A;  3S14 H;  3OOC A;  4XL9 A;  1LT6 D;  2CF4 A;  2ZJR A;  5CR3 A;  5F2D A;  1J9O A;  4Z4V A;  1A8V A;  2AKW B;  2JP1 A;  2I0Q A;  1W2B A;  1KK2 A;  4BY1 B;  1BCP F;  3M4Y A;  2MGS A;  1PMR A;  3BYY B;  3PUV A;  4YY3 Q;  4ZGN B;  4LFB L;  3OFN A;  2CBX A;  3K0Y A;  4YCU A;  5D65 A;  4GKK Q;  3PIP 3;  3WY9 A;  2KCM A;  2E2J B;  1RL2 A;  2WAC A;  1EY7 A;  2L5T A;  3RUZ A;  3J7A V;  3D0F A;  2F3I A;  4IFD I;  4WJ4 A;  3ULL A;  2XRQ D;  5C44 B;  2QTL A;  3GTJ H;  1GJR A;  1EP2 B;  4A3D G;  2L15 A;  3TP6 A;  2ZIT A;  5EPK A;  2EYH A;  2Y0S B;  3PA2 A;  4IZ8 A;  2D3N A;  5LMN Q;  4L5R C;  4EQP A;  2F0P A;  2K75 A;  4MTN A;  4JYA Q;  4P2C B;  3MXN B;  3RLF A;  3JAM c;  2C5H A;  1WYD A;  1CK1 A;  2NV4 A;  4FXU A;  1TXY A;  3DDY A;  4OO1 G;  4DNI A;  2PI2 A;  2Q6O A;  3U9O A;  3C46 A;  1EFT A;  4C3H B;  4MIU A;  2WKD A;  4PZ8 A;  4X64 Q;  3S24 A;  3CME A;  2F0K A;  2V7T A;  1KL9 A;  4PC3 A;  3AVY A;  2ZT9 C;  3GTK H;  3PIO A;  2VNI A;  3CES A;  1OXU A;  3EN2 A;  2OCE A;  4X3U A;  4A3E G;  4QUZ A;  3NEM A;  5GAD C;  3PVD A;  2IX0 A;  3Q6R A;  1K3R A;  1B44 D;  1IBL L;  2K05 A;  3NSW A;  1BR9 A;  4HE6 A;  3ZJY C;  4OPS A;  5H59 A;  3CCS B;  3GTL H;  4BBS G;  3S15 B;  5C0X G;  5KW9 A;  1CA5 A;  3CCQ B;  3STB C;  5C44 G;  4DV4 Q;  5I2X A;  3GTQ H;  4Q5V A;  3PO2 B;  5EKL A;  3I3C A;  3KK7 A;  2KEE A;  4ME5 A;  3CW2 A;  1SFO B;  4YAF A;  4OP7 A;  4FN5 A;  1I6V C;  2BCO A;  4Z9C B;  3OKX A;  2LFN A;  1PH2 A;  2V7Q A;  3FPK A;  1KD1 C;  1N0V C;  2VBS A;  5LL6 S;  5I9O A;  4JG2 A;  3Q6Q A;  2K5V A;  1R4Q B;  2GK6 A;  1T6X A;  3FJO A;  4X07 A;  3I4O A;  4K14 A;  1NBM A;  1A62 A;  3HOV G;  1T5X D;  1GAQ A;  1MBY A;  2JXM B;  2BPO A;  3TN2 A;  1HR0 W;  4X62 Q;  1D2B A;  3BY1 A;  3W2D A;  3HOV H;  1B50 A;  4ZUJ A;  3OWF A;  1Q1B A;  5FLM H;  4X06 A;  3BS1 A;  4JOI C;  4RA8 A;  1S5B D;  1EUJ A;  2EE1 A;  4K1X A;  2XND A;  5H5J A;  5EBC A;  4DNR B;  4B3R Q;  3D6C A;  3X3N A;  2Z0S A;  1JIC A;  2JK8 A;  3SGI A;  3K7A B;  1E79 A;  1FJG Q;  3K5O A;  3QG1 A;  1G2S A;  2EJM A;  2CKZ B;  5GAE C;  1WSV A;  1CHP D;  4LBZ A;  3W2H A;  4K5X A;  4GNX A;  2X53 S;  3DWP A;  3CCM B;  2UXD L;  3AFQ A;  1QIL A;  3J80 c;  3IKJ A;  5C0X I;  3OW2 B;  2HQE A;  3SHL A;  1NB0 A;  3DUZ A;  3JAM i;  1SJE D;  1IL2 A;  1H9S B;  1DD2 A;  1FGB D;  2E74 C;  3TME A;  1JOK A;  3H0G B;  2RHQ B;  3A8K A;  3AST A;  4PV1 C;  4OO1 H;  2PQA B;  4C3I H;  2JA6 H;  1QGZ A;  2KVM A;  5M5X H;  1Z9F A;  3O13 A;  3BVM A;  4KD3 A;  3EBE A;  2PZU A;  5GV7 A;  2QCP X;  3KBX A;  4KMU C;  1E1T A;  1XYI A;  3CCL B;  2WFW A;  1KQS A;  4FK8 A;  4ZYS A;  3OSO A;  4U68 A;  4EQO A;  2EYO A;  3RR5 A;  2CH4 W;  1SYC A;  1VQ9 B;  2DY7 A;  2F0E A;  3CME B;  1FL0 A;  2A69 C;  4POF A;  3EJI A;  3K5N A;  1FDR A;  1XB2 A;  2OK7 A;  3HKS A;  1I4H A;  1Y14 B;  2QGG A;  3NWS A;  4HIZ A;  2JA7 H;  4DR5 Q;  3OZV A;  5I2Y A;  3CP8 A;  1SAP A;  2CVR A;  4NXM L;  1VQA A;  2VJI A;  3BZK A;  3M4O B;  4G7W A;  3A8K E;  2PW5 A;  4O2D A;  4GNX B;  3NWT A;  5CDF A;  1L0W A;  1K83 H;  3ERQ A;  4E6I A;  1QFJ A;  2A8V A;  1JJ2 B;  1I50 H;  1QUF A;  3LWE A;  1QUE A;  1Y1V G;  3VNU A;  4G1V A;  3CCQ A;  1K8A C;  4KLK A;  4GZY C;  2D62 A;  4OEM B;  1XNR L;  4QQB X;  5C4X B;  5C6A A;  4X0C A;  2HMA A;  1BCP B;  4X65 Q;  1STN A;  1Y1V B;  1W35 A;  3OPO A;  3SVM A;  1PTO H;  4H13 C;  1HTL D;  2NN6 H;  2HQL A;  1PA6 A;  1TII D;  4XQF A;  2RVL A;  2W6J A;  3KDF B;  2BM1 A;  4KTA A;  5C4J B;  4DR1 L;  2FXQ A;  3I4N B;  3T1Y L;  2O2L D;  1YIT A;  2QF7 A;  2OBR A;  4C3H G;  3GTL B;  3S15 H;  4OWX B;  1A3U A;  2Z8L A;  2E76 C;  1B9N A;  3H0G G;  2ZZE A;  1JC7 A;  1V1P A;  3GD7 A;  1S5E D;  1ILP A;  3OJX A;  1N9W A;  4BXX G;  1D5X C;  4WRD A;  1STG A;  1PH6 A;  4KHZ A;  4K5W A;  1MHW C;  1XTC D;  4K0K L;  4IFD J;  1XTD A;  1NAP A;  3I91 A;  4LBY A;  2ALY B;  4DAP A;  3MAQ A;  4DV1 Q;  5CGK A;  4WZT A;  3JC6 6;  1QVG B;  1Z6H A;  3RD4 A;  1HR0 L;  5A8A A;  3J7A 5;  1I6H B;  3TZD A;  2WII B;  4X7C A;  4A3C G;  3KEW A;  1HNZ L;  3TSS A;  2RSO A;  3HOU H;  1ICF B;  2QDL A;  5IP9 G;  2XRS D;  2KA7 A;  1S72 A;  1PH3 A;  3ZBT A;  2K5H A;  1F9S A;  3H3V I;  3V96 A;  3PMF A;  2XWJ B;  4A3B B;  1PZI D;  2PMZ E;  1TQO A;  3ERS X;  4B3X A;  2PW7 A;  4H02 A;  1XWE A;  5LMU Q;  1MRZ A;  4NBS A;  4AVZ A;  4PZ7 A;  2KEC A;  1OB2 A;  2D9U A;  4JI3 L;  2QE7 A;  1JT8 A;  3M7N A;  3QE2 A;  2Z1C A;  1N32 Q;  3MHB A;  3FKS A;  2K14 A;  2Q2T A;  4Y9U A;  3G4S B;  4XON A;  3SJP A;  5C0X H;  2K50 A;  1LYL A;  1X32 A;  4P75 A;  2B3G A;  3GTG B;  3JQP A;  4R4T A;  1EIY B;  2JA6 B;  2ZZF A;  4OOX A;  5BN5 A;  1LLR D;  4KKT A;  4B3S Q;  5FO8 B;  1TWA B;  1RD9 D;  4PNY A;  3DLL A;  4X62 L;  3WBK A;  2QIL A;  1VQL B;  1E64 A;  2JA8 B;  1BUV T;  4LUZ A;  1SYE A;  1U2R A;  2F4I A;  2K28 A;  3I8Z A;  1DOK A;  3R6J A;  3CMA B;  1E2Z A;  2B2T C;  4CGY B;  4NCN A;  4M53 A;  1O7Z A;  2NYZ D;  1IBM L;  2HDN B;  1TU2 B;  3QFT A;  1B4O A;  1F2Y A;  1V5V A;  2Z9H A;  4PQX A;  3S1R H;  3RZO B;  4UDU C;  1QGY A;  4HMI A;  3T4A C;  1ELO A;  1AZP A;  1WTX A;  1HZA A;  1UD3 A;  1XMQ Q;  2B2V A;  5JJL A;  2WAQ E;  4GLV B;  4OOV A;  3I73 A;  5J39 A;  3I56 B;  1WP6 A;  2AUK A;  4AQY Q;  3BCF A;  4WZK A;  3NBH A;  3AVW A;  3K81 C;  4HJ8 A;  1BBW A;  1PFN A;  5JBQ A;  5JJI A;  1X65 A;  1EWI A;  3F1Z A;  1IBL Q;  1KK1 A;  2MP1 A;  4OX9 Q;  1U5K A;  5HGT A;  4Y52 H;  5J3O A;  1SND A;  5C5L A;  3PF5 A;  2UUB Q;  3JQQ A;  4XLC A;  3ZIA A;  4JI0 L;  2F0L A;  4K8J A;  2JA9 A;  2RSN A;  4NP5 A;  4UP8 A;  5FKA C;  4KHP Q;  1Y1V H;  1D6E C;  1V0F A;  3QSY A;  1SKQ A;  4UZU A;  1WTV A;  2JA5 H;  1I3Q B;  1SYB A;  1QB5 D;  3HOZ G;  4ILW A;  3I4N H;  1CQX A;  4A75 A;  1GUW A;  5EQ0 A;  2F4V Q;  1ZYR D;  3HOY B;  1Q86 C;  3H3V H;  2KVO A;  1YIT B;  1QNK A;  4FF3 A;  2K5W A;  1I7P A;  1WOS A;  1EOV A;  2X6W A;  2FHT A;  2OQ0 A;  3HOZ B;  2PLF A;  1GJX A;  3VYU A;  3H94 A;  1AEX A;  3G71 B;  1STE A;  4YWL A;  4JW0 A;  2MNA A;  1E43 A;  2PIA A;  5JVG 3;  2F3W A;  1E3Z A;  2CCZ A;  5I6W A;  1EY4 A;  3I4N G;  4V0B A;  1OB5 A;  4IUN A;  4F7D A;  4XTC S;  1X6O A;  1S0U A;  2ID0 A;  1SYF A;  1CZW A;  3L2P A;  1L0X B;  4MHE A;  1AW7 A;  4LF8 Q;  3WNB A;  2MFI A;  1SXT A;  1E1R A;  3MVV A; 
#chains in the Genus database with same CATH homology
 4I7Z C;  1PDQ A;  2JE6 I;  4WJW A;  3HOU B;  2RDF A;  4KKS A;  1U4L A;  2SNM A;  2NN6 I;  3D31 A;  3NTK A;  1SDF A;  1KMH A;  4FP5 D;  4XKV A;  3MFY A;  2X69 A;  3DWA A;  2ZXI A;  1WTP A;  4X3S A;  2OXP A;  4II2 A;  5BN3 A;  2IT1 A;  2B39 A;  1ESF A;  1H9S A;  4RFB A;  1EIG A;  3L9A X;  1HA6 A;  3JU4 A;  4HTH A;  2D3L A;  1LTR D;  5IT9 L;  1BPL A;  3E5S A;  2MJ8 A;  2EYP A;  3T16 A;  1SE4 A;  2FMC A;  2PZW A;  1DOM A;  4K6L A;  1KTK A;  1GHJ A;  4RAU C;  5CBE E;  4C3J G;  2F03 A;  4H7B A;  3NTH A;  1HRJ A;  1W6J A;  1F9P A;  2G9D A;  4E0F A;  1OXT A;  2NTT A;  2WAQ B;  3LNN A;  4CJ1 B;  4DNT B;  4G7Z C;  5KNB A;  4TQU S;  2E1B A;  3CKI B;  3SXH A;  1F77 A;  4OL7 A;  4RWS C;  1LAB A;  1BCP C;  2VNU D;  3MXG A;  4WOR A;  1TS4 A;  1Q90 A;  1GUG A;  1WVL A;  3VR4 A;  4G7O C;  3ZYY X;  3GTQ B;  5J22 A;  1T5E A;  1BCP D;  1MSG A;  3OE7 A;  1ZEQ X;  4XQN A;  2F43 A;  4U67 3;  3NTI A;  2R7Z B;  2EJF C;  1ENA A;  3R2T A;  3KBG A;  3FMC A;  1C48 A;  3ND8 A;  2JJ1 A;  3AU7 A;  4XQQ A;  2F0H A;  4LAA A;  1RTN A;  1LO5 D;  3OAA A;  3FPP A;  1B9M A;  3BDL A;  5KND A;  1OXX K;  1B3A A;  4G57 A;  2F0G A;  2D2C C;  2WJV A;  3DWQ A;  4IUQ A;  1IKM A;  3MEH A;  4XDX A;  1HFN A;  1LTA D;  1EY5 A;  2A69 D;  4XXE A;  4QUC A;  2BE5 D;  2E2D C;  2XN9 C;  5CV4 A;  4IUT A;  4JBW A;  4A3G B;  3S1M B;  3FRP B;  4A93 B;  1QNU A;  3EVQ A;  2ZXH A;  1YNN D;  5JPM C;  3VR6 A;  1SE2 A;  5A2Q L;  2EY1 A;  3FKI B;  2A68 C;  1LAC A;  5CYU A;  2BE5 C;  1R9T B;  4G6I A;  5EGT A;  2WP8 J;  4A3K B;  1KLG D;  4K2K A;  2R92 B;  2DNE A;  2JJ2 A;  2M5S A;  1EY8 A;  2KCC A;  4PMC A;  1STH A;  4A3M B;  3GQB A;  2CQA A;  1W0K A;  2YU9 B;  3URY A;  1E2V A;  3QO2 A;  1B1Z A;  1LTT D;  1AN8 A;  1HQM C;  3V2T A;  1JE4 A;  2NVX B;  1I4X A;  1JR0 D;  1PTO B;  1IHZ A;  4I65 A;  5J1Z A;  4OIJ A;  1JWM D;  2ZXR A;  1OB0 A;  1NCV A;  1Q3L A;  3TZU A;  1GHK A;  2DN8 A;  5EKI A;  5EPL A;  2NWG A;  1CQV A;  5E4X A;  5IK2 A;  3I90 A;  4HED A;  2NBF A;  2RBM A;  3OIQ A;  1FNU A;  4IUP A;  3HRZ C;  1PXU A;  3C3L A;  2F3V A;  4IFD H;  2IWH A;  1A15 A;  2HDM A;  1ILQ A;  2F0N A;  4DAY A;  5FL7 A;  2L4N A;  2XIW A;  3A7L A;  5JEA H;  2LS0 1;  1Q1E A;  3T13 A;  5CV9 A;  2Q8I B;  2L1B A;  2OEO A;  1J8I A;  4QIW B;  2HLD A;  3BCD A;  2N88 A;  1LT4 D;  3A7A B;  5M3M B;  1QJO A;  1F2Z A;  4IN3 A;  1EQT A;  2GJK A;  4DK0 A;  1SYG A;  1H9R A;  2NVY B;  2IW3 A;  2VXW A;  1HXY D;  5C4Z A;  4XN3 A;  4B3G A;  1U9R A;  3ITP A;  2K33 A;  3A56 A;  5DAU A;  2HUG A;  3T51 B;  3SR1 A;  4LMQ D;  1WCM B;  4NMZ A;  2FMM A;  1ESR A;  2XVS A;  1RHP A;  3CMM A;  1V43 A;  1MSH A;  4A3J B;  4CJ0 B;  3C2P A;  4DN4 M;  4IUR A;  2BOS A;  1ZXT A;  4XQJ A;  1KDC A;  3GP7 A;  1I4G A;  2EYF A;  1LV9 A;  1H8H A;  3QIA A;  2IX3 A;  1Y8N B;  1EWH A;  2A5H A;  2RDH A;  1DJR D;  3S1Q B;  1WD1 A;  1GXD C;  4CHT B;  4KV6 A;  4CKB A;  4ZKB B;  4XR6 A;  3AB9 A;  2G9H D;  4R9W A;  2K1B A;  1PFM A;  1PTO C;  1LTI D;  5CV6 A;  2MHV A;  3HOW B;  4HCE A;  4NDX A;  5ELE A;  4F7X A;  1TR5 A;  2CW0 C;  1II3 A;  1NRK A;  1SKY B;  1ZKO A;  2I07 B;  5IGG A;  3BH4 A;  1X3Q A;  1Z7T A;  5EPJ A;  5M9O A;  1OO9 B;  3MFG A;  4FXG C;  1TY0 A;  1VF5 C;  4PMB A;  3J80 L;  4RH6 A;  2B2U C;  2AUJ D;  1SEB D;  5M3F B;  5M5Y B;  3BDC A;  3OIP A;  3LWU A;  2B2Y C;  3NK9 A;  2E75 C;  1SYD A;  4HCS A;  5M5W B;  2XOK A;  3J7Y W;  1HVX A;  3A8I E;  3ND9 A;  2BA1 A;  3HS0 C;  1Z47 A;  4X3T A;  4DXG A;  2VB2 X;  4C1N K;  1IL8 A;  2A6E C;  2K04 A;  2B63 B;  3PO3 B;  1UD5 A;  2JEA I;  5IGC A;  1PYW D;  4CKC A;  3TP7 A;  1EY9 A;  4J1M A;  3NXW A;  1Q8I A;  1I18 A;  2ZXP A;  2F0U A;  1OHH A;  1O7Y A;  1EEI D;  4TKO B;  1F2L A;  1STY A;  1PRT C;  2X6Y A;  4XOP A;  4V19 0;  4RGT A;  1SNP A;  2B8F A;  5I6Y A;  4F8M A;  3G7L A;  2K32 A;  2SEB D;  4IQZ A;  2B2W A;  3HG9 A;  3HKZ B;  5DEH A;  3ERO A;  2KUM A;  5FK9 C;  1W0J A;  4G7X A;  2J7Z A;  2NVT B;  1V8Q A;  1ICW A;  3HEJ A;  5KYL A;  2IPK D;  4XNF A;  1K8M A;  3D4R A;  1IYV A;  2F0O A;  1EFI D;  1K83 B;  1EY6 A;  2PPB C;  1GUN A;  5BN4 A;  3FVQ A;  3NQT A;  3H91 A;  3P75 A;  3QWN A;  3QJY A;  2L11 A;  3A35 A;  2EXZ A;  4RKL A;  2D5D A;  5KEE A;  1I4P A;  4XOR A;  3R93 A;  2KED A;  5JEA G;  4XLH A;  4XIG S;  1HQR D;  1RCV D;  5FOB B;  3GTO B;  5C0X J;  1G6Z A;  4XLE A;  1HA5 A;  2LMC B;  3M7G A;  3H09 A;  4ZKC B;  4R8I A;  1QG7 A;  2OF1 A;  2R3Z A;  2GA4 B;  5CBA E;  3DXJ C;  1RKN A;  4ULL A;  1CFM A;  4KJO A;  3UI2 A;  2Z4I A;  5CC4 A;  4TT3 A;  4B3F X;  4A3D B;  4LK1 C;  5K36 H;  1B2T A;  4BWG B;  4YEL A;  4KJN A;  3WOE A;  3TP8 A;  3EA6 A;  3VR3 A;  2GK7 A;  5LL6 X;  1SNQ A;  3K5L A;  3S2D B;  4X3K A;  1E1Q A;  1HHV A;  3K6O A;  1U4R A;  4C2M B;  4QCL A;  1PKV A;  5A2Q E;  4GQN A;  2Z4H A;  5ELD A;  2PCF B;  2SNS A;  1O7L A;  3S17 B;  1FYC A;  2C5C A;  2WSS A;  4YXW A;  2K7V A;  2N55 A;  2K5Q A;  5IGF A;  2ICI A;  4WFN 3;  3S14 B;  2W6I A;  5CV8 A;  3M3Y B;  1GUT A;  1ET6 A;  1U4M A;  5DN6 A;  3QOJ A;  3VR5 A;  2LY7 A;  4K5V A;  5JAV A;  3D4D A;  1AP0 A;  4S3S A;  3BVZ A;  2EYL A;  1FNV A;  2H1E A;  1PTO F;  1YNN C;  1X3P A;  4MN3 A;  2V4D A;  1KDB A;  3BC9 A;  1S4Z A;  3GV3 A;  1PZK D;  1SNO A;  1VLY A;  4AYB B;  1K8O A;  1BO0 A;  3S1N B;  2M9V A;  2XWB B;  4TSF A;  2X6G A;  2WJY A;  1EYA A;  4M1U B;  1HPC A;  1OXV A;  3EFX D;  4L63 B;  2A73 B;  3OEE A;  1STB A;  1DOL A;  3GTK B;  4KY6 A;  1UD2 A;  1VDZ A;  1FD7 D;  2ZTG A;  5C3X A;  1JCK B;  1UD8 A;  1EU4 A;  2KOL A;  1WTR A;  1E2W A;  1S5F D;  4IAL A;  1RJT A;  4R8N A;  1ENC A;  1PRT F;  3A3B A;  3D3R A;  1UEA B;  1Y69 U;  5NUC A;  4RGM A;  3E6Z X;  1HTP A;  3RMH A;  2B2V C;  3PUZ A;  2GJR A;  5COR A;  3S9W A;  1JB3 A;  3NQI A;  2K5D A;  4KHV A;  3HOV B;  5IIF A;  5KRU A;  1CA6 A;  3VR2 A;  4ABN A;  3L7Z C;  3J81 E;  4KD4 A;  5G3L F;  2LZJ A;  1EY0 A;  3PUX A;  4HAE A;  1O80 A;  4FYD A;  4RKB A;  3EQL C;  5DM7 3;  1MAB A;  1GOZ A;  4OO1 I;  5ELB A;  5KGU A;  4XYQ A;  1A3T A;  1ONL A;  3A55 A;  3HP3 A;  1IW7 D;  1BXT A;  1L0Y B;  3A54 A;  3PV0 A;  1FX0 A;  4KI0 A;  4C3I B;  5IGB A;  3S2H B;  1HUM A;  1Q12 A;  3D4W A;  2Z6B D;  1LT3 D;  4M8A A;  5M5X B;  3TDQ A;  1EYC A;  3FEW X;  1FR3 A;  4II3 A;  2J0T D;  1TY2 A;  2A6H C;  1ET9 A;  4XD7 A;  2JDI A;  2ICE C;  1O78 A;  4BBS B;  2F0T A;  1W9X A;  1BNZ A;  1Y8P B;  3I4L A;  4DFA A;  2F0M A;  1TS2 A;  3KF8 A;  2KHS A;  1CTM A;  3C1F A;  3GO5 A;  3SK8 A;  2QKI C;  2QEJ C;  2A6H D;  1BDO A;  1I8D A;  3MTS A;  2EY6 A;  5DM6 3;  1QCB D;  1E3X A;  4FF1 A;  4PMW A;  4KK7 A;  4XLF A;  5E1F A;  4G7H C;  3OMC A;  2J4X A;  1JQY D;  3BYT B;  3BZD B;  2AQ2 B;  4FXD A;  1WTW A;  1TWC B;  3WOF A;  4CJ2 C;  1COW A;  3CQZ B;  2X85 A;  5JVH 3;  2BDN A;  1AFP A;  2QDB A;  4XM3 A;  4CKE A;  1PTO D;  2A74 C;  4ZK9 B;  2H4O A;  1BQQ T;  1JWS D;  2XZL A;  1PFB A;  1TKW B;  2CW0 D;  2NUC A;  1H8E A;  1TS5 A;  1DON A;  2JYO A;  1C8C A;  4HSV A;  1D5M C;  1KDA A;  4KY7 A;  2I46 A;  1TVX A;  3NBI A;  1BF4 A;  3SK5 A;  4J8Q A;  2X8K A;  2F0D A;  4NNJ A;  2L0C A;  1A2T A;  1PRT B;  1CHQ D;  1KZL A;  2F0S A;  1VF7 A;  4G4K A;  3DM1 A;  2NVQ B;  1FNW A;  3NHH A;  3X3M A;  4OHJ A;  5K5P A;  1MD2 D;  1QWY A;  2Q8T A;  4DU9 A;  1XXG A;  4P22 A;  2XNA C;  2SOB A;  2AWN A;  3D6W A;  2KJX A;  4ZRZ A;  1UNS A;  4Z1M A;  4DK1 A;  1PRT D;  2NB0 A;  2L12 A;  4RGO S;  1TS3 A;  4Q0F A;  2R6G A;  4FXK C;  4ODG A;  3KUP A;  1SNC A;  4DXF A;  3G05 A;  3TBI B;  3ONA B;  1G91 A;  1YNJ D;  4XYO A;  3HZX A;  3Q22 A;  5IOD A;  2XZP A;  1KAA A;  2WV6 D;  3BG3 A;  1SSO A;  3A3G A;  2F0V A;  3P7J A;  4DAV A;  3MXP A;  4OGQ C;  2K6A A;  3P20 A;  3CP2 A;  4DGZ A;  2PQE A;  4ZLT F;  1SMY D;  5FO7 B;  4QUF A;  2B8G A;  2L55 A;  1YNJ C;  1NR4 A;  2PO4 A;  5CV7 A;  2SDF A;  1I4R A;  3CHB D;  1G2T A;  1AZQ A;  4XMY A;  1LT5 D;  3F2U A;  1F9Q A;  3OMG A;  4JK1 C;  5D14 A;  1ROD A;  3VYT A;  3J7A F;  1UD6 A;  2XZO A;  3J80 E;  3K5M A;  5FO9 B;  1EFR A;  1UD4 A;  2Q8R E;  2IJ0 A;  3MC0 B;  4ID6 A;  5T1I A;  1I4Q A;  2O5J C;  2K01 A;  3CRL C;  2E2H B;  5C5M A;  2V31 A;  3MWY W;  3H6M A;  4OIK A;  3WQZ A;  1RDP D;  1SBB B;  3WDN A;  4Y7N B;  1OXS C;  2B2T A;  2EOT A;  3K58 A;  2FJ2 A;  3L3O C;  4BS9 A;  5EBD A;  5C3W A;  2DNC A;  1VCI A;  4JMQ A;  3H3V C;  4ZQ3 A;  4QMG A;  1EL0 A;  4BBR B;  5AFW A;  1QE6 A;  2HCC A;  2VB3 X;  2R61 A;  2AQ1 B;  3J81 L;  1TWH B;  4BY7 B;  2AQ3 B;  3C1E A;  4A3F B;  4RCN A;  2EPB A;  5LHY 1;  4XT1 B;  4NW2 A;  3R3O A;  3NPP A;  1WPC A;  3CRK C;  4RHS A;  3PUY A;  5E4W C;  2F0W A;  1IYU A;  5T1G A;  3KLS X;  2B2U A;  4IUV A;  1TT2 A;  1KAB A;  4UAI A;  2B2Y A;  1CM9 A;  2EYJ A;  4F88 A;  2E2I B;  3QB3 A;  2WIN B;  1DYQ A;  2A68 D;  4EQN A;  4RGN A;  1V1P B;  3G6J B;  5IGD A;  1MGS A;  3HOX B;  1DXM A;  1CQF A;  1WTH D;  2CHB D;  5KNL A;  4H44 C;  4L6T B;  4B08 A;  3R2I A;  2JSO A;  5CMD A;  2F0Q A;  2JEB I;  2RDG A;  1W6K A;  5JEA J;  3OW7 A;  1BBX C;  1DCZ A;  5JOB A;  3Q24 A;  1R4P B;  2CK3 A;  4TSS A;  2TSS A;  2ENB A;  1WD0 A;  2GJP A;  1CZG A;  3W3A A;  4DA2 A;  4J6H A;  4KY5 A;  1JWU D;  3U9S A;  2PYK A;  2PNR C;  4HSP A;  3SEB A;  4FF2 A;  4TRD A;  2AWO A;  4O1N A;  4EVO A;  3SDZ A;  2OT2 A;  1JOQ A;  2DIE A;  3GTP B;  2ZZG A;  4QB4 A;  3FDT A;  1EU3 A;  3N6R A;  3KLR A;  2IL8 A;  2K03 A;  2F0F A;  1IW7 C;  4B9X A;  2F1M A;  3SK6 A;  1EEF D;  2F0I A;  1KLU D;  4HR7 B;  3PIO 3;  4B9W A;  1PZJ D;  2M2L A;  1NR2 A;  3T53 B;  1KNA A;  1PLF A;  2BDO A;  4N9P A;  1Y8O B;  1EOT A;  2X6L A;  1UAP A;  5HUR A;  2IX1 A;  2MPM A;  1HUN A;  5EJW A;  3NUC A;  1EWC A;  4KKU A;  1M8A A;  1VMP A;  1B53 A;  3HAG A;  3N52 A;  1BMF A;  1WTO A;  2WB1 B;  4YIJ A;  5CV5 A;  5JJZ A;  3MA2 B;  2R93 B;  1H9M A;  2RKS A;  1V1O A;  3V05 A;  4XT3 B;  3RZD B;  2EZV A;  1VMC A;  4BA1 I;  1D1K A;  3Q6S A;  5I9P A;  5KIX A;  2BA0 A;  1VJS A;  5TSS A;  3LX0 A;  3R8B A;  1DZ1 A;  4XLA A;  2L9H A;  2F0J A;  1SNM A;  2JA7 B;  4EGV A;  5EKK A;  5HKK A;  1GUS A;  2FIN B;  4FVM A;  1S5D D;  2XSC A;  1EYD A;  1BOS A;  2HDL A;  1I50 B;  3OWE B;  3Q0A A;  3IL8 A;  3DEP A;  4XKW A;  2WKC A;  1EZ8 A;  5KNC A;  4A3I B;  3IAY A;  1C4Q A;  4F87 A;  1K28 D;  2TMP A;  5ISR A;  3TP5 A;  1U4P A;  5G3L D;  3OHX C;  5D3I B;  3IFD A;  5D3D A;  1TWF B;  2LKV A;  1QOH A;  2EJG C;  2B2W C;  2ZXO A;  4HMJ A;  3M85 A;  4XN0 A;  3I70 A;  3GVL A;  3PUW A;  2NN6 G;  4CBV A;  2JIZ A;  1IKL A;  1LTB D;  3MXU A;  1MI2 A;  2EY2 A;  1HFG A;  1V0E A;  2RA4 A;  1ENF A;  4K2L A;  5ELF A;  1D5Z C;  3D8G A;  1G29 1;  3K59 A;  4L8J A;  4ZUI A;  4N9T A;  4RHR A;  4K8I A;  5FLX E;  4YEJ A;  1Y1W B;  3DEO A;  1JOO A;  1RF2 D;  4C1N I;  1F2M A;  1KNE A;  2MUY A;  2YYZ A;  4C3J B;  5COY A;  3VA7 A;  3JAM E;  4K6D A;  3FPU B;  1E0B A;  3GVJ A;  2KCN A;  3NE5 B;  4O42 A;  1M4V A;  3ZPN A;  1A3V A;  3P1H A;  1HZE A;  1A2U A;  5I4D A;  3VA5 A;  5DNF A;  5IT9 E;  1G8Z D;  1H9J A;  2NTS A;  4KN4 C;  3GVK A;  1LTS D;  4KN7 C;  3QOL A;  4FNF A;  4BA2 I;  5ELC A;  1HCZ A;  1CT1 D;  1TWG B;  1EIH A;  3T56 B;  4RCO A;  2VJJ A;  3JAM L;  2RQX A;  1F9R A;  5IGE A;  3OEH A;  3MZ5 A;  2EDG A;  3KLS A;  3SE0 A;  1SE3 A;  1BLI A;  3S1R B;  1XX8 A;  5IOC A;  4H0L C;  3GTJ B;  4IUU A;  4QF4 A;  4FF4 A;  2ZTN A;  3I4M B;  1DM0 B;  4A3E B;  3VYR A;  2XGJ A;  1GUO A;  3BDO A;  3I72 A;  4C3I G;  4LJZ C;  3S16 B;  1EQV A;  2PZT A;  5C4H A;  3DHQ A;  2WZP P;  1H9K A;  1ZYR C;  2NZ1 D;  1S5C D;  1LTG D;  4DF7 A;  2JA5 B;  1SJH D;  1CI3 M;  4C56 C;  1RTO A;  1SMY C;  4HN7 A;  1NUC A;  2O5I C;  3HGB A;  2VUM B;  3BVG A;  3NP8 A;  1EZ6 A;  5E3F A;  4ZAI A;  3E0J A;  2WPD A;  2PMZ B;  3SK4 A;  3K57 A;  1ML0 D;  1NSN S;  5KYI A;  3GV6 A;  3IFT A;  1A6X A;  3A8J E;  2C9O A;  2FFK B;  3AMU A;  2KQ3 A;  4XOT A;  5FLX L;  2EYM A;  5JPN C;  2A6E D;  1WTQ A;  1D1I A;  3VYS A;  2X6X A;  4FO2 A;  2DY8 A;  1STA A;  2EVB A;  2M00 A;  5A35 A;  3MXN A;  2ZZQ A;  1UUP A;  4ASU A;  3GTM B;  3Q23 A;  1JOR A;  3DMU A;  2HCI A;  2EY5 A;  4NKL A;  5K36 G;  2R9V A;  5C3E B;  4IFD G;  2O4X A;  3CU7 A;  3OOC A;  4XL9 A;  1LT6 D;  5CR3 A;  5F2D A;  1J9O A;  2JP1 A;  4BY1 B;  1BCP F;  3M4Y A;  2MGS A;  1PMR A;  3BYY B;  3PUV A;  3OFN A;  3K0Y A;  5D65 A;  3PIP 3;  2E2J B;  2WAC A;  1EY7 A;  2L5T A;  3RUZ A;  3J7A V;  4IFD I;  2XRQ D;  5C44 B;  3TP6 A;  5EPK A;  2EYH A;  2Y0S B;  4IZ8 A;  2D3N A;  4EQP A;  2F0P A;  4P2C B;  3RLF A;  1CK1 A;  4FXU A;  3DDY A;  4OO1 G;  3U9O A;  3C46 A;  4C3H B;  4MIU A;  2WKD A;  2F0K A;  2ZT9 C;  3CES A;  1OXU A;  4X3U A;  2IX0 A;  1B44 D;  2K05 A;  3NSW A;  1BR9 A;  3S15 B;  5C0X G;  1CA5 A;  5I2X A;  4Q5V A;  3PO2 B;  5EKL A;  3I3C A;  3KK7 A;  2KEE A;  4ME5 A;  1SFO B;  1I6V C;  4Z9C B;  2BCO A;  2LFN A;  2V7Q A;  5LL6 S;  5I9O A;  1R4Q B;  2GK6 A;  4K14 A;  1NBM A;  1T5X D;  1MBY A;  2JXM B;  3TN2 A;  1D2B A;  3W2D A;  1B50 A;  4ZUJ A;  3OWF A;  1Q1B A;  3BS1 A;  4RA8 A;  1S5B D;  2EE1 A;  2XND A;  5EBC A;  4DNR B;  3D6C A;  3X3N A;  1JIC A;  3K7A B;  1E79 A;  3K5O A;  3QG1 A;  1G2S A;  2EJM A;  1CHP D;  4K5X A;  2X53 S;  3DWP A;  1QIL A;  3IKJ A;  5C0X I;  2HQE A;  3SHL A;  3DUZ A;  1SJE D;  1H9S B;  1DD2 A;  1FGB D;  2E74 C;  3TME A;  1JOK A;  3H0G B;  4OO1 H;  4PV1 C;  2KVM A;  3O13 A;  4KD3 A;  3BVM A;  2PZU A;  3KBX A;  2QCP X;  4KMU C;  1XYI A;  4ZYS A;  3OSO A;  4U68 A;  4EQO A;  2EYO A;  1SYC A;  2DY7 A;  2F0E A;  2A69 C;  3EJI A;  3K5N A;  1I4H A;  3NWS A;  4HIZ A;  5I2Y A;  3CP8 A;  1SAP A;  2CVR A;  2VJI A;  3M4O B;  4G7W A;  3A8K E;  2PW5 A;  3NWT A;  5CDF A;  3ERQ A;  4E6I A;  3LWE A;  4GZY C;  2D62 A;  5C4X B;  5C6A A;  1BCP B;  1STN A;  1Y1V B;  3OPO A;  3SVM A;  1PTO H;  4H13 C;  1HTL D;  2NN6 H;  1TII D;  4XQF A;  2RVL A;  2W6J A;  5C4J B;  4KTA A;  3I4N B;  2O2L D;  2QF7 A;  4C3H G;  3GTL B;  1A3U A;  2Z8L A;  2E76 C;  1B9N A;  2ZZE A;  1JC7 A;  1V1P A;  3GD7 A;  1S5E D;  1ILP A;  1D5X C;  4WRD A;  1STG A;  4KHZ A;  4K5W A;  1XTC D;  4IFD J;  1NAP A;  3I91 A;  4DAP A;  3MAQ A;  5CGK A;  1Z6H A;  3RD4 A;  1I6H B;  3TZD A;  2WII B;  3KEW A;  3TSS A;  2RSO A;  2XRS D;  2KA7 A;  1F9S A;  3V96 A;  3PMF A;  2XWJ B;  4A3B B;  1PZI D;  1TQO A;  2PW7 A;  1XWE A;  4AVZ A;  2KEC A;  2D9U A;  2QE7 A;  3M7N A;  2Z1C A;  3MHB A;  3FKS A;  4XON A;  5C0X H;  1X32 A;  3GTG B;  2JA6 B;  2ZZF A;  5BN5 A;  1LLR D;  4KKT A;  5FO8 B;  1TWA B;  1RD9 D;  4PNY A;  2QIL A;  2JA8 B;  1BUV T;  1SYE A;  2F4I A;  2K28 A;  3I8Z A;  1DOK A;  1E2Z A;  2B2T C;  4CGY B;  1O7Z A;  2NYZ D;  1TU2 B;  1B4O A;  1F2Y A;  4PQX A;  3RZO B;  4UDU C;  4HMI A;  3T4A C;  1AZP A;  1WTX A;  1UD3 A;  2B2V A;  3I73 A;  5J39 A;  2AUK A;  1WP6 A;  3BCF A;  3NBH A;  1PFN A;  2MP1 A;  5HGT A;  1SND A;  5C5L A;  4XLC A;  3ZIA A;  2F0L A;  4K8J A;  2RSN A;  4NP5 A;  5FKA C;  1D6E C;  1V0F A;  4UZU A;  1WTV A;  1I3Q B;  1SYB A;  1QB5 D;  4ILW A;  1GUW A;  5EQ0 A;  1ZYR D;  3HOY B;  2KVO A;  1QNK A;  4FF3 A;  2K5W A;  2X6W A;  2FHT A;  3HOZ B;  1GJX A;  3VYU A;  3H94 A;  1AEX A;  1STE A;  1E43 A;  5JVG 3;  2F3W A;  1E3Z A;  5I6W A;  1EY4 A;  4V0B A;  4IUN A;  4XTC S;  2ID0 A;  1SYF A;  1CZW A;  1L0X B;  4MHE A;  1AW7 A;  1SXT A;  1E1R A;  3MVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...