3OOCA

Crystal structure of the membrane fusion protein cusb from escherichia coli
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
297
structure length
297
Chain Sequence
b'TQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein cusB
publication title Crystal structure of the membrane fusion protein CusB from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 40
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3oocA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3oocA03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3oocA01
1Z6HA 2NN6G 3WDNA 3H94A 1GUNA 4LK1C 4KN7C 1Q1BA 1E2ZA 2CW0C 2EJMA 3QIAA 1I6VC 3MFYA 1DD2A 5BN5A 1GUOA 1E2WA 4KHZA 3OPOA 3I73A 5BN3A 3ND9A 2Q8IB 4KKTA 1B9MA 1PMRA 2AUJD 4I7ZC 2EDGA 3LWUA 3OOCA 1VF7A 3T56B 1DCZA 1O7LA 1OXUA 2K7VA 2QF7A 3HGBA 4IQZA 3VR2A 2O5IC 5A35A 2DNEA 3CRKC 3QG1A 2E75C 3GQBA 3N6RA 1TKWB 4XIGS 3A8KE 1SMYC 4XTCS 2A6HC 3KLRA 1TU2B 1K8MA 1OXXK 2IT1A 2PCFB 3BDOA 2A6HD 1B9NA 5BN4A 2BE5D 1ONLA 3SE0A 2A69D 3PUYA 2EJFC 2L5TA 3BG3A 3VR5A 3AB9A 3SDZA 2ZT9C 1VF5C 3L7ZC 1CI3M 2A6EC 2LMCB 3ND8A 2DNCA 1OXSC 3I72A 2JEAI 3T51B 2A6ED 4OGQC 3VR6A 3IKJA 2E76C 3LNNA 1HQMC 1ZYRC 3PV0A 4JK1C 3OW7A 3D4RA 4KMUC 3A7AB 4KN4C 3W3AA 1H9RA 2BA1A 3TZUA 3PUWA 2BE5C 2PNRC 5KNCA 2AWOA 2A69C 1FYCA 1BDOA 1Q90A 4DNTB 4DK0A 1H9MA 1VCIA 2E74C 3CRLC 3PUXA 3PUVA 3FPPA 4HR7B 1HPCA 2EVBA 3P20A 1CTMA 1Y8OB 4H0LC 4JBWA 1V8QA 3I4LA 4G7ZC 3DXJC 2V4DA 1H9KA 1YNNC 3IFTA 1Y8NB 1IW7C 3RLFA 2D5DA 1FR3A 1IYUA 1LABA 2K32A 2PPBC 1Y8PB 5C0XG 1G291 1QJOA 4IFDH 1IW7D 4G7HC 1K8OA 1H9SB 2BA0A 5C0XH 4RCNA 1HTPA 1V43A 1T5EA 2A68C 2DN8A 2D2CC 2EJGC 1GHJA 2JEBI 2K33A 1H9JA 3D31A 3EQLC 1VDZA 1Z7TA 1OXVA 3NE5B 2A68D 2KA7A 4GZYC 4DK1A 2B8GA 4TKOB 2O5JC 1EWHA 4H13C 1GUSA 1Q1EA 3A8JE 3M7NA 4H44C 1GUGA 2NN6H 3T53B 1LACA 2JXMB 2F1MA 4DNRB 1HCZA 2BDOA 3VR4A 1Q12A 1Y69U 1CFMA 3FMCA 1OXTA 3GD7A 3VR3A 3VA7A 3A7LA 4BA1I 2KCCA 5K36G 2D62A 1E2VA 4KKSA 4IFDG 4L8JA 5K36H 2JE6I 2AUKA 2YYZA 5KNDA 1YNJC 1DXMA 3MXUA 4G7OC 1GUTA 4TQUS 5KNBA 4BA2I 5JEAG 3M85A 4OO1G 2B8FA 2NN6I 1H9SA 5JEAH 4KI0A 4PV1C 4OO1H 1GHKA 3A8IE 3U9SA 3QJYA 4KKUA 1A6XA 2R6GA 3PUZA 3M4YA 4LJZC 1IYVA 1GJXA 1ZKOA 1O78A
chains in the Genus database with same CATH superfamily
2SEBD 1XE1A 1VQ9A 4OWXB 5KNLA 3DHQA 4ZK9B 2HT1A 4X62Q 3ERQA 5IYWA 1CQVA 1FNDA 5IGBA 3ISXA 2ZXIA 4AQYQ 4AVZA 1CHQD 4CQJA 3O13A 4DK3C 2LY7A 1NNXA 4DAYB 2F0GA 1IKLA 2LKVA 4LBZA 3S2HB 2KCTA 4K5VA 3CRKC 1EXMA 1BF4A 3CCVA 3M3YH 1HH2P 1SMYC 4UDUC 2DCUA 4KJOA 4LF6L 3MZ5A 2K5VA 2Q6OA 3E0EA 3W5UA 1KD1C 3BNWA 5BR8L 4XKVA 1EYGA 5NUCA 1JICA 3FKSA 1N34Q 1YLOA 1WD1A 4PGOA 1EY4A 4R4IA 1I5FA 4K5WA 5CR3A 1VQGA 5D14A 4R4QA 4IOCA 1XMOL 3W2IA 5ELNA 3I4NB 5M3FH 1VQ7A 2CW5A 1WTVA 4DV7L 3OW7A 4Q0FA 3HOVB 4TMVA 4XM3A 1XNRQ 4P2NA 4NB3A 2IX0A 1E3XA 3I4OA 2ZTCA 4FF3A 1LTID 4PZ6A 3UE0A 1TR5A 2ES2A 4H02A 4R1JA 4H0LC 4F7XA 1AZQA 2B2VA 2K05A 3V96A 1JB3A 2ZJQA 2F0QA 1ELOA 4YXWA 1JR0D 1I50B 1KDCA 2F3IA 3CESA 1T6YA 4DV4Q 2ZZFA 5C0XH 3J80L 3FPUB 1V43A 1T5EA 1CZWA 5CV6A 1JWMD 4MIUA 2DEUA 5I6YA 4JI1L 4NXNQ 4RGMA 1YBYA 2PQEA 3WY9A 1UE5A 5IYBH 1JJGA 4ZGNB 1Q1EA 1A3TA 2B7CA 2OK8A 2WR8A 1CHPD 3OYYA 5FOBB 4U673 4F7DA 4ZCKA 3Q8DA 4JMQA 3WBJA 4P75A 4QL5A 4WJ4A 4P3IA 3FMCA 3CC7B 4OOVA 3GD7A 4GQNA 1BOSA 2KVMA 1L1OC 1D5XC 4DR6Q 5AFWA 4LUVA 2NVQH 1UAPA 4AIMA 4TQUS 2YWHA 5I6WA 4OELB 4LFCL 2F4NA 1Z47A 3HKSA 3JC66 3B78A 3T1YQ 2R9VA 4GLXA 1YZ6A 2IPKD 4O2DA 1BBXC 5IYCG 1HZBA 3P7JA 3P26A 4Y7CA 1KTVA 4RCYA 1FRNA 2XNJA 3H94A 4XLFA 1S72B 4XQFA 1KABA 1TWHB 2HDMA 4DV2L 1O7ZA 3Q39A 2DJGC 1E1RA 2CW0C 1FNCA 4UZUA 2OCEA 1EP2B 1YNXA 3AGPA 4B3MQ 1OHHA 1E2WA 2K5QA 3I2ZA 1RODA 3ND9A 1SYCA 1VQBA 2Q2UA 1N08A 1V1OA 5DEHA 1G6PA 2J7KA 2F1LA 3G71B 3K7AB 2Q8TA 1Q7YD 1YITA 5IGDA 1AMOA 4P1VA 3D3RA 4CDDC 4CDEC 1CZGA 1J9OA 4FDBA 1RIPA 4KHVA 5KRUA 1GJRA 1IB0A 4Z4SA 3EIVA 2X6LA 3VYTA 4CDFC 4X65L 2CRVA 3ZPNA 1DZ1A 2PZUA 3VMFA 2B2TC 2ZT9C 1PXUA 1S72A 4QVAA 3QFRA 4DQKA 5JJLA 2ZTGA 4A93G 3EN2A 3IKJA 3S1RH 2GA4B 1HUNA 1A8PA 4OWWB 1BQEA 3OEHA 1EZ8A 2FHTA 4O1NA 4LF7L 1Y1WG 3CCMB 1V1PB 1UD2A 2LSSA 2NVTB 4LMQD 1JOOA 5DM63 1STNA 4BY7G 2AWOA 5FJ8H 1KHIA 4DR7L 2JN4A 3OZUA 4R4OA 4C1NI 4A3MB 1KK0A 4IPDA 1YJ9B 1NSNS 2F0VA 5A89A 4OIKA 1KRSA 1BMFA 2RDGA 3OSOA 2HQLA 4H7BA 2K52A 1JE5A 4A3KG 4X05A 5DSZA 1UWVA 2E2IH 2ZXPA 1G291 1K8OA 3S1NB 1G2SA 4ZRZA 3GTMH 2OBSA 1VQPB 1ENAA 3H91A 1E3ZA 4OHJA 1FGBD 3CB4A 4HTHA 4A3BG 5JAVA 1XMQQ 1VQCA 2JQOA 5C4XH 3K5MA 3CCRB 5C4ZA 4FYDA 1SROA 2Z6BA 5HZBA 1MHWC 3A8JE 4X3SA 4DR4Q 2ZXOA 3HAGA 4H44C 1S4ZA 2MPMA 1VQLB 4IFDI 1YIJB 4A93B 1WYDA 2OEOA 3P75A 1BVSA 1HZAA 2WAQE 3GTGB 1CNEA 2BPOA 4BA1I 2VNIA 1VQDA 2J4XA 3FHWA 4IFDG 2G9HD 3PF4A 1JB9A 1F2LA 3A55A 1JQYD 3HZXA 5IGCA 1Y1WB 2W6IA 5CDFA 1E1TA 1ICFB 1TT2A 4TMWA 4BY7B 2RF4A 3ASRA 3V76A 3S24A 5C3XA 2WFWA 4C3JB 1E3PA 1SN8A 1PTOF 3TMEA 4QCLA 2R3ZA 5E4XA 3QSYA 1PVOA 4HCSA 4A3KB 1Q86D 3CCRA 2RCFA 5LMZA 2QEXB 2E5LL 1EQTA 3QIAA 4GKKL 3AVUA 3BC9A 3HRZC 1DD2A 1HFNA 3URYA 1VQLA 4JI3L 4C0SA 4A3BB 1OGJA 2RBMA 1WD0A 1N06A 1ZM4A 2EDGA 1YJNB 1R9TB 3J7AV 2K5DA 1DCZA 4JI0Q 2EYJA 1WCMB 5I9OA 2DNEA 4UZEA 3TS2A 3JQRA 1MGSA 1X9NA 2ZZEA 5JOBA 3CF5A 2K01A 2EY6A 4BBRG 2PCFB 3K0XA 4B08A 5BN4A 5ISRA 1N8RC 3V7AA 5C5MA 2JA8G 1AIPA 1B44D 4YWKA 3MC0B 3LVBA 1T6XA 1GAQA 1TWCH 4KTAA 3I72A 3T51B 2A6ED 1E1OA 2CKZB 4OGQC 3BVGA 2HCCA 3TSSA 4X06A 2OTJA 4PABA 3NQTA 1U5KA 1A0IA 1HR0W 1KAWA 3IRBA 1AN8A 1ZYRD 1VLOA 4F87A 2B5OA 3CPXA 1Q8IA 2L0CA 1NBMA 1PTOC 3OW2A 1BDOA 1L1OB 1R4QB 3LQ6A 1NTGA 4ACAA 2GK6A 1EWCA 1K3BC 5I9PA 4A3GG 1W35A 2EVBA 3R8BA 2X6WA 3MHPA 4ZKBB 3OWEB 4R71A 3IFTA 3NUCA 1XNQL 1GVPA 1FNWA 4IUNA 1WOSA 2XZOA 1A2TA 2WAQG 1Y8PB 1MIUA 4M1KA 2XNAC 4IO9A 4G7HC 3QFSA 4KY7A 4DU9A 1HTPA 4LF4Q 1YHAA 4BBRB 4TRDA 1M90C 1SR3A 4C3IG 4JI7L 1VDZA 3CCJB 5C4JH 2JA8B 4R9WA 4LF5L 4RPDA 2GN5A 4FNFA 3CPWB 3CC4B 3AQQA 1UEAB 4XQJA 4KY6A 4X6AH 2WSSA 3Q24A 2QA4B 3TDQA 1NY4A 1SNQA 2K50A 3HG9A 2KQ3A 1HCZA 4TMTA 3F2UA 4Y7NB 4ROXA 1L1OA 1TTTA 4RHSA 5K36G 1JB7A 3I70A 1E2VA 2F0OA 3S16B 1X32A 2N88A 4A3LH 2BGJA 3OAAA 1YNJC 5ELFA 1L0XB 3UDFA 3BVMA 1RDPD 1RJTA 3KL9A 1EUJA 3R2IA 4P2CB 5EGTA 5C3WA 4BA2I 1E22A 1EY7A 1H42A 4X7DA 3K7UC 5ELOA 2ENBA 5FNZA 1EFWA 4LFBL 3K80C 1I4GA 2VY3A 4P26A 4P72A 2LZJA 2CF4A 4J0QA 3VDYA 4A3GB 3PUZA 2VQEL 1IBLL 2R7FA 2VNHA 1J5EQ 4IPHA 4B3SQ 2D3NA 1O78A 3TREA 2N78A 4U9UA 2WAQB 3NTHA 4XONA 2EJMA 3DDYA 2XNDA 1NDHA 4Z4WA 4JBJA 1W0KA 4Z4YA 2VB3X 2ID0A 2B2YC 3OPOA 1P4MA 1ILPA 3CHBD 3J7YW 2AHOB 2SNMA 5FO8B 1K9MC 1A62A 3W2EA 2BH8A 1B23P 3OOCA 1IXRA 2EIFA 5IYDG 3K6OA 5J3BA 1N33L 1ASZA 5IYPA 5EAYA 3A5UA 1BQQT 1PHJA 2K28A 3G6EA 1AEXA 3D4DA 1ONLA 4JI5Q 2B2TA 2EOTA 2PW7A 4RD1A 2BH2A 2DJFC 1OB2A 3AEVA 3OFNA 1M1KC 3BYYB 4M53A 3ZJYC 1SE2A 1NBWA 4LBWA 1GM5A 3BDLA 1IHZA 1I3QB 3J81E 2OWOA 4IUUA 1HQMC 4PC1A 4JK1C 3CC2B 5GROA 3W2FA 2VB2X 3I4MH 3A7AB 5H1SE 3RLOA 4I7AA 4DV3L 1PYBA 1ESFA 2E8GA 2A1AA 4RMFA 2OK7A 3VO2A 4N8FA 3NWSA 3ONYA 1I6HB 4MTKA 2WB1G 2MNAA 1R4PB 1OTCA 1CTMA 2GJPA 1Y8OB 3NELA 4WZTA 5JEAJ 4DR3L 1QJOA 3OZWA 3GDEA 1Q82D 1SM4A 1C9OA 3GTPH 1VQ4B 3MEFA 4HIKA 4YCUA 1Z7TA 3GTOB 2HIXA 1VQ6B 1QZHA 4GLVB 3GP7A 1GUSA 3CKIB 4MNOA 3R6JA 1FNVA 1TS5A 4DKAC 1FX0A 3JU4A 3G48A 5J39A 5TSSA 3S9WA 3SEBA 1D8LA 1VQ5B 1K3RA 4RD0A 1STBA 1F77A 1DDIA 3S1QH 4IW3B 1QVCA 3A35A 2B2VC 2EYPA 2RQXA 2HLDA 2DERA 1GUTA 4NW2A 2PYKA 1QGYA 5EQ0A 2R93H 4L5SA 1C4QA 1TWFH 4KI0A 1GHKA 3GIRA 1PV4A 4XXEA 2WB1B 4RGTA 2MFIA 2Q8RE 2B63B 4Z4RA 4X62L 3CXCA 1EEFD 2A19A 2SDFA 3PO2G 4TMZA 1E0BA 2KOLA 1XWEA 2Q6LA 3JQQA 2Z6KC 4EH1A 4LK1C 2F0FA 2K04A 1WTRA 4QUZA 4KHPL 3PO3B 4NCNA 4FF4A 2Z9HA 3G7LA 3J80E 3PQIA 1W34A 1WFQA 4OL7A 1PTOB 1KQSB 1YHQA 3CCQA 2Q6KA 5E4WC 1WU8A 4QUCA 5A35A 5M5YH 4Z1MA 3VNVA 1J8IA 1BNZA 1EIYB 2EY1A 2L9HA 5E1FA 1ENFA 4DPGA 1Y1VH 1K8AD 2A6HD 2IWHA 3GV6A 4X7FA 5C0XJ 2L5TA 4FF2A 1PH3A 3EA6A 3VR5A 2LXJA 2AQ2B 3PA2A 3M4OB 3CW2A 3CMEA 4B3GA 2JDIA 3CMAA 2CH4A 3H09A 3E5SA 3NBHB 3MEHA 1QX4A 1K83H 3A3BA 2C78A 1QVGB 1QUFA 4P73A 3TP7A 1EY9A 4LUZA 4R4CA 3PO2B 1XNRL 5A8AA 3HOWG 4DUYQ 3HOZH 2BM0A 2WINB 3KBGA 1H9RA 3PIPA 3W2GA 3S2HH 4N9PA 3CP2A 4MTNA 1NMGA 4IUVA 5FK9C 3ZYYX 2XVSA 3PUXA 1XXGA 5M5WB 1N32L 4K5XA 4ZGQB 2TMPA 4DV4L 3FEWX 3RLFA 3OZVA 5C44G 2ZITA 2E2JB 3KLSX 3W5HA 2K32A 1JT8A 1UD4A 5KW9A 4HIOA 4M8AA 3KF8A 2PMZE 1RQRA 3Q38A 1YJWB 3NBHA 4G5GA 3BJUA 4DFAA 4XORA 2K5HA 4AH6A 3TRZA 4IPCA 1KRTA 3UDGA 3W5OA 3M7NA 1HFGA 1G91A 3CCUA 1Q9SA 2ZXHA 3HOVH 4N3GA 3WNDA 4HJ5A 4XYQA 2Z6BD 4OWTB 4HJAA 4A76A 4CDCC 1N36Q 3WYAA 3FKIB 3MVVA 5FLMG 4GNXB 2NWGA 4A3EB 4FXGC 2Z4HA 1EYDA 4RKLA 3BQJA 4X66Q 3G4SB 1T5XD 2B29A 1CKMA 1I4PA 4DV1L 2F4VQ 2HD3A 3BZDB 4OPSA 1VQ9B 1H8EA 1MJEA 3BDCA 3RZDB 1YJWA 1WORA 3NK9A 1TWGH 4MN3A 2IHEA 5C44B 1E79A 2CBXA 1IBKQ 2DY1A 2GJKA 4TSFA 1VMPA 2F0UA 3SK5A 1E2ZA 1STGA 1D2BA 1BCPF 2MGSA 5J3OA 1GUOA 5IT9c 5BN3A 2L11A 1KNEA 1TS2A 3S15H 1VLYA 4XNFA 1QVFA 2AUJD 2F0KA 2BMWA 4XD7A 2QW7A 1VF7A 1L2FA 1O7LA 3CCVB 3LWUA 3SJPA 3HGBA 4LF8Q 4K0KQ 2VL6A 4A3FG 3NPPA 1X3FA 2E75C 4NXMQ 2PI2A 1F2MA 2GPJA 3G4SA 3PSIA 2F03A 5DAUA 2NVXB 1TIID 4B9WA 2V7QA 4JBKA 1QUEA 3PUYA 5HXBA 3BG3A 1N0UA 1KD1D 2A74C 2GVBA 4O0AA 3B82A 3A3GA 3BH4A 5GAGC 1I4QA 2ASBA 3I7FA 3UDXA 5M3MH 2I46A 2KJXA 3T4AC 5CC4A 4X3TA 1JMCA 1VQ7B 1HA6A 3MCAA 4B4DA 1QB5D 3U6BA 3MAQA 5JJKA 1R5NA 3VR6A 3OIQA 3OE7A 4UHVA 4YY3Q 2Q2HA 2H1EA 3GVKA 1EOVA 4RHRA 3U2QA 3H0GH 4CKCA 3W3AA 3CMMA 2BA1A 1UD8A 4X07A 1SMXA 4KY5A 3K7AH 4DV0L 1CT1D 1FD7D 1Q90A 3EBEA 4X3KA 2VBTA 3GTKH 5A88A 4G7ZC 4BY1G 3HOXB 4TMXA 2R92G 3FP9A 5CV8A 2OF1A 2QTZA 1H9SB 1S0UA 1SE3A 5HY6A 2UU9Q 1S4MA 1PFMA 4A75A 2JEBI 3EQLC 1SJHD 1H85A 1DGSA 1WTHA 1QG0A 3NTKA 4DR4L 2IX1A 3CQZB 2D0OA 5FLXE 1WTXA 1SSOA 4K6DA 3KEWA 1X54A 1LACA 4JI6Q 4JI8Q 1K0SA 1RTOA 5C3EG 4IUTA 1FJGL 4CHTB 2GQFA 1CFMA 5EPLA 1Q81C 4EX5A 3A7LA 1ASYA 2CVRA 4A3MH 2PMZB 3J81k 1EEID 3ULPA 5LHY1 1L0YB 3HOYH 5JEAG 4KJNA 2NN6I 1H9SA 3NXWA 4YIJA 1VQAA 1D5ZC 1LT3D 4YELA 4XKWA 3W2HA 1CSPA 2EFGA 5EKLA 3PVDA 2Z6KA 4LUOA 4LBVA 2R92B 2K14A 2NN6G 1PRTF 3OTOQ 2ZTNA 2KEDA 2X3UA 2RSOA 2C2WA 4OX9Q 2PE3A 1FGUA 5EKIA 3NP8A 4UPAA 4BXXH 2CW0D 1HQRD 2G5DA 4FP5D 4KHZA 4ODGA 4JYAQ 1VQNB 4OPOA 3T13A 1VQKA 1PMRA 3Q6SA 2C5BA 1Q8KA 1YITB 1SYDA 3CD6A 4IQZA 4MYUA 2HDNB 4J8QA 1E7ZA 5DS0A 3WQZA 5GQOA 4XTCS 1EQRA 3VA5A 2VUMH 4XLCA 2K5NA 1PH6A 4II2A 3I55A 4HSPA 1OXXK 1XQBA 2MJ8A 1KK2A 1F60A 1H95A 4XT1B 4C3JH 1A3VA 1RF2D 3RN2A 4HAEA 4HE5A 1F9PA 2R7ZH 1ZM3A 1K28D 2UXBQ 1CI3M 5HGQA 2P3MA 2X69A 1OXSC 4JI4L 5M3FG 4ZCMA 3CRZA 3QOLA 4B3TQ 1VQNA 3B8HA 4QGUA 2D9RA 2RVLA 4KD3A 4JC0A 1QUQA 5DLQE 4GLAC 4NBSA 2V7TA 1K8GA 4JI2Q 4IN3A 2MP1A 2HHHL 4C2MH 4JV5Q 1WCMH 3U58A 2JA6H 1VQHA 3LO8A 2V7UA 1D5MC 1SNDA 3E1YE 1VCIA 5C0XI 3IL8A 4HR7B 1PRTC 3LX0A 3ASQA 3C3LA 4EQPA 3DXJC 4UP8A 3AU7A 3RN5A 3DWPA 5LMUQ 5C0XG 1PFBA 1SE8A 4IFDH 1SFOH 5IP7H 2ATWA 4B3XA 1N9WA 3D31A 2EQSA 4QUFA 2F4IA 5JVG3 2L12A 5IYBG 1TVCA 3KF6A 1PH9A 1B4OA 2F0NA 1STYA 2OT2A 4QJFA 1D6EC 2UUCQ 4WZLA 3D26A 1CUKA 2XNCA 3CP0A 3CCLA 5A2QE 4L5QA 2KCMA 5G3LF 2K5WA 1CNFA 1DJRD 4A3IH 4ILWA 2CWAA 4Q5VA 1II3A 2ZJRA 3QO2A 2QTLA 2D62A 3TP6A 2NPFA 3ZBTA 2C5CA 4A3JH 5IGGA 2D0PA 5D65A 1WTPA 2VNUD 2F0TA 2PQAA 4PC6A 1B3AA 1PH7A 2L55A 1J5EL 4Z9CB 4ZV4A 1KC8C 2FXQA 1VQMA 5LMNQ 1I94Q 2B2WA 3SR1A 3K57A 1PA6A 4LF6Q 1JCKB 1LUZA 2XGTA 5F2DA 3NQIA 2JA8H 4LC0A 2EXDA 4UP9A 3LQEA 2N8NA 5BR8Q 4K2KA 5IP9G 1LYLA 3CPFA 2QEJC 1P16A 2JJ2A 4XQNA 5ELBA 3PCOB 3ASPA 4Z4ZA 4YHBA 1ILQA 5B6IA 4Y7NH 1LTBD 3AFPA 1XMOQ 1QGZA 2E2HH 2VNJA 5I2XA 5M9OA 4RWSC 1RHPA 5KGUA 2YU9B 3S14H 4NMZA 1K8MA 2CNDA 4DV5L 3NENA 2NV4A 2BE5D 1RTNA 3PIOA 2ZJPA 1TQOA 1N8RD 2RDFA 2NVQB 5FL7A 1MRZA 1EY8A 3BZKA 3ER0A 3M7GA 2LMCB 4ULLA 5JPNC 2OTJB 3CAMA 1SBBB 4PG3A 4IZ8A 1FNMA 4PC7A 2IHFA 5ELDA 4XOTA 2DOGA 4DXFA 3S2DH 1PFSA 4IPGA 3FVQA 3RY8A 3OW2B 2A73B 2XN9C 4JI1Q 3U9OA 5FJ8G 2BE5C 1I4RA 1HR0L 3DM1A 1U4RA 1GXDC 4PMWA 4DK0A 1EWYA 1PTOD 2QN6A 1HPCA 5HKKA 2JJ1A 1HTLD 4DK6C 1YNNC 1Y8NB 4K8IA 2SOBA 3CU7A 2ZM6L 4RJLA 3KLWA 2OTLA 4N9TA 2I0QA 4WWVA 5ELEA 3CW2C 1H9JA 1DARA 1MABA 4OOXA 1AE3A 4P74A 5C4XG 1Q46A 1M90D 2XWJB 2A8VA 1I3QH 1E43A 4H13C 4LFCQ 1HVXA 3M4PA 1X3EA 3D6CA 4GOPC 1YI2A 1TWAH 2ZL7A 1UMKA 5IK2A 4IURA 1XFOA 4K8JA 4MHEA 1KK1A 3S1RB 1CA6A 4YAWA 4DV2Q 1YX2A 1Y69U 2V1CC 3CCSA 1ZUNB 1X6OA 5H59A 5F4OA 1I6HH 2AQ3B 2XRSD 4GNXC 2E2DC 2BGIA 4FWTA 4FN5A 1W0JA 1PH2A 2V7WA 1YNJD 4ZUIA 4ZUJA 4OO1H 2VJIA 1F9QA 1JJ2B 2KEEA 2QGGA 4A3DH 2PZWA 1UD6A 4HJ8A 1XPOA 2JA7H 4OIJA 1A6XA 1ZM2A 2X6YA 4LJZC 1UNSA 5JBQA 1SYFA 2RC5A 1KIXA 2E2IB 3DWAA 3GTOH 1S3OA 2WB1E 3AVXA 1GUNA 4XMYA 4C1NK 3GTMB 3LGJA 2Z8LA 2RSNA 4X65Q 4LNQA 1CKNA 5BN5A 4DV6L 3QR8A 3QFTA 5C4XB 3C46A 5IYRA 4EQ5A 3AVYA 1JORA 4XN3A 1K9MD 1OXUA 2IJ0A 2K7VA 3SKBA 1S5FD 1HNXL 2UXCQ 1PRTB 4OONA 3G6EB 1PDQA 1U4MA 3KLRA 5C5LA 5GAHC 1JJ2A 3G05A 1U2RA 1WTQA 2NB0A 2F0HA 2VXWA 1KJZA 1EY0A 2FX3A 4G6IA 4QB4A 1B1ZA 4DUZL 2B63H 3GTLB 4OOSA 5E6TA 4QF4A 3IAYA 2B2UA 4P71A 4C3IB 2JA5H 1M1KD 3FPKA 1F2ZA 3CCEB 1G7SA 2NTSA 4ZAIA 4JBMA 4X8IA 2JN9A 3S17H 2ICIA 5GAEC 3PO3H 4X64Q 1HA5A 4B3RL 5FO1A 4NPSA 1NMFA 4LBYA 4GN5A 1F9SA 5IWAL 3RZOB 2C4TA 2Y0SG 4JOIC 1H9MA 1C8CA 1LTGD 1W2BA 2UXDL 1IL2A 3ITPA 5FO7B 1DOMA 1EIGA 1U9RA 4QFMA 2F0EA 4E6IA 2M9VA 1U4LA 3GTJH 3SK4A 5CBEE 3ZIAA 4ASUA 1HNWL 2NZOA 3T1HL 3CCEA 4BBSH 4P25A 2VBVA 3K5NA 1J6QA 3BY2A 3A8JA 2BDNA 3DUZA 4HMJA 2J7ZA 2F0DA 2KHJA 1TWCB 4ZYSA 2UUAQ 3BCDA 2AQ1B 4DXGA 1PFNA 1BPLA 4DNRB 5BSYA 3KJPA 4YAUA 1OXTA 4LFAL 1MD2D 2RHQB 4L5TA 3U4ZA 4N3NA 3SJZA 4DR1L 1G7CA 1BJKA 2PW5A 2ZTDA 3BZCA 3H15A 2MO1A 2OQKA 2DIEA 1EQVA 4GKJL 2ZTEA 2B8FA 1W6JA 2WKCA 2Y0SB 1JNYA 1NB9A 4RG1A 3CXCB 2EE1A 5I4DA 4FF1A 1VJSA 4QHYA 4OP7A 2O4XA 1WSVA 1IYVA 2KVOA 1VQOB 2CCZA 4PZ7A 2YWEA 1ZKOA 1X65A 3WOFA 4A3CH 4P12A 4WORA 4WQMA 5C4HA 1MSGA 1TS3A 5THXA 4Y52H 1HNZL 3DM3A 3U4VA 3WXMA 1W87A 3RMHA 2ALYB 1I4HA 5TRDA 5CMDA 3J7AF 1YHQB 3CCQB 2QDXA 3MHBA 2Q8IB 4JCVE 4I7ZC 5M5XH 4NXML 4CBVA 3MTSA 3F2CA 1EY6A 3T16A 1EFRA 3E0JA 3HFZB 4IJHA 4F8MA 3JAMi 5C6AA 3A8IA 1LT6D 3FKIH 1L0WA 4L6TB 4A3EH 1EIHA 1UE7A 4PQXA 2B39A 4CJ2C 2A5HA 2OQ0A 3NWTA 1OB5A 1STHA 3ERSX 2VBSA 2DY8A 1PJ5A 3GTQH 2EJFC 1AFPA 1D1NA 1VQOA 4AQYL 3CMEB 3FRPB 1UE6A 3CMAB 5IOCA 3SDZA 4DR2Q 1NJID 1VF5C 4RDJA 3L7ZC 4UY8C 3KFUA 3AVVA 1GD7A 1PZJD 5EMNA 1VMCA 1BX0A 1VQJA 3D8GA 5L37A 1XNQQ 1OB0A 5CV4A 4AYBG 3E9HA 3VYUA 4C3HH 4DQLA 5FA6A 1TVXA 1X56A 3SHLA 3HKZG 3I4MG 5F4MA 5GV7A 4WZKA 3A8KA 1WI5A 4LF5Q 1AZPA 2VNKA 5L46A 3WNCA 3U6KA 4CJ1B 2XIWA 3CRLC 1CSQA 2ICEC 3IFDA 4RGOS 3E6ZX 1BO0A 3ONUA 4APVA 2XTIA 1STEA 1N34L 1NJIC 1CQFA 1FRQA 1PKVA 4XLHA 4NDXA 2NVXH 3A54A 2LS01 1O7YA 2NVTH 1IYUA 1EFUA 1EU3A 3HOUH 3KF8B 1E62A 1CM9A 5FLMH 1U0LA 1GR1A 1N05A 3GVLA 4IJLA 2ZBVA 2DN8A 1GHJA 4X7CA 1I7PA 1K0RA 5IYQA 4GOPA 4LWCA 2PO4A 4ZCIA 1B70B 2JYOA 4LFBQ 1BX1A 4TT3A 3ZZTA 3CCUB 1IL8A 2QDBA 2L15A 2KUMA 1DM0B 2XZPA 1SNMA 2VQEQ 1IBLQ 2F1MA 4G57A 3SK8A 5LL6X 2CQAA 4AYBB 3BS1A 2I1LA 1TY2A 4GNXA 3QOJA 1WOCA 3HS0C 3H3VH 5KIXA 3I4MB 3KK7A 4KKSA 1VQIA 5AJ3Q 1SXTA 2JE6I 1X3QA 4R4TA 1PZKD 1KLGD 4NXNL 3HOXH 2R93G 2AKWB 4JPBW 1BXTA 3M85A 3S1MB 1QNKA 4MYTA 1N33Q 5H5JA 1KK3A 1KZLA 3KBXA 3KDFA 4FK8A 1XTCD 4RFBA 3I4NH 3WDNA 4QY7A 3KYHC 4NNJA 1SEBD 2FMMA 4HIMA 1EFID 1WSRA 2ZL5A 1I6VC 1QVFB 4DR6L 1J9ZA 3MMPA 2LFNA 3K8AA 2I5LX 1SJED 3HOWB 1CKOA 1B9MA 2F52A 2XRQD 4YCVA 3PIP3 2FMCA 3GO5A 1KMHA 3C2PA 1Z9FA 2QF7A 3VR2A 2X53S 1UEBA 3T1YL 5KYIA 3GQBA 1I50H 1GO2A 1QFZA 2NYZD 4JG2A 1XTDA 1Y1VG 2YTXA 3BY1A 1V1QA 1QWYA 2R6HA 4ZCLA 5HURA 1R5OA 1EY5A 3Q6QA 4R8IA 4IFDJ 3EJIA 2UXBL 1ET9A 4R8NA 5TV2A 5F4JA 2B2WC 4B3ML 2ZL6A 3A56A 2R92H 1WP6A 2DNCA 2JEAI 4KD4A 4DR3Q 3I3CA 2IY5B 1B50A 5GV8A 2N49A 3LNNA 3K81C 3AVWA 4RKBA 3HOZG 2D9UA 4JI2L 4JV5L 1O7IA 2JJQA 3M4QA 2KCNA 4JOIA 1FVIA 3TZUA 1PJ7A 3Q6RA 4DNIA 3R93A 3L9AX 1KRHA 2PNRC 4NP5A 1EYCA 2GVAA 3DWQA 3DMUA 4A4IA 4DR5Q 2CHBD 2PMDA 2RKSA 5LMUL 1V8QA 4XLAA 3RR5A 2NVYB 3HEJA 2V4DA 3STBC 2KENA 1W3SA 1IW7C 1HRJA 2D5DA 4NKLA 1G2TA 2WACA 4WZEA 1EZ6A 2XWBB 1TWHH 1ENCA 1Y1VB 2A68C 2D2CC 1PH8A 4B44A 1BBWA 2X6GA 4TVAB 1UD3A 2KA7A 3X3NA 3NBIA 1PH1A 2HCIA 2UUCL 1ZM9A 4HCEA 2NZHA 2R61A 1B2RA 2HIVA 4MZ9A 1HXYD 4POFA 4ABNA 4FVMA 2K6AA 3HOVG 2NN6H 2Q2TA 1JC7A 4WFN3 2BDOA 4K6LA 1K83B 3I56A 5IT9L 2D3LA 3UI2A 3HOZB 1G7RA 1NRKA 4KHPQ 1Q81D 3D6WA 3KUPA 4A3FB 4Q7JB 1BCPC 2QDLA 3W5VA 3OJWA 4YEJA 3F2BA 2WV6D 4CKEA 5KEEA 2EYHA 3J80c 2XOKA 1UE1A 1XMQL 1VQ8A 2V7VA 5I2YA 5KSWB 5LMNL 1I94L 1A8VA 1Y14B 3KLSA 4C43A 3TZDA 4HIZA 3DEPA 3MXNA 1S5CD 1ET6A 5E7NA 2F0WA 3L3OC 1QGAA 5IYCH 3E20A 2CC2A 4YCWA 1C48A 3MFGA 4G4KA 2WKDA 2CQOA 1VQKB 1XPRA 1CK1A 1ICWA 3M9BA 3CD6B 1IBMQ 1E24A 2K75A 4KKTA 2BF4A 1I4XA 4L63B 1GO3E 2TSSA 5LMNW 4DAYA 1RKNA 2BOSA 3E9IA 3I55B 2EYFA 4ZKCB 1FNUA 3ZZ0A 5COYA 2PNHA 4M0LA 3S1NH 3BU2A 2X6XA 1TU2B 1HJPA 2M00A 4IALA 4BY1B 2A69D 3UDIA 4G7XA 5IE8A 3VNUA 1COWA 4BS9A 5IODA 1A63A 5M3MG 3Q22A 4IOAA 3K5OA 1SYBA 3TN2A 1N32Q 1EWIA 5GADC 4ALPA 4HN7A 3WBKA 1K73D 4JI0L 1XB2A 4IUPA 3W2DA 1TWGB 3A5ZB 2OYNA 4A93H 1QUQB 1GOZA 1EOTA 3H0GG 3GTGH 4LF9Q 4KN4C 2ZBUA 4O42A 2EIXA 3QE2A 3K5LA 1Y1WH 5C3EB 1IJFA 2C9OA 2A69C 4DF7A 3TEHB 4QQBX 4BY7H 3S15B 4RH6A 4DNTB 3PUVA 3FPPA 4JBWA 1QILA 2YU9H 2Q2IA 3I4LA 2VS1A 2F0JA 2F43A 1H9KA 3I90A 1PRTD 2VQFQ 4BPRA 1K73C 3CP8A 4A3KH 4Z4UA 2DYIA 1NR4A 2WIIB 1NR2A 4ME3A 2B2UC 2K33A 1CA5A 1IJEA 3KF6B 3W1GA 2QMUA 2EXZA 3F1ZA 3JAMc 4A3BH 2O5JC 2RHSB 1EWHA 2JP1A 3GV3A 1D2EA 1R9TH 3CCLB 4DV1Q 4HIDA 2UUBQ 1V5VA 5M3MB 3R3OA 1JE4A 2F0PA 1IZ6A 2HQEA 3P1HA 1PJ6A 1RL2A 4PMCA 1HZ9A 3J7A5 2H5XA 2GREA 5IP9H 4M2LA 2PIAA 3VA7A 4A3MG 3H0GB 1U4PA 3SEJA 4L8JA 3CC7A 1EQQA 4LF4L 4Y9RA 2AUKA 1QH0A 2W6JA 2PQAB 1Y0RA 4K2LA 4OPVA 5KNDA 3HOYG 1QCBD 4RM0A 4RDKA 4UAJA 1VQMB 2R7DA 3LWEA 1SDFA 1ESRA 2HCJB 1NAPA 3Q0AA 4K14A 3GTKB 4FXUA 4CGYB 4YAOA 2G9DA 2X85A 1KC8D 1C7YA 1BR9A 4GN3B 4I65A 4YHHQ 2DETA 4KN7C 4L5RC 4CKBA 4BXXG 5M3FB 1LTLA 5JJZA 3AGQA 4J6HA 4N8X1 2EY2A 3SXHA 4XR6A 2VYQA 2M5SA 2DGYA 2V7XA 2UXCL 1Q7YC 2RDHA 1D8TA 2E1RA 3T56B 2N3SA 1D1KA 4TN1A 2MO0A 3RD4A 3JAML 2O5IC 2VUMG 3G71A 3N6RA 1TKWB 2B7BA 2X0KA 2I07B 3F8TA 3I8ZA 4B3SL 4RLZA 2FINB 2IT1A 1EP3B 3BDOA 3KJOA 4BBRH 4RAUC 4C3JG 3EROA 3AFQA 4DV0Q 4K1XA 1P8LA 4AC9A 4J1MA 2R7ZG 2KBNA 3HOYB 1SE4A 2NTTA 3AB9A 3ONAB 3DLLA 1MSHA 4RD6A 1PZID 5CV5A 5G3LD 3OEEA 5J1ZA 2Q6IA 4RCZA 4X64L 4B3FX 2O2LD 4YAFA 4P3YA 2X8KA 3ASTA 1KTKA 3V2TA 4J15A 4KK7A 4XL9A 4KMUC 1NE3A 3S16H 2JIZA 4YWMA 1KL9A 1WCMG 3A74A 3PUWA 4B9XA 4DV7Q 3CTAA 4JI5L 3SK6A 2JA6G 5TY0A 1LTAD 1V1PA 3CCMA 1BCPB 1LT4D 1AP0A 4JVZA 1OGIA 5IIFA 1N0VC 2ZZGA 4P6YA 3L0OA 5FLXc 4A3GH 2CFMA 2OTLB 3VO1A 1YJ9A 1FJGQ 2EYMA 4GN4B 1SLJA 4TSSA 2VUMB 5IP7G 2PPBC 1YNND 2F0SA 3A0JA 1JJCB 4RCNA 3ULJA 3GTLH 1HUMA 2NBFA 1ML0D 5T1IA 2VBUA 1V0EA 4ID6A 3PUNA 1Y0YA 1YI2B 4C3IH 1JWUD 2VZLA 3SVMA 1F20A 4GZYC 1VQPA 1DONA 2R7ZB 2UUAL 2H4OA 1E63A 3I91A 4KV6A 3KOJA 2P5ZX 2SNSA 4DA2A 3AYHB 3CCSB 2JSOA 1KDBA 1EP1B 1TUIA 4A3IG 1I18A 4B48A 4UP7A 5EJWA 3VR3A 4CJ0B 2KHSA 1YIJA 3RZOH 1PLFA 1LLRD 2MUYA 4EQOA 4A3JG 5K36H 1LM0A 1I8DA 2XSCA 4C2MB 4XDXA 1BUVT 1KDAA 4PC3A 3TBIB 4BWGB 4YALA 2C4UA 4XLEA 2JA6B 1W6KA 2D74A 2V31A 2E1BA 2VZAA 4AF6A 4PV1C 4S3SA 3J81i 3PIO3 2CK3A 3A8IE 4UZFA 4ME5A 3QJYA 3OKXA 5J22A 1Q86C 2LXKA 2C77A 5T1GA 2Y0SE 1IYJB 5E3FA 1WVLA 5FLXL 1UUPA 1C0AA 2ZXRA 1E1QA 3NSWA 1SFOB 4HE6A 1CKNB 3SGIA 3SLNA 3PGZA 2FJ2A 3F2DA 1SYGA 3TP8A 3VYSA 2QEXA 4WJWA 1WOPA 2YWGA 4XOPA 3GSIA 2RCNA 4HMIA 3TS0A 2Z0SA 4DAPA 1DDGA 5FO0A 4JI4Q 1WTOA 3L2PA 5IYDH 1LV9A 2YV5A 1YJNA 4PNYA 4WRDA 2Z1CA 3A8KE 3K59A 4A3IB 4PC2A 4UAIA 2QILA 1D1IA 2HHHQ 4ZLTF 4DR2L 4A3JB 5FO9B 1BLIA 1RCVD 3TP5A 1MJCA 2GJRA 4P22A 2HMAA 2F0LA 3C1FA 2A6EC 3MXPA 4XQQA 1QG7A 1DG1G 2N55A 5FIUA 4P9SA 3W1BA 1SNCA 2E76C 1NUCA 3J81j 2VJJA 1TS4A 1W9XA 3TQYA 1ZYRC 1HZCA 3D4RA 1ZXTA 1WTWA 5LL6S 1QE6A 2L4NA 1ZEQX 3ASSA 1KXLA 1NB0A 1W2BB 4LF7Q 3PF5A 4P6VF 2E74C 1EFCA 1B3QA 2BSAA 4DR7Q 1B8AA 1QZGA 3WNBA 1HA3A 1PYSB 2E2HB 2K1BA 2MQHA 2BM1A 1FR3A 1JA1A 1LABA 4DGZA 3ICEA 3S14B 1PH4A 1SNOA 2I5HA 5CV9A 5DNFA 1JOQA 2EJGC 4DUYL 1T6ZA 3R6KA 3J80i 4LAAA 1IHMA 1MBYA 3NE5B 5BSXA 3K0YA 4FO2A 1PYWD 5FKAC 1VS0A 3PENA 3CCJA 3DEOA 4JW0A 4ACBA 1PTOH 2B3GA 3HP3A 3WOEA 1S40A 3CPWA 3CC4A 5CORA 4B43A 4ZQ3A 2EZVA 2JXMB 5EKKA 2GK7A 4HJ9A 3V05A 3VR4A 2QA4A 1LTSD 4EQNA 5K5PA 3BVZA 5AJ3L 3BCFA 1DOKA 4RPBA 3S2DB 4OO1I 2KCCA 1UD5A 1SAPA 1M4VA 4AYBE 3MXGA 3ULLA 4X7EA 2QE7A 2M2LA 3R2TA 4EVOA 3MXUA 2WZPP 2YWFA 3HKZE 5KNBA 1G8ZD 3E3XA 4OO1G 1G51A 3AVTA 3M4OH 4A3DG 2JA7G 2K03A 2OBRA 1STAA 2L1BA 1K28A 3U9SA 4KKUA 2FVGA 1SYEA 1T9HA 2R6GA 3M4YA 2WYRA 5CGKA 3PO2H 2WPDA 4DV5Q 5HZAA 1WTHD 5CV7A 5A2QL 1Q1BA 2OXPA 3MFYA 1GKHA 2KECA 2YTYA 1N36L 2F0MA 4RD4A 2KHIA 2E5LQ 3ZUGA 3RLNA 4A3LG 3D0FA 4GKKQ 5CBAE 3H9NA 2QGQA 5HGTA 4V0BA 4PMBA 4X66L 4HJ7A 4QMGA 4JI3Q 5D3DA 5M5WH 1TWAB 2AHOA 4C56C 4QVJA 2F4VL 1VHOA 4FXDA 1XPUA 4XN0A 4H9GA 1JWSD 1QOHA 3H6MA 3K58A 4F88A 2E2JH 2NZ1D 1A2UA 2PI2E 1DYQA 2WJYA 3OP1A 4RD3A 3ZZUA 5EPJA 1IBKL 4G1BA 1RD9D 3EFXD 1HR0Q 3S1MH 1QNUA 1CQXA 5IT9E 2K4KA 2B63G 2BN4A 4RDLA 1O80A 4DAVA 3P27A 3OIPA 1LTRD 2JA5G 5C4JB 3EVQA 4OEMB 3UE1A 4A3DB 3ND8A 3J7ZC 4LW1A 2JA7B 4LF8L 3OMGA 3BYTB 3OJXA 2ZM6Q 4K0KL 1GUWA 3JQPA 2JK8A 3NHHA 1Q3LA 3PO3G 4EGVA 1TY0A 3HOWH 1VHEA 3C2QA 2J0TD 3CC2A 5EPKA 3FDTA 5KNCA 4DR5L 1FYCA 1AW7A 5CYUA 1F9RA 2Z4IA 1VQFA 4XT3B 1N07A 2IX3A 4KLKA 1SNPA 3RZDH 3AMUA 2HUGA 3H3VC 3OWFA 4HEDA 5C44H 2FFKB 4RGNA 1Q82C 2BCOA 2BA0A 3OMCA 2XGJA 4YY3L 4GOPB 3MWYW 1HHVA 4G7WA 3X3MA 5ELCA 3A1PA 4B47A 4BBSG 2DUDA 1OXVA 2CWPA 2OBTA 1WOOA 2WZNA 3ES9A 1IKMA 4GS3A 4DK1A 2B8GA 1VQ4A 4JI7Q 4WJ3M 1QFYA 1QFJA 1D7QA 4QIWE 4DN4M 5IY0A 1VQ6A 1R5BA 2JA5B 3D4WA 1SRUA 3Q3AA 4M1UB 2C5HA 3S17B 4RCOA 1TLLA 2BV3A 4PAAA 2EY5A 1XJVA 1NCVA 1VQ5A 2UU9L 2AMCB 4DV6Q 3QWNA 2C35B 2BVNA 2XZLA 1DXMA 3B6YA 1LTTD 2NVYH 1AE2A 1B7YB 3PMFA 3KDFB 4PZ8A 3I1FA 4RD2A 1HNXQ 3OHXC 1X3GA 1GJXA 4YWLA 5AN9A 2WP8J 4A3CG 1G7TA 2MHVA 1A15A 3ZC3A 3GTJB 4JI6L 1Z6HA 4JI8L 1E64A 2F0IA 5IYNA 1IBML 1SKQA 1DOLA 1EU4A 4DUZQ 4BBSB 3I73A 3HKZB 3GVJA 3ZBUA 1BKBA 2PLFA 3NEMA 3NTIA 5KYLA 1KQSA 3FKIG 3QG1A 1S5BD 4U68A 4A3EG 4XIGS 4A3FH 1EL0A 2A6HC 4FXKC 2JA9A 2IL8A 1K8AC 4B3RQ 2XEXA 3OTOL 3PA1A 1JOKA 1S5ED 4POGA 1V0FA 1B9NA 1X55A 1RQPA 1VQEA 4XYOA 3SE0A 4OX9L 5IWAQ 1FL0A 1KLUD 2HDLA 2IW3A 2EYLA 3VYRA 4JYAL 4E0FA 3CQZH 3GTPB 2UXDQ 4X0CA 1KAAA 1AH9A 1GAWA 4X3UA 4Y9UA 1G6ZA 4Z4VA 1B53A 4C3HG 4IUQA 1S5DD 1EYAA 4LF9L 4Z4TA 3MA2B 3PV0A 3C1EA 4AF7A 1LO5D 2DY7A 1WJJA 1QVGA 1KNAA 3J81c 2YTVA 1HNWQ 1PH5A 3N52A 5EBCA 1M8AA 3RUZA 1H8HA 3T1HQ 1V9PA 3FJOA 2AWNA 1X3PA 3S1QB 5EBDA 2NUCA 4DV3Q 1YEZA 1BBUA 4OXPA 3QFCA 2VQFL 5M5XB 3P20A 2I5MX 1FDRA 2F3WA 2QCPX 3HOUG 4BY1H 2R93B 2CH4W 1TWFB 4LFAQ 3STBD 4DR1Q 1IW7D 1YVCA 4B3TL 1LT5D 3JAME 5JPMC 3M3YB 2VW9A 1MI2A 3GTQB 4RA8A 3PUMA 2A68D 3RNUA 2UUBL 4GKJQ 4QV2A 2PZTA 4TKOB 5D3IB 1JA0A 3G6JB 4HSVA 1F2YA 3H3VI 3WWVA 5JVH3 1WDTA 1EIFA 5IGFA 4II3A 1GUGA 3I56B 2B2YA 4G1VA 4V190 3T53B 4C3HB 1HZEA 1Q12A 5TR9A 1HNZQ 1FNBA 5C3EH 3QB3A 2RA4A 1EFTA 2RC6A 5M5YB 5IGEA 3U50C 1XYIA 1XX8A 1WPCA 1VQ8B 1B2TA 1TXYA 2YYZA 5J35A 3HOXG 4G7OC 1BCPD 3Q23A 2EPBA 5JJIA 2F3VA 5DN6A 3J81L 4M4SA 2EYOA 5JEAH 1GVHA 4QIWB 2WJVA 2QKIC 3MXNB 1SKYB 3SLDA 1MKHA 1SMYD 4DAMA 1OO9B 4YHHL 5DM73 2ZZQA 3I4NG 1A3UA 1YHBA 3HOUB
chains in the Genus database with same CATH topology
2SEBD 5KNLA 3DHQA 4ZK9B 3ERQA 1CQVA 5IGBA 2ZXIA 4AVZA 1CHQD 3O13A 2LY7A 2F0GA 1IKLA 2LKVA 3S2HB 4K5VA 3CRKC 1BF4A 1SMYC 4UDUC 4KJOA 3MZ5A 4XKVA 5NUCA 1JICA 3FKSA 1WD1A 1EY4A 4K5WA 5CR3A 5D14A 3I4NB 1WTVA 3OW7A 4Q0FA 3HOVB 4XM3A 2IX0A 1E3XA 4FF3A 1LTID 1TR5A 4H0LC 4F7XA 1AZQA 2B2VA 2K05A 3V96A 1JB3A 2F0QA 4YXWA 1JR0D 1I50B 1KDCA 3CESA 2ZZFA 5C0XH 3J80L 3FPUB 1V43A 1T5EA 1CZWA 5CV6A 1JWMD 4MIUA 5I6YA 4RGMA 2PQEA 1Q1EA 1A3TA 1CHPD 5FOBB 4U673 4JMQA 3FMCA 3GD7A 4GQNA 1BOSA 2KVMA 1D5XC 5AFWA 1UAPA 4TQUS 5I6WA 1Z47A 2R9VA 2IPKD 1BBXC 3P7JA 1KABA 3H94A 4XLFA 2HDMA 4XQFA 1TWHB 1O7ZA 2CW0C 1E1RA 4UZUA 1OHHA 1E2WA 2K5QA 1RODA 3ND9A 1SYCA 1V1OA 5DEHA 3K7AB 2Q8TA 5IGDA 3D3RA 1CZGA 1J9OA 4KHVA 5KRUA 2X6LA 3VYTA 3ZPNA 1DZ1A 2PZUA 2B2TC 2ZT9C 1PXUA 2ZTGA 3IKJA 2GA4B 1HUNA 3OEHA 1EZ8A 2FHTA 4O1NA 1V1PB 1UD2A 4LMQD 1JOOA 5DM63 1STNA 2AWOA 4C1NI 4A3MB 1NSNS 2F0VA 4OIKA 2RDGA 1BMFA 3OSOA 4H7BA 2ZXPA 1G291 1K8OA 3S1NB 1G2SA 4ZRZA 1ENAA 3H91A 1E3ZA 4OHJA 1FGBD 4HTHA 5JAVA 3K5MA 5C4ZA 4FYDA 4X3SA 3A8JE 2ZXOA 3HAGA 4H44C 1S4ZA 2MPMA 4IFDI 4A93B 2OEOA 3P75A 3GTGB 4BA1I 2J4XA 4IFDG 2G9HD 1F2LA 5IGCA 3A55A 1JQYD 3HZXA 1Y1WB 2W6IA 5CDFA 1TT2A 4BY7B 5C3XA 4C3JB 1PTOF 3TMEA 4QCLA 2R3ZA 5E4XA 4HCSA 4A3KB 1EQTA 3QIAA 3HRZC 3BC9A 1DD2A 1HFNA 3URYA 4A3BB 2RBMA 1WD0A 1R9TB 3J7AV 2EDGA 2K5DA 1DCZA 2EYJA 1WCMB 5I9OA 2DNEA 1MGSA 2ZZEA 5JOBA 2K01A 2EY6A 2PCFB 4B08A 5BN4A 5ISRA 5C5MA 1B44D 3MC0B 4KTAA 3I72A 3T51B 2A6ED 4OGQC 3BVGA 2HCCA 3TSSA 3NQTA 1AN8A 1ZYRD 4F87A 1Q8IA 2L0CA 1NBMA 1PTOC 1BDOA 1R4QB 2GK6A 1EWCA 5I9PA 2EVBA 3R8BA 2X6WA 4ZKBB 3OWEB 3IFTA 3NUCA 1FNWA 4IUNA 2XZOA 1A2TA 1Y8PB 2XNAC 4G7HC 4KY7A 4DU9A 1HTPA 4BBRB 4TRDA 4C3IG 1VDZA 2JA8B 4R9WA 4FNFA 1UEAB 4XQJA 4KY6A 2WSSA 3Q24A 3TDQA 1SNQA 3HG9A 2KQ3A 1HCZA 3F2UA 4Y7NB 4RHSA 5K36G 3I70A 1E2VA 2F0OA 3S16B 1X32A 2N88A 3OAAA 1YNJC 5ELFA 1L0XB 5C3WA 3BVMA 1RDPD 1RJTA 3R2IA 4P2CB 5EGTA 4BA2I 1EY7A 2ENBA 1I4GA 2LZJA 4A3GB 3PUZA 2D3NA 1O78A 2WAQB 3NTHA 4XONA 2EJMA 3DDYA 2XNDA 1W0KA 2VB3X 2ID0A 2B2YC 3OPOA 1ILPA 3CHBD 3J7YW 2SNMA 5FO8B 3OOCA 3K6OA 1BQQT 2K28A 1AEXA 3D4DA 1ONLA 2B2TA 2EOTA 2PW7A 3OFNA 3BYYB 1SE2A 3BDLA 1IHZA 1I3QB 3J81E 4IUUA 1HQMC 4JK1C 2VB2X 3A7AB 1ESFA 3NWSA 1I6HB 1R4PB 1CTMA 2GJPA 1Y8OB 5JEAJ 1QJOA 1Z7TA 3GTOB 3GP7A 1GUSA 3CKIB 1TS5A 1FNVA 1FX0A 3JU4A 5J39A 5TSSA 3S9WA 3SEBA 1STBA 1F77A 3A35A 2B2VC 2EYPA 2RQXA 2HLDA 1GUTA 4NW2A 2PYKA 5EQ0A 1C4QA 4KI0A 1GHKA 4XXEA 2WB1B 4RGTA 2Q8RE 2B63B 1EEFD 2SDFA 1E0BA 2KOLA 1XWEA 4LK1C 2F0FA 2K04A 1WTRA 3PO3B 4FF4A 3G7LA 3J80E 4OL7A 1PTOB 5E4WC 5A35A 4QUCA 4Z1MA 1J8IA 1BNZA 2EY1A 2L9HA 5E1FA 1ENFA 2A6HD 2IWHA 3GV6A 5C0XJ 2L5TA 4FF2A 3EA6A 3VR5A 2AQ2B 3M4OB 4B3GA 2JDIA 3H09A 3E5SA 3MEHA 3A3BA 3TP7A 1EY9A 3PO2B 2WINB 3KBGA 1H9RA 4N9PA 3CP2A 4IUVA 5FK9C 3ZYYX 2XVSA 3PUXA 1XXGA 5M5WB 4K5XA 2TMPA 3FEWX 3RLFA 2E2JB 3KLSX 2K32A 1UD4A 4M8AA 3KF8A 3NBHA 4DFAA 4XORA 3M7NA 1HFGA 1G91A 2ZXHA 4XYQA 2Z6BD 3FKIB 3MVVA 2NWGA 4A3EB 4FXGC 2Z4HA 1EYDA 4RKLA 1T5XD 1I4PA 3BZDB 1H8EA 3BDCA 3RZDB 3NK9A 4MN3A 5C44B 1E79A 2GJKA 4TSFA 1VMPA 2F0UA 3SK5A 1E2ZA 1STGA 1D2BA 1BCPF 2MGSA 1GUOA 5BN3A 2L11A 1KNEA 1TS2A 1VLYA 4XNFA 2AUJD 2F0KA 4XD7A 3LWUA 1VF7A 1O7LA 3HGBA 3NPPA 2E75C 1F2MA 2F03A 5DAUA 2NVXB 1TIID 4B9WA 2V7QA 3PUYA 3BG3A 2A74C 3A3GA 3BH4A 1I4QA 2I46A 2KJXA 3T4AC 5CC4A 4X3TA 1HA6A 1QB5D 3MAQA 3VR6A 3OIQA 3OE7A 2H1EA 3GVKA 4RHRA 4CKCA 3W3AA 3CMMA 2BA1A 1UD8A 4KY5A 1CT1D 1FD7D 1Q90A 4X3KA 4G7ZC 3HOXB 5CV8A 2OF1A 1H9SB 1SE3A 1PFMA 2JEBI 3EQLC 1SJHD 3NTKA 2IX1A 3CQZB 5FLXE 1WTXA 1SSOA 4K6DA 3KEWA 1LACA 1RTOA 4IUTA 4CHTB 1CFMA 5EPLA 3A7LA 2CVRA 2PMZB 1EEID 5LHY1 1L0YB 5JEAG 4KJNA 2NN6I 1H9SA 3NXWA 4YIJA 1D5ZC 1LT3D 4YELA 4XKWA 5EKLA 2R92B 2NN6G 1PRTF 2ZTNA 2KEDA 2RSOA 5EKIA 3NP8A 2CW0D 1HQRD 4FP5D 4KHZA 4ODGA 3T13A 1PMRA 3Q6SA 1SYDA 4IQZA 4J8QA 3WQZA 4XTCS 3VA5A 4XLCA 4II2A 4HSPA 1OXXK 2MJ8A 4XT1B 1A3VA 1RF2D 4HAEA 1F9PA 1K28D 1CI3M 2X69A 1OXSC 3QOLA 2RVLA 4KD3A 4IN3A 2MP1A 1D5MC 1SNDA 1VCIA 5C0XI 3IL8A 4HR7B 1PRTC 3LX0A 3C3LA 4EQPA 3DXJC 3AU7A 3DWPA 5C0XG 1PFBA 4IFDH 3D31A 4QUFA 2F4IA 5JVG3 2L12A 1B4OA 2F0NA 1STYA 2OT2A 1D6EC 5A2QE 5G3LF 2K5WA 1DJRD 4ILWA 4Q5VA 1II3A 3QO2A 2D62A 3TP6A 2C5CA 5IGGA 5D65A 1WTPA 2VNUD 2F0TA 1B3AA 2L55A 4Z9CB 2B2WA 3SR1A 3K57A 1JCKB 5F2DA 3NQIA 4K2KA 2QEJC 2JJ2A 4XQNA 5ELBA 1ILQA 1LTBD 5I2XA 5M9OA 4RWSC 1RHPA 5KGUA 2YU9B 4NMZA 1K8MA 2BE5D 1RTNA 1TQOA 2RDFA 2NVQB 5FL7A 1EY8A 3M7GA 2LMCB 4ULLA 5JPNC 1SBBB 4IZ8A 5ELDA 4XOTA 4DXFA 3FVQA 2XN9C 2A73B 3U9OA 2BE5C 1I4RA 3DM1A 1U4RA 1GXDC 4PMWA 4DK0A 1PTOD 1HPCA 5HKKA 2JJ1A 1HTLD 1YNNC 1Y8NB 4K8IA 2SOBA 3CU7A 4N9TA 5ELEA 1H9JA 1MABA 2XWJB 1E43A 4H13C 1HVXA 3D6CA 5IK2A 4IURA 4K8JA 4MHEA 3S1RB 1CA6A 1Y69U 2AQ3B 2XRSD 2E2DC 1W0JA 1YNJD 4ZUIA 4ZUJA 4OO1H 2VJIA 1F9QA 2KEEA 2PZWA 1UD6A 1A6XA 4OIJA 2X6YA 4LJZC 1UNSA 1SYFA 2E2IB 3DWAA 1GUNA 4XMYA 4C1NK 3GTMB 2Z8LA 2RSNA 5BN5A 5C4XB 3C46A 1JORA 4XN3A 1OXUA 2IJ0A 2K7VA 1S5FD 1PRTB 1PDQA 1U4MA 3KLRA 5C5LA 3G05A 1WTQA 2NB0A 2F0HA 2VXWA 1EY0A 4G6IA 4QB4A 1B1ZA 3GTLB 4QF4A 3IAYA 2B2UA 4C3IB 1F2ZA 2NTSA 4ZAIA 2ICIA 1HA5A 1F9SA 3RZOB 1H9MA 1C8CA 1LTGD 3ITPA 5FO7B 1DOMA 1EIGA 1U9RA 2F0EA 4E6IA 2M9VA 1U4LA 3SK4A 5CBEE 3ZIAA 4ASUA 3K5NA 2BDNA 3DUZA 4HMJA 2J7ZA 2F0DA 1TWCB 4ZYSA 3BCDA 2AQ1B 4DXGA 1BPLA 4DNRB 1PFNA 1OXTA 1MD2D 2PW5A 2DIEA 1EQVA 2B8FA 1W6JA 2WKCA 2Y0SB 2EE1A 5I4DA 4FF1A 1VJSA 2O4XA 1IYVA 2KVOA 1ZKOA 3WOFA 4WORA 5C4HA 1MSGA 1TS3A 3RMHA 1I4HA 5CMDA 3J7AF 2Q8IB 3MHBA 4I7ZC 4CBVA 3MTSA 1EY6A 3T16A 1EFRA 3E0JA 4F8MA 5C6AA 1LT6D 1EIHA 4L6TB 4PQXA 2B39A 4CJ2C 2A5HA 3NWTA 1STHA 2DY8A 1AFPA 2EJFC 3FRPB 5IOCA 3SDZA 1VF5C 3L7ZC 1PZJD 1VMCA 3D8GA 1OB0A 5CV4A 3VYUA 1TVXA 3SHLA 1AZPA 4CJ1B 2XIWA 3CRLC 2ICEC 3IFDA 4RGOS 3E6ZX 1BO0A 1STEA 1CQFA 1PKVA 4XLHA 4NDXA 3A54A 2LS01 1O7YA 1IYUA 1EU3A 1CM9A 3GVLA 2DN8A 1GHJA 2PO4A 2JYOA 4TT3A 1IL8A 2QDBA 2KUMA 1DM0B 2XZPA 1SNMA 2F1MA 4G57A 3SK8A 5LL6X 2CQAA 4AYBB 3BS1A 1TY2A 3QOJA 3HS0C 5KIXA 3I4MB 3KK7A 4KKSA 1SXTA 2JE6I 1X3QA 1PZKD 1KLGD 1BXTA 3M85A 3S1MB 1QNKA 1KZLA 3KBXA 1XTCD 4RFBA 3WDNA 4NNJA 1SEBD 2FMMA 1EFID 1I6VC 2LFNA 1SJED 3HOWB 1B9MA 2XRQD 3PIP3 2FMCA 3GO5A 1KMHA 3C2PA 2QF7A 3VR2A 2X53S 5KYIA 3GQBA 2NYZD 1QWYA 5HURA 1EY5A 4R8IA 4IFDJ 3EJIA 1ET9A 4R8NA 2B2WC 3A56A 1WP6A 2DNCA 2JEAI 4KD4A 3I3CA 1B50A 3LNNA 4RKBA 2D9UA 2KCNA 3TZUA 3R93A 3L9AX 2PNRC 4NP5A 1EYCA 3DWQA 3DMUA 2CHBD 2RKSA 1V8QA 4XLAA 2NVYB 3HEJA 2V4DA 1IW7C 1HRJA 2D5DA 4NKLA 1G2TA 2WACA 1EZ6A 2XWBB 1ENCA 1Y1VB 2A68C 2D2CC 2X6GA 1UD3A 2KA7A 3X3NA 3NBIA 2HCIA 4HCEA 2R61A 1HXYD 4ABNA 4FVMA 2K6AA 2NN6H 1JC7A 4WFN3 2BDOA 4K6LA 1K83B 5IT9L 2D3LA 3UI2A 3HOZB 1NRKA 3D6WA 3KUPA 4A3FB 1BCPC 4YEJA 2WV6D 4CKEA 5KEEA 2EYHA 2XOKA 5I2YA 3KLSA 3TZDA 4HIZA 3DEPA 3MXNA 1S5CD 1ET6A 2F0WA 3L3OC 1C48A 3MFGA 4G4KA 2WKDA 1CK1A 1ICWA 4KKTA 1I4XA 4L63B 2TSSA 4DAYA 1RKNA 2BOSA 2EYFA 4ZKCB 1FNUA 5COYA 2X6XA 1TU2B 2M00A 4IALA 4BY1B 2A69D 4G7XA 1COWA 4BS9A 5IODA 3Q22A 3K5OA 1SYBA 3TN2A 4HN7A 4IUPA 3W2DA 1TWGB 1GOZA 1EOTA 4KN4C 4O42A 3K5LA 5C3EB 2C9OA 2A69C 4DF7A 3S15B 4RH6A 4DNTB 3PUVA 3FPPA 4JBWA 1QILA 3I4LA 2F0JA 2F43A 1H9KA 3I90A 1PRTD 3CP8A 1NR4A 2WIIB 1NR2A 2B2UC 2K33A 1CA5A 2EXZA 2O5JC 1EWHA 2JP1A 3GV3A 5M3MB 3R3OA 1JE4A 2F0PA 2HQEA 3P1HA 4PMCA 3VA7A 3H0GB 1U4PA 3M3YB 4L8JA 2AUKA 4K2LA 2W6JA 5KNDA 1QCBD 3LWEA 1SDFA 1ESRA 1NAPA 3Q0AA 3GTKB 4K14A 4FXUA 4CGYB 2G9DA 2X85A 1BR9A 4I65A 4KN7C 4CKBA 5M3FB 5JJZA 4J6HA 2EY2A 3SXHA 4XR6A 2M5SA 2RDHA 3T56B 1D1KA 3RD4A 3JAML 2O5IC 3N6RA 1TKWB 2I07B 3I8ZA 2FINB 2IT1A 3BDOA 4RAUC 4C3JG 3EROA 4J1MA 3HOYB 1SE4A 2NTTA 3AB9A 3ONAB 1MSHA 1PZID 5CV5A 5G3LD 3OEEA 5J1ZA 4B3FX 2O2LD 2X8KA 1KTKA 3V2TA 4KK7A 4XL9A 4KMUC 2JIZA 3PUWA 4B9XA 3SK6A 1LTAD 1V1PA 1BCPB 1LT4D 1AP0A 5IIFA 2ZZGA 2EYMA 4TSSA 2VUMB 2PPBC 1YNND 2F0SA 4RCNA 1HUMA 2NBFA 1ML0D 5T1IA 1V0EA 4ID6A 1DONA 3SVMA 1JWUD 4GZYC 2R7ZB 2H4OA 3I91A 4KV6A 2SNSA 4DA2A 2JSOA 1KDBA 1I18A 5EJWA 3VR3A 4CJ0B 2KHSA 1PLFA 1LLRD 2MUYA 4EQOA 5K36H 1I8DA 2XSCA 4C2MB 4XDXA 1BUVT 1KDAA 3TBIB 4BWGB 2JA6B 4XLEA 1W6KA 2V31A 2E1BA 4PV1C 4S3SA 3PIO3 2CK3A 3A8IE 5J22A 4ME5A 3QJYA 5T1GA 5E3FA 1WVLA 5FLXL 1UUPA 2ZXRA 1E1QA 3NSWA 1SFOB 2FJ2A 1SYGA 3TP8A 3VYSA 4WJWA 4XOPA 4HMIA 4DAPA 1WTOA 1LV9A 4PNYA 4WRDA 2Z1CA 3A8KE 3K59A 4A3IB 4UAIA 2QILA 1D1IA 4ZLTF 4A3JB 5FO9B 1BLIA 1RCVD 3TP5A 2GJRA 4P22A 3MXPA 2F0LA 3C1FA 2A6EC 4XQQA 1QG7A 2N55A 1SNCA 2E76C 1NUCA 2VJJA 1TS4A 1W9XA 1ZYRC 3D4RA 1ZXTA 1WTWA 5LL6S 1QE6A 2L4NA 1ZEQX 2E74C 2E2HB 2K1BA 1FR3A 1LABA 4DGZA 3S14B 1SNOA 5CV9A 5DNFA 1JOQA 2EJGC 4LAAA 1MBYA 3NE5B 3K0YA 4FO2A 1PYWD 5FKAC 3DEOA 1PTOH 3HP3A 3WOEA 5CORA 4ZQ3A 2EZVA 2JXMB 5EKKA 2GK7A 3V05A 3VR4A 1LTSD 4EQNA 5K5PA 3BVZA 3BCFA 1DOKA 3S2DB 4OO1I 2KCCA 1UD5A 1SAPA 1M4VA 3MXGA 2M2LA 3R2TA 2QE7A 4EVOA 3MXUA 2WZPP 5KNBA 1G8ZD 4OO1G 2K03A 1STAA 2L1BA 3U9SA 4KKUA 1SYEA 2R6GA 3M4YA 5CGKA 2WPDA 1WTHD 5CV7A 5A2QL 1Q1BA 2OXPA 3MFYA 2KECA 2F0MA 5CBAE 5HGTA 4V0BA 4PMBA 4QMGA 5D3DA 1TWAB 4C56C 4FXDA 4XN0A 1JWSD 1QOHA 3H6MA 3K58A 4F88A 2NZ1D 1A2UA 1DYQA 2WJYA 5EPJA 1RD9D 3EFXD 1QNUA 5IT9E 1O80A 4DAVA 3OIPA 1LTRD 5C4JB 3EVQA 4A3DB 3ND8A 2JA7B 3OMGA 3BYTB 1GUWA 3NHHA 1Q3LA 4EGVA 1TY0A 2J0TD 5EPKA 3FDTA 5KNCA 1FYCA 1AW7A 5CYUA 1F9RA 2Z4IA 4XT3B 2IX3A 1SNPA 3AMUA 2HUGA 3H3VC 3OWFA 4HEDA 2FFKB 4RGNA 2BCOA 2BA0A 3OMCA 2XGJA 1HHVA 3MWYW 4G7WA 3X3MA 5ELCA 1OXVA 1IKMA 4DK1A 2B8GA 4DN4M 2JA5B 3D4WA 4M1UB 3S17B 4RCOA 2EY5A 1NCVA 3QWNA 2XZLA 1DXMA 1LTTD 3PMFA 3OHXC 1GJXA 2WP8J 2MHVA 1A15A 3GTJB 1Z6HA 2F0IA 1DOLA 1EU4A 4BBSB 3I73A 3HKZB 3GVJA 3NTIA 5KYLA 3QG1A 1S5BD 4U68A 4XIGS 1EL0A 2A6HC 4FXKC 2IL8A 1JOKA 1S5ED 1V0FA 1B9NA 4XYOA 3SE0A 2HDLA 1KLUD 2IW3A 2EYLA 3VYRA 4E0FA 3GTPB 1KAAA 4X3UA 1G6ZA 1B53A 4C3HG 4IUQA 1S5DD 1EYAA 3MA2B 3PV0A 3C1EA 1LO5D 2DY7A 1KNAA 3N52A 5EBCA 1M8AA 3RUZA 1H8HA 2AWNA 1X3PA 3S1QB 5EBDA 2NUCA 5M5XB 3P20A 2F3WA 2QCPX 2R93B 1TWFB 1IW7D 1LT5D 3JAME 5JPMC 1MI2A 3GTQB 4RA8A 2A68D 2PZTA 4TKOB 5D3IB 3G6JB 4HSVA 1F2YA 5JVH3 5IGFA 4II3A 1GUGA 2B2YA 4V190 3T53B 4C3HB 1HZEA 1Q12A 3QB3A 2RA4A 5M5YB 5IGEA 1XYIA 1XX8A 1WPCA 1B2TA 2YYZA 4G7OC 1BCPD 3Q23A 2EPBA 2F3VA 5DN6A 3J81L 2EYOA 5JEAH 4QIWB 2WJVA 2QKIC 1SKYB 1SMYD 1OO9B 5DM73 2ZZQA 1A3UA 2NVTB 3HOUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z6H A;  2NN6 G;  3WDN A;  3H94 A;  1GUN A;  4LK1 C;  4KN7 C;  1Q1B A;  1E2Z A;  2CW0 C;  2EJM A;  3QIA A;  1I6V C;  3MFY A;  1DD2 A;  5BN5 A;  1GUO A;  1E2W A;  4KHZ A;  3OPO A;  3I73 A;  5BN3 A;  3ND9 A;  2Q8I B;  4KKT A;  1B9M A;  1PMR A;  2AUJ D;  4I7Z C;  2EDG A;  3LWU A;  3OOC A;  1VF7 A;  3T56 B;  1DCZ A;  1O7L A;  1OXU A;  2K7V A;  2QF7 A;  3HGB A;  4IQZ A;  3VR2 A;  2O5I C;  5A35 A;  2DNE A;  3CRK C;  3QG1 A;  2E75 C;  3GQB A;  3N6R A;  1TKW B;  4XIG S;  3A8K E;  1SMY C;  4XTC S;  2A6H C;  3KLR A;  1TU2 B;  1K8M A;  1OXX K;  2IT1 A;  2PCF B;  3BDO A;  2A6H D;  1B9N A;  5BN4 A;  2BE5 D;  1ONL A;  3SE0 A;  2A69 D;  3PUY A;  2EJF C;  2L5T A;  3BG3 A;  3VR5 A;  3AB9 A;  3SDZ A;  2ZT9 C;  1VF5 C;  3L7Z C;  1CI3 M;  2A6E C;  2LMC B;  3ND8 A;  2DNC A;  1OXS C;  3I72 A;  2JEA I;  3T51 B;  2A6E D;  4OGQ C;  3VR6 A;  3IKJ A;  2E76 C;  3LNN A;  1HQM C;  1ZYR C;  3PV0 A;  4JK1 C;  3OW7 A;  3D4R A;  4KMU C;  3A7A B;  4KN4 C;  3W3A A;  1H9R A;  2BA1 A;  3TZU A;  3PUW A;  2BE5 C;  2PNR C;  5KNC A;  2AWO A;  2A69 C;  1FYC A;  1BDO A;  1Q90 A;  4DNT B;  4DK0 A;  1H9M A;  1VCI A;  2E74 C;  3CRL C;  3PUX A;  3PUV A;  3FPP A;  4HR7 B;  1HPC A;  2EVB A;  3P20 A;  1CTM A;  1Y8O B;  4H0L C;  4JBW A;  1V8Q A;  3I4L A;  4G7Z C;  3DXJ C;  2V4D A;  1H9K A;  1YNN C;  3IFT A;  1Y8N B;  1IW7 C;  3RLF A;  2D5D A;  1FR3 A;  1IYU A;  1LAB A;  2K32 A;  2PPB C;  1Y8P B;  5C0X G;  1G29 1;  1QJO A;  4IFD H;  1IW7 D;  4G7H C;  1K8O A;  1H9S B;  2BA0 A;  5C0X H;  4RCN A;  1HTP A;  1V43 A;  1T5E A;  2A68 C;  2DN8 A;  2D2C C;  2EJG C;  1GHJ A;  2JEB I;  2K33 A;  1H9J A;  3D31 A;  3EQL C;  1VDZ A;  1Z7T A;  1OXV A;  3NE5 B;  2A68 D;  2KA7 A;  4GZY C;  4DK1 A;  2B8G A;  4TKO B;  2O5J C;  1EWH A;  4H13 C;  1GUS A;  1Q1E A;  3A8J E;  3M7N A;  4H44 C;  1GUG A;  2NN6 H;  3T53 B;  1LAC A;  2JXM B;  2F1M A;  4DNR B;  1HCZ A;  2BDO A;  3VR4 A;  1Q12 A;  1Y69 U;  1CFM A;  3FMC A;  1OXT A;  3GD7 A;  3VR3 A;  3VA7 A;  3A7L A;  4BA1 I;  2KCC A;  5K36 G;  2D62 A;  1E2V A;  4KKS A;  4IFD G;  4L8J A;  5K36 H;  2JE6 I;  2AUK A;  2YYZ A;  5KND A;  1YNJ C;  1DXM A;  3MXU A;  4G7O C;  1GUT A;  4TQU S;  5KNB A;  4BA2 I;  5JEA G;  3M85 A;  4OO1 G;  2B8F A;  2NN6 I;  1H9S A;  5JEA H;  4KI0 A;  4PV1 C;  4OO1 H;  1GHK A;  3A8I E;  3U9S A;  3QJY A;  4KKU A;  1A6X A;  2R6G A;  3PUZ A;  3M4Y A;  4LJZ C;  1IYV A;  1GJX A;  1ZKO A;  1O78 A; 
#chains in the Genus database with same CATH topology
 2SEB D;  1XE1 A;  1VQ9 A;  4OWX B;  5KNL A;  3DHQ A;  4ZK9 B;  2HT1 A;  4X62 Q;  3ERQ A;  5IYW A;  1CQV A;  1FND A;  5IGB A;  3ISX A;  2ZXI A;  4AQY Q;  4AVZ A;  1CHQ D;  4CQJ A;  3O13 A;  4DK3 C;  2LY7 A;  1NNX A;  4DAY B;  2F0G A;  1IKL A;  2LKV A;  4LBZ A;  3S2H B;  2KCT A;  4K5V A;  3CRK C;  1EXM A;  1BF4 A;  3CCV A;  3M3Y H;  1HH2 P;  1SMY C;  4UDU C;  2DCU A;  4KJO A;  4LF6 L;  3MZ5 A;  2K5V A;  2Q6O A;  3E0E A;  3W5U A;  1KD1 C;  3BNW A;  5BR8 L;  4XKV A;  1EYG A;  5NUC A;  1JIC A;  3FKS A;  1N34 Q;  1YLO A;  1WD1 A;  4PGO A;  1EY4 A;  4R4I A;  1I5F A;  4K5W A;  5CR3 A;  1VQG A;  5D14 A;  4R4Q A;  4IOC A;  1XMO L;  3W2I A;  5ELN A;  3I4N B;  5M3F H;  1VQ7 A;  2CW5 A;  1WTV A;  4DV7 L;  3OW7 A;  4Q0F A;  3HOV B;  4TMV A;  4XM3 A;  1XNR Q;  4P2N A;  4NB3 A;  2IX0 A;  1E3X A;  3I4O A;  2ZTC A;  4FF3 A;  1LTI D;  4PZ6 A;  3UE0 A;  1TR5 A;  2ES2 A;  4H02 A;  4R1J A;  4H0L C;  4F7X A;  1AZQ A;  2B2V A;  2K05 A;  3V96 A;  1JB3 A;  2ZJQ A;  2F0Q A;  1ELO A;  4YXW A;  1JR0 D;  1I50 B;  1KDC A;  2F3I A;  3CES A;  1T6Y A;  4DV4 Q;  2ZZF A;  5C0X H;  3J80 L;  3FPU B;  1V43 A;  1T5E A;  1CZW A;  5CV6 A;  1JWM D;  4MIU A;  2DEU A;  5I6Y A;  4JI1 L;  4NXN Q;  4RGM A;  1YBY A;  2PQE A;  3WY9 A;  1UE5 A;  5IYB H;  1JJG A;  4ZGN B;  1Q1E A;  1A3T A;  2B7C A;  2OK8 A;  2WR8 A;  1CHP D;  3OYY A;  5FOB B;  4U67 3;  4F7D A;  4ZCK A;  3Q8D A;  4JMQ A;  3WBJ A;  4P75 A;  4QL5 A;  4WJ4 A;  4P3I A;  3FMC A;  3CC7 B;  4OOV A;  3GD7 A;  4GQN A;  1BOS A;  2KVM A;  1L1O C;  1D5X C;  4DR6 Q;  5AFW A;  4LUV A;  2NVQ H;  1UAP A;  4AIM A;  4TQU S;  2YWH A;  5I6W A;  4OEL B;  4LFC L;  2F4N A;  1Z47 A;  3HKS A;  3JC6 6;  3B78 A;  3T1Y Q;  2R9V A;  4GLX A;  1YZ6 A;  2IPK D;  4O2D A;  1BBX C;  5IYC G;  1HZB A;  3P7J A;  3P26 A;  4Y7C A;  1KTV A;  4RCY A;  1FRN A;  2XNJ A;  3H94 A;  4XLF A;  1S72 B;  4XQF A;  1KAB A;  1TWH B;  2HDM A;  4DV2 L;  1O7Z A;  3Q39 A;  2DJG C;  1E1R A;  2CW0 C;  1FNC A;  4UZU A;  2OCE A;  1EP2 B;  1YNX A;  3AGP A;  4B3M Q;  1OHH A;  1E2W A;  2K5Q A;  3I2Z A;  1ROD A;  3ND9 A;  1SYC A;  1VQB A;  2Q2U A;  1N08 A;  1V1O A;  5DEH A;  1G6P A;  2J7K A;  2F1L A;  3G71 B;  3K7A B;  2Q8T A;  1Q7Y D;  1YIT A;  5IGD A;  1AMO A;  4P1V A;  3D3R A;  4CDD C;  4CDE C;  1CZG A;  1J9O A;  4FDB A;  1RIP A;  4KHV A;  5KRU A;  1GJR A;  1IB0 A;  4Z4S A;  3EIV A;  2X6L A;  3VYT A;  4CDF C;  4X65 L;  2CRV A;  3ZPN A;  1DZ1 A;  2PZU A;  3VMF A;  2B2T C;  2ZT9 C;  1PXU A;  1S72 A;  4QVA A;  3QFR A;  4DQK A;  5JJL A;  2ZTG A;  4A93 G;  3EN2 A;  3IKJ A;  3S1R H;  2GA4 B;  1HUN A;  1A8P A;  4OWW B;  1BQE A;  3OEH A;  1EZ8 A;  2FHT A;  4O1N A;  4LF7 L;  1Y1W G;  3CCM B;  1V1P B;  1UD2 A;  2LSS A;  2NVT B;  4LMQ D;  1JOO A;  5DM6 3;  1STN A;  4BY7 G;  2AWO A;  5FJ8 H;  1KHI A;  4DR7 L;  2JN4 A;  3OZU A;  4R4O A;  4C1N I;  4A3M B;  1KK0 A;  4IPD A;  1YJ9 B;  1NSN S;  2F0V A;  5A89 A;  4OIK A;  1KRS A;  1BMF A;  2RDG A;  3OSO A;  2HQL A;  4H7B A;  2K52 A;  1JE5 A;  4A3K G;  4X05 A;  5DSZ A;  1UWV A;  2E2I H;  2ZXP A;  1G29 1;  1K8O A;  3S1N B;  1G2S A;  4ZRZ A;  3GTM H;  2OBS A;  1VQP B;  1ENA A;  3H91 A;  1E3Z A;  4OHJ A;  1FGB D;  3CB4 A;  4HTH A;  4A3B G;  5JAV A;  1XMQ Q;  1VQC A;  2JQO A;  5C4X H;  3K5M A;  3CCR B;  5C4Z A;  4FYD A;  1SRO A;  2Z6B A;  5HZB A;  1MHW C;  3A8J E;  4X3S A;  4DR4 Q;  2ZXO A;  3HAG A;  4H44 C;  1S4Z A;  2MPM A;  1VQL B;  4IFD I;  1YIJ B;  4A93 B;  1WYD A;  2OEO A;  3P75 A;  1BVS A;  1HZA A;  2WAQ E;  3GTG B;  1CNE A;  2BPO A;  4BA1 I;  2VNI A;  1VQD A;  2J4X A;  3FHW A;  4IFD G;  2G9H D;  3PF4 A;  1JB9 A;  1F2L A;  3A55 A;  1JQY D;  3HZX A;  5IGC A;  1Y1W B;  2W6I A;  5CDF A;  1E1T A;  1ICF B;  1TT2 A;  4TMW A;  4BY7 B;  2RF4 A;  3ASR A;  3V76 A;  3S24 A;  5C3X A;  2WFW A;  4C3J B;  1E3P A;  1SN8 A;  1PTO F;  3TME A;  4QCL A;  2R3Z A;  5E4X A;  3QSY A;  1PVO A;  4HCS A;  4A3K B;  1Q86 D;  3CCR A;  2RCF A;  5LMZ A;  2QEX B;  2E5L L;  1EQT A;  3QIA A;  4GKK L;  3AVU A;  3BC9 A;  3HRZ C;  1DD2 A;  1HFN A;  3URY A;  1VQL A;  4JI3 L;  4C0S A;  4A3B B;  1OGJ A;  2RBM A;  1WD0 A;  1N06 A;  1ZM4 A;  2EDG A;  1YJN B;  1R9T B;  3J7A V;  2K5D A;  1DCZ A;  4JI0 Q;  2EYJ A;  1WCM B;  5I9O A;  2DNE A;  4UZE A;  3TS2 A;  3JQR A;  1MGS A;  1X9N A;  2ZZE A;  5JOB A;  3CF5 A;  2K01 A;  2EY6 A;  4BBR G;  2PCF B;  3K0X A;  4B08 A;  5BN4 A;  5ISR A;  1N8R C;  3V7A A;  5C5M A;  2JA8 G;  1AIP A;  1B44 D;  4YWK A;  3MC0 B;  3LVB A;  1T6X A;  1GAQ A;  1TWC H;  4KTA A;  3I72 A;  3T51 B;  2A6E D;  1E1O A;  2CKZ B;  4OGQ C;  3BVG A;  2HCC A;  3TSS A;  4X06 A;  2OTJ A;  4PAB A;  3NQT A;  1U5K A;  1A0I A;  1HR0 W;  1KAW A;  3IRB A;  1AN8 A;  1ZYR D;  1VLO A;  4F87 A;  2B5O A;  3CPX A;  1Q8I A;  2L0C A;  1NBM A;  1PTO C;  3OW2 A;  1BDO A;  1L1O B;  1R4Q B;  3LQ6 A;  1NTG A;  4ACA A;  2GK6 A;  1EWC A;  1K3B C;  5I9P A;  4A3G G;  1W35 A;  2EVB A;  3R8B A;  2X6W A;  3MHP A;  4ZKB B;  3OWE B;  4R71 A;  3IFT A;  3NUC A;  1XNQ L;  1GVP A;  1FNW A;  4IUN A;  1WOS A;  2XZO A;  1A2T A;  2WAQ G;  1Y8P B;  1MIU A;  4M1K A;  2XNA C;  4IO9 A;  4G7H C;  3QFS A;  4KY7 A;  4DU9 A;  1HTP A;  4LF4 Q;  1YHA A;  4BBR B;  4TRD A;  1M90 C;  1SR3 A;  4C3I G;  4JI7 L;  1VDZ A;  3CCJ B;  5C4J H;  2JA8 B;  4R9W A;  4LF5 L;  4RPD A;  2GN5 A;  4FNF A;  3CPW B;  3CC4 B;  3AQQ A;  1UEA B;  4XQJ A;  4KY6 A;  4X6A H;  2WSS A;  3Q24 A;  2QA4 B;  3TDQ A;  1NY4 A;  1SNQ A;  2K50 A;  3HG9 A;  2KQ3 A;  1HCZ A;  4TMT A;  3F2U A;  4Y7N B;  4ROX A;  1L1O A;  1TTT A;  4RHS A;  5K36 G;  1JB7 A;  3I70 A;  1E2V A;  2F0O A;  3S16 B;  1X32 A;  2N88 A;  4A3L H;  2BGJ A;  3OAA A;  1YNJ C;  5ELF A;  1L0X B;  3UDF A;  3BVM A;  1RDP D;  1RJT A;  3KL9 A;  1EUJ A;  3R2I A;  4P2C B;  5EGT A;  5C3W A;  4BA2 I;  1E22 A;  1EY7 A;  1H42 A;  4X7D A;  3K7U C;  5ELO A;  2ENB A;  5FNZ A;  1EFW A;  4LFB L;  3K80 C;  1I4G A;  2VY3 A;  4P26 A;  4P72 A;  2LZJ A;  2CF4 A;  4J0Q A;  3VDY A;  4A3G B;  3PUZ A;  2VQE L;  1IBL L;  2R7F A;  2VNH A;  1J5E Q;  4IPH A;  4B3S Q;  2D3N A;  1O78 A;  3TRE A;  2N78 A;  4U9U A;  2WAQ B;  3NTH A;  4XON A;  2EJM A;  3DDY A;  2XND A;  1NDH A;  4Z4W A;  4JBJ A;  1W0K A;  4Z4Y A;  2VB3 X;  2ID0 A;  2B2Y C;  3OPO A;  1P4M A;  1ILP A;  3CHB D;  3J7Y W;  2AHO B;  2SNM A;  5FO8 B;  1K9M C;  1A62 A;  3W2E A;  2BH8 A;  1B23 P;  3OOC A;  1IXR A;  2EIF A;  5IYD G;  3K6O A;  5J3B A;  1N33 L;  1ASZ A;  5IYP A;  5EAY A;  3A5U A;  1BQQ T;  1PHJ A;  2K28 A;  3G6E A;  1AEX A;  3D4D A;  1ONL A;  4JI5 Q;  2B2T A;  2EOT A;  2PW7 A;  4RD1 A;  2BH2 A;  2DJF C;  1OB2 A;  3AEV A;  3OFN A;  1M1K C;  3BYY B;  4M53 A;  3ZJY C;  1SE2 A;  1NBW A;  4LBW A;  1GM5 A;  3BDL A;  1IHZ A;  1I3Q B;  3J81 E;  2OWO A;  4IUU A;  1HQM C;  4PC1 A;  4JK1 C;  3CC2 B;  5GRO A;  3W2F A;  2VB2 X;  3I4M H;  3A7A B;  5H1S E;  3RLO A;  4I7A A;  4DV3 L;  1PYB A;  1ESF A;  2E8G A;  2A1A A;  4RMF A;  2OK7 A;  3VO2 A;  4N8F A;  3NWS A;  3ONY A;  1I6H B;  4MTK A;  2WB1 G;  2MNA A;  1R4P B;  1OTC A;  1CTM A;  2GJP A;  1Y8O B;  3NEL A;  4WZT A;  5JEA J;  4DR3 L;  1QJO A;  3OZW A;  3GDE A;  1Q82 D;  1SM4 A;  1C9O A;  3GTP H;  1VQ4 B;  3MEF A;  4HIK A;  4YCU A;  1Z7T A;  3GTO B;  2HIX A;  1VQ6 B;  1QZH A;  4GLV B;  3GP7 A;  1GUS A;  3CKI B;  4MNO A;  3R6J A;  1FNV A;  1TS5 A;  4DKA C;  1FX0 A;  3JU4 A;  3G48 A;  5J39 A;  5TSS A;  3S9W A;  3SEB A;  1D8L A;  1VQ5 B;  1K3R A;  4RD0 A;  1STB A;  1F77 A;  1DDI A;  3S1Q H;  4IW3 B;  1QVC A;  3A35 A;  2B2V C;  2EYP A;  2RQX A;  2HLD A;  2DER A;  1GUT A;  4NW2 A;  2PYK A;  1QGY A;  5EQ0 A;  2R93 H;  4L5S A;  1C4Q A;  1TWF H;  4KI0 A;  1GHK A;  3GIR A;  1PV4 A;  4XXE A;  2WB1 B;  4RGT A;  2MFI A;  2Q8R E;  2B63 B;  4Z4R A;  4X62 L;  3CXC A;  1EEF D;  2A19 A;  2SDF A;  3PO2 G;  4TMZ A;  1E0B A;  2KOL A;  1XWE A;  2Q6L A;  3JQQ A;  2Z6K C;  4EH1 A;  4LK1 C;  2F0F A;  2K04 A;  1WTR A;  4QUZ A;  4KHP L;  3PO3 B;  4NCN A;  4FF4 A;  2Z9H A;  3G7L A;  3J80 E;  3PQI A;  1W34 A;  1WFQ A;  4OL7 A;  1PTO B;  1KQS B;  1YHQ A;  3CCQ A;  2Q6K A;  5E4W C;  1WU8 A;  4QUC A;  5A35 A;  5M5Y H;  4Z1M A;  3VNV A;  1J8I A;  1BNZ A;  1EIY B;  2EY1 A;  2L9H A;  5E1F A;  1ENF A;  4DPG A;  1Y1V H;  1K8A D;  2A6H D;  2IWH A;  3GV6 A;  4X7F A;  5C0X J;  2L5T A;  4FF2 A;  1PH3 A;  3EA6 A;  3VR5 A;  2LXJ A;  2AQ2 B;  3PA2 A;  3M4O B;  3CW2 A;  3CME A;  4B3G A;  2JDI A;  3CMA A;  2CH4 A;  3H09 A;  3E5S A;  3NBH B;  3MEH A;  1QX4 A;  1K83 H;  3A3B A;  2C78 A;  1QVG B;  1QUF A;  4P73 A;  3TP7 A;  1EY9 A;  4LUZ A;  4R4C A;  3PO2 B;  1XNR L;  5A8A A;  3HOW G;  4DUY Q;  3HOZ H;  2BM0 A;  2WIN B;  3KBG A;  1H9R A;  3PIP A;  3W2G A;  3S2H H;  4N9P A;  3CP2 A;  4MTN A;  1NMG A;  4IUV A;  5FK9 C;  3ZYY X;  2XVS A;  3PUX A;  1XXG A;  5M5W B;  1N32 L;  4K5X A;  4ZGQ B;  2TMP A;  4DV4 L;  3FEW X;  3RLF A;  3OZV A;  5C44 G;  2ZIT A;  2E2J B;  3KLS X;  3W5H A;  2K32 A;  1JT8 A;  1UD4 A;  5KW9 A;  4HIO A;  4M8A A;  3KF8 A;  2PMZ E;  1RQR A;  3Q38 A;  1YJW B;  3NBH A;  4G5G A;  3BJU A;  4DFA A;  4XOR A;  2K5H A;  4AH6 A;  3TRZ A;  4IPC A;  1KRT A;  3UDG A;  3W5O A;  3M7N A;  1HFG A;  1G91 A;  3CCU A;  1Q9S A;  2ZXH A;  3HOV H;  4N3G A;  3WND A;  4HJ5 A;  4XYQ A;  2Z6B D;  4OWT B;  4HJA A;  4A76 A;  4CDC C;  1N36 Q;  3WYA A;  3FKI B;  3MVV A;  5FLM G;  4GNX B;  2NWG A;  4A3E B;  4FXG C;  2Z4H A;  1EYD A;  4RKL A;  3BQJ A;  4X66 Q;  3G4S B;  1T5X D;  2B29 A;  1CKM A;  1I4P A;  4DV1 L;  2F4V Q;  2HD3 A;  3BZD B;  4OPS A;  1VQ9 B;  1H8E A;  1MJE A;  3BDC A;  3RZD B;  1YJW A;  1WOR A;  3NK9 A;  1TWG H;  4MN3 A;  2IHE A;  5C44 B;  1E79 A;  2CBX A;  1IBK Q;  2DY1 A;  2GJK A;  4TSF A;  1VMP A;  2F0U A;  3SK5 A;  1E2Z A;  1STG A;  1D2B A;  1BCP F;  2MGS A;  5J3O A;  1GUO A;  5IT9 c;  5BN3 A;  2L11 A;  1KNE A;  1TS2 A;  3S15 H;  1VLY A;  4XNF A;  1QVF A;  2AUJ D;  2F0K A;  2BMW A;  4XD7 A;  2QW7 A;  1VF7 A;  1L2F A;  1O7L A;  3CCV B;  3LWU A;  3SJP A;  3HGB A;  4LF8 Q;  4K0K Q;  2VL6 A;  4A3F G;  3NPP A;  1X3F A;  2E75 C;  4NXM Q;  2PI2 A;  1F2M A;  2GPJ A;  3G4S A;  3PSI A;  2F03 A;  5DAU A;  2NVX B;  1TII D;  4B9W A;  2V7Q A;  4JBK A;  1QUE A;  3PUY A;  5HXB A;  3BG3 A;  1N0U A;  1KD1 D;  2A74 C;  2GVB A;  4O0A A;  3B82 A;  3A3G A;  3BH4 A;  5GAG C;  1I4Q A;  2ASB A;  3I7F A;  3UDX A;  5M3M H;  2I46 A;  2KJX A;  3T4A C;  5CC4 A;  4X3T A;  1JMC A;  1VQ7 B;  1HA6 A;  3MCA A;  4B4D A;  1QB5 D;  3U6B A;  3MAQ A;  5JJK A;  1R5N A;  3VR6 A;  3OIQ A;  3OE7 A;  4UHV A;  4YY3 Q;  2Q2H A;  2H1E A;  3GVK A;  1EOV A;  4RHR A;  3U2Q A;  3H0G H;  4CKC A;  3W3A A;  3CMM A;  2BA1 A;  1UD8 A;  4X07 A;  1SMX A;  4KY5 A;  3K7A H;  4DV0 L;  1CT1 D;  1FD7 D;  1Q90 A;  3EBE A;  4X3K A;  2VBT A;  3GTK H;  5A88 A;  4G7Z C;  4BY1 G;  3HOX B;  4TMX A;  2R92 G;  3FP9 A;  5CV8 A;  2OF1 A;  2QTZ A;  1H9S B;  1S0U A;  1SE3 A;  5HY6 A;  2UU9 Q;  1S4M A;  1PFM A;  4A75 A;  2JEB I;  3EQL C;  1SJH D;  1H85 A;  1DGS A;  1WTH A;  1QG0 A;  3NTK A;  4DR4 L;  2IX1 A;  3CQZ B;  2D0O A;  5FLX E;  1WTX A;  1SSO A;  4K6D A;  3KEW A;  1X54 A;  1LAC A;  4JI6 Q;  4JI8 Q;  1K0S A;  1RTO A;  5C3E G;  4IUT A;  1FJG L;  4CHT B;  2GQF A;  1CFM A;  5EPL A;  1Q81 C;  4EX5 A;  3A7L A;  1ASY A;  2CVR A;  4A3M H;  2PMZ B;  3J81 k;  1EEI D;  3ULP A;  5LHY 1;  1L0Y B;  3HOY H;  5JEA G;  4KJN A;  2NN6 I;  1H9S A;  3NXW A;  4YIJ A;  1VQA A;  1D5Z C;  1LT3 D;  4YEL A;  4XKW A;  3W2H A;  1CSP A;  2EFG A;  5EKL A;  3PVD A;  2Z6K A;  4LUO A;  4LBV A;  2R92 B;  2K14 A;  2NN6 G;  1PRT F;  3OTO Q;  2ZTN A;  2KED A;  2X3U A;  2RSO A;  2C2W A;  4OX9 Q;  2PE3 A;  1FGU A;  5EKI A;  3NP8 A;  4UPA A;  4BXX H;  2CW0 D;  1HQR D;  2G5D A;  4FP5 D;  4KHZ A;  4ODG A;  4JYA Q;  1VQN B;  4OPO A;  3T13 A;  1VQK A;  1PMR A;  3Q6S A;  2C5B A;  1Q8K A;  1YIT B;  1SYD A;  3CD6 A;  4IQZ A;  4MYU A;  2HDN B;  4J8Q A;  1E7Z A;  5DS0 A;  3WQZ A;  5GQO A;  4XTC S;  1EQR A;  3VA5 A;  2VUM H;  4XLC A;  2K5N A;  1PH6 A;  4II2 A;  3I55 A;  4HSP A;  1OXX K;  1XQB A;  2MJ8 A;  1KK2 A;  1F60 A;  1H95 A;  4XT1 B;  4C3J H;  1A3V A;  1RF2 D;  3RN2 A;  4HAE A;  4HE5 A;  1F9P A;  2R7Z H;  1ZM3 A;  1K28 D;  2UXB Q;  1CI3 M;  5HGQ A;  2P3M A;  2X69 A;  1OXS C;  4JI4 L;  5M3F G;  4ZCM A;  3CRZ A;  3QOL A;  4B3T Q;  1VQN A;  3B8H A;  4QGU A;  2D9R A;  2RVL A;  4KD3 A;  4JC0 A;  1QUQ A;  5DLQ E;  4GLA C;  4NBS A;  2V7T A;  1K8G A;  4JI2 Q;  4IN3 A;  2MP1 A;  2HHH L;  4C2M H;  4JV5 Q;  1WCM H;  3U58 A;  2JA6 H;  1VQH A;  3LO8 A;  2V7U A;  1D5M C;  1SND A;  3E1Y E;  1VCI A;  5C0X I;  3IL8 A;  4HR7 B;  1PRT C;  3LX0 A;  3ASQ A;  3C3L A;  4EQP A;  3DXJ C;  4UP8 A;  3AU7 A;  3RN5 A;  3DWP A;  5LMU Q;  5C0X G;  1PFB A;  1SE8 A;  4IFD H;  1SFO H;  5IP7 H;  2ATW A;  4B3X A;  1N9W A;  3D31 A;  2EQS A;  4QUF A;  2F4I A;  5JVG 3;  2L12 A;  5IYB G;  1TVC A;  3KF6 A;  1PH9 A;  1B4O A;  2F0N A;  1STY A;  2OT2 A;  4QJF A;  1D6E C;  2UUC Q;  4WZL A;  3D26 A;  1CUK A;  2XNC A;  3CP0 A;  3CCL A;  5A2Q E;  4L5Q A;  2KCM A;  5G3L F;  2K5W A;  1CNF A;  1DJR D;  4A3I H;  4ILW A;  2CWA A;  4Q5V A;  1II3 A;  2ZJR A;  3QO2 A;  2QTL A;  2D62 A;  3TP6 A;  2NPF A;  3ZBT A;  2C5C A;  4A3J H;  5IGG A;  2D0P A;  5D65 A;  1WTP A;  2VNU D;  2F0T A;  2PQA A;  4PC6 A;  1B3A A;  1PH7 A;  2L55 A;  1J5E L;  4Z9C B;  4ZV4 A;  1KC8 C;  2FXQ A;  1VQM A;  5LMN Q;  1I94 Q;  2B2W A;  3SR1 A;  3K57 A;  1PA6 A;  4LF6 Q;  1JCK B;  1LUZ A;  2XGT A;  5F2D A;  3NQI A;  2JA8 H;  4LC0 A;  2EXD A;  4UP9 A;  3LQE A;  2N8N A;  5BR8 Q;  4K2K A;  5IP9 G;  1LYL A;  3CPF A;  2QEJ C;  1P16 A;  2JJ2 A;  4XQN A;  5ELB A;  3PCO B;  3ASP A;  4Z4Z A;  4YHB A;  1ILQ A;  5B6I A;  4Y7N H;  1LTB D;  3AFP A;  1XMO Q;  1QGZ A;  2E2H H;  2VNJ A;  5I2X A;  5M9O A;  4RWS C;  1RHP A;  5KGU A;  2YU9 B;  3S14 H;  4NMZ A;  1K8M A;  2CND A;  4DV5 L;  3NEN A;  2NV4 A;  2BE5 D;  1RTN A;  3PIO A;  2ZJP A;  1TQO A;  1N8R D;  2RDF A;  2NVQ B;  5FL7 A;  1MRZ A;  1EY8 A;  3BZK A;  3ER0 A;  3M7G A;  2LMC B;  4ULL A;  5JPN C;  2OTJ B;  3CAM A;  1SBB B;  4PG3 A;  4IZ8 A;  1FNM A;  4PC7 A;  2IHF A;  5ELD A;  4XOT A;  2DOG A;  4DXF A;  3S2D H;  1PFS A;  4IPG A;  3FVQ A;  3RY8 A;  3OW2 B;  2A73 B;  2XN9 C;  4JI1 Q;  3U9O A;  5FJ8 G;  2BE5 C;  1I4R A;  1HR0 L;  3DM1 A;  1U4R A;  1GXD C;  4PMW A;  4DK0 A;  1EWY A;  1PTO D;  2QN6 A;  1HPC A;  5HKK A;  2JJ1 A;  1HTL D;  4DK6 C;  1YNN C;  1Y8N B;  4K8I A;  2SOB A;  3CU7 A;  2ZM6 L;  4RJL A;  3KLW A;  2OTL A;  4N9T A;  2I0Q A;  4WWV A;  5ELE A;  3CW2 C;  1H9J A;  1DAR A;  1MAB A;  4OOX A;  1AE3 A;  4P74 A;  5C4X G;  1Q46 A;  1M90 D;  2XWJ B;  2A8V A;  1I3Q H;  1E43 A;  4H13 C;  4LFC Q;  1HVX A;  3M4P A;  1X3E A;  3D6C A;  4GOP C;  1YI2 A;  1TWA H;  2ZL7 A;  1UMK A;  5IK2 A;  4IUR A;  1XFO A;  4K8J A;  4MHE A;  1KK1 A;  3S1R B;  1CA6 A;  4YAW A;  4DV2 Q;  1YX2 A;  1Y69 U;  2V1C C;  3CCS A;  1ZUN B;  1X6O A;  5H59 A;  5F4O A;  1I6H H;  2AQ3 B;  2XRS D;  4GNX C;  2E2D C;  2BGI A;  4FWT A;  4FN5 A;  1W0J A;  1PH2 A;  2V7W A;  1YNJ D;  4ZUI A;  4ZUJ A;  4OO1 H;  2VJI A;  1F9Q A;  1JJ2 B;  2KEE A;  2QGG A;  4A3D H;  2PZW A;  1UD6 A;  4HJ8 A;  1XPO A;  2JA7 H;  4OIJ A;  1A6X A;  1ZM2 A;  2X6Y A;  4LJZ C;  1UNS A;  5JBQ A;  1SYF A;  2RC5 A;  1KIX A;  2E2I B;  3DWA A;  3GTO H;  1S3O A;  2WB1 E;  3AVX A;  1GUN A;  4XMY A;  4C1N K;  3GTM B;  3LGJ A;  2Z8L A;  2RSN A;  4X65 Q;  4LNQ A;  1CKN A;  5BN5 A;  4DV6 L;  3QR8 A;  3QFT A;  5C4X B;  3C46 A;  5IYR A;  4EQ5 A;  3AVY A;  1JOR A;  4XN3 A;  1K9M D;  1OXU A;  2IJ0 A;  2K7V A;  3SKB A;  1S5F D;  1HNX L;  2UXC Q;  1PRT B;  4OON A;  3G6E B;  1PDQ A;  1U4M A;  3KLR A;  5C5L A;  5GAH C;  1JJ2 A;  3G05 A;  1U2R A;  1WTQ A;  2NB0 A;  2F0H A;  2VXW A;  1KJZ A;  1EY0 A;  2FX3 A;  4G6I A;  4QB4 A;  1B1Z A;  4DUZ L;  2B63 H;  3GTL B;  4OOS A;  5E6T A;  4QF4 A;  3IAY A;  2B2U A;  4P71 A;  4C3I B;  2JA5 H;  1M1K D;  3FPK A;  1F2Z A;  3CCE B;  1G7S A;  2NTS A;  4ZAI A;  4JBM A;  4X8I A;  2JN9 A;  3S17 H;  2ICI A;  5GAE C;  3PO3 H;  4X64 Q;  1HA5 A;  4B3R L;  5FO1 A;  4NPS A;  1NMF A;  4LBY A;  4GN5 A;  1F9S A;  5IWA L;  3RZO B;  2C4T A;  2Y0S G;  4JOI C;  1H9M A;  1C8C A;  1LTG D;  1W2B A;  2UXD L;  1IL2 A;  3ITP A;  5FO7 B;  1DOM A;  1EIG A;  1U9R A;  4QFM A;  2F0E A;  4E6I A;  2M9V A;  1U4L A;  3GTJ H;  3SK4 A;  5CBE E;  3ZIA A;  4ASU A;  1HNW L;  2NZO A;  3T1H L;  3CCE A;  4BBS H;  4P25 A;  2VBV A;  3K5N A;  1J6Q A;  3BY2 A;  3A8J A;  2BDN A;  3DUZ A;  4HMJ A;  2J7Z A;  2F0D A;  2KHJ A;  1TWC B;  4ZYS A;  2UUA Q;  3BCD A;  2AQ1 B;  4DXG A;  1PFN A;  1BPL A;  4DNR B;  5BSY A;  3KJP A;  4YAU A;  1OXT A;  4LFA L;  1MD2 D;  2RHQ B;  4L5T A;  3U4Z A;  4N3N A;  3SJZ A;  4DR1 L;  1G7C A;  1BJK A;  2PW5 A;  2ZTD A;  3BZC A;  3H15 A;  2MO1 A;  2OQK A;  2DIE A;  1EQV A;  4GKJ L;  2ZTE A;  2B8F A;  1W6J A;  2WKC A;  2Y0S B;  1JNY A;  1NB9 A;  4RG1 A;  3CXC B;  2EE1 A;  5I4D A;  4FF1 A;  1VJS A;  4QHY A;  4OP7 A;  2O4X A;  1WSV A;  1IYV A;  2KVO A;  1VQO B;  2CCZ A;  4PZ7 A;  2YWE A;  1ZKO A;  1X65 A;  3WOF A;  4A3C H;  4P12 A;  4WOR A;  4WQM A;  5C4H A;  1MSG A;  1TS3 A;  5THX A;  4Y52 H;  1HNZ L;  3DM3 A;  3U4V A;  3WXM A;  1W87 A;  3RMH A;  2ALY B;  1I4H A;  5TRD A;  5CMD A;  3J7A F;  1YHQ B;  3CCQ B;  2QDX A;  3MHB A;  2Q8I B;  4JCV E;  4I7Z C;  5M5X H;  4NXM L;  4CBV A;  3MTS A;  3F2C A;  1EY6 A;  3T16 A;  1EFR A;  3E0J A;  3HFZ B;  4IJH A;  4F8M A;  3JAM i;  5C6A A;  3A8I A;  1LT6 D;  3FKI H;  1L0W A;  4L6T B;  4A3E H;  1EIH A;  1UE7 A;  4PQX A;  2B39 A;  4CJ2 C;  2A5H A;  2OQ0 A;  3NWT A;  1OB5 A;  1STH A;  3ERS X;  2VBS A;  2DY8 A;  1PJ5 A;  3GTQ H;  2EJF C;  1AFP A;  1D1N A;  1VQO A;  4AQY L;  3CME B;  3FRP B;  1UE6 A;  3CMA B;  5IOC A;  3SDZ A;  4DR2 Q;  1NJI D;  1VF5 C;  4RDJ A;  3L7Z C;  4UY8 C;  3KFU A;  3AVV A;  1GD7 A;  1PZJ D;  5EMN A;  1VMC A;  1BX0 A;  1VQJ A;  3D8G A;  5L37 A;  1XNQ Q;  1OB0 A;  5CV4 A;  4AYB G;  3E9H A;  3VYU A;  4C3H H;  4DQL A;  5FA6 A;  1TVX A;  1X56 A;  3SHL A;  3HKZ G;  3I4M G;  5F4M A;  5GV7 A;  4WZK A;  3A8K A;  1WI5 A;  4LF5 Q;  1AZP A;  2VNK A;  5L46 A;  3WNC A;  3U6K A;  4CJ1 B;  2XIW A;  3CRL C;  1CSQ A;  2ICE C;  3IFD A;  4RGO S;  3E6Z X;  1BO0 A;  3ONU A;  4APV A;  2XTI A;  1STE A;  1N34 L;  1NJI C;  1CQF A;  1FRQ A;  1PKV A;  4XLH A;  4NDX A;  2NVX H;  3A54 A;  2LS0 1;  1O7Y A;  2NVT H;  1IYU A;  1EFU A;  1EU3 A;  3HOU H;  3KF8 B;  1E62 A;  1CM9 A;  5FLM H;  1U0L A;  1GR1 A;  1N05 A;  3GVL A;  4IJL A;  2ZBV A;  2DN8 A;  1GHJ A;  4X7C A;  1I7P A;  1K0R A;  5IYQ A;  4GOP A;  4LWC A;  2PO4 A;  4ZCI A;  1B70 B;  2JYO A;  4LFB Q;  1BX1 A;  4TT3 A;  3ZZT A;  3CCU B;  1IL8 A;  2QDB A;  2L15 A;  2KUM A;  1DM0 B;  2XZP A;  1SNM A;  2VQE Q;  1IBL Q;  2F1M A;  4G57 A;  3SK8 A;  5LL6 X;  2CQA A;  4AYB B;  3BS1 A;  2I1L A;  1TY2 A;  4GNX A;  3QOJ A;  1WOC A;  3HS0 C;  3H3V H;  5KIX A;  3I4M B;  3KK7 A;  4KKS A;  1VQI A;  5AJ3 Q;  1SXT A;  2JE6 I;  1X3Q A;  4R4T A;  1PZK D;  1KLG D;  4NXN L;  3HOX H;  2R93 G;  2AKW B;  4JPB W;  1BXT A;  3M85 A;  3S1M B;  1QNK A;  4MYT A;  1N33 Q;  5H5J A;  1KK3 A;  1KZL A;  3KBX A;  3KDF A;  4FK8 A;  1XTC D;  4RFB A;  3I4N H;  3WDN A;  4QY7 A;  3KYH C;  4NNJ A;  1SEB D;  2FMM A;  4HIM A;  1EFI D;  1WSR A;  2ZL5 A;  1I6V C;  1QVF B;  4DR6 L;  1J9Z A;  3MMP A;  2LFN A;  3K8A A;  2I5L X;  1SJE D;  3HOW B;  1CKO A;  1B9M A;  2F52 A;  2XRQ D;  4YCV A;  3PIP 3;  2FMC A;  3GO5 A;  1KMH A;  3C2P A;  1Z9F A;  2QF7 A;  3VR2 A;  2X53 S;  1UEB A;  3T1Y L;  5KYI A;  3GQB A;  1I50 H;  1GO2 A;  1QFZ A;  2NYZ D;  4JG2 A;  1XTD A;  1Y1V G;  2YTX A;  3BY1 A;  1V1Q A;  1QWY A;  2R6H A;  4ZCL A;  5HUR A;  1R5O A;  1EY5 A;  3Q6Q A;  4R8I A;  4IFD J;  3EJI A;  2UXB L;  1ET9 A;  4R8N A;  5TV2 A;  5F4J A;  2B2W C;  4B3M L;  2ZL6 A;  3A56 A;  2R92 H;  1WP6 A;  2DNC A;  2JEA I;  4KD4 A;  4DR3 Q;  3I3C A;  2IY5 B;  1B50 A;  5GV8 A;  2N49 A;  3LNN A;  3K81 C;  3AVW A;  4RKB A;  3HOZ G;  2D9U A;  4JI2 L;  4JV5 L;  1O7I A;  2JJQ A;  3M4Q A;  2KCN A;  4JOI A;  1FVI A;  3TZU A;  1PJ7 A;  3Q6R A;  4DNI A;  3R93 A;  3L9A X;  1KRH A;  2PNR C;  4NP5 A;  1EYC A;  2GVA A;  3DWQ A;  3DMU A;  4A4I A;  4DR5 Q;  2CHB D;  2PMD A;  2RKS A;  5LMU L;  1V8Q A;  4XLA A;  3RR5 A;  2NVY B;  3HEJ A;  2V4D A;  3STB C;  2KEN A;  1W3S A;  1IW7 C;  1HRJ A;  2D5D A;  4NKL A;  1G2T A;  2WAC A;  4WZE A;  1EZ6 A;  2XWB B;  1TWH H;  1ENC A;  1Y1V B;  2A68 C;  2D2C C;  1PH8 A;  4B44 A;  1BBW A;  2X6G A;  4TVA B;  1UD3 A;  2KA7 A;  3X3N A;  3NBI A;  1PH1 A;  2HCI A;  2UUC L;  1ZM9 A;  4HCE A;  2NZH A;  2R61 A;  1B2R A;  2HIV A;  4MZ9 A;  1HXY D;  4POF A;  4ABN A;  4FVM A;  2K6A A;  3HOV G;  2NN6 H;  2Q2T A;  1JC7 A;  4WFN 3;  2BDO A;  4K6L A;  1K83 B;  3I56 A;  5IT9 L;  2D3L A;  3UI2 A;  3HOZ B;  1G7R A;  1NRK A;  4KHP Q;  1Q81 D;  3D6W A;  3KUP A;  4A3F B;  4Q7J B;  1BCP C;  2QDL A;  3W5V A;  3OJW A;  4YEJ A;  3F2B A;  2WV6 D;  4CKE A;  5KEE A;  2EYH A;  3J80 c;  2XOK A;  1UE1 A;  1XMQ L;  1VQ8 A;  2V7V A;  5I2Y A;  5KSW B;  5LMN L;  1I94 L;  1A8V A;  1Y14 B;  3KLS A;  4C43 A;  3TZD A;  4HIZ A;  3DEP A;  3MXN A;  1S5C D;  1ET6 A;  5E7N A;  2F0W A;  3L3O C;  1QGA A;  5IYC H;  3E20 A;  2CC2 A;  4YCW A;  1C48 A;  3MFG A;  4G4K A;  2WKD A;  2CQO A;  1VQK B;  1XPR A;  1CK1 A;  1ICW A;  3M9B A;  3CD6 B;  1IBM Q;  1E24 A;  2K75 A;  4KKT A;  2BF4 A;  1I4X A;  4L63 B;  1GO3 E;  2TSS A;  5LMN W;  4DAY A;  1RKN A;  2BOS A;  3E9I A;  3I55 B;  2EYF A;  4ZKC B;  1FNU A;  3ZZ0 A;  5COY A;  2PNH A;  4M0L A;  3S1N H;  3BU2 A;  2X6X A;  1TU2 B;  1HJP A;  2M00 A;  4IAL A;  4BY1 B;  2A69 D;  3UDI A;  4G7X A;  5IE8 A;  3VNU A;  1COW A;  4BS9 A;  5IOD A;  1A63 A;  5M3M G;  3Q22 A;  4IOA A;  3K5O A;  1SYB A;  3TN2 A;  1N32 Q;  1EWI A;  5GAD C;  4ALP A;  4HN7 A;  3WBK A;  1K73 D;  4JI0 L;  1XB2 A;  4IUP A;  3W2D A;  1TWG B;  3A5Z B;  2OYN A;  4A93 H;  1QUQ B;  1GOZ A;  1EOT A;  3H0G G;  3GTG H;  4LF9 Q;  4KN4 C;  2ZBU A;  4O42 A;  2EIX A;  3QE2 A;  3K5L A;  1Y1W H;  5C3E B;  1IJF A;  2C9O A;  2A69 C;  4DF7 A;  3TEH B;  4QQB X;  4BY7 H;  3S15 B;  4RH6 A;  4DNT B;  3PUV A;  3FPP A;  4JBW A;  1QIL A;  2YU9 H;  2Q2I A;  3I4L A;  2VS1 A;  2F0J A;  2F43 A;  1H9K A;  3I90 A;  1PRT D;  2VQF Q;  4BPR A;  1K73 C;  3CP8 A;  4A3K H;  4Z4U A;  2DYI A;  1NR4 A;  2WII B;  1NR2 A;  4ME3 A;  2B2U C;  2K33 A;  1CA5 A;  1IJE A;  3KF6 B;  3W1G A;  2QMU A;  2EXZ A;  3F1Z A;  3JAM c;  4A3B H;  2O5J C;  2RHS B;  1EWH A;  2JP1 A;  3GV3 A;  1D2E A;  1R9T H;  3CCL B;  4DV1 Q;  4HID A;  2UUB Q;  1V5V A;  5M3M B;  3R3O A;  1JE4 A;  2F0P A;  1IZ6 A;  2HQE A;  3P1H A;  1PJ6 A;  1RL2 A;  4PMC A;  1HZ9 A;  3J7A 5;  2H5X A;  2GRE A;  5IP9 H;  4M2L A;  2PIA A;  3VA7 A;  4A3M G;  3H0G B;  1U4P A;  3SEJ A;  4L8J A;  3CC7 A;  1EQQ A;  4LF4 L;  4Y9R A;  2AUK A;  1QH0 A;  2W6J A;  2PQA B;  1Y0R A;  4K2L A;  4OPV A;  5KND A;  3HOY G;  1QCB D;  4RM0 A;  4RDK A;  4UAJ A;  1VQM B;  2R7D A;  3LWE A;  1SDF A;  1ESR A;  2HCJ B;  1NAP A;  3Q0A A;  4K14 A;  3GTK B;  4FXU A;  4CGY B;  4YAO A;  2G9D A;  2X85 A;  1KC8 D;  1C7Y A;  1BR9 A;  4GN3 B;  4I65 A;  4YHH Q;  2DET A;  4KN7 C;  4L5R C;  4CKB A;  4BXX G;  5M3F B;  1LTL A;  5JJZ A;  3AGQ A;  4J6H A;  4N8X 1;  2EY2 A;  3SXH A;  4XR6 A;  2VYQ A;  2M5S A;  2DGY A;  2V7X A;  2UXC L;  1Q7Y C;  2RDH A;  1D8T A;  2E1R A;  3T56 B;  2N3S A;  1D1K A;  4TN1 A;  2MO0 A;  3RD4 A;  3JAM L;  2O5I C;  2VUM G;  3G71 A;  3N6R A;  1TKW B;  2B7B A;  2X0K A;  2I07 B;  3F8T A;  3I8Z A;  4B3S L;  4RLZ A;  2FIN B;  2IT1 A;  1EP3 B;  3BDO A;  3KJO A;  4BBR H;  4RAU C;  4C3J G;  3ERO A;  3AFQ A;  4DV0 Q;  4K1X A;  1P8L A;  4AC9 A;  4J1M A;  2R7Z G;  2KBN A;  3HOY B;  1SE4 A;  2NTT A;  3AB9 A;  3ONA B;  3DLL A;  1MSH A;  4RD6 A;  1PZI D;  5CV5 A;  5G3L D;  3OEE A;  5J1Z A;  2Q6I A;  4RCZ A;  4X64 L;  4B3F X;  2O2L D;  4YAF A;  4P3Y A;  2X8K A;  3AST A;  1KTK A;  3V2T A;  4J15 A;  4KK7 A;  4XL9 A;  4KMU C;  1NE3 A;  3S16 H;  2JIZ A;  4YWM A;  1KL9 A;  1WCM G;  3A74 A;  3PUW A;  4B9X A;  4DV7 Q;  3CTA A;  4JI5 L;  3SK6 A;  2JA6 G;  5TY0 A;  1LTA D;  1V1P A;  3CCM A;  1BCP B;  1LT4 D;  1AP0 A;  4JVZ A;  1OGI A;  5IIF A;  1N0V C;  2ZZG A;  4P6Y A;  3L0O A;  5FLX c;  4A3G H;  2CFM A;  2OTL B;  3VO1 A;  1YJ9 A;  1FJG Q;  2EYM A;  4GN4 B;  1SLJ A;  4TSS A;  2VUM B;  5IP7 G;  2PPB C;  1YNN D;  2F0S A;  3A0J A;  1JJC B;  4RCN A;  3ULJ A;  3GTL H;  1HUM A;  2NBF A;  1ML0 D;  5T1I A;  2VBU A;  1V0E A;  4ID6 A;  3PUN A;  1Y0Y A;  1YI2 B;  4C3I H;  1JWU D;  2VZL A;  3SVM A;  1F20 A;  4GZY C;  1VQP A;  1DON A;  2R7Z B;  2UUA L;  2H4O A;  1E63 A;  3I91 A;  4KV6 A;  3KOJ A;  2P5Z X;  2SNS A;  4DA2 A;  3AYH B;  3CCS B;  2JSO A;  1KDB A;  1EP1 B;  1TUI A;  4A3I G;  1I18 A;  4B48 A;  4UP7 A;  5EJW A;  3VR3 A;  4CJ0 B;  2KHS A;  1YIJ A;  3RZO H;  1PLF A;  1LLR D;  2MUY A;  4EQO A;  4A3J G;  5K36 H;  1LM0 A;  1I8D A;  2XSC A;  4C2M B;  4XDX A;  1BUV T;  1KDA A;  4PC3 A;  3TBI B;  4BWG B;  4YAL A;  2C4U A;  4XLE A;  2JA6 B;  1W6K A;  2D74 A;  2V31 A;  2E1B A;  2VZA A;  4AF6 A;  4PV1 C;  4S3S A;  3J81 i;  3PIO 3;  2CK3 A;  3A8I E;  4UZF A;  4ME5 A;  3QJY A;  3OKX A;  5J22 A;  1Q86 C;  2LXK A;  2C77 A;  5T1G A;  2Y0S E;  1IYJ B;  5E3F A;  1WVL A;  5FLX L;  1UUP A;  1C0A A;  2ZXR A;  1E1Q A;  3NSW A;  1SFO B;  4HE6 A;  1CKN B;  3SGI A;  3SLN A;  3PGZ A;  2FJ2 A;  3F2D A;  1SYG A;  3TP8 A;  3VYS A;  2QEX A;  4WJW A;  1WOP A;  2YWG A;  4XOP A;  3GSI A;  2RCN A;  4HMI A;  3TS0 A;  2Z0S A;  4DAP A;  1DDG A;  5FO0 A;  4JI4 Q;  1WTO A;  3L2P A;  5IYD H;  1LV9 A;  2YV5 A;  1YJN A;  4PNY A;  4WRD A;  2Z1C A;  3A8K E;  3K59 A;  4A3I B;  4PC2 A;  4UAI A;  2QIL A;  1D1I A;  2HHH Q;  4ZLT F;  4DR2 L;  4A3J B;  5FO9 B;  1BLI A;  1RCV D;  3TP5 A;  1MJC A;  2GJR A;  4P22 A;  2HMA A;  2F0L A;  3C1F A;  2A6E C;  3MXP A;  4XQQ A;  1QG7 A;  1DG1 G;  2N55 A;  5FIU A;  4P9S A;  3W1B A;  1SNC A;  2E76 C;  1NUC A;  3J81 j;  2VJJ A;  1TS4 A;  1W9X A;  3TQY A;  1ZYR C;  1HZC A;  3D4R A;  1ZXT A;  1WTW A;  5LL6 S;  1QE6 A;  2L4N A;  1ZEQ X;  3ASS A;  1KXL A;  1NB0 A;  1W2B B;  4LF7 Q;  3PF5 A;  4P6V F;  2E74 C;  1EFC A;  1B3Q A;  2BSA A;  4DR7 Q;  1B8A A;  1QZG A;  3WNB A;  1HA3 A;  1PYS B;  2E2H B;  2K1B A;  2MQH A;  2BM1 A;  1FR3 A;  1JA1 A;  1LAB A;  4DGZ A;  3ICE A;  3S14 B;  1PH4 A;  1SNO A;  2I5H A;  5CV9 A;  5DNF A;  1JOQ A;  2EJG C;  4DUY L;  1T6Z A;  3R6K A;  3J80 i;  4LAA A;  1IHM A;  1MBY A;  3NE5 B;  5BSX A;  3K0Y A;  4FO2 A;  1PYW D;  5FKA C;  1VS0 A;  3PEN A;  3CCJ A;  3DEO A;  4JW0 A;  4ACB A;  1PTO H;  2B3G A;  3HP3 A;  3WOE A;  1S40 A;  3CPW A;  3CC4 A;  5COR A;  4B43 A;  4ZQ3 A;  2EZV A;  2JXM B;  5EKK A;  2GK7 A;  4HJ9 A;  3V05 A;  3VR4 A;  2QA4 A;  1LTS D;  4EQN A;  5K5P A;  3BVZ A;  5AJ3 L;  3BCF A;  1DOK A;  4RPB A;  3S2D B;  4OO1 I;  2KCC A;  1UD5 A;  1SAP A;  1M4V A;  4AYB E;  3MXG A;  3ULL A;  4X7E A;  2QE7 A;  2M2L A;  3R2T A;  4EVO A;  3MXU A;  2WZP P;  2YWF A;  3HKZ E;  5KNB A;  1G8Z D;  3E3X A;  4OO1 G;  1G51 A;  3AVT A;  3M4O H;  4A3D G;  2JA7 G;  2K03 A;  2OBR A;  1STA A;  2L1B A;  1K28 A;  3U9S A;  4KKU A;  2FVG A;  1SYE A;  1T9H A;  2R6G A;  3M4Y A;  2WYR A;  5CGK A;  3PO2 H;  2WPD A;  4DV5 Q;  5HZA A;  1WTH D;  5CV7 A;  5A2Q L;  1Q1B A;  2OXP A;  3MFY A;  1GKH A;  2KEC A;  2YTY A;  1N36 L;  2F0M A;  4RD4 A;  2KHI A;  2E5L Q;  3ZUG A;  3RLN A;  4A3L G;  3D0F A;  4GKK Q;  5CBA E;  3H9N A;  2QGQ A;  5HGT A;  4V0B A;  4PMB A;  4X66 L;  4HJ7 A;  4QMG A;  4JI3 Q;  5D3D A;  5M5W H;  1TWA B;  2AHO A;  4C56 C;  4QVJ A;  2F4V L;  1VHO A;  4FXD A;  1XPU A;  4XN0 A;  4H9G A;  1JWS D;  1QOH A;  3H6M A;  3K58 A;  4F88 A;  2E2J H;  2NZ1 D;  1A2U A;  2PI2 E;  1DYQ A;  2WJY A;  3OP1 A;  4RD3 A;  3ZZU A;  5EPJ A;  1IBK L;  4G1B A;  1RD9 D;  3EFX D;  1HR0 Q;  3S1M H;  1QNU A;  1CQX A;  5IT9 E;  2K4K A;  2B63 G;  2BN4 A;  4RDL A;  1O80 A;  4DAV A;  3P27 A;  3OIP A;  1LTR D;  2JA5 G;  5C4J B;  3EVQ A;  4OEM B;  3UE1 A;  4A3D B;  3ND8 A;  3J7Z C;  4LW1 A;  2JA7 B;  4LF8 L;  3OMG A;  3BYT B;  3OJX A;  2ZM6 Q;  4K0K L;  1GUW A;  3JQP A;  2JK8 A;  3NHH A;  1Q3L A;  3PO3 G;  4EGV A;  1TY0 A;  3HOW H;  1VHE A;  3C2Q A;  2J0T D;  3CC2 A;  5EPK A;  3FDT A;  5KNC A;  4DR5 L;  1FYC A;  1AW7 A;  5CYU A;  1F9R A;  2Z4I A;  1VQF A;  4XT3 B;  1N07 A;  2IX3 A;  4KLK A;  1SNP A;  3RZD H;  3AMU A;  2HUG A;  3H3V C;  3OWF A;  4HED A;  5C44 H;  2FFK B;  4RGN A;  1Q82 C;  2BCO A;  2BA0 A;  3OMC A;  2XGJ A;  4YY3 L;  4GOP B;  3MWY W;  1HHV A;  4G7W A;  3X3M A;  5ELC A;  3A1P A;  4B47 A;  4BBS G;  2DUD A;  1OXV A;  2CWP A;  2OBT A;  1WOO A;  2WZN A;  3ES9 A;  1IKM A;  4GS3 A;  4DK1 A;  2B8G A;  1VQ4 A;  4JI7 Q;  4WJ3 M;  1QFY A;  1QFJ A;  1D7Q A;  4QIW E;  4DN4 M;  5IY0 A;  1VQ6 A;  1R5B A;  2JA5 B;  3D4W A;  1SRU A;  3Q3A A;  4M1U B;  2C5H A;  3S17 B;  4RCO A;  1TLL A;  2BV3 A;  4PAA A;  2EY5 A;  1XJV A;  1NCV A;  1VQ5 A;  2UU9 L;  2AMC B;  4DV6 Q;  3QWN A;  2C35 B;  2BVN A;  2XZL A;  1DXM A;  3B6Y A;  1LTT D;  2NVY H;  1AE2 A;  1B7Y B;  3PMF A;  3KDF B;  4PZ8 A;  3I1F A;  4RD2 A;  1HNX Q;  3OHX C;  1X3G A;  1GJX A;  4YWL A;  5AN9 A;  2WP8 J;  4A3C G;  1G7T A;  2MHV A;  1A15 A;  3ZC3 A;  3GTJ B;  4JI6 L;  1Z6H A;  4JI8 L;  1E64 A;  2F0I A;  5IYN A;  1IBM L;  1SKQ A;  1DOL A;  1EU4 A;  4DUZ Q;  4BBS B;  3I73 A;  3HKZ B;  3GVJ A;  3ZBU A;  1BKB A;  2PLF A;  3NEM A;  3NTI A;  5KYL A;  1KQS A;  3FKI G;  3QG1 A;  1S5B D;  4U68 A;  4A3E G;  4XIG S;  4A3F H;  1EL0 A;  2A6H C;  4FXK C;  2JA9 A;  2IL8 A;  1K8A C;  4B3R Q;  2XEX A;  3OTO L;  3PA1 A;  1JOK A;  1S5E D;  4POG A;  1V0F A;  1B9N A;  1X55 A;  1RQP A;  1VQE A;  4XYO A;  3SE0 A;  4OX9 L;  5IWA Q;  1FL0 A;  1KLU D;  2HDL A;  2IW3 A;  2EYL A;  3VYR A;  4JYA L;  4E0F A;  3CQZ H;  3GTP B;  2UXD Q;  4X0C A;  1KAA A;  1AH9 A;  1GAW A;  4X3U A;  4Y9U A;  1G6Z A;  4Z4V A;  1B53 A;  4C3H G;  4IUQ A;  1S5D D;  1EYA A;  4LF9 L;  4Z4T A;  3MA2 B;  3PV0 A;  3C1E A;  4AF7 A;  1LO5 D;  2DY7 A;  1WJJ A;  1QVG A;  1KNA A;  3J81 c;  2YTV A;  1HNW Q;  1PH5 A;  3N52 A;  5EBC A;  1M8A A;  3RUZ A;  1H8H A;  3T1H Q;  1V9P A;  3FJO A;  2AWN A;  1X3P A;  3S1Q B;  5EBD A;  2NUC A;  4DV3 Q;  1YEZ A;  1BBU A;  4OXP A;  3QFC A;  2VQF L;  5M5X B;  3P20 A;  2I5M X;  1FDR A;  2F3W A;  2QCP X;  3HOU G;  4BY1 H;  2R93 B;  2CH4 W;  1TWF B;  4LFA Q;  3STB D;  4DR1 Q;  1IW7 D;  1YVC A;  4B3T L;  1LT5 D;  3JAM E;  5JPM C;  3M3Y B;  2VW9 A;  1MI2 A;  3GTQ B;  4RA8 A;  3PUM A;  2A68 D;  3RNU A;  2UUB L;  4GKJ Q;  4QV2 A;  2PZT A;  4TKO B;  5D3I B;  1JA0 A;  3G6J B;  4HSV A;  1F2Y A;  3H3V I;  3WWV A;  5JVH 3;  1WDT A;  1EIF A;  5IGF A;  4II3 A;  1GUG A;  3I56 B;  2B2Y A;  4G1V A;  4V19 0;  3T53 B;  4C3H B;  1HZE A;  1Q12 A;  5TR9 A;  1HNZ Q;  1FNB A;  5C3E H;  3QB3 A;  2RA4 A;  1EFT A;  2RC6 A;  5M5Y B;  5IGE A;  3U50 C;  1XYI A;  1XX8 A;  1WPC A;  1VQ8 B;  1B2T A;  1TXY A;  2YYZ A;  5J35 A;  3HOX G;  4G7O C;  1BCP D;  3Q23 A;  2EPB A;  5JJI A;  2F3V A;  5DN6 A;  3J81 L;  4M4S A;  2EYO A;  5JEA H;  1GVH A;  4QIW B;  2WJV A;  2QKI C;  3MXN B;  1SKY B;  3SLD A;  1MKH A;  1SMY D;  4DAM A;  1OO9 B;  4YHH L;  5DM7 3;  2ZZQ A;  3I4N G;  1A3U A;  1YHB A;  3HOU B; 
#chains in the Genus database with same CATH homology
 2SEB D;  5KNL A;  3DHQ A;  4ZK9 B;  3ERQ A;  1CQV A;  5IGB A;  2ZXI A;  4AVZ A;  1CHQ D;  3O13 A;  2LY7 A;  2F0G A;  1IKL A;  2LKV A;  3S2H B;  4K5V A;  3CRK C;  1BF4 A;  1SMY C;  4UDU C;  4KJO A;  3MZ5 A;  4XKV A;  5NUC A;  1JIC A;  3FKS A;  1WD1 A;  1EY4 A;  4K5W A;  5CR3 A;  5D14 A;  3I4N B;  1WTV A;  3OW7 A;  4Q0F A;  3HOV B;  4XM3 A;  2IX0 A;  1E3X A;  4FF3 A;  1LTI D;  1TR5 A;  4H0L C;  4F7X A;  1AZQ A;  2B2V A;  2K05 A;  3V96 A;  1JB3 A;  2F0Q A;  4YXW A;  1JR0 D;  1I50 B;  1KDC A;  3CES A;  2ZZF A;  5C0X H;  3J80 L;  3FPU B;  1V43 A;  1T5E A;  1CZW A;  5CV6 A;  1JWM D;  4MIU A;  5I6Y A;  4RGM A;  2PQE A;  1Q1E A;  1A3T A;  1CHP D;  5FOB B;  4U67 3;  4JMQ A;  3FMC A;  3GD7 A;  4GQN A;  1BOS A;  2KVM A;  1D5X C;  5AFW A;  1UAP A;  4TQU S;  5I6W A;  1Z47 A;  2R9V A;  2IPK D;  1BBX C;  3P7J A;  1KAB A;  3H94 A;  4XLF A;  2HDM A;  4XQF A;  1TWH B;  1O7Z A;  2CW0 C;  1E1R A;  4UZU A;  1OHH A;  1E2W A;  2K5Q A;  1ROD A;  3ND9 A;  1SYC A;  1V1O A;  5DEH A;  3K7A B;  2Q8T A;  5IGD A;  3D3R A;  1CZG A;  1J9O A;  4KHV A;  5KRU A;  2X6L A;  3VYT A;  3ZPN A;  1DZ1 A;  2PZU A;  2B2T C;  2ZT9 C;  1PXU A;  2ZTG A;  3IKJ A;  2GA4 B;  1HUN A;  3OEH A;  1EZ8 A;  2FHT A;  4O1N A;  1V1P B;  1UD2 A;  4LMQ D;  1JOO A;  5DM6 3;  1STN A;  2AWO A;  4C1N I;  4A3M B;  1NSN S;  2F0V A;  4OIK A;  2RDG A;  1BMF A;  3OSO A;  4H7B A;  2ZXP A;  1G29 1;  1K8O A;  3S1N B;  1G2S A;  4ZRZ A;  1ENA A;  3H91 A;  1E3Z A;  4OHJ A;  1FGB D;  4HTH A;  5JAV A;  3K5M A;  5C4Z A;  4FYD A;  4X3S A;  3A8J E;  2ZXO A;  3HAG A;  4H44 C;  1S4Z A;  2MPM A;  4IFD I;  4A93 B;  2OEO A;  3P75 A;  3GTG B;  4BA1 I;  2J4X A;  4IFD G;  2G9H D;  1F2L A;  5IGC A;  3A55 A;  1JQY D;  3HZX A;  1Y1W B;  2W6I A;  5CDF A;  1TT2 A;  4BY7 B;  5C3X A;  4C3J B;  1PTO F;  3TME A;  4QCL A;  2R3Z A;  5E4X A;  4HCS A;  4A3K B;  1EQT A;  3QIA A;  3HRZ C;  3BC9 A;  1DD2 A;  1HFN A;  3URY A;  4A3B B;  2RBM A;  1WD0 A;  1R9T B;  3J7A V;  2EDG A;  2K5D A;  1DCZ A;  2EYJ A;  1WCM B;  5I9O A;  2DNE A;  1MGS A;  2ZZE A;  5JOB A;  2K01 A;  2EY6 A;  2PCF B;  4B08 A;  5BN4 A;  5ISR A;  5C5M A;  1B44 D;  3MC0 B;  4KTA A;  3I72 A;  3T51 B;  2A6E D;  4OGQ C;  3BVG A;  2HCC A;  3TSS A;  3NQT A;  1AN8 A;  1ZYR D;  4F87 A;  1Q8I A;  2L0C A;  1NBM A;  1PTO C;  1BDO A;  1R4Q B;  2GK6 A;  1EWC A;  5I9P A;  2EVB A;  3R8B A;  2X6W A;  4ZKB B;  3OWE B;  3IFT A;  3NUC A;  1FNW A;  4IUN A;  2XZO A;  1A2T A;  1Y8P B;  2XNA C;  4G7H C;  4KY7 A;  4DU9 A;  1HTP A;  4BBR B;  4TRD A;  4C3I G;  1VDZ A;  2JA8 B;  4R9W A;  4FNF A;  1UEA B;  4XQJ A;  4KY6 A;  2WSS A;  3Q24 A;  3TDQ A;  1SNQ A;  3HG9 A;  2KQ3 A;  1HCZ A;  3F2U A;  4Y7N B;  4RHS A;  5K36 G;  3I70 A;  1E2V A;  2F0O A;  3S16 B;  1X32 A;  2N88 A;  3OAA A;  1YNJ C;  5ELF A;  1L0X B;  5C3W A;  3BVM A;  1RDP D;  1RJT A;  3R2I A;  4P2C B;  5EGT A;  4BA2 I;  1EY7 A;  2ENB A;  1I4G A;  2LZJ A;  4A3G B;  3PUZ A;  2D3N A;  1O78 A;  2WAQ B;  3NTH A;  4XON A;  2EJM A;  3DDY A;  2XND A;  1W0K A;  2VB3 X;  2ID0 A;  2B2Y C;  3OPO A;  1ILP A;  3CHB D;  3J7Y W;  2SNM A;  5FO8 B;  3OOC A;  3K6O A;  1BQQ T;  2K28 A;  1AEX A;  3D4D A;  1ONL A;  2B2T A;  2EOT A;  2PW7 A;  3OFN A;  3BYY B;  1SE2 A;  3BDL A;  1IHZ A;  1I3Q B;  3J81 E;  4IUU A;  1HQM C;  4JK1 C;  2VB2 X;  3A7A B;  1ESF A;  3NWS A;  1I6H B;  1R4P B;  1CTM A;  2GJP A;  1Y8O B;  5JEA J;  1QJO A;  1Z7T A;  3GTO B;  3GP7 A;  1GUS A;  3CKI B;  1TS5 A;  1FNV A;  1FX0 A;  3JU4 A;  5J39 A;  5TSS A;  3S9W A;  3SEB A;  1STB A;  1F77 A;  3A35 A;  2B2V C;  2EYP A;  2RQX A;  2HLD A;  1GUT A;  4NW2 A;  2PYK A;  5EQ0 A;  1C4Q A;  4KI0 A;  1GHK A;  4XXE A;  2WB1 B;  4RGT A;  2Q8R E;  2B63 B;  1EEF D;  2SDF A;  1E0B A;  2KOL A;  1XWE A;  4LK1 C;  2F0F A;  2K04 A;  1WTR A;  3PO3 B;  4FF4 A;  3G7L A;  3J80 E;  4OL7 A;  1PTO B;  5E4W C;  5A35 A;  4QUC A;  4Z1M A;  1J8I A;  1BNZ A;  2EY1 A;  2L9H A;  5E1F A;  1ENF A;  2A6H D;  2IWH A;  3GV6 A;  5C0X J;  2L5T A;  4FF2 A;  3EA6 A;  3VR5 A;  2AQ2 B;  3M4O B;  4B3G A;  2JDI A;  3H09 A;  3E5S A;  3MEH A;  3A3B A;  3TP7 A;  1EY9 A;  3PO2 B;  2WIN B;  3KBG A;  1H9R A;  4N9P A;  3CP2 A;  4IUV A;  5FK9 C;  3ZYY X;  2XVS A;  3PUX A;  1XXG A;  5M5W B;  4K5X A;  2TMP A;  3FEW X;  3RLF A;  2E2J B;  3KLS X;  2K32 A;  1UD4 A;  4M8A A;  3KF8 A;  3NBH A;  4DFA A;  4XOR A;  3M7N A;  1HFG A;  1G91 A;  2ZXH A;  4XYQ A;  2Z6B D;  3FKI B;  3MVV A;  2NWG A;  4A3E B;  4FXG C;  2Z4H A;  1EYD A;  4RKL A;  1T5X D;  1I4P A;  3BZD B;  1H8E A;  3BDC A;  3RZD B;  3NK9 A;  4MN3 A;  5C44 B;  1E79 A;  2GJK A;  4TSF A;  1VMP A;  2F0U A;  3SK5 A;  1E2Z A;  1STG A;  1D2B A;  1BCP F;  2MGS A;  1GUO A;  5BN3 A;  2L11 A;  1KNE A;  1TS2 A;  1VLY A;  4XNF A;  2AUJ D;  2F0K A;  4XD7 A;  3LWU A;  1VF7 A;  1O7L A;  3HGB A;  3NPP A;  2E75 C;  1F2M A;  2F03 A;  5DAU A;  2NVX B;  1TII D;  4B9W A;  2V7Q A;  3PUY A;  3BG3 A;  2A74 C;  3A3G A;  3BH4 A;  1I4Q A;  2I46 A;  2KJX A;  3T4A C;  5CC4 A;  4X3T A;  1HA6 A;  1QB5 D;  3MAQ A;  3VR6 A;  3OIQ A;  3OE7 A;  2H1E A;  3GVK A;  4RHR A;  4CKC A;  3W3A A;  3CMM A;  2BA1 A;  1UD8 A;  4KY5 A;  1CT1 D;  1FD7 D;  1Q90 A;  4X3K A;  4G7Z C;  3HOX B;  5CV8 A;  2OF1 A;  1H9S B;  1SE3 A;  1PFM A;  2JEB I;  3EQL C;  1SJH D;  3NTK A;  2IX1 A;  3CQZ B;  5FLX E;  1WTX A;  1SSO A;  4K6D A;  3KEW A;  1LAC A;  1RTO A;  4IUT A;  4CHT B;  1CFM A;  5EPL A;  3A7L A;  2CVR A;  2PMZ B;  1EEI D;  5LHY 1;  1L0Y B;  5JEA G;  4KJN A;  2NN6 I;  1H9S A;  3NXW A;  4YIJ A;  1D5Z C;  1LT3 D;  4YEL A;  4XKW A;  5EKL A;  2R92 B;  2NN6 G;  1PRT F;  2ZTN A;  2KED A;  2RSO A;  5EKI A;  3NP8 A;  2CW0 D;  1HQR D;  4FP5 D;  4KHZ A;  4ODG A;  3T13 A;  1PMR A;  3Q6S A;  1SYD A;  4IQZ A;  4J8Q A;  3WQZ A;  4XTC S;  3VA5 A;  4XLC A;  4II2 A;  4HSP A;  1OXX K;  2MJ8 A;  4XT1 B;  1A3V A;  1RF2 D;  4HAE A;  1F9P A;  1K28 D;  1CI3 M;  2X69 A;  1OXS C;  3QOL A;  2RVL A;  4KD3 A;  4IN3 A;  2MP1 A;  1D5M C;  1SND A;  1VCI A;  5C0X I;  3IL8 A;  4HR7 B;  1PRT C;  3LX0 A;  3C3L A;  4EQP A;  3DXJ C;  3AU7 A;  3DWP A;  5C0X G;  1PFB A;  4IFD H;  3D31 A;  4QUF A;  2F4I A;  5JVG 3;  2L12 A;  1B4O A;  2F0N A;  1STY A;  2OT2 A;  1D6E C;  5A2Q E;  5G3L F;  2K5W A;  1DJR D;  4ILW A;  4Q5V A;  1II3 A;  3QO2 A;  2D62 A;  3TP6 A;  2C5C A;  5IGG A;  5D65 A;  1WTP A;  2VNU D;  2F0T A;  1B3A A;  2L55 A;  4Z9C B;  2B2W A;  3SR1 A;  3K57 A;  1JCK B;  5F2D A;  3NQI A;  4K2K A;  2QEJ C;  2JJ2 A;  4XQN A;  5ELB A;  1ILQ A;  1LTB D;  5I2X A;  5M9O A;  4RWS C;  1RHP A;  5KGU A;  2YU9 B;  4NMZ A;  1K8M A;  2BE5 D;  1RTN A;  1TQO A;  2RDF A;  2NVQ B;  5FL7 A;  1EY8 A;  3M7G A;  2LMC B;  4ULL A;  5JPN C;  1SBB B;  4IZ8 A;  5ELD A;  4XOT A;  4DXF A;  3FVQ A;  2XN9 C;  2A73 B;  3U9O A;  2BE5 C;  1I4R A;  3DM1 A;  1U4R A;  1GXD C;  4PMW A;  4DK0 A;  1PTO D;  1HPC A;  5HKK A;  2JJ1 A;  1HTL D;  1YNN C;  1Y8N B;  4K8I A;  2SOB A;  3CU7 A;  4N9T A;  5ELE A;  1H9J A;  1MAB A;  2XWJ B;  1E43 A;  4H13 C;  1HVX A;  3D6C A;  5IK2 A;  4IUR A;  4K8J A;  4MHE A;  3S1R B;  1CA6 A;  1Y69 U;  2AQ3 B;  2XRS D;  2E2D C;  1W0J A;  1YNJ D;  4ZUI A;  4ZUJ A;  4OO1 H;  2VJI A;  1F9Q A;  2KEE A;  2PZW A;  1UD6 A;  1A6X A;  4OIJ A;  2X6Y A;  4LJZ C;  1UNS A;  1SYF A;  2E2I B;  3DWA A;  1GUN A;  4XMY A;  4C1N K;  3GTM B;  2Z8L A;  2RSN A;  5BN5 A;  5C4X B;  3C46 A;  1JOR A;  4XN3 A;  1OXU A;  2IJ0 A;  2K7V A;  1S5F D;  1PRT B;  1PDQ A;  1U4M A;  3KLR A;  5C5L A;  3G05 A;  1WTQ A;  2NB0 A;  2F0H A;  2VXW A;  1EY0 A;  4G6I A;  4QB4 A;  1B1Z A;  3GTL B;  4QF4 A;  3IAY A;  2B2U A;  4C3I B;  1F2Z A;  2NTS A;  4ZAI A;  2ICI A;  1HA5 A;  1F9S A;  3RZO B;  1H9M A;  1C8C A;  1LTG D;  3ITP A;  5FO7 B;  1DOM A;  1EIG A;  1U9R A;  2F0E A;  4E6I A;  2M9V A;  1U4L A;  3SK4 A;  5CBE E;  3ZIA A;  4ASU A;  3K5N A;  2BDN A;  3DUZ A;  4HMJ A;  2J7Z A;  2F0D A;  1TWC B;  4ZYS A;  3BCD A;  2AQ1 B;  4DXG A;  1BPL A;  4DNR B;  1PFN A;  1OXT A;  1MD2 D;  2PW5 A;  2DIE A;  1EQV A;  2B8F A;  1W6J A;  2WKC A;  2Y0S B;  2EE1 A;  5I4D A;  4FF1 A;  1VJS A;  2O4X A;  1IYV A;  2KVO A;  1ZKO A;  3WOF A;  4WOR A;  5C4H A;  1MSG A;  1TS3 A;  3RMH A;  1I4H A;  5CMD A;  3J7A F;  2Q8I B;  3MHB A;  4I7Z C;  4CBV A;  3MTS A;  1EY6 A;  3T16 A;  1EFR A;  3E0J A;  4F8M A;  5C6A A;  1LT6 D;  1EIH A;  4L6T B;  4PQX A;  2B39 A;  4CJ2 C;  2A5H A;  3NWT A;  1STH A;  2DY8 A;  1AFP A;  2EJF C;  3FRP B;  5IOC A;  3SDZ A;  1VF5 C;  3L7Z C;  1PZJ D;  1VMC A;  3D8G A;  1OB0 A;  5CV4 A;  3VYU A;  1TVX A;  3SHL A;  1AZP A;  4CJ1 B;  2XIW A;  3CRL C;  2ICE C;  3IFD A;  4RGO S;  3E6Z X;  1BO0 A;  1STE A;  1CQF A;  1PKV A;  4XLH A;  4NDX A;  3A54 A;  2LS0 1;  1O7Y A;  1IYU A;  1EU3 A;  1CM9 A;  3GVL A;  2DN8 A;  1GHJ A;  2PO4 A;  2JYO A;  4TT3 A;  1IL8 A;  2QDB A;  2KUM A;  1DM0 B;  2XZP A;  1SNM A;  2F1M A;  4G57 A;  3SK8 A;  5LL6 X;  2CQA A;  4AYB B;  3BS1 A;  1TY2 A;  3QOJ A;  3HS0 C;  5KIX A;  3I4M B;  3KK7 A;  4KKS A;  1SXT A;  2JE6 I;  1X3Q A;  1PZK D;  1KLG D;  1BXT A;  3M85 A;  3S1M B;  1QNK A;  1KZL A;  3KBX A;  1XTC D;  4RFB A;  3WDN A;  4NNJ A;  1SEB D;  2FMM A;  1EFI D;  1I6V C;  2LFN A;  1SJE D;  3HOW B;  1B9M A;  2XRQ D;  3PIP 3;  2FMC A;  3GO5 A;  1KMH A;  3C2P A;  2QF7 A;  3VR2 A;  2X53 S;  5KYI A;  3GQB A;  2NYZ D;  1QWY A;  5HUR A;  1EY5 A;  4R8I A;  4IFD J;  3EJI A;  1ET9 A;  4R8N A;  2B2W C;  3A56 A;  1WP6 A;  2DNC A;  2JEA I;  4KD4 A;  3I3C A;  1B50 A;  3LNN A;  4RKB A;  2D9U A;  2KCN A;  3TZU A;  3R93 A;  3L9A X;  2PNR C;  4NP5 A;  1EYC A;  3DWQ A;  3DMU A;  2CHB D;  2RKS A;  1V8Q A;  4XLA A;  2NVY B;  3HEJ A;  2V4D A;  1IW7 C;  1HRJ A;  2D5D A;  4NKL A;  1G2T A;  2WAC A;  1EZ6 A;  2XWB B;  1ENC A;  1Y1V B;  2A68 C;  2D2C C;  2X6G A;  1UD3 A;  2KA7 A;  3X3N A;  3NBI A;  2HCI A;  4HCE A;  2R61 A;  1HXY D;  4ABN A;  4FVM A;  2K6A A;  2NN6 H;  1JC7 A;  4WFN 3;  2BDO A;  4K6L A;  1K83 B;  5IT9 L;  2D3L A;  3UI2 A;  3HOZ B;  1NRK A;  3D6W A;  3KUP A;  4A3F B;  1BCP C;  4YEJ A;  2WV6 D;  4CKE A;  5KEE A;  2EYH A;  2XOK A;  5I2Y A;  3KLS A;  3TZD A;  4HIZ A;  3DEP A;  3MXN A;  1S5C D;  1ET6 A;  2F0W A;  3L3O C;  1C48 A;  3MFG A;  4G4K A;  2WKD A;  1CK1 A;  1ICW A;  4KKT A;  1I4X A;  4L63 B;  2TSS A;  4DAY A;  1RKN A;  2BOS A;  2EYF A;  4ZKC B;  1FNU A;  5COY A;  2X6X A;  1TU2 B;  2M00 A;  4IAL A;  4BY1 B;  2A69 D;  4G7X A;  1COW A;  4BS9 A;  5IOD A;  3Q22 A;  3K5O A;  1SYB A;  3TN2 A;  4HN7 A;  4IUP A;  3W2D A;  1TWG B;  1GOZ A;  1EOT A;  4KN4 C;  4O42 A;  3K5L A;  5C3E B;  2C9O A;  2A69 C;  4DF7 A;  3S15 B;  4RH6 A;  4DNT B;  3PUV A;  3FPP A;  4JBW A;  1QIL A;  3I4L A;  2F0J A;  2F43 A;  1H9K A;  3I90 A;  1PRT D;  3CP8 A;  1NR4 A;  2WII B;  1NR2 A;  2B2U C;  2K33 A;  1CA5 A;  2EXZ A;  2O5J C;  1EWH A;  2JP1 A;  3GV3 A;  5M3M B;  3R3O A;  1JE4 A;  2F0P A;  2HQE A;  3P1H A;  4PMC A;  3VA7 A;  3H0G B;  1U4P A;  3M3Y B;  4L8J A;  2AUK A;  4K2L A;  2W6J A;  5KND A;  1QCB D;  3LWE A;  1SDF A;  1ESR A;  1NAP A;  3Q0A A;  3GTK B;  4K14 A;  4FXU A;  4CGY B;  2G9D A;  2X85 A;  1BR9 A;  4I65 A;  4KN7 C;  4CKB A;  5M3F B;  5JJZ A;  4J6H A;  2EY2 A;  3SXH A;  4XR6 A;  2M5S A;  2RDH A;  3T56 B;  1D1K A;  3RD4 A;  3JAM L;  2O5I C;  3N6R A;  1TKW B;  2I07 B;  3I8Z A;  2FIN B;  2IT1 A;  3BDO A;  4RAU C;  4C3J G;  3ERO A;  4J1M A;  3HOY B;  1SE4 A;  2NTT A;  3AB9 A;  3ONA B;  1MSH A;  1PZI D;  5CV5 A;  5G3L D;  3OEE A;  5J1Z A;  4B3F X;  2O2L D;  2X8K A;  1KTK A;  3V2T A;  4KK7 A;  4XL9 A;  4KMU C;  2JIZ A;  3PUW A;  4B9X A;  3SK6 A;  1LTA D;  1V1P A;  1BCP B;  1LT4 D;  1AP0 A;  5IIF A;  2ZZG A;  2EYM A;  4TSS A;  2VUM B;  2PPB C;  1YNN D;  2F0S A;  4RCN A;  1HUM A;  2NBF A;  1ML0 D;  5T1I A;  1V0E A;  4ID6 A;  1DON A;  3SVM A;  1JWU D;  4GZY C;  2R7Z B;  2H4O A;  3I91 A;  4KV6 A;  2SNS A;  4DA2 A;  2JSO A;  1KDB A;  1I18 A;  5EJW A;  3VR3 A;  4CJ0 B;  2KHS A;  1PLF A;  1LLR D;  2MUY A;  4EQO A;  5K36 H;  1I8D A;  2XSC A;  4C2M B;  4XDX A;  1BUV T;  1KDA A;  3TBI B;  4BWG B;  2JA6 B;  4XLE A;  1W6K A;  2V31 A;  2E1B A;  4PV1 C;  4S3S A;  3PIO 3;  2CK3 A;  3A8I E;  5J22 A;  4ME5 A;  3QJY A;  5T1G A;  5E3F A;  1WVL A;  5FLX L;  1UUP A;  2ZXR A;  1E1Q A;  3NSW A;  1SFO B;  2FJ2 A;  1SYG A;  3TP8 A;  3VYS A;  4WJW A;  4XOP A;  4HMI A;  4DAP A;  1WTO A;  1LV9 A;  4PNY A;  4WRD A;  2Z1C A;  3A8K E;  3K59 A;  4A3I B;  4UAI A;  2QIL A;  1D1I A;  4ZLT F;  4A3J B;  5FO9 B;  1BLI A;  1RCV D;  3TP5 A;  2GJR A;  4P22 A;  3MXP A;  2F0L A;  3C1F A;  2A6E C;  4XQQ A;  1QG7 A;  2N55 A;  1SNC A;  2E76 C;  1NUC A;  2VJJ A;  1TS4 A;  1W9X A;  1ZYR C;  3D4R A;  1ZXT A;  1WTW A;  5LL6 S;  1QE6 A;  2L4N A;  1ZEQ X;  2E74 C;  2E2H B;  2K1B A;  1FR3 A;  1LAB A;  4DGZ A;  3S14 B;  1SNO A;  5CV9 A;  5DNF A;  1JOQ A;  2EJG C;  4LAA A;  1MBY A;  3NE5 B;  3K0Y A;  4FO2 A;  1PYW D;  5FKA C;  3DEO A;  1PTO H;  3HP3 A;  3WOE A;  5COR A;  4ZQ3 A;  2EZV A;  2JXM B;  5EKK A;  2GK7 A;  3V05 A;  3VR4 A;  1LTS D;  4EQN A;  5K5P A;  3BVZ A;  3BCF A;  1DOK A;  3S2D B;  4OO1 I;  2KCC A;  1UD5 A;  1SAP A;  1M4V A;  3MXG A;  2M2L A;  3R2T A;  2QE7 A;  4EVO A;  3MXU A;  2WZP P;  5KNB A;  1G8Z D;  4OO1 G;  2K03 A;  1STA A;  2L1B A;  3U9S A;  4KKU A;  1SYE A;  2R6G A;  3M4Y A;  5CGK A;  2WPD A;  1WTH D;  5CV7 A;  5A2Q L;  1Q1B A;  2OXP A;  3MFY A;  2KEC A;  2F0M A;  5CBA E;  5HGT A;  4V0B A;  4PMB A;  4QMG A;  5D3D A;  1TWA B;  4C56 C;  4FXD A;  4XN0 A;  1JWS D;  1QOH A;  3H6M A;  3K58 A;  4F88 A;  2NZ1 D;  1A2U A;  1DYQ A;  2WJY A;  5EPJ A;  1RD9 D;  3EFX D;  1QNU A;  5IT9 E;  1O80 A;  4DAV A;  3OIP A;  1LTR D;  5C4J B;  3EVQ A;  4A3D B;  3ND8 A;  2JA7 B;  3OMG A;  3BYT B;  1GUW A;  3NHH A;  1Q3L A;  4EGV A;  1TY0 A;  2J0T D;  5EPK A;  3FDT A;  5KNC A;  1FYC A;  1AW7 A;  5CYU A;  1F9R A;  2Z4I A;  4XT3 B;  2IX3 A;  1SNP A;  3AMU A;  2HUG A;  3H3V C;  3OWF A;  4HED A;  2FFK B;  4RGN A;  2BCO A;  2BA0 A;  3OMC A;  2XGJ A;  1HHV A;  3MWY W;  4G7W A;  3X3M A;  5ELC A;  1OXV A;  1IKM A;  4DK1 A;  2B8G A;  4DN4 M;  2JA5 B;  3D4W A;  4M1U B;  3S17 B;  4RCO A;  2EY5 A;  1NCV A;  3QWN A;  2XZL A;  1DXM A;  1LTT D;  3PMF A;  3OHX C;  1GJX A;  2WP8 J;  2MHV A;  1A15 A;  3GTJ B;  1Z6H A;  2F0I A;  1DOL A;  1EU4 A;  4BBS B;  3I73 A;  3HKZ B;  3GVJ A;  3NTI A;  5KYL A;  3QG1 A;  1S5B D;  4U68 A;  4XIG S;  1EL0 A;  2A6H C;  4FXK C;  2IL8 A;  1JOK A;  1S5E D;  1V0F A;  1B9N A;  4XYO A;  3SE0 A;  2HDL A;  1KLU D;  2IW3 A;  2EYL A;  3VYR A;  4E0F A;  3GTP B;  1KAA A;  4X3U A;  1G6Z A;  1B53 A;  4C3H G;  4IUQ A;  1S5D D;  1EYA A;  3MA2 B;  3PV0 A;  3C1E A;  1LO5 D;  2DY7 A;  1KNA A;  3N52 A;  5EBC A;  1M8A A;  3RUZ A;  1H8H A;  2AWN A;  1X3P A;  3S1Q B;  5EBD A;  2NUC A;  5M5X B;  3P20 A;  2F3W A;  2QCP X;  2R93 B;  1TWF B;  1IW7 D;  1LT5 D;  3JAM E;  5JPM C;  1MI2 A;  3GTQ B;  4RA8 A;  2A68 D;  2PZT A;  4TKO B;  5D3I B;  3G6J B;  4HSV A;  1F2Y A;  5JVH 3;  5IGF A;  4II3 A;  1GUG A;  2B2Y A;  4V19 0;  3T53 B;  4C3H B;  1HZE A;  1Q12 A;  3QB3 A;  2RA4 A;  5M5Y B;  5IGE A;  1XYI A;  1XX8 A;  1WPC A;  1B2T A;  2YYZ A;  4G7O C;  1BCP D;  3Q23 A;  2EPB A;  2F3V A;  5DN6 A;  3J81 L;  2EYO A;  5JEA H;  4QIW B;  2WJV A;  2QKI C;  1SKY B;  1SMY D;  1OO9 B;  5DM7 3;  2ZZQ A;  1A3U A;  2NVT B;  3HOU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...