3OOCA

Crystal structure of the membrane fusion protein cusb from escherichia coli
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
297
structure length
297
Chain Sequence
TQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cation efflux system protein cusB
publication title Crystal structure of the membrane fusion protein CusB from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 40
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3oocA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3oocA03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3oocA01
1GHKA 3AB9A 3VR4A 4KKTA 5C0XG 4TKOB 4DK1A 1GUNA 1ZKOA 3BG3A 3M85A 3VR3A 4DNRB 4PV1C 1OXSC 1OXUA 1OXXK 1SMYC 2A69D 2A6EC 5A35A 1VDZA 4LJZC 1B9MA 3PUWA 3OOCA 3EQLC 2PCFB 4H13C 1IYVA 1K8MA 2A68D 2JXMB 1Y8PB 2E74C 5BN5A 4G7OC 3T51B 4KKSA 2B8FA 2K33A 1Z7TA 3I72A 4LK1C 5KNBA 2NN6H 2EVBA 2JEBI 4KN7C 1HCZA 3ND8A 5BN3A 1H9MA 2AWOA 2Q8IB 1E2WA 3A8KE 1Y8OB 5KNDA 3H94A 2A68C 4JK1C 2V4DA 2F1MA 2KA7A 4DNTB 2BA1A 3FMCA 3T53B 1HPCA 1QJOA 2AUKA 3W3AA 1VF7A 4H44C 4JBWA 2D2CC 2BDOA 4L8JA 2BA0A 2R6GA 3PUZA 4RCNA 2DNEA 1V8QA 1T5EA 2E76C 3I4LA 3CRLC 3SE0A 5BN4A 3LWUA 3I73A 4IQZA 3FPPA 1GHJA 2O5IC 1A6XA 3A8IE 1ZYRC 1CTMA 3PUXA 1O78A 2AUJD 4XTCS 2A6HD 2JEAI 5C0XH 3VR6A 4IFDG 2ZT9C 3A8JE 3GQBA 3QJYA 2EJGC 5JEAG 1Q1BA 2A69C 2CW0C 4BA2I 1GJXA 2BE5D 2IT1A 1BDOA 1PMRA 1VF5C 2NN6I 5K36G 1VCIA 1G291 3MFYA 2DNCA 1LACA 3P20A 4OO1G 4DK0A 1B9NA 3L7ZC 5KNCA 1OXVA 1ONLA 3DXJC 3M4YA 1DCZA 1GUTA 1O7LA 1IYUA 1Q90A 2JE6I 4KN4C 4G7ZC 4OGQC 1CFMA 1H9SA 2B8GA 2BE5C 3D4RA 1I6VC 1H9KA 1H9RA 1V43A 5JEAH 1DXMA 1H9JA 2E75C 3PUVA 3QIAA 3NE5B 4KHZA 1LABA 3M7NA 1Q1EA 3WDNA 3IKJA 2EJMA 1FR3A 4G7HC 1HQMC 4OO1H 2LMCB 1EWHA 3HGBA 4I7ZC 1GUGA 3A7LA 3GD7A 4TQUS 1H9SB 2A6ED 3CRKC 3ND9A 2DN8A 3VR2A 3T56B 1IW7D 1DD2A 3OW7A 2A6HC 2NN6G 2O5JC 1TU2B 1YNNC 3KLRA 1K8OA 3VA7A 2D5DA 1E2VA 4H0LC 1TKWB 2L5TA 1OXTA 3QG1A 1CI3M 4XIGS 2KCCA 2D62A 3LNNA 1GUSA 2K7VA 4KI0A 3TZUA 3RLFA 3MXUA 3VR5A 4IFDH 1YNJC 3SDZA 3A7AB 1IW7C 4GZYC 1GUOA 2YYZA 2PPBC 1FYCA 3IFTA 4KMUC 2EJFC 3OPOA 3D31A 1Q12A 1HTPA 4KKUA 1Z6HA 3PUYA 5K36H 2PNRC 1Y8NB 1E2ZA 1Y69U 3PV0A 3U9SA 4BA1I 2QF7A 4HR7B 3BDOA 2EDGA 3N6RA 2K32A
chains in the Genus database with same CATH superfamily
1KRSA 4UHVA 2QGGA 5AJ3Q 1BBUA 4AQYL 1ZKOA 1V0EA 4ZKCB 1SN8A 1U4RA 3M85A 3CC7B 1LUZA 4A3DH 1DOMA 2PW5A 1I4XA 4JI5L 4PV1C 2ZXRA 4M1KA 3D0FA 1MBYA 1E1OA 3NWSA 4MTKA 4N8FA 3QE2A 3OOCA 4QB4A 1VQ6A 4F87A 2D74A 1JICA 5CV9A 4QUFA 4XQNA 1AH9A 1N32Q 3GVLA 4C3HG 3EVQA 3CP8A 1Q81D 1VQPB 3DMUA 2ZJQA 1HXYD 2GVAA 1CHPD 2M5SA 3CMEB 3I4MB 2X6WA 1SKQA 1ENCA 1KNEA 3D3RA 4IPDA 1ML0D 2RHSB 1I3QH 3A0JA 3GSIA 4A3KG 2HT1A 3FPPA 2AMCB 4GKJL 1CTMA 3OSOA 5C6AA 1C9OA 2HIVA 2F0JA 5LL6X 2VY3A 5C4XH 1EEFD 1IJEA 3PO2G 3VR6A 2NVTH 1GXDC 1QVGA 5M5YB 1F77A 5IGCA 2B2WA 4RCOA 1VQHA 3U9OA 2OT2A 5FO7B 4A3BB 2DIEA 2MUYA 5IYRA 2MO0A 1G291 1WOSA 3SKBA 3RUZA 2CC2A 5DM63 1I50B 1VQDA 1OXVA 2AWNA 4RD1A 1S0UA 3WQZA 3IAYA 4C2MH 2R93B 2L11A 4HIDA 1I6VC 3GIRA 1KIXA 3MTSA 3BZCA 1JB9A 2F43A 3SHLA 4ZGNB 3I2ZA 1XE1A 3SEJA 2CH4W 2Z6BA 4PZ8A 2YU9H 1PHJA 3I70A 2ICIA 1CA6A 5C3EH 2F4IA 3ZYYX 3MXGA 3A3GA 4DF7A 2ZZFA 2AKWB 4F88A 3OZWA 1F9QA 5KGUA 1J5EQ 2QMUA 2E2JH 1XPOA 3RZOH 4QCLA 5HURA 1TKWB 1VQEA 2NUCA 4Y7NH 3Q24A 4OOVA 2JA6H 4RD0A 1QFZA 3BJUA 2HDNB 4R4IA 1W3SA 3HRZC 3A7AB 1G7SA 1EFID 4YAOA 4XL9A 4LF9L 2PQEA 5CV5A 1FL0A 1S5FD 4RD2A 2F1LA 2JQOA 4ZCKA 5M3FH 4O1NA 4HR7B 4XNFA 1BCPB 2HHHL 4F8MA 3VR4A 4X7DA 2VUMH 3VNUA 1KRTA 1TTTA 4U68A 4BBSG 3CCVB 4BBRB 2E2HH 4A3LH 2VNJA 3IRBA 1GJRA 2VNUD 4NMZA 1PFMA 4JI8Q 3C2QA 2KUMA 3KYHC 1Q9SA 1E63A 1FGBD 3MHPA 3RZDH 1R4PB 5IGFA 4KY7A 3EROA 4X7CA 1FNDA 3A3BA 4DU9A 2E74C 4X06A 2EXZA 5BN5A 1K8AD 2GQFA 2GJRA 4HJAA 1JWUD 4OWTB 3I4NB 4R71A 1I6HB 3ASRA 4RFBA 1H9MA 1UE5A 1XXGA 3CAMA 1W87A 1Y14B 2B63B 5F4MA 1JWSD 2ZTNA 4JI3Q 1PRTF 2ZXIA 5TV2A 5IYBH 3S17B 4IOCA 3JAML 2JA8G 3W3AA 4HCEA 2BOSA 3KF6B 3CKIB 1RD9D 1QUEA 2F0QA 4R4OA 5EQ0A 1BQQT 2AUJD 1BVSA 2EY1A 5EKLA 4MYTA 1VQMB 1BQEA 2QA4A 2R7DA 1S4MA 2Q6KA 1MSGA 5JEAG 4EQ5A 5IYCH 4B3GA 3M4OH 1I4QA 4DR2L 2BDNA 1RL2A 1PMRA 3K5NA 5IP7G 1VCIA 1JC7A 4DKAC 4CDCC 2UUAL 1M8AA 4OO1G 4YY3Q 3FKIH 3NUCA 1TLLA 1NCVA 4KV6A 1CUKA 3ERQA 1H9KA 1YJ9B 4O0AA 1DXMA 3OIPA 1OO9B 3PUVA 5BSYA 2V7UA 2F3WA 2NVQB 3M7NA 2K52A 3IKJA 1EFWA 3A1PA 3WNDA 3ZBUA 2RDFA 3F2DA 1GUWA 1WSVA 2WAQB 1HA6A 3GD7A 1IBML 3TEHB 4FXGC 1KDAA 5M9OA 3R6JA 4DAVA 4HAEA 1TU2B 1SYBA 4HIMA 3EJIA 3ZPNA 5EPJA 2L5TA 3QG1A 2D62A 5IYDH 3WNCA 1ILQA 4FXKC 4IURA 4GN5A 1T6XA 3U58A 2HIXA 2E2DC 2E5LQ 4HIOA 5C44H 4HCSA 1YHQB 3HG9A 1VQLA 1UD3A 3LQ6A 4HE5A 3QOLA 5AFWA 1B3QA 3U9SA 5JJIA 4JV5Q 2BF4A 1RQRA 4RJLA 2KOLA 4P26A 5EAYA 4P2NA 2P3MA 5IK2A 1XTDA 1BBXC 1N33Q 3BG3A 1QOHA 1EFCA 2BGIA 1PFBA 3BC9A 5CV6A 3CXCA 4FO2A 5CGKA 1SJED 1OXXK 2F0DA 1PYSB 3AMUA 4II2A 2K28A 2EIFA 4M1UB 4YAWA 3GTJB 3H3VC 3CCJB 3J80c 1VQJA 3A55A 4BY7G 4WJ4A 2HDMA 2QN6A 4B43A 3CD6B 2B8FA 3ASQA 1Z7TA 2HQEA 4XQJA 4IPGA 4NKLA 3TP6A 4B4DA 5HGQA 5A2QE 3T1YQ 3QB3A 5IGGA 1VHOA 4CGYB 4HJ5A 5CBAE 1W6KA 5TRDA 2K04A 1N0VC 3B82A 3OWFA 4UP7A 1C48A 4GKKQ 2ZL7A 1HPCA 1J8IA 5C3EG 3K5OA 4DV7Q 1AP0A 2IPKD 1D2BA 3H3VI 5BN4A 4IUTA 1KDBA 1S5DD 2K50A 4TN1A 4JI3L 4OIKA 5IWAL 1HRJA 3CQZH 4K5WA 2PMDA 1O7ZA 1YLOA 1A3VA 2CKZB 2CNDA 3CCUA 1XWEA 5J3OA 4JPBW 2ZXOA 1BJKA 1LTTD 4P22A 2A1AA 5IT9E 4LF6Q 2RVLA 2DERA 4RDJA 3H15A 2QE7A 3RMHA 3RLNA 4LF4Q 3MFYA 1YHQA 2HDLA 5M3FG 1KAAA 3PSIA 2VW9A 4G57A 4WQMA 3AVVA 1AEXA 2KHJA 4C3HB 4XKWA 1ZM4A 1IYUA 4P2CB 2L1BA 4P72A 3ONUA 1G91A 5EMNA 4LFAQ 3E20A 2MFIA 4A3LG 4IJHA 2YWGA 1IBLQ 1H9JA 2CK3A 3QIAA 1UAPA 2F0MA 3E9HA 1N34L 3EN2A 2PZUA 1HA5A 1G6ZA 2QEXB 4G7HC 1STBA 2QEJC 3CCSA 4A3KB 1XYIA 2A6ED 5H59A 1ENAA 3ZZUA 5KEEA 5A88A 1LTAD 5LMNW 3RY8A 3PO2B 2ID0A 2LFNA 3H3VH 3HOVH 4JC0A 4XQQA 4BPRA 1L0YB 2D5DA 3CPXA 1MJEA 4DR4Q 2EYLA 1CI3M 4MNOA 1SNOA 5IYBG 3PF5A 3S15H 3A5ZB 1D1KA 3PUMA 4RKBA 1HNXL 1U4MA 1BCPF 3MXNB 3T4AC 2Y0SG 4JBJA 1TWHH 3PUYA 4ZKBB 3G6EA 3CCRB 5C4JH 3MEFA 2HMAA 4OIJA 2VNIA 2B2UA 1X3FA 1GAWA 1N36L 1PJ7A 3CCMB 4NDXA 1ZYRD 1VQOA 3GVKA 2NVXB 3BZDB 1MHWC 3GP7A 1VQ8B 1QWYA 3KEWA 1EIFA 1VJSA 3OJWA 4WZTA 1B44D 3DUZA 1KLUD 5EKIA 4QUZA 1N33L 4A93G 2KEEA 3I56B 1IYVA 1X65A 3PIOA 2IX0A 4AYBG 4IUVA 3I72A 1BXTA 3EFXD 1UD5A 1EFUA 2XWJB 2AQ2B 4RGOS 1PTOD 2AWOA 4PGOA 1E2WA 1VQFA 2B2UC 4A3CH 3S16H 2KCMA 5LMUQ 3T53B 1KLGD 1QG7A 3VYSA 4ASUA 3ZC3A 4H44C 4MIUA 5EPLA 4X64Q 1PH3A 4L8JA 4OX9Q 4G1VA 2K5DA 4Z4RA 1UEAB 2JA7H 3BVZA 1GAQA 2OYNA 3I73A 3ASPA 3AFQA 4BBSB 4A3BG 2GREA 2IWHA 2V7QA 4ZGQB 1HUMA 5BR8Q 4DV7L 2V7WA 1W34A 5IYDG 4NXML 1TWGB 3DEPA 1QH0A 2ZT9C 3FRPB 4FF3A 1VQ5B 4RLZA 3AVUA 2Z6KA 1I94L 2CCZA 5C44G 1S3OA 1YNJD 2FFKB 1IHZA 3VYRA 5ISRA 4IUUA 1PZJD 2Q6LA 1G8ZD 4LF6L 2F4VQ 2R3ZA 5IYPA 4LBYA 3MHBA 5AN9A 2JE6I 4FF1A 2MO1A 5C4ZA 4QF4A 1A8PA 1P8LA 1QE6A 3URYA 3K57A 3AU7A 1NDHA 4Q7JB 3VO1A 3KDFA 4C43A 5M5WB 3QFRA 4A3FH 1S40A 2JYOA 2JA8B 1KK0A 2MP1A 3UI2A 3G4SB 2K5NA 3CCQA 3CB4A 1VQKB 2MNAA 1O7YA 4LFAL 4RCZA 4GS3A 2XZPA 1MABA 3FP9A 2HUGA 2WINB 3K5LA 2XOKA 1VHEA 4XKVA 3C2PA 2Z6KC 2E1RA 3SJZA 3QR8A 3AQQA 1YITB 1JE5A 3CP0A 3BZKA 4FP5D 4UP8A 4X62Q 1QGYA 4A3MH 1GO3E 1BPLA 1NNXA 3RN5A 4DUZL 2N88A 1SRUA 1D8TA 2K7VA 4DGZA 1IBKL 3TZUA 1JB3A 3EBEA 1HNZL 2NZOA 4FN5A 1W35A 2M2LA 2PPBC 2W6IA 2A73B 1LTLA 2UXBQ 4Z4SA 2ZZEA 2DY1A 1ELOA 2UUCQ 4A3DB 1SSOA 1NB0A 4JI7Q 1LTGD 3H09A 4PMWA 4B08A 1YIJA 4QV2A 1HR0Q 5EBDA 4AC9A 2JA9A 2MPMA 2ICEC 1VQ5A 4YWKA 4V190 5I9OA 5I2XA 1TWAB 4XLFA 3W2FA 2A6EC 3CC2B 2F0FA 1B9MA 2OWOA 3Q6QA 4L5TA 3KFUA 1K8MA 1C7YA 1Y8PB 3S1MH 4LFBL 3NQIA 4K6DA 4R4QA 1GOZA 1V1OA 1VS0A 1WYDA 5GAGC 4JI5Q 2PZTA 4HIKA 1KRHA 4PMBA 4BY1H 1B50A 1HJPA 4JG2A 3HOZH 1K28D 2OTLA 2LSSA 3GTGB 4J1MA 1I3QB 2A68C 1TS3A 1R5OA 4DAYB 3G05A 4P1VA 2XWBB 2LZJA 2BDOA 4UDUC 4DR6L 1XNQL 2XGJA 3NWTA 1CM9A 3KUPA 1WTPA 2NVTB 3HOVG 4DN4M 3HOXH 1L0XB 1ZYRC 4CBVA 5C0XJ 3OTOL 2Q2UA 1SE3A 4CJ1B 3GTLH 1SAPA 1WORA 1LTSD 1YHBA 3FEWX 3HOUH 3M3YB 3P26A 4R4TA 4DAMA 2RF4A 2V7VA 3AVXA 4PC1A 3JQRA 5FO9B 4BY7B 2QTLA 4LUZA 4GKJQ 1SE8A 4IPHA 1W0JA 1ONLA 3DXJC 4LNQA 4ZCLA 3CMAB 1H9SA 4ALPA 3UDGA 4MN3A 1L1OB 3J80i 1PTOC 2KCNA 1PRTB 1KABA 2XN9C 2YU9B 3BNWA 3CCLA 1I18A 1STGA 5C3EB 3V76A 2X3UA 1UEBA 4P12A 3GO5A 1W9XA 2X0KA 1UWVA 2JIZA 4PC2A 5A89A 4RDKA 3J7YW 1FRNA 3W2HA 3IFDA 4YCUA 1Q3LA 1W2BA 4Z1MA 2B2VA 3RZOB 1QUFA 1FGUA 2LKVA 3PO3H 4Y7NB 3NBHB 1SXTA 4DNIA 1AZQA 1NMFA 4EGVA 1SFOH 4QL5A 3VA7A 1EZ8A 2A74C 4A3CG 2ZXPA 1EZ6A 1WOPA 3BVMA 2CWPA 1YNJC 2Z6BD 3SDZA 1D8LA 2Z4HA 5M3FB 3OP1A 4YALA 4TMTA 1EU4A 2K6AA 4TVAB 5T1GA 2V7TA 4LAAA 2PNHA 4C3IH 2DY7A 2BH2A 3S14H 4DR3L 2E2HB 3ZUGA 4I65A 2A8VA 1N08A 5FNZA 2GK6A 1AE2A 2QF7A 3BDOA 1XPUA 4OO1I 2I1LA 4PC3A 2K32A 3AGQA 3KOJA 4KKTA 1EIYB 2VZLA 2B2VC 3O13A 3HFZB 4XT1B 3GVJA 4LF9Q 4JI0Q 1JNYA 3K0XA 3A35A 3RZDB 4Y9RA 1TVCA 1OXSC 3QO2A 4IPCA 4RD3A 5HY6A 3V2TA 2X69A 1VQNA 1EY0A 3NXWA 2OBSA 2JA5H 4MHEA 3JAME 1IHMA 2PCFB 1G7TA 5CV8A 4BWGB 4IFDI 2HHHQ 4GLVB 5LHY1 4LFCL 3R3OA 2B7CA 4XQFA 3QOJA 4A3FG 3S1QB 4DV5L 1TR5A 4QFMA 1HCZA 1KK2A 2WKCA 4KD3A 2VJIA 3B6YA 3PA1A 2Y0SB 1II3A 1PTOH 2YV5A 3NQTA 1C0AA 4XXEA 3SK8A 1QJOA 2R61A 1K28A 4RCNA 1R4QB 5FO1A 4A76A 4G1BA 4XN3A 4B3ML 2BN4A 3LWUA 3C1FA 1U4PA 1D6EC 3M4OB 1WI5A 4JCVE 5LMNL 3CP2A 4AVZA 5C0XH 3HEJA 4OWWB 5KRUA 3HKSA 1U4LA 4J8QA 4DR7L 4A93B 4RDLA 1MGSA 4NXNL 3H6MA 1YJNB 1XJVA 3BVGA 4P73A 4UZUA 2FX3A 1ZM3A 3KLSX 4AYBB 5M5XH 3HOYH 1K0SA 1JMCA 4KHPL 4DAPA 1CQXA 1F2YA 4B47A 1YI2B 4B3SL 4RPBA 4RWSC 3R8BA 2EYOA 1IL8A 1SE4A 2VS1A 4OL7A 1UD8A 1I4HA 3I8ZA 4DR2Q 2J4XA 1KQSA 1SR3A 3QSYA 3MFGA 3TREA 5LMZA 2UUAQ 4QJFA 3NK9A 3MXPA 2PLFA 3JC66 3WWVA 1R9TH 1QVFA 1FD7D 1YX2A 3CPWB 1X3GA 5D14A 1SNQA 1J9OA 3L2PA 1QUQB 1BCPD 4A4IA 4DR5L 4P75A 4TMXA 3C3LA 1DD2A 1NR2A 2Z1CA 1L2FA 3H9NA 4NW2A 1PZKD 1BLIA 1KAWA 1ASZA 5C44B 4P9SA 2IJ0A 5E7NA 3I4OA 1IBMQ 5IGBA 3CC7A 1H95A 1QX4A 5FLMH 1Q12A 2EY5A 3VYTA 4B3TL 3HOXG 1CSPA 2E2IB 2LS01 5I6YA 4GQNA 4PC7A 3HP3A 2KENA 1K8GA 2B2WC 2CWAA 3SXHA 4LF8L 2AQ3B 1PH6A 2ENBA 4RCYA 3HOUG 4QIWE 3G48A 3SEBA 1DARA 1XPRA 5L46A 1TWFH 1JCKB 2SNSA 1VQPA 5I4DA 5HXBA 1YJNA 5GV8A 1D5XC 1QNUA 2I5HA 4ULLA 2HQLA 3T13A 3W1BA 1JJ2B 1YBYA 2XIWA 2VXWA 4ZQ3A 3W2DA 3CMEA 4JI0L 4HMJA 1OB0A 1AIPA 1UD6A 4PAAA 2YTVA 2TSSA 4A3IH 3AVYA 4LK1C 2G5DA 2JEBI 1DZ1A 1F20A 3PGZA 3NELA 1F60A 2P5ZX 3ASTA 4XORA 1I5FA 2IY5B 1QNKA 1DOKA 1SMXA 1PH8A 1ESRA 4EQNA 2RA4A 3K7AH 3K5MA 3PO3G 2BA0A 1TY2A 3W2IA 3UDFA 2PI2A 1NRKA 2XEXA 3BY1A 4C0SA 1O80A 1OTCA 4II3A 4FVMA 3UDIA 3V7AA 2EYFA 1HFGA 5J3BA 2A6HD 3U2QA 3NPPA 1EP2B 2IHEA 1X55A 2X53S 2BCOA 4OHJA 5GQOA 1V1PB 4DV1L 3CESA 1VQCA 3TS0A 1HZ9A 3ICEA 2NN6I 4C3IG 5IWAQ 4DK0A 1SDFA 4X66L 1GKHA 2FJ2A 5GAEC 5F4OA 1E3ZA 2I5MX 4ODGA 3W5HA 3OMCA 3BQJA 4HTHA 1K3RA 3OEEA 3VYUA 4JYAL 1PH1A 3ONAB 2G9HD 4KHZA 4QMGA 1PDQA 1Q1EA 2C78A 4ACBA 1E22A 3D4WA 2ZTDA 4R4CA 3CC4B 2ALYB 2QGQA 2RHQB 3HOVB 4TQUS 4FF4A 2HCJB 1JJ2A 1QILA 4IO9A 2CVRA 1XX8A 5CV4A 4Y7CA 1RKNA 3NTIA 1F2MA 2V31A 2Q2HA 1N8RD 1N34Q 4BXXH 5H5JA 3CRZA 3JQQA 3J80E 2JJQA 3I55B 4KI0A 4A3DG 2NTTA 4YIJA 4CKBA 1NJIC 4UAJA 2B29A 4OXPA 1RHPA 1TT2A 3CCVA 1EY6A 2K01A 4OPSA 2DETA 3FJOA 4DK3C 4K14A 3SVMA 5FIUA 1EY4A 1Y0YA 1HVXA 2RC5A 3AVTA 2FMMA 5C0XG 2WR8A 1WCMH 3S2DB 5JAVA 1EYCA 1HNXQ 3ER0A 1XB2A 3WBJA 4O42A 1TWCB 4B48A 4YELA 2F0NA 3HOYG 3OIQA 1LYLA 2XZLA 1BX0A 1M4VA 4PZ6A 4H9GA 1N36Q 2RSNA 1BCPC 4BS9A 1K83B 1Q46A 1S5CD 1U5KA 3KF6A 2ZL5A 3STBD 4WWVA 2QILA 4HN7A 2BM1A 1WTHD 1KHIA 4X3SA 1Q86D 2HLDA 3S1RB 2BMWA 1IXRA 2F0IA 3J81c 2WACA 4YHHL 5C4XG 2NTSA 4A3EH 1CZWA 2RDGA 2AUKA 4IN3A 1VQMA 3DWAA 3LX0A 3DHQA 1E24A 3B8HA 2E76C 4ZAIA 4EH1A 2BV3A 2F0PA 2H1EA 4ZCIA 1JWMD 2R93H 1MIUA 3PUXA 1H8HA 2ZBUA 2WZNA 2BPOA 5FK9C 4FXDA 3OW2B 4KJOA 4ID6A 1VLOA 3OWEB 1CSQA 4OPVA 1KC8D 1A15A 3FKSA 2O2LD 2WKDA 2XVSA 3A8JE 1F2LA 1SROA 3TBIB 4TMVA 1VQ7B 3S1NB 1YJ9A 4DV3L 5FLMG 1VF5C 4TT3A 5B6IA 2E8GA 4JI1L 2HD3A 4JI4L 1JR0D 2DNCA 2D0OA 3K81C 1WTWA 4A3FB 3GTOB 2PZWA 1A3UA 2SEBD 1MJCA 4G7ZC 1GUTA 4NXMQ 1JA0A 4LWCA 1UNSA 4H7BA 1RQPA 1FNWA 2VB3X 1MD2D 3BH4A 5FKAC 4L5SA 2V1CC 2EY2A 4L5QA 3GTPH 2JJ2A 3MCAA 2KQ3A 1I94Q 4LMQD 4HEDA 4OOSA 1K0RA 2OEOA 2JA6G 4Z4ZA 3NP8A 3HGBA 4NNJA 2UXCL 5FL7A 2VBUA 1IYJB 4UAIA 1Y1VH 5GAHC 4A3IG 3VR2A 4MYUA 1BNZA 2XNCA 4OONA 1NMGA 2A6HC 2DCUA 2F0GA 3CTAA 1HZCA 3Q6SA 4G4KA 3F8TA 3LQEA 1V1QA 2GJKA 1EUJA 1WJJA 4M53A 1SNMA 2VUMG 3LNNA 3ZJYC 1Q8IA 2YWFA 3VR5A 1PYWD 1OGJA 4ZCMA 1GUOA 2C9OA 3R2IA 1EWIA 2KJXA 4K5XA 4CJ2C 2R7FA 1N05A 2RCFA 3AVWA 3M4PA 4IUQA 5CR3A 4RAUC 3W2EA 1Y8NB 5TY0A 4AH6A 4DUZQ 1UMKA 3KJOA 3CCJA 1IBKQ 1G6PA 1HNZQ 3ZZTA 3BY2A 4G7XA 1OB2A 1F9PA 4JW0A 3CD6A 5D3IB 1ILPA 2B63H 1VQ9B 2K05A 4RMFA 3J81L 4NP5A 4QVAA 1UD4A 2F4NA 5DS0A 2PYKA 1B3AA 2CQAA 1Z9FA 2F3VA 3K0YA 5EGTA 2F03A 4L5RC 2A68D 3HKZG 3K58A 1E64A 1GR1A 3SJPA 1G2SA 3QWNA 5GV7A 4Z4WA 1N8RC 4DXFA 2A19A 5BN3A 2F3IA 2CHBD 2VNKA 3J80L 1LO5D 2V4DA 2L15A 2BA1A 3G7LA 1YHAA 3OEHA 1WTHA 4IUPA 5IYCG 5ELEA 3WOFA 3HOXB 4B3RL 1KK1A 1YEZA 2J7ZA 4EQPA 4LFBQ 1H8EA 3CMMA 5NUCA 1E79A 3CRLC 4XLCA 1CQVA 4V0BA 4TMZA 1X54A 2F0EA 1Y0RA 3WBKA 2EY6A 2RKSA 4U673 3GTLB 1QFJA 3SLDA 1CNEA 4DQLA 3FKIG 3HOUB 1KL9A 3DLLA 3BCFA 3PF4A 4Q5VA 1C8CA 4IW3B 1YNND 1JOKA 1EFRA 2XNJA 4ZUJA 3VNVA 1HQRD 1OHHA 4N8X1 1I8DA 4G7WA 4B3FX 1Q1BA 3BS1A 4DR6Q 4BA2I 1XNQQ 1PFSA 5IT9c 1DDIA 3M4QA 5IGDA 1TY0A 2N78A 5DNFA 4TSSA 1B9NA 2GA4B 3OTOQ 3STBC 2QEXA 2R7ZH 3FHWA 2PQAB 5FO8B 5I6WA 1Q86C 3ZIAA 4QHYA 4DR1Q 3ULPA 3LVBA 3X3NA 5J35A 2WP8J 1EU3A 1CKMA 4WZEA 2VL6A 3PO3B 5TR9A 1E3XA 2F0HA 1A2TA 2PW7A 1SFOB 4POFA 1CKNB 2GK7A 1KJZA 1IKMA 4FK8A 5DEHA 2NBFA 3MXNA 3GTQH 2O5JC 1E1RA 4UZFA 1UE6A 1Q8KA 3HS0C 3CCRA 2UUBL 1D5ZC 1WD0A 2EXDA 1KC8C 1ZEQX 3UE0A 1M90C 4A3EG 4C3IB 2E1BA 3D8GA 1IL2A 3U4ZA 4K5VA 3CCMA 3S14B 4GZYC 3BYYB 1FYCA 5ELBA 1CQFA 4CDEC 1VQ8A 2CRVA 1HTPA 4RD6A 2XRQD 3E6ZX 1WTVA 2TMPA 4DUYL 3T1HL 2I07B 3BCDA 4POGA 4R9WA 3TN2A 4A75A 4XM3A 2SNMA 2GJPA 3D26A 4ABNA 2Q6IA 5CDFA 5FLXc 3I56A 4H02A 3Q6RA 1X3PA 1B23P 3B78A 5T1IA 2CBXA 3ASSA 4X8IA 4KD4A 5THXA 2C4TA 2VBSA 4X3UA 4DR3Q 4F7XA 1VDZA 1W0KA 2NVYB 5IGEA 3PUWA 3RD4A 3FPKA 2BVNA 1MI2A 1E0BA 1TS4A 1CNFA 2FINB 3OZUA 2K1BA 5C5LA 3PIP3 3A74A 5FO0A 1PXUA 2EVBA 4DV0L 4O2DA 1VQ4B 1HNWL 3J7A5 3I91A 1XQBA 3CF5A 1LTRD 4K0KL 1OGIA 1KNAA 2KA7A 2NZ1D 2N49A 1B8AA 4GNXB 1XMOL 3T16A 5J22A 2YWHA 2D2CC 3E0JA 1Y1VG 2R6GA 3A56A 3Q22A 4LFCQ 4OELB 3I4LA 2R92H 3S2HH 2C35B 3E9IA 3AGPA 1FDRA 4JMQA 4DV5Q 2O5IC 3G6JB 2RCNA 4FXUA 1AN8A 1O78A 4LUVA 1CT1D 1PRTD 3WOEA 1TIID 5HGTA 1N06A 2NB0A 1AZPA 3HOWH 5M5XB 3HOYB 4RHSA 4JI2Q 3TMEA 1GJXA 3TSSA 1DJRD 1X9NA 4B3MQ 2AQ1B 3P20A 1LACA 3FPUB 3G4SA 1VQKA 3K80C 3L7ZC 3A5UA 4HIZA 5CMDA 5LMNQ 1PKVA 1O7LA 1S5BD 1EYAA 5JEAJ 1PA6A 2BE5C 1ET6A 1XNRL 5C4XB 5EPKA 1H9RA 4DR7Q 3WXMA 1R9TB 4NXNQ 1YITA 2UXDL 3W5VA 3WDNA 3BDCA 4UY8C 3H0GH 2ZBVA 3J81i 4DV6L 2C5BA 4DR1L 4KHPQ 2YTYA 4I7ZC 1WDTA 3RLOA 3A54A 3PQIA 1NSNS 1LT4D 4B3SQ 2DN8A 3ZBTA 4C2MB 4CDFC 1CK1A 4CKCA 3SLNA 1G7RA 1YNNC 1VMPA 2N3SA 4XONA 2QKIC 2WB1G 5M3MH 4IFDJ 5CORA 5FLXL 1EFTA 1QGZA 1PH4A 4KLKA 2IX3A 4GNXA 3UE1A 1B7YB 4HJ9A 3HKZE 4Z4YA 1LT5D 3OPOA 4LBZA 2VZAA 4DR5Q 2K5QA 1BMFA 2PNRC 4DV2Q 4YWMA 3ZZ0A 2OQKA 3CC2A 2M9VA 3A8KA 1H85A 2E2JB 1BR9A 1GHKA 3Q23A 1TWFB 4TKOB 1ZM9A 2JA6B 1X3QA 1FJGL 3NTHA 4U9UA 4XR6A 4IJLA 2W6JA 5JJLA 1EQRA 3KLSA 4K8IA 1UE1A 4LBWA 4A3IB 4B3TQ 1XFOA 1KK3A 3A8IA 3SGIA 5L37A 2R7ZG 4AF7A 4C1NK 1UD2A 4DAYA 4RD4A 1A62A 1A8VA 2R9VA 4P6VF 5JBQA 4ZLTF 4LF8Q 2JA7G 3Q8DA 1R5BA 2PE3A 2ZL6A 4KKSA 4RG1A 4BBSH 2VUMB 1JJGA 1ASYA 3TP5A 4Z4VA 3K7AB 1VQAA 3I1FA 4XOPA 1BKBA 1VQ6B 4RKLA 4X7EA 3NBIA 4NPSA 2GN5A 2ES2A 1Q7YD 2VB2X 4JBWA 4GOPB 3Q39A 1JA1A 1WSRA 3PUZA 2L0CA 1V9PA 1PH2A 1PV4A 1RTNA 1EIGA 2H4OA 3E3XA 5IYWA 2VQEL 1L0WA 1WOOA 2DUDA 1A3TA 1PYBA 1QGAA 4HSVA 4X65L 4OP7A 3ONYA 1EOTA 1PFNA 1X3EA 1AW7A 2LXJA 4YEJA 3CMAA 1V5VA 1L1OA 4J0QA 2CW0C 2F0UA 5JVH3 1VLYA 3MWYW 4LUOA 3HKZB 1DYQA 5COYA 1HZAA 2CFMA 2RSOA 4FNFA 1WTRA 1JB7A 1E7ZA 1IKLA 4KTAA 5IOCA 2KCTA 3G71B 5G3LF 4JI2L 3MZ5A 2B8GA 2PI2E 2XSCA 3D4RA 1ZXTA 3MC0B 5JEAH 3NBHA 2WIIB 4DV1Q 2DYIA 1CKOA 1IJFA 1TUIA 4Z4UA 4C3JH 4A3MG 1ZM2A 5IP7H 2Q6OA 1E1TA 3I7FA 3C46A 1WTXA 2L4NA 1HQMC 3JU4A 2C77A 4OO1H 4P71A 4X66Q 1D5MC 1STNA 3FKIB 2MJ8A 4LF7Q 4RHRA 1L1OC 1NJID 3OFNA 1PRTC 3GTMH 1UE7A 3HZXA 4JYAQ 3NENA 2B39A 2VNHA 2VBTA 1BBWA 1EXMA 1SEBD 4CDDC 3CCEB 2WPDA 5IP9H 1EY5A 2F0TA 4IFDH 1GVHA 1NY4A 2YYZA 5GADC 2KVOA 1RIPA 2F52A 4KMUC 1TWAH 3SK4A 3MA2B 4GOPA 2R92G 4YWLA 3Q38A 4KKUA 1Y1WH 1WCMB 1DOLA 2FMCA 2XTIA 4R1JA 1Y69U 1E43A 1QZHA 3PUNA 1J6QA 1V0FA 4E6IA 2ZTCA 3HOWG 1G51A 1J9ZA 2I5LX 4BY1G 1S72B 4TRDA 3GTGH 3HOZG 2OBRA 4DV2L 4JI6L 5JJKA 1OXUA 1XMQL 1EP1B 3NEMA 4DV4L 1PTOF 2F0OA 2F0WA 4K2LA 4LJZC 2EYMA 1NUCA 2WV6D 4H13C 4K2KA 3S24A 5IYNA 1KZLA 1QFYA 3U6KA 1JE4A 3G71A 2MHVA 3JAMc 1PVOA 2PO4A 2GPJA 2K33A 4GOPC 4RGNA 4A3EB 2VBVA 1UUPA 2BH8A 3KBGA 3TDQA 4PZ7A 2MQHA 2BM0A 2Q8IB 3H0GG 5KNDA 1Q82D 1ICFB 2K4KA 1EY9A 2EFGA 3EIVA 3M3YH 5F2DA 1VF7A 4K6LA 2JP1A 3AYHB 4A3GH 1EL0A 4BY7H 5EJWA 1T5EA 4M0LA 2EIXA 1E62A 1PJ5A 4LBVA 3Q3AA 1EQVA 1PZID 2EYPA 5IY0A 3GTKH 5M3MG 2Q8RE 3U4VA 2Q2TA 1SNCA 2O4XA 2C5HA 4YHHQ 1B2RA 4P3YA 2J7KA 3VO2A 1AMOA 2BGJA 1YI2A 3I3CA 3CCEA 1PH5A 3K8AA 4L6TB 3KLWA 3QJYA 1JJCB 1STEA 4X05A 2UU9L 3BU2A 1WFQA 1NBWA 2GVBA 2WB1E 3F2CA 1GD7A 3KBXA 4E0FA 1SLJA 3GTPB 2IL8A 3M4YA 1DCZA 3CQZB 3R93A 2QA4B 1DONA 3I90A 2D9RA 1NR4A 3CPWA 1KTVA 2R6HA 1JORA 4OOXA 1S4ZA 1G2TA 1COWA 1QUQA 3GDEA 4DV3Q 1S72A 1Q7YC 1Y1VB 4JI1Q 2VQFL 4JI4Q 3FVQA 1FR3A 4LF5L 1GUGA 4A3JH 4XYOA 3WY9A 4XLAA 1SMYD 1SJHD 2FVGA 4FDBA 4XDXA 5DM73 3DDYA 5IIFA 2ZZQA 4ZK9B 1RCVD 3U50C 3PENA 1RF2D 4XLHA 1VMCA 2FHTA 1TQOA 4Q0FA 1OXTA 5DSZA 3J81j 2QDXA 3QFSA 2WAQE 3DM1A 4XIGS 5AJ3L 1GUSA 4YAFA 2NPFA 4DXGA 3CW2A 3GV6A 4MTNA 3RLFA 4LF7L 2UXCQ 5I9PA 1WPCA 1IW7C 1WTQA 3AFPA 1TS2A 1F2ZA 5IODA 4N3GA 1B53A 4QIWB 4J15A 3J81E 5ELCA 4M8AA 1QVCA 1MSHA 4LW1A 4WJWA 5CYUA 2JA5G 1NTGA 2OF1A 5F4JA 4BA1I 4G6IA 1K9MD 5EKKA 2XNDA 2EDGA 3C1EA 3N6RA 4KY6A 4DFAA 3S1QH 4DK1A 1HZBA 4K8JA 4XD7A 3JQPA 3W1GA 1N32L 4Z4TA 4DNRB 3S15B 5DAUA 3F2BA 1VQLB 2Z8LA 2V7XA 4WZLA 4N9PA 5JJZA 1B2TA 4X0CA 2A69D 3J7ZC 1TWHB 2F0KA 5C4JB 3U6BA 4UZEA 3EQLC 4YHBA 3CW2C 4X7FA 2WB1B 5KW9A 1K73D 2JXMB 2C4UA 2ZTEA 3V05A 3CXCB 2NN6H 4F7DA 4C3JG 4YXWA 1T6YA 3D6CA 1MRZA 2X6GA 1X6OA 3QFCA 1E1QA 5JOBA 2KVMA 3K6OA 4P3IA 1EQQA 4A93H 4XYQA 1I4PA 1V1PA 4CHTB 3LGJA 4RH6A 4WFN3 1X56A 1I4GA 1K3BC 2MGSA 4EQOA 1Q81C 1FRQA 2ZZGA 2XRSD 4DA2A 3I4MH 1GHJA 4HMIA 2OTJB 1DM0B 2DJGC 4OPOA 5E3FA 5IP9G 1X32A 1FNVA 1G7CA 4IFDG 1D1IA 3MEHA 4ZRZA 3S16B 4B3RQ 3W2GA 2Q8TA 4KY5A 2R7ZB 2IHFA 3OMGA 1Y1WG 4KHVA 4HSPA 5M5YH 2ZM6Q 2JA7B 3LO8A 1R5NA 3CCUB 5CC4A 1B4OA 1PH7A 2NZHA 4A3BH 3EA6A 1QG0A 3CC4A 3OHXC 4XT3B 1WVLA 1CFMA 1H42A 2KECA 1I50H 1BUVT 1LV9A 1B1ZA 2D0PA 1J5EL 1Q82C 3W5OA 1BX1A 1O7IA 3DWPA 3GTQB 4ZUIA 2KEDA 2JN4A 3KJPA 1WTOA 1EEID 3NHHA 5ELFA 3I55A 2A5HA 1SYGA 1M90D 2F0LA 4Y52H 1HH2P 1NAPA 4P74A 2OXPA 4JBKA 4ACAA 3P7JA 2Q2IA 3DEOA 4DQKA 2E2IH 5J1ZA 4IUNA 5KYLA 1HUNA 4DPGA 1HZEA 5HZBA 1FVIA 3CCSB 2KCCA 4GLXA 4B44A 4R8IA 3OKXA 2N55A 1EIHA 4A3GG 2LXKA 1EWCA 2WZPP 4RGTA 3P75A 4PNYA 3IFTA 1YJWB 5H1SE 2K03A 1Z6HA 3VMFA 2ZJRA 4JI8L 5K36H 1F9SA 5D3DA 2UUBQ 3PV0A 4OEMB 1XTCD 3DM3A 2OTJA 1D2EA 1E3PA 4A3MB 1HTLD 2WJYA 1LLRD 1YVCA 1YZ6A 2AHOB 2H5XA 4CKEA 4LC0A 1EQTA 2CQOA 3G6EB 1SMYC 2K5HA 4DUYQ 5A35A 4XN0A 1ET9A 4BBRH 3T1HQ 1KDCA 5JPMC 1SYEA 1D1NA 3HAGA 1HA3A 1VQOB 1BOSA 4YCWA 1SNDA 2EZVA 4QUCA 2QDLA 4UP9A 3SR1A 1M1KD 2EQSA 1HR0W 5DN6A 5HZAA 4YAUA 1EOVA 2QDBA 4UPAA 2JN9A 1Y8OB 2EPBA 2R92B 3S2HB 1I7PA 2F0SA 1QB5D 4DNTB 1HHVA 4EVOA 2B5OA 4A3JG 3OW2A 4RGMA 3E1YE 3R2TA 1A0IA 2DJFC 3ULJA 1K8AC 3I4NH 1I6HH 3L9AX 3GV3A 3MMPA 3Q0AA 4TMWA 1VQ7A 1K9MC 2CF4A 3S1MB 3KL9A 3S17H 4DV0Q 3HOWB 3N52A 1HNWQ 4YY3L 1A2UA 1SBBB 4ME3A 1SYCA 3TZDA 2C2WA 1NE3A 4BY1B 2EOTA 3AEVA 5C5MA 4NBSA 3HOZB 4K0KQ 1CA5A 5A8AA 5G3LD 2K14A 1XMOQ 2SOBA 3VDYA 2A69C 1ZUNB 1KD1D 2EYHA 2BE5D 4N9TA 4PC6A 1HFNA 1YJWA 2OBTA 1FX0A 4CQJA 1N07A 1K73C 1FNUA 2ZITA 1STAA 2IW3A 5BSXA 1FNBA 3S9WA 1EP3B 3H91A 2X85A 1N0UA 3H0GB 4X3KA 2X6YA 1V43A 2RBMA 1DDGA 3D4DA 1GVPA 4PABA 2CH4A 3MVVA 5ELNA 2ZM6L 2RDHA 4DK6C 3NE5B 3JAMi 3E5SA 4BXXG 2AHOA 3PIO3 4MZ9A 1LM0A 3CHBD 5FLXE 1RDPD 4ZV4A 1ESFA 1EYGA 2FXQA 3ES9A 2NVQH 5M3MB 2EE1A 3KDFB 2E5LL 1XNRQ 1N9WA 2OCEA 3J7AF 3F2UA 3OW7A 2NN6G 3NTKA 3J81k 3KLRA 2QTZA 1AFPA 1U0LA 4H0LC 3CCQB 1I4RA 4JV5L 1TS5A 2UXDQ 3S2DH 4GN3B 2IX1A 3R6KA 1ICWA 1WCMG 2M00A 1T6ZA 4DV6Q 2DOGA 1PLFA 1TWCH 2D3LA 2PMZE 3X3MA 4JBMA 1PJ6A 2JJ1A 2EJFC 3D31A 3I4MG 3A8JA 4PQXA 1SM4A 5IE8A 1VQ9A 2ZJPA 3SK6A 3BDLA 4QQBX 2WSSA 1K83H 3DWQA 3CPFA 3K7UC 4XTCS 2L12A 3AB9A 3IL8A 5JVG3 2OK8A 2XNAC 1GUNA 3LWEA 2OK7A 2RQXA 3S1RH 3TRZA 2X6LA 4WJ3M 5KNLA 3T1YL 2KBNA 3SK5A 1F9RA 5KYIA 4X3TA 1D7QA 3KK7A 1C4QA 5J39A 2PIAA 1YIJB 4GKKL 4R8NA 1WD1A 2HCCA 3L3OC 2XZOA 1VQGA 1SE2A 4APVA 2KHSA 1JOQA 4G7OC 4RM0A 5KNBA 2D3NA 1FJGQ 3GTJH 4RPDA 4KN7C 3VA5A 4JVZA 2R93G 5C4HA 2VYQA 2C5CA 2KHIA 5I2YA 3A8KE 1JOOA 3F1ZA 2K75A 3FMCA 4GLAC 5FJ8H 3S1NH 4JOIA 4XMYA 4QY7A 4C1NI 2B2YA 2JA5B 5DLQE 1SYDA 3TS2A 2JK8A 3TP8A 2DNEA 1VQBA 3GTOH 4LF4L 3ISXA 4FF2A 4IQZA 4WORA 1TVXA 2DGYA 2OTLB 2CW0D 4CJ0B 1A6XA 3A8IE 1P4MA 3ERSX 4M2LA 5A2QL 2NV4A 2JSOA 4PG3A 2ZTGA 1EYDA 2CW5A 2PQAA 1PTOB 1IBLL 1KTKA 3PA2A 1LT3D 1BF4A 1DGSA 2PMZB 5K36G 1ENFA 5ELDA 4Y9UA 4HJ8A 1PH9A 2VQEQ 1SYFA 5E1FA 1OB5A 1SKYB 4JOIC 4L63B 4C3JB 4X65Q 2B2YC 2K5WA 1M1KC 1CKNA 2B3GA 2ZXHA 5IT9L 3V96A 1WP6A 3TP7A 4GN4B 2L9HA 4C3HH 4FWTA 4DR4L 2N8NA 1FNMA 2L55A 2EJMA 3RR5A 4BBRG 3GTMB 3PIPA 2LMCB 4IALA 4ME5A 2WYRA 1GM5A 4FYDA 2DEUA 1H9SB 2EYJA 1FNCA 3CRKC 3ND9A 4XOTA 4ZYSA 3CCLB 2NWGA 5KSWB 4A3KH 1NB9A 1K8OA 1E2VA 2Z0SA 2ASBA 4QVJA 5HKKA 1VQIA 1P16A 1KD1C 1Y1WB 4TSFA 1W2BB 1W6JA 3PO2H 3MXUA 2RC6A 3I4NG 4KJNA 1EY7A 4J6HA 2B63G 4AQYQ 4IZ8A 3ULLA 2QW7A 3OYYA 3K59A 4G5GA 2Z9HA 3M7GA 1IB0A 5D65A 4B3XA 3PCOB 1E2ZA 1RODA 4KK7A 5CBEE 3W5UA 4X07A 1U9RA 2HCIA 1IZ6A 2ATWA 3RNUA 3MAQA 3E0EA 3VR3A 1NBMA 2BSAA 1JT8A 4P25A 4AIMA 1TXYA 1VQ4A 1CHQD 2YWEA 1SNPA 2NVXH 2SDFA 5E4WC 4QGUA 5LMUL 4K1XA 5KIXA 1CZGA 1WOCA 4X64L 3WNBA 4YCVA 4OX9L 3OJXA 1WU8A 3WYAA 2B7BA 3OAAA 3T51B 2XGTA 4I7AA 5CV7A 2NYZD 3M9BA 2YTXA 3PVDA 1VQNB 3ND8A 4EX5A 4JI6Q 4A3GB 1XMQQ 3FDTA 2WFWA 5GROA 5BR8L 4DV4Q 3H94A 4JK1C 2F1MA 3GTKB 3UDXA 4IOAA 4M4SA 3D6WA 1QCBD 1V8QA 3KF8B 3SE0A 5FA6A 2Z4IA 4HE6A 2WAQG 4XLEA 5FOBB 1B70B 4C56C 4Z9CB 4HJ7A 4RA8A 2Y0SE 1BO0A 2F4VL 1KMHA 4AF6A 2JEAI 1LTBD 3CU7A 5C3WA 4GNXC 3BYTB 3GQBA 2EJGC 2K5VA 2G9DA 3ITPA 2QCPX 2IT1A 1LT6D 1BDOA 2J0TD 2D9UA 5E6TA 4NCNA 2LY7A 3NSWA 5JPNC 4N3NA 1MKHA 1T9HA 1TWGH 2B2TA 1LTID 5KNCA 5K5PA 4KN4C 1Q90A 1STYA 1STHA 4OGQC 1RJTA 2VJJA 3QFTA 2I46A 4P6YA 1RTOA 4WRDA 1QZGA 1DG1G 4X62L 4PMCA 1JQYD 2E75C 4A3JB 5ELOA 4AYBE 2UU9Q 1T5XD 3OE7A 1LABA 2WJVA 2OQ0A 3J7AV 2I0QA 5M5WH 1EWYA 1EWHA 3A7LA 5C0XI 2JA8H 1KXLA 3RN2A 5E4XA 3TQYA 2UXBL 4S3SA 3T56B 2DY8A 1IW7D 2UUCL 1AE3A 1KQSB 1YNXA 4OWXB 1U2RA 4JI7L 5EBCA 3P27A 2X8KA 2B2TC 5TSSA 4NB3A 2X6XA 1QVGB 2VQFQ 5FJ8G 5LL6S 1QVFB 1HR0L 4LF5Q 4X6AH 3OZVA 3L0OA 4B9WA 4ILWA 2F0VA 2JDIA 1S5ED 4WZKA 4B9XA 5C3XA 2NVYH 1Z47A 3KF8A 3P1HA 1GO2A 1EY8A 4ROXA 5IYQA 1A63A 3PMFA
chains in the Genus database with same CATH topology
1ZKOA 1V0EA 4ZKCB 1U4RA 3M85A 1DOMA 2PW5A 1I4XA 4PV1C 2ZXRA 1MBYA 3NWSA 3OOCA 4QB4A 4F87A 1JICA 5CV9A 4QUFA 4XQNA 3GVLA 4C3HG 3EVQA 3CP8A 3DMUA 1HXYD 1CHPD 2M5SA 3I4MB 2X6WA 1ENCA 1KNEA 3D3RA 1ML0D 3FPPA 1CTMA 3OSOA 5C6AA 2F0JA 5LL6X 1EEFD 3VR6A 1GXDC 5M5YB 1F77A 5IGCA 2B2WA 4RCOA 3U9OA 2OT2A 5FO7B 4A3BB 2DIEA 2MUYA 1G291 3RUZA 5DM63 1I50B 1OXVA 2AWNA 3WQZA 2R93B 3IAYA 2L11A 1I6VC 3MTSA 2F43A 3SHLA 3I70A 2ICIA 1CA6A 2F4IA 3ZYYX 3MXGA 3A3GA 4DF7A 2ZZFA 4F88A 5KGUA 1F9QA 4QCLA 5HURA 1TKWB 2NUCA 3Q24A 3HRZC 3A7AB 1EFID 4XL9A 2PQEA 5CV5A 1S5FD 4O1NA 4HR7B 4XNFA 1BCPB 4F8MA 3VR4A 4U68A 4BBRB 2VNUD 4NMZA 1PFMA 2KUMA 1FGBD 1R4PB 5IGFA 4KY7A 3EROA 3A3BA 4DU9A 2E74C 2EXZA 5BN5A 2GJRA 1JWUD 3I4NB 1I6HB 4RFBA 1H9MA 1XXGA 2B63B 1JWSD 2ZTNA 1PRTF 2ZXIA 3S17B 3JAML 3W3AA 4HCEA 2BOSA 3CKIB 1RD9D 2F0QA 5EQ0A 1BQQT 2AUJD 2EY1A 5EKLA 5JEAG 1MSGA 4B3GA 1I4QA 2BDNA 1PMRA 3K5NA 1VCIA 1JC7A 1M8AA 4OO1G 3NUCA 1NCVA 4KV6A 3ERQA 1H9KA 1DXMA 3OIPA 1OO9B 3PUVA 2F3WA 2NVQB 3M7NA 3IKJA 2RDFA 1GUWA 2WAQB 1HA6A 3GD7A 4FXGC 1KDAA 5M9OA 4DAVA 4HAEA 1TU2B 1SYBA 3EJIA 3ZPNA 5EPJA 2L5TA 3QG1A 2D62A 1ILQA 4IURA 4FXKC 2E2DC 4HCSA 3HG9A 1UD3A 3QOLA 5AFWA 3U9SA 2KOLA 1BBXC 5IK2A 3BG3A 1QOHA 1PFBA 3BC9A 5CV6A 4FO2A 5CGKA 1SJED 1OXXK 2F0DA 3AMUA 4II2A 2K28A 4M1UB 3GTJB 3H3VC 3A55A 2HDMA 2B8FA 1Z7TA 2HQEA 4XQJA 4NKLA 3TP6A 5A2QE 3QB3A 5IGGA 4CGYB 5CBAE 1W6KA 2K04A 3OWFA 1C48A 1HPCA 1J8IA 3K5OA 1AP0A 2IPKD 1D2BA 5BN4A 4IUTA 1KDBA 1S5DD 4OIKA 1HRJA 4K5WA 1O7ZA 1A3VA 1XWEA 2ZXOA 1LTTD 4P22A 5IT9E 2RVLA 2QE7A 3RMHA 3MFYA 2HDLA 1KAAA 4G57A 1AEXA 4C3HB 4XKWA 1IYUA 4P2CB 2L1BA 1G91A 1H9JA 2CK3A 3QIAA 1UAPA 2F0MA 2PZUA 1HA5A 1G6ZA 4G7HC 1STBA 2QEJC 4A3KB 1XYIA 2A6ED 1ENAA 5KEEA 1LTAD 3PO2B 2ID0A 2LFNA 4XQQA 1L0YB 2D5DA 2EYLA 1CI3M 1SNOA 1D1KA 4RKBA 1U4MA 1BCPF 3T4AC 3PUYA 4ZKBB 4OIJA 2B2UA 4NDXA 1ZYRD 3GVKA 2NVXB 3BZDB 3GP7A 1QWYA 3KEWA 1VJSA 1B44D 3DUZA 1KLUD 5EKIA 2KEEA 1IYVA 2IX0A 4IUVA 3I72A 1BXTA 3EFXD 1UD5A 2XWJB 2AQ2B 4RGOS 1PTOD 2AWOA 2B2UC 1E2WA 3T53B 1KLGD 1QG7A 3VYSA 4ASUA 4MIUA 4H44C 5EPLA 4L8JA 2K5DA 1UEAB 3BVZA 3I73A 4BBSB 2IWHA 2V7QA 1HUMA 1TWGB 3DEPA 2ZT9C 3FRPB 4FF3A 1YNJD 2FFKB 1IHZA 3VYRA 5ISRA 4IUUA 1PZJD 1G8ZD 2R3ZA 3MHBA 2JE6I 4FF1A 5C4ZA 4QF4A 1QE6A 3URYA 3K57A 3AU7A 5M5WB 2JYOA 2JA8B 2MP1A 3UI2A 1O7YA 2XZPA 1MABA 2HUGA 2WINB 3K5LA 2XOKA 4XKVA 3C2PA 4FP5D 1BPLA 2N88A 2K7VA 4DGZA 3TZUA 1JB3A 2M2LA 2PPBC 2W6IA 2A73B 2ZZEA 4A3DB 1SSOA 1LTGD 3H09A 4PMWA 4B08A 5EBDA 2MPMA 2ICEC 4V190 5I9OA 5I2XA 1TWAB 4XLFA 2A6EC 2F0FA 1B9MA 1K8MA 1Y8PB 3NQIA 4K6DA 1GOZA 1V1OA 2PZTA 4PMBA 1B50A 1K28D 3GTGB 4J1MA 1I3QB 2A68C 1TS3A 3G05A 2XWBB 2LZJA 2BDOA 4UDUC 2XGJA 3NWTA 1CM9A 3KUPA 1WTPA 2NVTB 4DN4M 1L0XB 1ZYRC 4CBVA 5C0XJ 1SE3A 4CJ1B 1SAPA 1LTSD 3FEWX 3M3YB 5FO9B 4BY7B 1W0JA 1ONLA 3DXJC 1H9SA 4MN3A 1PTOC 2KCNA 1PRTB 1KABA 2XN9C 2YU9B 1I18A 1STGA 5C3EB 3GO5A 1W9XA 2JIZA 3J7YW 3IFDA 1Q3LA 3RZOB 4Z1MA 2B2VA 2LKVA 4Y7NB 1SXTA 1AZQA 4EGVA 3VA7A 1EZ8A 2A74C 2ZXPA 1EZ6A 3BVMA 1YNJC 2Z6BD 3SDZA 2Z4HA 5M3FB 1EU4A 2K6AA 5T1GA 4LAAA 2DY7A 2E2HB 4I65A 2GK6A 2QF7A 3BDOA 4OO1I 2K32A 4KKTA 2B2VC 3O13A 4XT1B 3GVJA 3A35A 3RZDB 1OXSC 3QO2A 3V2TA 2X69A 1EY0A 3NXWA 4MHEA 3JAME 2PCFB 5CV8A 4BWGB 4IFDI 5LHY1 3R3OA 4XQFA 3QOJA 3S1QB 1TR5A 1HCZA 2WKCA 4KD3A 2VJIA 2Y0SB 1II3A 1PTOH 3NQTA 4XXEA 3SK8A 1QJOA 2R61A 4RCNA 1R4QB 4XN3A 3LWUA 3C1FA 1U4PA 1D6EC 3M4OB 3CP2A 4AVZA 5C0XH 3HEJA 5KRUA 4J8QA 1U4LA 4A93B 1MGSA 3H6MA 3BVGA 4UZUA 3KLSX 4AYBB 4DAPA 1F2YA 4RWSC 3R8BA 2EYOA 1IL8A 1SE4A 4OL7A 1UD8A 1I4HA 3I8ZA 2J4XA 3MFGA 3NK9A 3MXPA 1FD7D 5D14A 1SNQA 1J9OA 1BCPD 1DD2A 3C3LA 1NR2A 2Z1CA 4NW2A 1PZKD 1BLIA 5C44B 2IJ0A 5IGBA 1Q12A 2EY5A 3VYTA 2E2IB 2LS01 5I6YA 4GQNA 3HP3A 2B2WC 3SXHA 2AQ3B 2ENBA 3SEBA 1JCKB 2SNSA 5I4DA 1QNUA 1D5XC 4ULLA 3T13A 2XIWA 4ZQ3A 3W2DA 2VXWA 4HMJA 1OB0A 1UD6A 2TSSA 4LK1C 2JEBI 1DZ1A 4XORA 1QNKA 1DOKA 1ESRA 4EQNA 2RA4A 3K5MA 2BA0A 1TY2A 1NRKA 1O80A 4II3A 4FVMA 2EYFA 1HFGA 2A6HD 3NPPA 2X53S 2BCOA 4OHJA 1V1PB 3CESA 2NN6I 4C3IG 4DK0A 1SDFA 2FJ2A 1E3ZA 4ODGA 3OMCA 4HTHA 3OEEA 3VYUA 3ONAB 2G9HD 4KHZA 4QMGA 1PDQA 1Q1EA 3D4WA 3HOVB 4TQUS 4FF4A 1QILA 2CVRA 1XX8A 5CV4A 1RKNA 3NTIA 1F2MA 2V31A 3J80E 4KI0A 2NTTA 4YIJA 4CKBA 1RHPA 1TT2A 1EY6A 2K01A 4K14A 3SVMA 1EY4A 1HVXA 2FMMA 5C0XG 3S2DB 5JAVA 1EYCA 4O42A 1TWCB 2F0NA 4YELA 3OIQA 2XZLA 1M4VA 2RSNA 1BCPC 4BS9A 1K83B 1S5CD 2QILA 4HN7A 1WTHD 4X3SA 2HLDA 3S1RB 2F0IA 2WACA 2NTSA 1CZWA 2RDGA 2AUKA 4IN3A 3DWAA 3LX0A 3DHQA 2E76C 4ZAIA 2F0PA 2H1EA 1JWMD 3PUXA 1H8HA 5FK9C 4FXDA 4KJOA 4ID6A 3OWEB 3A8JE 3FKSA 1A15A 2O2LD 2WKDA 2XVSA 1F2LA 3TBIB 3S1NB 1VF5C 4TT3A 1JR0D 2DNCA 1WTWA 3GTOB 4A3FB 2PZWA 1A3UA 2SEBD 4G7ZC 1GUTA 1UNSA 4H7BA 1FNWA 2VB3X 1MD2D 3BH4A 5FKAC 2EY2A 2JJ2A 2KQ3A 4LMQD 4HEDA 2OEOA 3NP8A 3HGBA 4NNJA 5FL7A 4UAIA 1BNZA 3VR2A 2A6HC 2F0GA 3Q6SA 4G4KA 2GJKA 1SNMA 3LNNA 1Q8IA 3VR5A 1PYWD 1GUOA 2C9OA 3R2IA 4K5XA 2KJXA 4CJ2C 4IUQA 5CR3A 4RAUC 1Y8NB 4G7XA 1F9PA 5D3IB 1ILPA 2K05A 3J81L 4NP5A 1UD4A 2PYKA 1B3AA 2CQAA 2F3VA 3K0YA 5EGTA 2F03A 2A68D 3K58A 3QWNA 1G2SA 4DXFA 5BN3A 2CHBD 3J80L 1LO5D 2V4DA 3G7LA 2BA1A 3OEHA 4IUPA 3HOXB 5ELEA 3WOFA 2J7ZA 4EQPA 1H8EA 3CMMA 5NUCA 1E79A 3CRLC 4XLCA 1CQVA 4V0BA 2F0EA 3GTLB 2EY6A 2RKSA 4U673 3HOUB 3BCFA 4Q5VA 1C8CA 1YNND 1JOKA 1EFRA 4ZUJA 1HQRD 1OHHA 1I8DA 4G7WA 4B3FX 1Q1BA 3BS1A 4BA2I 5IGDA 1TY0A 5DNFA 4TSSA 1B9NA 2GA4B 5FO8B 5I6WA 3ZIAA 3X3NA 2WP8J 1EU3A 3PO3B 2F0HA 1E3XA 1A2TA 2PW7A 1SFOB 2GK7A 1IKMA 5DEHA 2NBFA 3MXNA 2O5JC 1E1RA 3HS0C 1D5ZC 1WD0A 1ZEQX 4C3IB 2E1BA 3D8GA 4K5VA 3S14B 4GZYC 3BYYB 1FYCA 5ELBA 1CQFA 1HTPA 2XRQD 3E6ZX 1WTVA 2TMPA 2I07B 3BCDA 4R9WA 3TN2A 4XM3A 2SNMA 2GJPA 4ABNA 5CDFA 1X3PA 5T1IA 4KD4A 4X3UA 4F7XA 1VDZA 1W0KA 2NVYB 5IGEA 3PUWA 3RD4A 1MI2A 1E0BA 1TS4A 2FINB 5C5LA 2K1BA 3PIP3 1PXUA 2EVBA 3I91A 1LTRD 1KNAA 2KA7A 2NZ1D 3T16A 5J22A 2D2CC 3E0JA 2R6GA 3A56A 3Q22A 3I4LA 4JMQA 2O5IC 3G6JB 4FXUA 1AN8A 1O78A 1CT1D 1PRTD 3WOEA 1TIID 5HGTA 2NB0A 1AZPA 5M5XB 3HOYB 4RHSA 3TMEA 1GJXA 3TSSA 1DJRD 2AQ1B 3P20A 1LACA 3FPUB 3L7ZC 4HIZA 5CMDA 1PKVA 1O7LA 1S5BD 1EYAA 5JEAJ 2BE5C 1ET6A 5C4XB 5EPKA 1H9RA 1R9TB 3WDNA 3BDCA 4I7ZC 3A54A 1NSNS 1LT4D 2DN8A 4C2MB 1CK1A 4CKCA 1YNNC 1VMPA 4XONA 2QKIC 4IFDJ 5CORA 5FLXL 2IX3A 1LT5D 3OPOA 2K5QA 1BMFA 2PNRC 2E2JB 2M9VA 1BR9A 1GHKA 3Q23A 1TWFB 4TKOB 2JA6B 1X3QA 3NTHA 4XR6A 2W6JA 3KLSA 4K8IA 4A3IB 4C1NK 1UD2A 4DAYA 2R9VA 4ZLTF 4KKSA 2VUMB 3TP5A 3K7AB 4XOPA 4RKLA 3NBIA 2VB2X 4JBWA 3PUZA 2L0CA 1RTNA 1EIGA 2H4OA 1A3TA 4HSVA 1EOTA 1PFNA 1AW7A 4YEJA 2CW0C 2F0UA 5JVH3 1VLYA 3MWYW 3HKZB 1DYQA 5COYA 4FNFA 2RSOA 1WTRA 1IKLA 4KTAA 5IOCA 5G3LF 3MZ5A 2B8GA 2XSCA 3D4RA 1ZXTA 3MC0B 5JEAH 3NBHA 2WIIB 3C46A 1WTXA 2L4NA 1HQMC 3JU4A 4OO1H 1D5MC 1STNA 3FKIB 2MJ8A 4RHRA 3OFNA 1PRTC 3HZXA 2B39A 1SEBD 2WPDA 1EY5A 2F0TA 4IFDH 2YYZA 2KVOA 4KMUC 3SK4A 3MA2B 4KKUA 1WCMB 1DOLA 2FMCA 1Y69U 1E43A 1V0FA 4E6IA 4TRDA 1OXUA 1PTOF 2F0OA 2F0WA 4K2LA 4LJZC 2EYMA 1NUCA 2WV6D 4H13C 4K2KA 1KZLA 1JE4A 2MHVA 2PO4A 2K33A 4RGNA 4A3EB 1UUPA 3KBGA 3TDQA 2Q8IB 5KNDA 1EY9A 5F2DA 1VF7A 4K6LA 2JP1A 1EL0A 5EJWA 1T5EA 1PZID 1EQVA 2EYPA 2Q8RE 1SNCA 2O4XA 3I3CA 4L6TB 3QJYA 1STEA 3KBXA 3GTPB 4E0FA 2IL8A 3M4YA 1DCZA 3CQZB 3R93A 1DONA 3I90A 1NR4A 1JORA 1S4ZA 1G2TA 1COWA 1Y1VB 3FVQA 1FR3A 1GUGA 4XYOA 4XLAA 1SMYD 1SJHD 4XDXA 5DM73 3DDYA 5IIFA 2ZZQA 4ZK9B 1RCVD 1RF2D 4XLHA 1VMCA 2FHTA 1TQOA 4Q0FA 1OXTA 3DM1A 4XIGS 1GUSA 4DXGA 3GV6A 3RLFA 5I9PA 1WPCA 1IW7C 1WTQA 1TS2A 1F2ZA 5IODA 1B53A 4QIWB 3J81E 5ELCA 4M8AA 1MSHA 4WJWA 5CYUA 2OF1A 4BA1I 5EKKA 4G6IA 2XNDA 2EDGA 3N6RA 3C1EA 4KY6A 4DFAA 4DK1A 4K8JA 4XD7A 4DNRB 3S15B 5DAUA 4N9PA 2Z8LA 5JJZA 1B2TA 2A69D 1TWHB 2F0KA 5C4JB 3EQLC 2WB1B 2JXMB 3V05A 2NN6H 4C3JG 4YXWA 3D6CA 2X6GA 1E1QA 5JOBA 2KVMA 3K6OA 4XYQA 1I4PA 1V1PA 4CHTB 4RH6A 4WFN3 2MGSA 1I4GA 4EQOA 2ZZGA 2XRSD 4DA2A 1GHJA 4HMIA 1DM0B 5E3FA 1X32A 1FNVA 4IFDG 1D1IA 3MEHA 4ZRZA 3S16B 2Q8TA 4KY5A 2R7ZB 3OMGA 4KHVA 4HSPA 2JA7B 5CC4A 1B4OA 3EA6A 3OHXC 4XT3B 1WVLA 1CFMA 2KECA 1LV9A 1BUVT 1B1ZA 3DWPA 3GTQB 4ZUIA 2KEDA 1WTOA 1EEID 3NHHA 5ELFA 2A5HA 1SYGA 2F0LA 1NAPA 2OXPA 3P7JA 3DEOA 5J1ZA 4IUNA 5KYLA 1HUNA 1HZEA 2KCCA 4R8IA 2N55A 1EIHA 1EWCA 2WZPP 4RGTA 3P75A 4PNYA 3IFTA 2K03A 1Z6HA 5K36H 1F9SA 5D3DA 3PV0A 1XTCD 4A3MB 1HTLD 2WJYA 1LLRD 4CKEA 1EQTA 1SMYC 5A35A 4XN0A 1ET9A 1KDCA 5JPMC 1SYEA 3HAGA 1BOSA 2EZVA 1SNDA 4QUCA 3SR1A 5DN6A 2QDBA 1Y8OB 2EPBA 2R92B 3S2HB 2F0SA 1QB5D 4DNTB 1HHVA 4EVOA 4RGMA 3R2TA 3L9AX 3GV3A 3Q0AA 3S1MB 3HOWB 3N52A 1A2UA 1SBBB 1SYCA 3TZDA 4BY1B 2EOTA 5C5MA 3HOZB 1CA5A 5G3LD 2SOBA 2A69C 2EYHA 2BE5D 4N9TA 1HFNA 1FX0A 1FNUA 1STAA 2IW3A 3S9WA 3H91A 2X85A 3H0GB 4X3KA 2X6YA 1V43A 2RBMA 3D4DA 3MVVA 2RDHA 3NE5B 3E5SA 3PIO3 3CHBD 5FLXE 1RDPD 1ESFA 5M3MB 2EE1A 3J7AF 3F2UA 3OW7A 2NN6G 3NTKA 3KLRA 1AFPA 4H0LC 1I4RA 1TS5A 2IX1A 1ICWA 2M00A 1PLFA 3X3MA 2D3LA 2JJ1A 2EJFC 3D31A 4PQXA 3SK6A 3BDLA 2WSSA 3DWQA 4XTCS 2L12A 3AB9A 3IL8A 5JVG3 2XNAC 1GUNA 3LWEA 2RQXA 2X6LA 5KNLA 3SK5A 1F9RA 5KYIA 4X3TA 3KK7A 1C4QA 5J39A 4R8NA 1WD1A 2HCCA 3L3OC 2XZOA 1SE2A 2KHSA 1JOQA 4G7OC 5KNBA 2D3NA 4KN7C 3VA5A 5C4HA 2C5CA 5I2YA 3A8KE 1JOOA 3FMCA 4XMYA 4C1NI 2B2YA 2JA5B 1SYDA 3TP8A 2DNEA 4FF2A 4WORA 4IQZA 1TVXA 4CJ0B 2CW0D 1A6XA 3A8IE 5A2QL 2JSOA 2ZTGA 1EYDA 1PTOB 1KTKA 1LT3D 1BF4A 2PMZB 5K36G 1ENFA 5ELDA 1SYFA 5E1FA 1SKYB 4L63B 4C3JB 2B2YC 2K5WA 2ZXHA 5IT9L 3V96A 1WP6A 3TP7A 2L9HA 2L55A 2EJMA 3GTMB 2LMCB 4IALA 4ME5A 4FYDA 1H9SB 2EYJA 3CRKC 3ND9A 4XOTA 4ZYSA 2NWGA 1K8OA 1E2VA 5HKKA 1Y1WB 4TSFA 1W6JA 3MXUA 4KJNA 1EY7A 4J6HA 4IZ8A 3K59A 3M7GA 5D65A 1E2ZA 1RODA 4KK7A 5CBEE 1U9RA 2HCIA 3MAQA 3VR3A 1NBMA 1CHQD 1SNPA 2SDFA 5E4WC 5KIXA 1CZGA 3OAAA 3T51B 5CV7A 2NYZD 3ND8A 4A3GB 3FDTA 3H94A 4JK1C 2F1MA 3GTKB 3D6WA 1QCBD 1V8QA 3SE0A 2Z4IA 4XLEA 5FOBB 4C56C 4Z9CB 4RA8A 1BO0A 1KMHA 2JEAI 1LTBD 3CU7A 5C3WA 3BYTB 3GQBA 2EJGC 2G9DA 3ITPA 2QCPX 2IT1A 1LT6D 1BDOA 2J0TD 2D9UA 2LY7A 3NSWA 5JPNC 2B2TA 1LTID 5KNCA 5K5PA 4KN4C 1Q90A 1STYA 1STHA 4OGQC 1RJTA 2VJJA 2I46A 1RTOA 4WRDA 4PMCA 1JQYD 2E75C 4A3JB 1T5XD 3OE7A 1LABA 2WJVA 3J7AV 1EWHA 3A7LA 5C0XI 5E4XA 4S3SA 3T56B 2DY8A 1IW7D 5EBCA 2X8KA 2B2TC 5TSSA 2X6XA 5LL6S 4B9WA 4ILWA 2F0VA 2JDIA 1S5ED 4B9XA 5C3XA 1Z47A 3KF8A 3P1HA 1EY8A 3PMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GHK A;  3AB9 A;  3VR4 A;  4KKT A;  5C0X G;  4TKO B;  4DK1 A;  1GUN A;  1ZKO A;  3BG3 A;  3M85 A;  3VR3 A;  4DNR B;  4PV1 C;  1OXS C;  1OXU A;  1OXX K;  1SMY C;  2A69 D;  2A6E C;  5A35 A;  1VDZ A;  4LJZ C;  1B9M A;  3PUW A;  3OOC A;  3EQL C;  2PCF B;  4H13 C;  1IYV A;  1K8M A;  2A68 D;  2JXM B;  1Y8P B;  2E74 C;  5BN5 A;  4G7O C;  3T51 B;  4KKS A;  2B8F A;  2K33 A;  1Z7T A;  3I72 A;  4LK1 C;  5KNB A;  2NN6 H;  2EVB A;  2JEB I;  4KN7 C;  1HCZ A;  3ND8 A;  5BN3 A;  1H9M A;  2AWO A;  2Q8I B;  1E2W A;  3A8K E;  1Y8O B;  5KND A;  3H94 A;  2A68 C;  4JK1 C;  2V4D A;  2F1M A;  2KA7 A;  4DNT B;  2BA1 A;  3FMC A;  3T53 B;  1HPC A;  1QJO A;  2AUK A;  3W3A A;  1VF7 A;  4H44 C;  4JBW A;  2D2C C;  2BDO A;  4L8J A;  2BA0 A;  2R6G A;  3PUZ A;  4RCN A;  2DNE A;  1V8Q A;  1T5E A;  2E76 C;  3I4L A;  3CRL C;  3SE0 A;  5BN4 A;  3LWU A;  3I73 A;  4IQZ A;  3FPP A;  1GHJ A;  2O5I C;  1A6X A;  3A8I E;  1ZYR C;  1CTM A;  3PUX A;  1O78 A;  2AUJ D;  4XTC S;  2A6H D;  2JEA I;  5C0X H;  3VR6 A;  4IFD G;  2ZT9 C;  3A8J E;  3GQB A;  3QJY A;  2EJG C;  5JEA G;  1Q1B A;  2A69 C;  2CW0 C;  4BA2 I;  1GJX A;  2BE5 D;  2IT1 A;  1BDO A;  1PMR A;  1VF5 C;  2NN6 I;  5K36 G;  1VCI A;  1G29 1;  3MFY A;  2DNC A;  1LAC A;  3P20 A;  4OO1 G;  4DK0 A;  1B9N A;  3L7Z C;  5KNC A;  1OXV A;  1ONL A;  3DXJ C;  3M4Y A;  1DCZ A;  1GUT A;  1O7L A;  1IYU A;  1Q90 A;  2JE6 I;  4KN4 C;  4G7Z C;  4OGQ C;  1CFM A;  1H9S A;  2B8G A;  2BE5 C;  3D4R A;  1I6V C;  1H9K A;  1H9R A;  1V43 A;  5JEA H;  1DXM A;  1H9J A;  2E75 C;  3PUV A;  3QIA A;  3NE5 B;  4KHZ A;  1LAB A;  3M7N A;  1Q1E A;  3WDN A;  3IKJ A;  2EJM A;  1FR3 A;  4G7H C;  1HQM C;  4OO1 H;  2LMC B;  1EWH A;  3HGB A;  4I7Z C;  1GUG A;  3A7L A;  3GD7 A;  4TQU S;  1H9S B;  2A6E D;  3CRK C;  3ND9 A;  2DN8 A;  3VR2 A;  3T56 B;  1IW7 D;  1DD2 A;  3OW7 A;  2A6H C;  2NN6 G;  2O5J C;  1TU2 B;  1YNN C;  3KLR A;  1K8O A;  3VA7 A;  2D5D A;  1E2V A;  4H0L C;  1TKW B;  2L5T A;  1OXT A;  3QG1 A;  1CI3 M;  4XIG S;  2KCC A;  2D62 A;  3LNN A;  1GUS A;  2K7V A;  4KI0 A;  3TZU A;  3RLF A;  3MXU A;  3VR5 A;  4IFD H;  1YNJ C;  3SDZ A;  3A7A B;  1IW7 C;  4GZY C;  1GUO A;  2YYZ A;  2PPB C;  1FYC A;  3IFT A;  4KMU C;  2EJF C;  3OPO A;  3D31 A;  1Q12 A;  1HTP A;  4KKU A;  1Z6H A;  3PUY A;  5K36 H;  2PNR C;  1Y8N B;  1E2Z A;  1Y69 U;  3PV0 A;  3U9S A;  4BA1 I;  2QF7 A;  4HR7 B;  3BDO A;  2EDG A;  3N6R A;  2K32 A; 
#chains in the Genus database with same CATH topology
 1KRS A;  4UHV A;  2QGG A;  5AJ3 Q;  1BBU A;  4AQY L;  1ZKO A;  1V0E A;  4ZKC B;  1SN8 A;  1U4R A;  3M85 A;  3CC7 B;  1LUZ A;  4A3D H;  1DOM A;  2PW5 A;  1I4X A;  4JI5 L;  4PV1 C;  2ZXR A;  4M1K A;  3D0F A;  1MBY A;  1E1O A;  3NWS A;  4MTK A;  4N8F A;  3QE2 A;  3OOC A;  4QB4 A;  1VQ6 A;  4F87 A;  2D74 A;  1JIC A;  5CV9 A;  4QUF A;  4XQN A;  1AH9 A;  1N32 Q;  3GVL A;  4C3H G;  3EVQ A;  3CP8 A;  1Q81 D;  1VQP B;  3DMU A;  2ZJQ A;  1HXY D;  2GVA A;  1CHP D;  2M5S A;  3CME B;  3I4M B;  2X6W A;  1SKQ A;  1ENC A;  1KNE A;  3D3R A;  4IPD A;  1ML0 D;  2RHS B;  1I3Q H;  3A0J A;  3GSI A;  4A3K G;  2HT1 A;  3FPP A;  2AMC B;  4GKJ L;  1CTM A;  3OSO A;  5C6A A;  1C9O A;  2HIV A;  2F0J A;  5LL6 X;  2VY3 A;  5C4X H;  1EEF D;  1IJE A;  3PO2 G;  3VR6 A;  2NVT H;  1GXD C;  1QVG A;  5M5Y B;  1F77 A;  5IGC A;  2B2W A;  4RCO A;  1VQH A;  3U9O A;  2OT2 A;  5FO7 B;  4A3B B;  2DIE A;  2MUY A;  5IYR A;  2MO0 A;  1G29 1;  1WOS A;  3SKB A;  3RUZ A;  2CC2 A;  5DM6 3;  1I50 B;  1VQD A;  1OXV A;  2AWN A;  4RD1 A;  1S0U A;  3WQZ A;  3IAY A;  4C2M H;  2R93 B;  2L11 A;  4HID A;  1I6V C;  3GIR A;  1KIX A;  3MTS A;  3BZC A;  1JB9 A;  2F43 A;  3SHL A;  4ZGN B;  3I2Z A;  1XE1 A;  3SEJ A;  2CH4 W;  2Z6B A;  4PZ8 A;  2YU9 H;  1PHJ A;  3I70 A;  2ICI A;  1CA6 A;  5C3E H;  2F4I A;  3ZYY X;  3MXG A;  3A3G A;  4DF7 A;  2ZZF A;  2AKW B;  4F88 A;  3OZW A;  1F9Q A;  5KGU A;  1J5E Q;  2QMU A;  2E2J H;  1XPO A;  3RZO H;  4QCL A;  5HUR A;  1TKW B;  1VQE A;  2NUC A;  4Y7N H;  3Q24 A;  4OOV A;  2JA6 H;  4RD0 A;  1QFZ A;  3BJU A;  2HDN B;  4R4I A;  1W3S A;  3HRZ C;  3A7A B;  1G7S A;  1EFI D;  4YAO A;  4XL9 A;  4LF9 L;  2PQE A;  5CV5 A;  1FL0 A;  1S5F D;  4RD2 A;  2F1L A;  2JQO A;  4ZCK A;  5M3F H;  4O1N A;  4HR7 B;  4XNF A;  1BCP B;  2HHH L;  4F8M A;  3VR4 A;  4X7D A;  2VUM H;  3VNU A;  1KRT A;  1TTT A;  4U68 A;  4BBS G;  3CCV B;  4BBR B;  2E2H H;  4A3L H;  2VNJ A;  3IRB A;  1GJR A;  2VNU D;  4NMZ A;  1PFM A;  4JI8 Q;  3C2Q A;  2KUM A;  3KYH C;  1Q9S A;  1E63 A;  1FGB D;  3MHP A;  3RZD H;  1R4P B;  5IGF A;  4KY7 A;  3ERO A;  4X7C A;  1FND A;  3A3B A;  4DU9 A;  2E74 C;  4X06 A;  2EXZ A;  5BN5 A;  1K8A D;  2GQF A;  2GJR A;  4HJA A;  1JWU D;  4OWT B;  3I4N B;  4R71 A;  1I6H B;  3ASR A;  4RFB A;  1H9M A;  1UE5 A;  1XXG A;  3CAM A;  1W87 A;  1Y14 B;  2B63 B;  5F4M A;  1JWS D;  2ZTN A;  4JI3 Q;  1PRT F;  2ZXI A;  5TV2 A;  5IYB H;  3S17 B;  4IOC A;  3JAM L;  2JA8 G;  3W3A A;  4HCE A;  2BOS A;  3KF6 B;  3CKI B;  1RD9 D;  1QUE A;  2F0Q A;  4R4O A;  5EQ0 A;  1BQQ T;  2AUJ D;  1BVS A;  2EY1 A;  5EKL A;  4MYT A;  1VQM B;  1BQE A;  2QA4 A;  2R7D A;  1S4M A;  2Q6K A;  1MSG A;  5JEA G;  4EQ5 A;  5IYC H;  4B3G A;  3M4O H;  1I4Q A;  4DR2 L;  2BDN A;  1RL2 A;  1PMR A;  3K5N A;  5IP7 G;  1VCI A;  1JC7 A;  4DKA C;  4CDC C;  2UUA L;  1M8A A;  4OO1 G;  4YY3 Q;  3FKI H;  3NUC A;  1TLL A;  1NCV A;  4KV6 A;  1CUK A;  3ERQ A;  1H9K A;  1YJ9 B;  4O0A A;  1DXM A;  3OIP A;  1OO9 B;  3PUV A;  5BSY A;  2V7U A;  2F3W A;  2NVQ B;  3M7N A;  2K52 A;  3IKJ A;  1EFW A;  3A1P A;  3WND A;  3ZBU A;  2RDF A;  3F2D A;  1GUW A;  1WSV A;  2WAQ B;  1HA6 A;  3GD7 A;  1IBM L;  3TEH B;  4FXG C;  1KDA A;  5M9O A;  3R6J A;  4DAV A;  4HAE A;  1TU2 B;  1SYB A;  4HIM A;  3EJI A;  3ZPN A;  5EPJ A;  2L5T A;  3QG1 A;  2D62 A;  5IYD H;  3WNC A;  1ILQ A;  4FXK C;  4IUR A;  4GN5 A;  1T6X A;  3U58 A;  2HIX A;  2E2D C;  2E5L Q;  4HIO A;  5C44 H;  4HCS A;  1YHQ B;  3HG9 A;  1VQL A;  1UD3 A;  3LQ6 A;  4HE5 A;  3QOL A;  5AFW A;  1B3Q A;  3U9S A;  5JJI A;  4JV5 Q;  2BF4 A;  1RQR A;  4RJL A;  2KOL A;  4P26 A;  5EAY A;  4P2N A;  2P3M A;  5IK2 A;  1XTD A;  1BBX C;  1N33 Q;  3BG3 A;  1QOH A;  1EFC A;  2BGI A;  1PFB A;  3BC9 A;  5CV6 A;  3CXC A;  4FO2 A;  5CGK A;  1SJE D;  1OXX K;  2F0D A;  1PYS B;  3AMU A;  4II2 A;  2K28 A;  2EIF A;  4M1U B;  4YAW A;  3GTJ B;  3H3V C;  3CCJ B;  3J80 c;  1VQJ A;  3A55 A;  4BY7 G;  4WJ4 A;  2HDM A;  2QN6 A;  4B43 A;  3CD6 B;  2B8F A;  3ASQ A;  1Z7T A;  2HQE A;  4XQJ A;  4IPG A;  4NKL A;  3TP6 A;  4B4D A;  5HGQ A;  5A2Q E;  3T1Y Q;  3QB3 A;  5IGG A;  1VHO A;  4CGY B;  4HJ5 A;  5CBA E;  1W6K A;  5TRD A;  2K04 A;  1N0V C;  3B82 A;  3OWF A;  4UP7 A;  1C48 A;  4GKK Q;  2ZL7 A;  1HPC A;  1J8I A;  5C3E G;  3K5O A;  4DV7 Q;  1AP0 A;  2IPK D;  1D2B A;  3H3V I;  5BN4 A;  4IUT A;  1KDB A;  1S5D D;  2K50 A;  4TN1 A;  4JI3 L;  4OIK A;  5IWA L;  1HRJ A;  3CQZ H;  4K5W A;  2PMD A;  1O7Z A;  1YLO A;  1A3V A;  2CKZ B;  2CND A;  3CCU A;  1XWE A;  5J3O A;  4JPB W;  2ZXO A;  1BJK A;  1LTT D;  4P22 A;  2A1A A;  5IT9 E;  4LF6 Q;  2RVL A;  2DER A;  4RDJ A;  3H15 A;  2QE7 A;  3RMH A;  3RLN A;  4LF4 Q;  3MFY A;  1YHQ A;  2HDL A;  5M3F G;  1KAA A;  3PSI A;  2VW9 A;  4G57 A;  4WQM A;  3AVV A;  1AEX A;  2KHJ A;  4C3H B;  4XKW A;  1ZM4 A;  1IYU A;  4P2C B;  2L1B A;  4P72 A;  3ONU A;  1G91 A;  5EMN A;  4LFA Q;  3E20 A;  2MFI A;  4A3L G;  4IJH A;  2YWG A;  1IBL Q;  1H9J A;  2CK3 A;  3QIA A;  1UAP A;  2F0M A;  3E9H A;  1N34 L;  3EN2 A;  2PZU A;  1HA5 A;  1G6Z A;  2QEX B;  4G7H C;  1STB A;  2QEJ C;  3CCS A;  4A3K B;  1XYI A;  2A6E D;  5H59 A;  1ENA A;  3ZZU A;  5KEE A;  5A88 A;  1LTA D;  5LMN W;  3RY8 A;  3PO2 B;  2ID0 A;  2LFN A;  3H3V H;  3HOV H;  4JC0 A;  4XQQ A;  4BPR A;  1L0Y B;  2D5D A;  3CPX A;  1MJE A;  4DR4 Q;  2EYL A;  1CI3 M;  4MNO A;  1SNO A;  5IYB G;  3PF5 A;  3S15 H;  3A5Z B;  1D1K A;  3PUM A;  4RKB A;  1HNX L;  1U4M A;  1BCP F;  3MXN B;  3T4A C;  2Y0S G;  4JBJ A;  1TWH H;  3PUY A;  4ZKB B;  3G6E A;  3CCR B;  5C4J H;  3MEF A;  2HMA A;  4OIJ A;  2VNI A;  2B2U A;  1X3F A;  1GAW A;  1N36 L;  1PJ7 A;  3CCM B;  4NDX A;  1ZYR D;  1VQO A;  3GVK A;  2NVX B;  3BZD B;  1MHW C;  3GP7 A;  1VQ8 B;  1QWY A;  3KEW A;  1EIF A;  1VJS A;  3OJW A;  4WZT A;  1B44 D;  3DUZ A;  1KLU D;  5EKI A;  4QUZ A;  1N33 L;  4A93 G;  2KEE A;  3I56 B;  1IYV A;  1X65 A;  3PIO A;  2IX0 A;  4AYB G;  4IUV A;  3I72 A;  1BXT A;  3EFX D;  1UD5 A;  1EFU A;  2XWJ B;  2AQ2 B;  4RGO S;  1PTO D;  2AWO A;  4PGO A;  1E2W A;  1VQF A;  2B2U C;  4A3C H;  3S16 H;  2KCM A;  5LMU Q;  3T53 B;  1KLG D;  1QG7 A;  3VYS A;  4ASU A;  3ZC3 A;  4H44 C;  4MIU A;  5EPL A;  4X64 Q;  1PH3 A;  4L8J A;  4OX9 Q;  4G1V A;  2K5D A;  4Z4R A;  1UEA B;  2JA7 H;  3BVZ A;  1GAQ A;  2OYN A;  3I73 A;  3ASP A;  3AFQ A;  4BBS B;  4A3B G;  2GRE A;  2IWH A;  2V7Q A;  4ZGQ B;  1HUM A;  5BR8 Q;  4DV7 L;  2V7W A;  1W34 A;  5IYD G;  4NXM L;  1TWG B;  3DEP A;  1QH0 A;  2ZT9 C;  3FRP B;  4FF3 A;  1VQ5 B;  4RLZ A;  3AVU A;  2Z6K A;  1I94 L;  2CCZ A;  5C44 G;  1S3O A;  1YNJ D;  2FFK B;  1IHZ A;  3VYR A;  5ISR A;  4IUU A;  1PZJ D;  2Q6L A;  1G8Z D;  4LF6 L;  2F4V Q;  2R3Z A;  5IYP A;  4LBY A;  3MHB A;  5AN9 A;  2JE6 I;  4FF1 A;  2MO1 A;  5C4Z A;  4QF4 A;  1A8P A;  1P8L A;  1QE6 A;  3URY A;  3K57 A;  3AU7 A;  1NDH A;  4Q7J B;  3VO1 A;  3KDF A;  4C43 A;  5M5W B;  3QFR A;  4A3F H;  1S40 A;  2JYO A;  2JA8 B;  1KK0 A;  2MP1 A;  3UI2 A;  3G4S B;  2K5N A;  3CCQ A;  3CB4 A;  1VQK B;  2MNA A;  1O7Y A;  4LFA L;  4RCZ A;  4GS3 A;  2XZP A;  1MAB A;  3FP9 A;  2HUG A;  2WIN B;  3K5L A;  2XOK A;  1VHE A;  4XKV A;  3C2P A;  2Z6K C;  2E1R A;  3SJZ A;  3QR8 A;  3AQQ A;  1YIT B;  1JE5 A;  3CP0 A;  3BZK A;  4FP5 D;  4UP8 A;  4X62 Q;  1QGY A;  4A3M H;  1GO3 E;  1BPL A;  1NNX A;  3RN5 A;  4DUZ L;  2N88 A;  1SRU A;  1D8T A;  2K7V A;  4DGZ A;  1IBK L;  3TZU A;  1JB3 A;  3EBE A;  1HNZ L;  2NZO A;  4FN5 A;  1W35 A;  2M2L A;  2PPB C;  2W6I A;  2A73 B;  1LTL A;  2UXB Q;  4Z4S A;  2ZZE A;  2DY1 A;  1ELO A;  2UUC Q;  4A3D B;  1SSO A;  1NB0 A;  4JI7 Q;  1LTG D;  3H09 A;  4PMW A;  4B08 A;  1YIJ A;  4QV2 A;  1HR0 Q;  5EBD A;  4AC9 A;  2JA9 A;  2MPM A;  2ICE C;  1VQ5 A;  4YWK A;  4V19 0;  5I9O A;  5I2X A;  1TWA B;  4XLF A;  3W2F A;  2A6E C;  3CC2 B;  2F0F A;  1B9M A;  2OWO A;  3Q6Q A;  4L5T A;  3KFU A;  1K8M A;  1C7Y A;  1Y8P B;  3S1M H;  4LFB L;  3NQI A;  4K6D A;  4R4Q A;  1GOZ A;  1V1O A;  1VS0 A;  1WYD A;  5GAG C;  4JI5 Q;  2PZT A;  4HIK A;  1KRH A;  4PMB A;  4BY1 H;  1B50 A;  1HJP A;  4JG2 A;  3HOZ H;  1K28 D;  2OTL A;  2LSS A;  3GTG B;  4J1M A;  1I3Q B;  2A68 C;  1TS3 A;  1R5O A;  4DAY B;  3G05 A;  4P1V A;  2XWB B;  2LZJ A;  2BDO A;  4UDU C;  4DR6 L;  1XNQ L;  2XGJ A;  3NWT A;  1CM9 A;  3KUP A;  1WTP A;  2NVT B;  3HOV G;  4DN4 M;  3HOX H;  1L0X B;  1ZYR C;  4CBV A;  5C0X J;  3OTO L;  2Q2U A;  1SE3 A;  4CJ1 B;  3GTL H;  1SAP A;  1WOR A;  1LTS D;  1YHB A;  3FEW X;  3HOU H;  3M3Y B;  3P26 A;  4R4T A;  4DAM A;  2RF4 A;  2V7V A;  3AVX A;  4PC1 A;  3JQR A;  5FO9 B;  4BY7 B;  2QTL A;  4LUZ A;  4GKJ Q;  1SE8 A;  4IPH A;  1W0J A;  1ONL A;  3DXJ C;  4LNQ A;  4ZCL A;  3CMA B;  1H9S A;  4ALP A;  3UDG A;  4MN3 A;  1L1O B;  3J80 i;  1PTO C;  2KCN A;  1PRT B;  1KAB A;  2XN9 C;  2YU9 B;  3BNW A;  3CCL A;  1I18 A;  1STG A;  5C3E B;  3V76 A;  2X3U A;  1UEB A;  4P12 A;  3GO5 A;  1W9X A;  2X0K A;  1UWV A;  2JIZ A;  4PC2 A;  5A89 A;  4RDK A;  3J7Y W;  1FRN A;  3W2H A;  3IFD A;  4YCU A;  1Q3L A;  1W2B A;  4Z1M A;  2B2V A;  3RZO B;  1QUF A;  1FGU A;  2LKV A;  3PO3 H;  4Y7N B;  3NBH B;  1SXT A;  4DNI A;  1AZQ A;  1NMF A;  4EGV A;  1SFO H;  4QL5 A;  3VA7 A;  1EZ8 A;  2A74 C;  4A3C G;  2ZXP A;  1EZ6 A;  1WOP A;  3BVM A;  2CWP A;  1YNJ C;  2Z6B D;  3SDZ A;  1D8L A;  2Z4H A;  5M3F B;  3OP1 A;  4YAL A;  4TMT A;  1EU4 A;  2K6A A;  4TVA B;  5T1G A;  2V7T A;  4LAA A;  2PNH A;  4C3I H;  2DY7 A;  2BH2 A;  3S14 H;  4DR3 L;  2E2H B;  3ZUG A;  4I65 A;  2A8V A;  1N08 A;  5FNZ A;  2GK6 A;  1AE2 A;  2QF7 A;  3BDO A;  1XPU A;  4OO1 I;  2I1L A;  4PC3 A;  2K32 A;  3AGQ A;  3KOJ A;  4KKT A;  1EIY B;  2VZL A;  2B2V C;  3O13 A;  3HFZ B;  4XT1 B;  3GVJ A;  4LF9 Q;  4JI0 Q;  1JNY A;  3K0X A;  3A35 A;  3RZD B;  4Y9R A;  1TVC A;  1OXS C;  3QO2 A;  4IPC A;  4RD3 A;  5HY6 A;  3V2T A;  2X69 A;  1VQN A;  1EY0 A;  3NXW A;  2OBS A;  2JA5 H;  4MHE A;  3JAM E;  1IHM A;  2PCF B;  1G7T A;  5CV8 A;  4BWG B;  4IFD I;  2HHH Q;  4GLV B;  5LHY 1;  4LFC L;  3R3O A;  2B7C A;  4XQF A;  3QOJ A;  4A3F G;  3S1Q B;  4DV5 L;  1TR5 A;  4QFM A;  1HCZ A;  1KK2 A;  2WKC A;  4KD3 A;  2VJI A;  3B6Y A;  3PA1 A;  2Y0S B;  1II3 A;  1PTO H;  2YV5 A;  3NQT A;  1C0A A;  4XXE A;  3SK8 A;  1QJO A;  2R61 A;  1K28 A;  4RCN A;  1R4Q B;  5FO1 A;  4A76 A;  4G1B A;  4XN3 A;  4B3M L;  2BN4 A;  3LWU A;  3C1F A;  1U4P A;  1D6E C;  3M4O B;  1WI5 A;  4JCV E;  5LMN L;  3CP2 A;  4AVZ A;  5C0X H;  3HEJ A;  4OWW B;  5KRU A;  3HKS A;  1U4L A;  4J8Q A;  4DR7 L;  4A93 B;  4RDL A;  1MGS A;  4NXN L;  3H6M A;  1YJN B;  1XJV A;  3BVG A;  4P73 A;  4UZU A;  2FX3 A;  1ZM3 A;  3KLS X;  4AYB B;  5M5X H;  3HOY H;  1K0S A;  1JMC A;  4KHP L;  4DAP A;  1CQX A;  1F2Y A;  4B47 A;  1YI2 B;  4B3S L;  4RPB A;  4RWS C;  3R8B A;  2EYO A;  1IL8 A;  1SE4 A;  2VS1 A;  4OL7 A;  1UD8 A;  1I4H A;  3I8Z A;  4DR2 Q;  2J4X A;  1KQS A;  1SR3 A;  3QSY A;  3MFG A;  3TRE A;  5LMZ A;  2UUA Q;  4QJF A;  3NK9 A;  3MXP A;  2PLF A;  3JC6 6;  3WWV A;  1R9T H;  1QVF A;  1FD7 D;  1YX2 A;  3CPW B;  1X3G A;  5D14 A;  1SNQ A;  1J9O A;  3L2P A;  1QUQ B;  1BCP D;  4A4I A;  4DR5 L;  4P75 A;  4TMX A;  3C3L A;  1DD2 A;  1NR2 A;  2Z1C A;  1L2F A;  3H9N A;  4NW2 A;  1PZK D;  1BLI A;  1KAW A;  1ASZ A;  5C44 B;  4P9S A;  2IJ0 A;  5E7N A;  3I4O A;  1IBM Q;  5IGB A;  3CC7 A;  1H95 A;  1QX4 A;  5FLM H;  1Q12 A;  2EY5 A;  3VYT A;  4B3T L;  3HOX G;  1CSP A;  2E2I B;  2LS0 1;  5I6Y A;  4GQN A;  4PC7 A;  3HP3 A;  2KEN A;  1K8G A;  2B2W C;  2CWA A;  3SXH A;  4LF8 L;  2AQ3 B;  1PH6 A;  2ENB A;  4RCY A;  3HOU G;  4QIW E;  3G48 A;  3SEB A;  1DAR A;  1XPR A;  5L46 A;  1TWF H;  1JCK B;  2SNS A;  1VQP A;  5I4D A;  5HXB A;  1YJN A;  5GV8 A;  1D5X C;  1QNU A;  2I5H A;  4ULL A;  2HQL A;  3T13 A;  3W1B A;  1JJ2 B;  1YBY A;  2XIW A;  2VXW A;  4ZQ3 A;  3W2D A;  3CME A;  4JI0 L;  4HMJ A;  1OB0 A;  1AIP A;  1UD6 A;  4PAA A;  2YTV A;  2TSS A;  4A3I H;  3AVY A;  4LK1 C;  2G5D A;  2JEB I;  1DZ1 A;  1F20 A;  3PGZ A;  3NEL A;  1F60 A;  2P5Z X;  3AST A;  4XOR A;  1I5F A;  2IY5 B;  1QNK A;  1DOK A;  1SMX A;  1PH8 A;  1ESR A;  4EQN A;  2RA4 A;  3K7A H;  3K5M A;  3PO3 G;  2BA0 A;  1TY2 A;  3W2I A;  3UDF A;  2PI2 A;  1NRK A;  2XEX A;  3BY1 A;  4C0S A;  1O80 A;  1OTC A;  4II3 A;  4FVM A;  3UDI A;  3V7A A;  2EYF A;  1HFG A;  5J3B A;  2A6H D;  3U2Q A;  3NPP A;  1EP2 B;  2IHE A;  1X55 A;  2X53 S;  2BCO A;  4OHJ A;  5GQO A;  1V1P B;  4DV1 L;  3CES A;  1VQC A;  3TS0 A;  1HZ9 A;  3ICE A;  2NN6 I;  4C3I G;  5IWA Q;  4DK0 A;  1SDF A;  4X66 L;  1GKH A;  2FJ2 A;  5GAE C;  5F4O A;  1E3Z A;  2I5M X;  4ODG A;  3W5H A;  3OMC A;  3BQJ A;  4HTH A;  1K3R A;  3OEE A;  3VYU A;  4JYA L;  1PH1 A;  3ONA B;  2G9H D;  4KHZ A;  4QMG A;  1PDQ A;  1Q1E A;  2C78 A;  4ACB A;  1E22 A;  3D4W A;  2ZTD A;  4R4C A;  3CC4 B;  2ALY B;  2QGQ A;  2RHQ B;  3HOV B;  4TQU S;  4FF4 A;  2HCJ B;  1JJ2 A;  1QIL A;  4IO9 A;  2CVR A;  1XX8 A;  5CV4 A;  4Y7C A;  1RKN A;  3NTI A;  1F2M A;  2V31 A;  2Q2H A;  1N8R D;  1N34 Q;  4BXX H;  5H5J A;  3CRZ A;  3JQQ A;  3J80 E;  2JJQ A;  3I55 B;  4KI0 A;  4A3D G;  2NTT A;  4YIJ A;  4CKB A;  1NJI C;  4UAJ A;  2B29 A;  4OXP A;  1RHP A;  1TT2 A;  3CCV A;  1EY6 A;  2K01 A;  4OPS A;  2DET A;  3FJO A;  4DK3 C;  4K14 A;  3SVM A;  5FIU A;  1EY4 A;  1Y0Y A;  1HVX A;  2RC5 A;  3AVT A;  2FMM A;  5C0X G;  2WR8 A;  1WCM H;  3S2D B;  5JAV A;  1EYC A;  1HNX Q;  3ER0 A;  1XB2 A;  3WBJ A;  4O42 A;  1TWC B;  4B48 A;  4YEL A;  2F0N A;  3HOY G;  3OIQ A;  1LYL A;  2XZL A;  1BX0 A;  1M4V A;  4PZ6 A;  4H9G A;  1N36 Q;  2RSN A;  1BCP C;  4BS9 A;  1K83 B;  1Q46 A;  1S5C D;  1U5K A;  3KF6 A;  2ZL5 A;  3STB D;  4WWV A;  2QIL A;  4HN7 A;  2BM1 A;  1WTH D;  1KHI A;  4X3S A;  1Q86 D;  2HLD A;  3S1R B;  2BMW A;  1IXR A;  2F0I A;  3J81 c;  2WAC A;  4YHH L;  5C4X G;  2NTS A;  4A3E H;  1CZW A;  2RDG A;  2AUK A;  4IN3 A;  1VQM A;  3DWA A;  3LX0 A;  3DHQ A;  1E24 A;  3B8H A;  2E76 C;  4ZAI A;  4EH1 A;  2BV3 A;  2F0P A;  2H1E A;  4ZCI A;  1JWM D;  2R93 H;  1MIU A;  3PUX A;  1H8H A;  2ZBU A;  2WZN A;  2BPO A;  5FK9 C;  4FXD A;  3OW2 B;  4KJO A;  4ID6 A;  1VLO A;  3OWE B;  1CSQ A;  4OPV A;  1KC8 D;  1A15 A;  3FKS A;  2O2L D;  2WKD A;  2XVS A;  3A8J E;  1F2L A;  1SRO A;  3TBI B;  4TMV A;  1VQ7 B;  3S1N B;  1YJ9 A;  4DV3 L;  5FLM G;  1VF5 C;  4TT3 A;  5B6I A;  2E8G A;  4JI1 L;  2HD3 A;  4JI4 L;  1JR0 D;  2DNC A;  2D0O A;  3K81 C;  1WTW A;  4A3F B;  3GTO B;  2PZW A;  1A3U A;  2SEB D;  1MJC A;  4G7Z C;  1GUT A;  4NXM Q;  1JA0 A;  4LWC A;  1UNS A;  4H7B A;  1RQP A;  1FNW A;  2VB3 X;  1MD2 D;  3BH4 A;  5FKA C;  4L5S A;  2V1C C;  2EY2 A;  4L5Q A;  3GTP H;  2JJ2 A;  3MCA A;  2KQ3 A;  1I94 Q;  4LMQ D;  4HED A;  4OOS A;  1K0R A;  2OEO A;  2JA6 G;  4Z4Z A;  3NP8 A;  3HGB A;  4NNJ A;  2UXC L;  5FL7 A;  2VBU A;  1IYJ B;  4UAI A;  1Y1V H;  5GAH C;  4A3I G;  3VR2 A;  4MYU A;  1BNZ A;  2XNC A;  4OON A;  1NMG A;  2A6H C;  2DCU A;  2F0G A;  3CTA A;  1HZC A;  3Q6S A;  4G4K A;  3F8T A;  3LQE A;  1V1Q A;  2GJK A;  1EUJ A;  1WJJ A;  4M53 A;  1SNM A;  2VUM G;  3LNN A;  3ZJY C;  1Q8I A;  2YWF A;  3VR5 A;  1PYW D;  1OGJ A;  4ZCM A;  1GUO A;  2C9O A;  3R2I A;  1EWI A;  2KJX A;  4K5X A;  4CJ2 C;  2R7F A;  1N05 A;  2RCF A;  3AVW A;  3M4P A;  4IUQ A;  5CR3 A;  4RAU C;  3W2E A;  1Y8N B;  5TY0 A;  4AH6 A;  4DUZ Q;  1UMK A;  3KJO A;  3CCJ A;  1IBK Q;  1G6P A;  1HNZ Q;  3ZZT A;  3BY2 A;  4G7X A;  1OB2 A;  1F9P A;  4JW0 A;  3CD6 A;  5D3I B;  1ILP A;  2B63 H;  1VQ9 B;  2K05 A;  4RMF A;  3J81 L;  4NP5 A;  4QVA A;  1UD4 A;  2F4N A;  5DS0 A;  2PYK A;  1B3A A;  2CQA A;  1Z9F A;  2F3V A;  3K0Y A;  5EGT A;  2F03 A;  4L5R C;  2A68 D;  3HKZ G;  3K58 A;  1E64 A;  1GR1 A;  3SJP A;  1G2S A;  3QWN A;  5GV7 A;  4Z4W A;  1N8R C;  4DXF A;  2A19 A;  5BN3 A;  2F3I A;  2CHB D;  2VNK A;  3J80 L;  1LO5 D;  2V4D A;  2L15 A;  2BA1 A;  3G7L A;  1YHA A;  3OEH A;  1WTH A;  4IUP A;  5IYC G;  5ELE A;  3WOF A;  3HOX B;  4B3R L;  1KK1 A;  1YEZ A;  2J7Z A;  4EQP A;  4LFB Q;  1H8E A;  3CMM A;  5NUC A;  1E79 A;  3CRL C;  4XLC A;  1CQV A;  4V0B A;  4TMZ A;  1X54 A;  2F0E A;  1Y0R A;  3WBK A;  2EY6 A;  2RKS A;  4U67 3;  3GTL B;  1QFJ A;  3SLD A;  1CNE A;  4DQL A;  3FKI G;  3HOU B;  1KL9 A;  3DLL A;  3BCF A;  3PF4 A;  4Q5V A;  1C8C A;  4IW3 B;  1YNN D;  1JOK A;  1EFR A;  2XNJ A;  4ZUJ A;  3VNV A;  1HQR D;  1OHH A;  4N8X 1;  1I8D A;  4G7W A;  4B3F X;  1Q1B A;  3BS1 A;  4DR6 Q;  4BA2 I;  1XNQ Q;  1PFS A;  5IT9 c;  1DDI A;  3M4Q A;  5IGD A;  1TY0 A;  2N78 A;  5DNF A;  4TSS A;  1B9N A;  2GA4 B;  3OTO Q;  3STB C;  2QEX A;  2R7Z H;  3FHW A;  2PQA B;  5FO8 B;  5I6W A;  1Q86 C;  3ZIA A;  4QHY A;  4DR1 Q;  3ULP A;  3LVB A;  3X3N A;  5J35 A;  2WP8 J;  1EU3 A;  1CKM A;  4WZE A;  2VL6 A;  3PO3 B;  5TR9 A;  1E3X A;  2F0H A;  1A2T A;  2PW7 A;  1SFO B;  4POF A;  1CKN B;  2GK7 A;  1KJZ A;  1IKM A;  4FK8 A;  5DEH A;  2NBF A;  3MXN A;  3GTQ H;  2O5J C;  1E1R A;  4UZF A;  1UE6 A;  1Q8K A;  3HS0 C;  3CCR A;  2UUB L;  1D5Z C;  1WD0 A;  2EXD A;  1KC8 C;  1ZEQ X;  3UE0 A;  1M90 C;  4A3E G;  4C3I B;  2E1B A;  3D8G A;  1IL2 A;  3U4Z A;  4K5V A;  3CCM A;  3S14 B;  4GZY C;  3BYY B;  1FYC A;  5ELB A;  1CQF A;  4CDE C;  1VQ8 A;  2CRV A;  1HTP A;  4RD6 A;  2XRQ D;  3E6Z X;  1WTV A;  2TMP A;  4DUY L;  3T1H L;  2I07 B;  3BCD A;  4POG A;  4R9W A;  3TN2 A;  4A75 A;  4XM3 A;  2SNM A;  2GJP A;  3D26 A;  4ABN A;  2Q6I A;  5CDF A;  5FLX c;  3I56 A;  4H02 A;  3Q6R A;  1X3P A;  1B23 P;  3B78 A;  5T1I A;  2CBX A;  3ASS A;  4X8I A;  4KD4 A;  5THX A;  2C4T A;  2VBS A;  4X3U A;  4DR3 Q;  4F7X A;  1VDZ A;  1W0K A;  2NVY B;  5IGE A;  3PUW A;  3RD4 A;  3FPK A;  2BVN A;  1MI2 A;  1E0B A;  1TS4 A;  1CNF A;  2FIN B;  3OZU A;  2K1B A;  5C5L A;  3PIP 3;  3A74 A;  5FO0 A;  1PXU A;  2EVB A;  4DV0 L;  4O2D A;  1VQ4 B;  1HNW L;  3J7A 5;  3I91 A;  1XQB A;  3CF5 A;  1LTR D;  4K0K L;  1OGI A;  1KNA A;  2KA7 A;  2NZ1 D;  2N49 A;  1B8A A;  4GNX B;  1XMO L;  3T16 A;  5J22 A;  2YWH A;  2D2C C;  3E0J A;  1Y1V G;  2R6G A;  3A56 A;  3Q22 A;  4LFC Q;  4OEL B;  3I4L A;  2R92 H;  3S2H H;  2C35 B;  3E9I A;  3AGP A;  1FDR A;  4JMQ A;  4DV5 Q;  2O5I C;  3G6J B;  2RCN A;  4FXU A;  1AN8 A;  1O78 A;  4LUV A;  1CT1 D;  1PRT D;  3WOE A;  1TII D;  5HGT A;  1N06 A;  2NB0 A;  1AZP A;  3HOW H;  5M5X B;  3HOY B;  4RHS A;  4JI2 Q;  3TME A;  1GJX A;  3TSS A;  1DJR D;  1X9N A;  4B3M Q;  2AQ1 B;  3P20 A;  1LAC A;  3FPU B;  3G4S A;  1VQK A;  3K80 C;  3L7Z C;  3A5U A;  4HIZ A;  5CMD A;  5LMN Q;  1PKV A;  1O7L A;  1S5B D;  1EYA A;  5JEA J;  1PA6 A;  2BE5 C;  1ET6 A;  1XNR L;  5C4X B;  5EPK A;  1H9R A;  4DR7 Q;  3WXM A;  1R9T B;  4NXN Q;  1YIT A;  2UXD L;  3W5V A;  3WDN A;  3BDC A;  4UY8 C;  3H0G H;  2ZBV A;  3J81 i;  4DV6 L;  2C5B A;  4DR1 L;  4KHP Q;  2YTY A;  4I7Z C;  1WDT A;  3RLO A;  3A54 A;  3PQI A;  1NSN S;  1LT4 D;  4B3S Q;  2DN8 A;  3ZBT A;  4C2M B;  4CDF C;  1CK1 A;  4CKC A;  3SLN A;  1G7R A;  1YNN C;  1VMP A;  2N3S A;  4XON A;  2QKI C;  2WB1 G;  5M3M H;  4IFD J;  5COR A;  5FLX L;  1EFT A;  1QGZ A;  1PH4 A;  4KLK A;  2IX3 A;  4GNX A;  3UE1 A;  1B7Y B;  4HJ9 A;  3HKZ E;  4Z4Y A;  1LT5 D;  3OPO A;  4LBZ A;  2VZA A;  4DR5 Q;  2K5Q A;  1BMF A;  2PNR C;  4DV2 Q;  4YWM A;  3ZZ0 A;  2OQK A;  3CC2 A;  2M9V A;  3A8K A;  1H85 A;  2E2J B;  1BR9 A;  1GHK A;  3Q23 A;  1TWF B;  4TKO B;  1ZM9 A;  2JA6 B;  1X3Q A;  1FJG L;  3NTH A;  4U9U A;  4XR6 A;  4IJL A;  2W6J A;  5JJL A;  1EQR A;  3KLS A;  4K8I A;  1UE1 A;  4LBW A;  4A3I B;  4B3T Q;  1XFO A;  1KK3 A;  3A8I A;  3SGI A;  5L37 A;  2R7Z G;  4AF7 A;  4C1N K;  1UD2 A;  4DAY A;  4RD4 A;  1A62 A;  1A8V A;  2R9V A;  4P6V F;  5JBQ A;  4ZLT F;  4LF8 Q;  2JA7 G;  3Q8D A;  1R5B A;  2PE3 A;  2ZL6 A;  4KKS A;  4RG1 A;  4BBS H;  2VUM B;  1JJG A;  1ASY A;  3TP5 A;  4Z4V A;  3K7A B;  1VQA A;  3I1F A;  4XOP A;  1BKB A;  1VQ6 B;  4RKL A;  4X7E A;  3NBI A;  4NPS A;  2GN5 A;  2ES2 A;  1Q7Y D;  2VB2 X;  4JBW A;  4GOP B;  3Q39 A;  1JA1 A;  1WSR A;  3PUZ A;  2L0C A;  1V9P A;  1PH2 A;  1PV4 A;  1RTN A;  1EIG A;  2H4O A;  3E3X A;  5IYW A;  2VQE L;  1L0W A;  1WOO A;  2DUD A;  1A3T A;  1PYB A;  1QGA A;  4HSV A;  4X65 L;  4OP7 A;  3ONY A;  1EOT A;  1PFN A;  1X3E A;  1AW7 A;  2LXJ A;  4YEJ A;  3CMA A;  1V5V A;  1L1O A;  4J0Q A;  2CW0 C;  2F0U A;  5JVH 3;  1VLY A;  3MWY W;  4LUO A;  3HKZ B;  1DYQ A;  5COY A;  1HZA A;  2CFM A;  2RSO A;  4FNF A;  1WTR A;  1JB7 A;  1E7Z A;  1IKL A;  4KTA A;  5IOC A;  2KCT A;  3G71 B;  5G3L F;  4JI2 L;  3MZ5 A;  2B8G A;  2PI2 E;  2XSC A;  3D4R A;  1ZXT A;  3MC0 B;  5JEA H;  3NBH A;  2WII B;  4DV1 Q;  2DYI A;  1CKO A;  1IJF A;  1TUI A;  4Z4U A;  4C3J H;  4A3M G;  1ZM2 A;  5IP7 H;  2Q6O A;  1E1T A;  3I7F A;  3C46 A;  1WTX A;  2L4N A;  1HQM C;  3JU4 A;  2C77 A;  4OO1 H;  4P71 A;  4X66 Q;  1D5M C;  1STN A;  3FKI B;  2MJ8 A;  4LF7 Q;  4RHR A;  1L1O C;  1NJI D;  3OFN A;  1PRT C;  3GTM H;  1UE7 A;  3HZX A;  4JYA Q;  3NEN A;  2B39 A;  2VNH A;  2VBT A;  1BBW A;  1EXM A;  1SEB D;  4CDD C;  3CCE B;  2WPD A;  5IP9 H;  1EY5 A;  2F0T A;  4IFD H;  1GVH A;  1NY4 A;  2YYZ A;  5GAD C;  2KVO A;  1RIP A;  2F52 A;  4KMU C;  1TWA H;  3SK4 A;  3MA2 B;  4GOP A;  2R92 G;  4YWL A;  3Q38 A;  4KKU A;  1Y1W H;  1WCM B;  1DOL A;  2FMC A;  2XTI A;  4R1J A;  1Y69 U;  1E43 A;  1QZH A;  3PUN A;  1J6Q A;  1V0F A;  4E6I A;  2ZTC A;  3HOW G;  1G51 A;  1J9Z A;  2I5L X;  4BY1 G;  1S72 B;  4TRD A;  3GTG H;  3HOZ G;  2OBR A;  4DV2 L;  4JI6 L;  5JJK A;  1OXU A;  1XMQ L;  1EP1 B;  3NEM A;  4DV4 L;  1PTO F;  2F0O A;  2F0W A;  4K2L A;  4LJZ C;  2EYM A;  1NUC A;  2WV6 D;  4H13 C;  4K2K A;  3S24 A;  5IYN A;  1KZL A;  1QFY A;  3U6K A;  1JE4 A;  3G71 A;  2MHV A;  3JAM c;  1PVO A;  2PO4 A;  2GPJ A;  2K33 A;  4GOP C;  4RGN A;  4A3E B;  2VBV A;  1UUP A;  2BH8 A;  3KBG A;  3TDQ A;  4PZ7 A;  2MQH A;  2BM0 A;  2Q8I B;  3H0G G;  5KND A;  1Q82 D;  1ICF B;  2K4K A;  1EY9 A;  2EFG A;  3EIV A;  3M3Y H;  5F2D A;  1VF7 A;  4K6L A;  2JP1 A;  3AYH B;  4A3G H;  1EL0 A;  4BY7 H;  5EJW A;  1T5E A;  4M0L A;  2EIX A;  1E62 A;  1PJ5 A;  4LBV A;  3Q3A A;  1EQV A;  1PZI D;  2EYP A;  5IY0 A;  3GTK H;  5M3M G;  2Q8R E;  3U4V A;  2Q2T A;  1SNC A;  2O4X A;  2C5H A;  4YHH Q;  1B2R A;  4P3Y A;  2J7K A;  3VO2 A;  1AMO A;  2BGJ A;  1YI2 A;  3I3C A;  3CCE A;  1PH5 A;  3K8A A;  4L6T B;  3KLW A;  3QJY A;  1JJC B;  1STE A;  4X05 A;  2UU9 L;  3BU2 A;  1WFQ A;  1NBW A;  2GVB A;  2WB1 E;  3F2C A;  1GD7 A;  3KBX A;  4E0F A;  1SLJ A;  3GTP B;  2IL8 A;  3M4Y A;  1DCZ A;  3CQZ B;  3R93 A;  2QA4 B;  1DON A;  3I90 A;  2D9R A;  1NR4 A;  3CPW A;  1KTV A;  2R6H A;  1JOR A;  4OOX A;  1S4Z A;  1G2T A;  1COW A;  1QUQ A;  3GDE A;  4DV3 Q;  1S72 A;  1Q7Y C;  1Y1V B;  4JI1 Q;  2VQF L;  4JI4 Q;  3FVQ A;  1FR3 A;  4LF5 L;  1GUG A;  4A3J H;  4XYO A;  3WY9 A;  4XLA A;  1SMY D;  1SJH D;  2FVG A;  4FDB A;  4XDX A;  5DM7 3;  3DDY A;  5IIF A;  2ZZQ A;  4ZK9 B;  1RCV D;  3U50 C;  3PEN A;  1RF2 D;  4XLH A;  1VMC A;  2FHT A;  1TQO A;  4Q0F A;  1OXT A;  5DSZ A;  3J81 j;  2QDX A;  3QFS A;  2WAQ E;  3DM1 A;  4XIG S;  5AJ3 L;  1GUS A;  4YAF A;  2NPF A;  4DXG A;  3CW2 A;  3GV6 A;  4MTN A;  3RLF A;  4LF7 L;  2UXC Q;  5I9P A;  1WPC A;  1IW7 C;  1WTQ A;  3AFP A;  1TS2 A;  1F2Z A;  5IOD A;  4N3G A;  1B53 A;  4QIW B;  4J15 A;  3J81 E;  5ELC A;  4M8A A;  1QVC A;  1MSH A;  4LW1 A;  4WJW A;  5CYU A;  2JA5 G;  1NTG A;  2OF1 A;  5F4J A;  4BA1 I;  4G6I A;  1K9M D;  5EKK A;  2XND A;  2EDG A;  3C1E A;  3N6R A;  4KY6 A;  4DFA A;  3S1Q H;  4DK1 A;  1HZB A;  4K8J A;  4XD7 A;  3JQP A;  3W1G A;  1N32 L;  4Z4T A;  4DNR B;  3S15 B;  5DAU A;  3F2B A;  1VQL B;  2Z8L A;  2V7X A;  4WZL A;  4N9P A;  5JJZ A;  1B2T A;  4X0C A;  2A69 D;  3J7Z C;  1TWH B;  2F0K A;  5C4J B;  3U6B A;  4UZE A;  3EQL C;  4YHB A;  3CW2 C;  4X7F A;  2WB1 B;  5KW9 A;  1K73 D;  2JXM B;  2C4U A;  2ZTE A;  3V05 A;  3CXC B;  2NN6 H;  4F7D A;  4C3J G;  4YXW A;  1T6Y A;  3D6C A;  1MRZ A;  2X6G A;  1X6O A;  3QFC A;  1E1Q A;  5JOB A;  2KVM A;  3K6O A;  4P3I A;  1EQQ A;  4A93 H;  4XYQ A;  1I4P A;  1V1P A;  4CHT B;  3LGJ A;  4RH6 A;  4WFN 3;  1X56 A;  1I4G A;  1K3B C;  2MGS A;  4EQO A;  1Q81 C;  1FRQ A;  2ZZG A;  2XRS D;  4DA2 A;  3I4M H;  1GHJ A;  4HMI A;  2OTJ B;  1DM0 B;  2DJG C;  4OPO A;  5E3F A;  5IP9 G;  1X32 A;  1FNV A;  1G7C A;  4IFD G;  1D1I A;  3MEH A;  4ZRZ A;  3S16 B;  4B3R Q;  3W2G A;  2Q8T A;  4KY5 A;  2R7Z B;  2IHF A;  3OMG A;  1Y1W G;  4KHV A;  4HSP A;  5M5Y H;  2ZM6 Q;  2JA7 B;  3LO8 A;  1R5N A;  3CCU B;  5CC4 A;  1B4O A;  1PH7 A;  2NZH A;  4A3B H;  3EA6 A;  1QG0 A;  3CC4 A;  3OHX C;  4XT3 B;  1WVL A;  1CFM A;  1H42 A;  2KEC A;  1I50 H;  1BUV T;  1LV9 A;  1B1Z A;  2D0P A;  1J5E L;  1Q82 C;  3W5O A;  1BX1 A;  1O7I A;  3DWP A;  3GTQ B;  4ZUI A;  2KED A;  2JN4 A;  3KJP A;  1WTO A;  1EEI D;  3NHH A;  5ELF A;  3I55 A;  2A5H A;  1SYG A;  1M90 D;  2F0L A;  4Y52 H;  1HH2 P;  1NAP A;  4P74 A;  2OXP A;  4JBK A;  4ACA A;  3P7J A;  2Q2I A;  3DEO A;  4DQK A;  2E2I H;  5J1Z A;  4IUN A;  5KYL A;  1HUN A;  4DPG A;  1HZE A;  5HZB A;  1FVI A;  3CCS B;  2KCC A;  4GLX A;  4B44 A;  4R8I A;  3OKX A;  2N55 A;  1EIH A;  4A3G G;  2LXK A;  1EWC A;  2WZP P;  4RGT A;  3P75 A;  4PNY A;  3IFT A;  1YJW B;  5H1S E;  2K03 A;  1Z6H A;  3VMF A;  2ZJR A;  4JI8 L;  5K36 H;  1F9S A;  5D3D A;  2UUB Q;  3PV0 A;  4OEM B;  1XTC D;  3DM3 A;  2OTJ A;  1D2E A;  1E3P A;  4A3M B;  1HTL D;  2WJY A;  1LLR D;  1YVC A;  1YZ6 A;  2AHO B;  2H5X A;  4CKE A;  4LC0 A;  1EQT A;  2CQO A;  3G6E B;  1SMY C;  2K5H A;  4DUY Q;  5A35 A;  4XN0 A;  1ET9 A;  4BBR H;  3T1H Q;  1KDC A;  5JPM C;  1SYE A;  1D1N A;  3HAG A;  1HA3 A;  1VQO B;  1BOS A;  4YCW A;  1SND A;  2EZV A;  4QUC A;  2QDL A;  4UP9 A;  3SR1 A;  1M1K D;  2EQS A;  1HR0 W;  5DN6 A;  5HZA A;  4YAU A;  1EOV A;  2QDB A;  4UPA A;  2JN9 A;  1Y8O B;  2EPB A;  2R92 B;  3S2H B;  1I7P A;  2F0S A;  1QB5 D;  4DNT B;  1HHV A;  4EVO A;  2B5O A;  4A3J G;  3OW2 A;  4RGM A;  3E1Y E;  3R2T A;  1A0I A;  2DJF C;  3ULJ A;  1K8A C;  3I4N H;  1I6H H;  3L9A X;  3GV3 A;  3MMP A;  3Q0A A;  4TMW A;  1VQ7 A;  1K9M C;  2CF4 A;  3S1M B;  3KL9 A;  3S17 H;  4DV0 Q;  3HOW B;  3N52 A;  1HNW Q;  4YY3 L;  1A2U A;  1SBB B;  4ME3 A;  1SYC A;  3TZD A;  2C2W A;  1NE3 A;  4BY1 B;  2EOT A;  3AEV A;  5C5M A;  4NBS A;  3HOZ B;  4K0K Q;  1CA5 A;  5A8A A;  5G3L D;  2K14 A;  1XMO Q;  2SOB A;  3VDY A;  2A69 C;  1ZUN B;  1KD1 D;  2EYH A;  2BE5 D;  4N9T A;  4PC6 A;  1HFN A;  1YJW A;  2OBT A;  1FX0 A;  4CQJ A;  1N07 A;  1K73 C;  1FNU A;  2ZIT A;  1STA A;  2IW3 A;  5BSX A;  1FNB A;  3S9W A;  1EP3 B;  3H91 A;  2X85 A;  1N0U A;  3H0G B;  4X3K A;  2X6Y A;  1V43 A;  2RBM A;  1DDG A;  3D4D A;  1GVP A;  4PAB A;  2CH4 A;  3MVV A;  5ELN A;  2ZM6 L;  2RDH A;  4DK6 C;  3NE5 B;  3JAM i;  3E5S A;  4BXX G;  2AHO A;  3PIO 3;  4MZ9 A;  1LM0 A;  3CHB D;  5FLX E;  1RDP D;  4ZV4 A;  1ESF A;  1EYG A;  2FXQ A;  3ES9 A;  2NVQ H;  5M3M B;  2EE1 A;  3KDF B;  2E5L L;  1XNR Q;  1N9W A;  2OCE A;  3J7A F;  3F2U A;  3OW7 A;  2NN6 G;  3NTK A;  3J81 k;  3KLR A;  2QTZ A;  1AFP A;  1U0L A;  4H0L C;  3CCQ B;  1I4R A;  4JV5 L;  1TS5 A;  2UXD Q;  3S2D H;  4GN3 B;  2IX1 A;  3R6K A;  1ICW A;  1WCM G;  2M00 A;  1T6Z A;  4DV6 Q;  2DOG A;  1PLF A;  1TWC H;  2D3L A;  2PMZ E;  3X3M A;  4JBM A;  1PJ6 A;  2JJ1 A;  2EJF C;  3D31 A;  3I4M G;  3A8J A;  4PQX A;  1SM4 A;  5IE8 A;  1VQ9 A;  2ZJP A;  3SK6 A;  3BDL A;  4QQB X;  2WSS A;  1K83 H;  3DWQ A;  3CPF A;  3K7U C;  4XTC S;  2L12 A;  3AB9 A;  3IL8 A;  5JVG 3;  2OK8 A;  2XNA C;  1GUN A;  3LWE A;  2OK7 A;  2RQX A;  3S1R H;  3TRZ A;  2X6L A;  4WJ3 M;  5KNL A;  3T1Y L;  2KBN A;  3SK5 A;  1F9R A;  5KYI A;  4X3T A;  1D7Q A;  3KK7 A;  1C4Q A;  5J39 A;  2PIA A;  1YIJ B;  4GKK L;  4R8N A;  1WD1 A;  2HCC A;  3L3O C;  2XZO A;  1VQG A;  1SE2 A;  4APV A;  2KHS A;  1JOQ A;  4G7O C;  4RM0 A;  5KNB A;  2D3N A;  1FJG Q;  3GTJ H;  4RPD A;  4KN7 C;  3VA5 A;  4JVZ A;  2R93 G;  5C4H A;  2VYQ A;  2C5C A;  2KHI A;  5I2Y A;  3A8K E;  1JOO A;  3F1Z A;  2K75 A;  3FMC A;  4GLA C;  5FJ8 H;  3S1N H;  4JOI A;  4XMY A;  4QY7 A;  4C1N I;  2B2Y A;  2JA5 B;  5DLQ E;  1SYD A;  3TS2 A;  2JK8 A;  3TP8 A;  2DNE A;  1VQB A;  3GTO H;  4LF4 L;  3ISX A;  4FF2 A;  4IQZ A;  4WOR A;  1TVX A;  2DGY A;  2OTL B;  2CW0 D;  4CJ0 B;  1A6X A;  3A8I E;  1P4M A;  3ERS X;  4M2L A;  5A2Q L;  2NV4 A;  2JSO A;  4PG3 A;  2ZTG A;  1EYD A;  2CW5 A;  2PQA A;  1PTO B;  1IBL L;  1KTK A;  3PA2 A;  1LT3 D;  1BF4 A;  1DGS A;  2PMZ B;  5K36 G;  1ENF A;  5ELD A;  4Y9U A;  4HJ8 A;  1PH9 A;  2VQE Q;  1SYF A;  5E1F A;  1OB5 A;  1SKY B;  4JOI C;  4L63 B;  4C3J B;  4X65 Q;  2B2Y C;  2K5W A;  1M1K C;  1CKN A;  2B3G A;  2ZXH A;  5IT9 L;  3V96 A;  1WP6 A;  3TP7 A;  4GN4 B;  2L9H A;  4C3H H;  4FWT A;  4DR4 L;  2N8N A;  1FNM A;  2L55 A;  2EJM A;  3RR5 A;  4BBR G;  3GTM B;  3PIP A;  2LMC B;  4IAL A;  4ME5 A;  2WYR A;  1GM5 A;  4FYD A;  2DEU A;  1H9S B;  2EYJ A;  1FNC A;  3CRK C;  3ND9 A;  4XOT A;  4ZYS A;  3CCL B;  2NWG A;  5KSW B;  4A3K H;  1NB9 A;  1K8O A;  1E2V A;  2Z0S A;  2ASB A;  4QVJ A;  5HKK A;  1VQI A;  1P16 A;  1KD1 C;  1Y1W B;  4TSF A;  1W2B B;  1W6J A;  3PO2 H;  3MXU A;  2RC6 A;  3I4N G;  4KJN A;  1EY7 A;  4J6H A;  2B63 G;  4AQY Q;  4IZ8 A;  3ULL A;  2QW7 A;  3OYY A;  3K59 A;  4G5G A;  2Z9H A;  3M7G A;  1IB0 A;  5D65 A;  4B3X A;  3PCO B;  1E2Z A;  1ROD A;  4KK7 A;  5CBE E;  3W5U A;  4X07 A;  1U9R A;  2HCI A;  1IZ6 A;  2ATW A;  3RNU A;  3MAQ A;  3E0E A;  3VR3 A;  1NBM A;  2BSA A;  1JT8 A;  4P25 A;  4AIM A;  1TXY A;  1VQ4 A;  1CHQ D;  2YWE A;  1SNP A;  2NVX H;  2SDF A;  5E4W C;  4QGU A;  5LMU L;  4K1X A;  5KIX A;  1CZG A;  1WOC A;  4X64 L;  3WNB A;  4YCV A;  4OX9 L;  3OJX A;  1WU8 A;  3WYA A;  2B7B A;  3OAA A;  3T51 B;  2XGT A;  4I7A A;  5CV7 A;  2NYZ D;  3M9B A;  2YTX A;  3PVD A;  1VQN B;  3ND8 A;  4EX5 A;  4JI6 Q;  4A3G B;  1XMQ Q;  3FDT A;  2WFW A;  5GRO A;  5BR8 L;  4DV4 Q;  3H94 A;  4JK1 C;  2F1M A;  3GTK B;  3UDX A;  4IOA A;  4M4S A;  3D6W A;  1QCB D;  1V8Q A;  3KF8 B;  3SE0 A;  5FA6 A;  2Z4I A;  4HE6 A;  2WAQ G;  4XLE A;  5FOB B;  1B70 B;  4C56 C;  4Z9C B;  4HJ7 A;  4RA8 A;  2Y0S E;  1BO0 A;  2F4V L;  1KMH A;  4AF6 A;  2JEA I;  1LTB D;  3CU7 A;  5C3W A;  4GNX C;  3BYT B;  3GQB A;  2EJG C;  2K5V A;  2G9D A;  3ITP A;  2QCP X;  2IT1 A;  1LT6 D;  1BDO A;  2J0T D;  2D9U A;  5E6T A;  4NCN A;  2LY7 A;  3NSW A;  5JPN C;  4N3N A;  1MKH A;  1T9H A;  1TWG H;  2B2T A;  1LTI D;  5KNC A;  5K5P A;  4KN4 C;  1Q90 A;  1STY A;  1STH A;  4OGQ C;  1RJT A;  2VJJ A;  3QFT A;  2I46 A;  4P6Y A;  1RTO A;  4WRD A;  1QZG A;  1DG1 G;  4X62 L;  4PMC A;  1JQY D;  2E75 C;  4A3J B;  5ELO A;  4AYB E;  2UU9 Q;  1T5X D;  3OE7 A;  1LAB A;  2WJV A;  2OQ0 A;  3J7A V;  2I0Q A;  5M5W H;  1EWY A;  1EWH A;  3A7L A;  5C0X I;  2JA8 H;  1KXL A;  3RN2 A;  5E4X A;  3TQY A;  2UXB L;  4S3S A;  3T56 B;  2DY8 A;  1IW7 D;  2UUC L;  1AE3 A;  1KQS B;  1YNX A;  4OWX B;  1U2R A;  4JI7 L;  5EBC A;  3P27 A;  2X8K A;  2B2T C;  5TSS A;  4NB3 A;  2X6X A;  1QVG B;  2VQF Q;  5FJ8 G;  5LL6 S;  1QVF B;  1HR0 L;  4LF5 Q;  4X6A H;  3OZV A;  3L0O A;  4B9W A;  4ILW A;  2F0V A;  2JDI A;  1S5E D;  4WZK A;  4B9X A;  5C3X A;  2NVY H;  1Z47 A;  3KF8 A;  3P1H A;  1GO2 A;  1EY8 A;  4ROX A;  5IYQ A;  1A63 A;  3PMF A; 
#chains in the Genus database with same CATH homology
 1ZKO A;  1V0E A;  4ZKC B;  1U4R A;  3M85 A;  1DOM A;  2PW5 A;  1I4X A;  4PV1 C;  2ZXR A;  1MBY A;  3NWS A;  3OOC A;  4QB4 A;  4F87 A;  1JIC A;  5CV9 A;  4QUF A;  4XQN A;  3GVL A;  4C3H G;  3EVQ A;  3CP8 A;  3DMU A;  1HXY D;  1CHP D;  2M5S A;  3I4M B;  2X6W A;  1ENC A;  1KNE A;  3D3R A;  1ML0 D;  3FPP A;  1CTM A;  3OSO A;  5C6A A;  2F0J A;  5LL6 X;  1EEF D;  3VR6 A;  1GXD C;  5M5Y B;  1F77 A;  5IGC A;  2B2W A;  4RCO A;  3U9O A;  2OT2 A;  5FO7 B;  4A3B B;  2DIE A;  2MUY A;  1G29 1;  3RUZ A;  5DM6 3;  1I50 B;  1OXV A;  2AWN A;  3WQZ A;  2R93 B;  3IAY A;  2L11 A;  1I6V C;  3MTS A;  2F43 A;  3SHL A;  3I70 A;  2ICI A;  1CA6 A;  2F4I A;  3ZYY X;  3MXG A;  3A3G A;  4DF7 A;  2ZZF A;  4F88 A;  5KGU A;  1F9Q A;  4QCL A;  5HUR A;  1TKW B;  2NUC A;  3Q24 A;  3HRZ C;  3A7A B;  1EFI D;  4XL9 A;  2PQE A;  5CV5 A;  1S5F D;  4O1N A;  4HR7 B;  4XNF A;  1BCP B;  4F8M A;  3VR4 A;  4U68 A;  4BBR B;  2VNU D;  4NMZ A;  1PFM A;  2KUM A;  1FGB D;  1R4P B;  5IGF A;  4KY7 A;  3ERO A;  3A3B A;  4DU9 A;  2E74 C;  2EXZ A;  5BN5 A;  2GJR A;  1JWU D;  3I4N B;  1I6H B;  4RFB A;  1H9M A;  1XXG A;  2B63 B;  1JWS D;  2ZTN A;  1PRT F;  2ZXI A;  3S17 B;  3JAM L;  3W3A A;  4HCE A;  2BOS A;  3CKI B;  1RD9 D;  2F0Q A;  5EQ0 A;  1BQQ T;  2AUJ D;  2EY1 A;  5EKL A;  5JEA G;  1MSG A;  4B3G A;  1I4Q A;  2BDN A;  1PMR A;  3K5N A;  1VCI A;  1JC7 A;  1M8A A;  4OO1 G;  3NUC A;  1NCV A;  4KV6 A;  3ERQ A;  1H9K A;  1DXM A;  3OIP A;  1OO9 B;  3PUV A;  2F3W A;  2NVQ B;  3M7N A;  3IKJ A;  2RDF A;  1GUW A;  2WAQ B;  1HA6 A;  3GD7 A;  4FXG C;  1KDA A;  5M9O A;  4DAV A;  4HAE A;  1TU2 B;  1SYB A;  3EJI A;  3ZPN A;  5EPJ A;  2L5T A;  3QG1 A;  2D62 A;  1ILQ A;  4IUR A;  4FXK C;  2E2D C;  4HCS A;  3HG9 A;  1UD3 A;  3QOL A;  5AFW A;  3U9S A;  2KOL A;  1BBX C;  5IK2 A;  3BG3 A;  1QOH A;  1PFB A;  3BC9 A;  5CV6 A;  4FO2 A;  5CGK A;  1SJE D;  1OXX K;  2F0D A;  3AMU A;  4II2 A;  2K28 A;  4M1U B;  3GTJ B;  3H3V C;  3A55 A;  2HDM A;  2B8F A;  1Z7T A;  2HQE A;  4XQJ A;  4NKL A;  3TP6 A;  5A2Q E;  3QB3 A;  5IGG A;  4CGY B;  5CBA E;  1W6K A;  2K04 A;  3OWF A;  1C48 A;  1HPC A;  1J8I A;  3K5O A;  1AP0 A;  2IPK D;  1D2B A;  5BN4 A;  4IUT A;  1KDB A;  1S5D D;  4OIK A;  1HRJ A;  4K5W A;  1O7Z A;  1A3V A;  1XWE A;  2ZXO A;  1LTT D;  4P22 A;  5IT9 E;  2RVL A;  2QE7 A;  3RMH A;  3MFY A;  2HDL A;  1KAA A;  4G57 A;  1AEX A;  4C3H B;  4XKW A;  1IYU A;  4P2C B;  2L1B A;  1G91 A;  1H9J A;  2CK3 A;  3QIA A;  1UAP A;  2F0M A;  2PZU A;  1HA5 A;  1G6Z A;  4G7H C;  1STB A;  2QEJ C;  4A3K B;  1XYI A;  2A6E D;  1ENA A;  5KEE A;  1LTA D;  3PO2 B;  2ID0 A;  2LFN A;  4XQQ A;  1L0Y B;  2D5D A;  2EYL A;  1CI3 M;  1SNO A;  1D1K A;  4RKB A;  1U4M A;  1BCP F;  3T4A C;  3PUY A;  4ZKB B;  4OIJ A;  2B2U A;  4NDX A;  1ZYR D;  3GVK A;  2NVX B;  3BZD B;  3GP7 A;  1QWY A;  3KEW A;  1VJS A;  1B44 D;  3DUZ A;  1KLU D;  5EKI A;  2KEE A;  1IYV A;  2IX0 A;  4IUV A;  3I72 A;  1BXT A;  3EFX D;  1UD5 A;  2XWJ B;  2AQ2 B;  4RGO S;  1PTO D;  2AWO A;  2B2U C;  1E2W A;  3T53 B;  1KLG D;  1QG7 A;  3VYS A;  4ASU A;  4MIU A;  4H44 C;  5EPL A;  4L8J A;  2K5D A;  1UEA B;  3BVZ A;  3I73 A;  4BBS B;  2IWH A;  2V7Q A;  1HUM A;  1TWG B;  3DEP A;  2ZT9 C;  3FRP B;  4FF3 A;  1YNJ D;  2FFK B;  1IHZ A;  3VYR A;  5ISR A;  4IUU A;  1PZJ D;  1G8Z D;  2R3Z A;  3MHB A;  2JE6 I;  4FF1 A;  5C4Z A;  4QF4 A;  1QE6 A;  3URY A;  3K57 A;  3AU7 A;  5M5W B;  2JYO A;  2JA8 B;  2MP1 A;  3UI2 A;  1O7Y A;  2XZP A;  1MAB A;  2HUG A;  2WIN B;  3K5L A;  2XOK A;  4XKV A;  3C2P A;  4FP5 D;  1BPL A;  2N88 A;  2K7V A;  4DGZ A;  3TZU A;  1JB3 A;  2M2L A;  2PPB C;  2W6I A;  2A73 B;  2ZZE A;  4A3D B;  1SSO A;  1LTG D;  3H09 A;  4PMW A;  4B08 A;  5EBD A;  2MPM A;  2ICE C;  4V19 0;  5I9O A;  5I2X A;  1TWA B;  4XLF A;  2A6E C;  2F0F A;  1B9M A;  1K8M A;  1Y8P B;  3NQI A;  4K6D A;  1GOZ A;  1V1O A;  2PZT A;  4PMB A;  1B50 A;  1K28 D;  3GTG B;  4J1M A;  1I3Q B;  2A68 C;  1TS3 A;  3G05 A;  2XWB B;  2LZJ A;  2BDO A;  4UDU C;  2XGJ A;  3NWT A;  1CM9 A;  3KUP A;  1WTP A;  2NVT B;  4DN4 M;  1L0X B;  1ZYR C;  4CBV A;  5C0X J;  1SE3 A;  4CJ1 B;  1SAP A;  1LTS D;  3FEW X;  3M3Y B;  5FO9 B;  4BY7 B;  1W0J A;  1ONL A;  3DXJ C;  1H9S A;  4MN3 A;  1PTO C;  2KCN A;  1PRT B;  1KAB A;  2XN9 C;  2YU9 B;  1I18 A;  1STG A;  5C3E B;  3GO5 A;  1W9X A;  2JIZ A;  3J7Y W;  3IFD A;  1Q3L A;  3RZO B;  4Z1M A;  2B2V A;  2LKV A;  4Y7N B;  1SXT A;  1AZQ A;  4EGV A;  3VA7 A;  1EZ8 A;  2A74 C;  2ZXP A;  1EZ6 A;  3BVM A;  1YNJ C;  2Z6B D;  3SDZ A;  2Z4H A;  5M3F B;  1EU4 A;  2K6A A;  5T1G A;  4LAA A;  2DY7 A;  2E2H B;  4I65 A;  2GK6 A;  2QF7 A;  3BDO A;  4OO1 I;  2K32 A;  4KKT A;  2B2V C;  3O13 A;  4XT1 B;  3GVJ A;  3A35 A;  3RZD B;  1OXS C;  3QO2 A;  3V2T A;  2X69 A;  1EY0 A;  3NXW A;  4MHE A;  3JAM E;  2PCF B;  5CV8 A;  4BWG B;  4IFD I;  5LHY 1;  3R3O A;  4XQF A;  3QOJ A;  3S1Q B;  1TR5 A;  1HCZ A;  2WKC A;  4KD3 A;  2VJI A;  2Y0S B;  1II3 A;  1PTO H;  3NQT A;  4XXE A;  3SK8 A;  1QJO A;  2R61 A;  4RCN A;  1R4Q B;  4XN3 A;  3LWU A;  3C1F A;  1U4P A;  1D6E C;  3M4O B;  3CP2 A;  4AVZ A;  5C0X H;  3HEJ A;  5KRU A;  4J8Q A;  1U4L A;  4A93 B;  1MGS A;  3H6M A;  3BVG A;  4UZU A;  3KLS X;  4AYB B;  4DAP A;  1F2Y A;  4RWS C;  3R8B A;  2EYO A;  1IL8 A;  1SE4 A;  4OL7 A;  1UD8 A;  1I4H A;  3I8Z A;  2J4X A;  3MFG A;  3NK9 A;  3MXP A;  1FD7 D;  5D14 A;  1SNQ A;  1J9O A;  1BCP D;  1DD2 A;  3C3L A;  1NR2 A;  2Z1C A;  4NW2 A;  1PZK D;  1BLI A;  5C44 B;  2IJ0 A;  5IGB A;  1Q12 A;  2EY5 A;  3VYT A;  2E2I B;  2LS0 1;  5I6Y A;  4GQN A;  3HP3 A;  2B2W C;  3SXH A;  2AQ3 B;  2ENB A;  3SEB A;  1JCK B;  2SNS A;  5I4D A;  1QNU A;  1D5X C;  4ULL A;  3T13 A;  2XIW A;  4ZQ3 A;  3W2D A;  2VXW A;  4HMJ A;  1OB0 A;  1UD6 A;  2TSS A;  4LK1 C;  2JEB I;  1DZ1 A;  4XOR A;  1QNK A;  1DOK A;  1ESR A;  4EQN A;  2RA4 A;  3K5M A;  2BA0 A;  1TY2 A;  1NRK A;  1O80 A;  4II3 A;  4FVM A;  2EYF A;  1HFG A;  2A6H D;  3NPP A;  2X53 S;  2BCO A;  4OHJ A;  1V1P B;  3CES A;  2NN6 I;  4C3I G;  4DK0 A;  1SDF A;  2FJ2 A;  1E3Z A;  4ODG A;  3OMC A;  4HTH A;  3OEE A;  3VYU A;  3ONA B;  2G9H D;  4KHZ A;  4QMG A;  1PDQ A;  1Q1E A;  3D4W A;  3HOV B;  4TQU S;  4FF4 A;  1QIL A;  2CVR A;  1XX8 A;  5CV4 A;  1RKN A;  3NTI A;  1F2M A;  2V31 A;  3J80 E;  4KI0 A;  2NTT A;  4YIJ A;  4CKB A;  1RHP A;  1TT2 A;  1EY6 A;  2K01 A;  4K14 A;  3SVM A;  1EY4 A;  1HVX A;  2FMM A;  5C0X G;  3S2D B;  5JAV A;  1EYC A;  4O42 A;  1TWC B;  2F0N A;  4YEL A;  3OIQ A;  2XZL A;  1M4V A;  2RSN A;  1BCP C;  4BS9 A;  1K83 B;  1S5C D;  2QIL A;  4HN7 A;  1WTH D;  4X3S A;  2HLD A;  3S1R B;  2F0I A;  2WAC A;  2NTS A;  1CZW A;  2RDG A;  2AUK A;  4IN3 A;  3DWA A;  3LX0 A;  3DHQ A;  2E76 C;  4ZAI A;  2F0P A;  2H1E A;  1JWM D;  3PUX A;  1H8H A;  5FK9 C;  4FXD A;  4KJO A;  4ID6 A;  3OWE B;  3A8J E;  3FKS A;  1A15 A;  2O2L D;  2WKD A;  2XVS A;  1F2L A;  3TBI B;  3S1N B;  1VF5 C;  4TT3 A;  1JR0 D;  2DNC A;  1WTW A;  3GTO B;  4A3F B;  2PZW A;  1A3U A;  2SEB D;  4G7Z C;  1GUT A;  1UNS A;  4H7B A;  1FNW A;  2VB3 X;  1MD2 D;  3BH4 A;  5FKA C;  2EY2 A;  2JJ2 A;  2KQ3 A;  4LMQ D;  4HED A;  2OEO A;  3NP8 A;  3HGB A;  4NNJ A;  5FL7 A;  4UAI A;  1BNZ A;  3VR2 A;  2A6H C;  2F0G A;  3Q6S A;  4G4K A;  2GJK A;  1SNM A;  3LNN A;  1Q8I A;  3VR5 A;  1PYW D;  1GUO A;  2C9O A;  3R2I A;  4K5X A;  2KJX A;  4CJ2 C;  4IUQ A;  5CR3 A;  4RAU C;  1Y8N B;  4G7X A;  1F9P A;  5D3I B;  1ILP A;  2K05 A;  3J81 L;  4NP5 A;  1UD4 A;  2PYK A;  1B3A A;  2CQA A;  2F3V A;  3K0Y A;  5EGT A;  2F03 A;  2A68 D;  3K58 A;  3QWN A;  1G2S A;  4DXF A;  5BN3 A;  2CHB D;  3J80 L;  1LO5 D;  2V4D A;  3G7L A;  2BA1 A;  3OEH A;  4IUP A;  3HOX B;  5ELE A;  3WOF A;  2J7Z A;  4EQP A;  1H8E A;  3CMM A;  5NUC A;  1E79 A;  3CRL C;  4XLC A;  1CQV A;  4V0B A;  2F0E A;  3GTL B;  2EY6 A;  2RKS A;  4U67 3;  3HOU B;  3BCF A;  4Q5V A;  1C8C A;  1YNN D;  1JOK A;  1EFR A;  4ZUJ A;  1HQR D;  1OHH A;  1I8D A;  4G7W A;  4B3F X;  1Q1B A;  3BS1 A;  4BA2 I;  5IGD A;  1TY0 A;  5DNF A;  4TSS A;  1B9N A;  2GA4 B;  5FO8 B;  5I6W A;  3ZIA A;  3X3N A;  2WP8 J;  1EU3 A;  3PO3 B;  2F0H A;  1E3X A;  1A2T A;  2PW7 A;  1SFO B;  2GK7 A;  1IKM A;  5DEH A;  2NBF A;  3MXN A;  2O5J C;  1E1R A;  3HS0 C;  1D5Z C;  1WD0 A;  1ZEQ X;  4C3I B;  2E1B A;  3D8G A;  4K5V A;  3S14 B;  4GZY C;  3BYY B;  1FYC A;  5ELB A;  1CQF A;  1HTP A;  2XRQ D;  3E6Z X;  1WTV A;  2TMP A;  2I07 B;  3BCD A;  4R9W A;  3TN2 A;  4XM3 A;  2SNM A;  2GJP A;  4ABN A;  5CDF A;  1X3P A;  5T1I A;  4KD4 A;  4X3U A;  4F7X A;  1VDZ A;  1W0K A;  2NVY B;  5IGE A;  3PUW A;  3RD4 A;  1MI2 A;  1E0B A;  1TS4 A;  2FIN B;  5C5L A;  2K1B A;  3PIP 3;  1PXU A;  2EVB A;  3I91 A;  1LTR D;  1KNA A;  2KA7 A;  2NZ1 D;  3T16 A;  5J22 A;  2D2C C;  3E0J A;  2R6G A;  3A56 A;  3Q22 A;  3I4L A;  4JMQ A;  2O5I C;  3G6J B;  4FXU A;  1AN8 A;  1O78 A;  1CT1 D;  1PRT D;  3WOE A;  1TII D;  5HGT A;  2NB0 A;  1AZP A;  5M5X B;  3HOY B;  4RHS A;  3TME A;  1GJX A;  3TSS A;  1DJR D;  2AQ1 B;  3P20 A;  1LAC A;  3FPU B;  3L7Z C;  4HIZ A;  5CMD A;  1PKV A;  1O7L A;  1S5B D;  1EYA A;  5JEA J;  2BE5 C;  1ET6 A;  5C4X B;  5EPK A;  1H9R A;  1R9T B;  3WDN A;  3BDC A;  4I7Z C;  3A54 A;  1NSN S;  1LT4 D;  2DN8 A;  4C2M B;  1CK1 A;  4CKC A;  1YNN C;  1VMP A;  4XON A;  2QKI C;  4IFD J;  5COR A;  5FLX L;  2IX3 A;  1LT5 D;  3OPO A;  2K5Q A;  1BMF A;  2PNR C;  2E2J B;  2M9V A;  1BR9 A;  1GHK A;  3Q23 A;  1TWF B;  4TKO B;  2JA6 B;  1X3Q A;  3NTH A;  4XR6 A;  2W6J A;  3KLS A;  4K8I A;  4A3I B;  4C1N K;  1UD2 A;  4DAY A;  2R9V A;  4ZLT F;  4KKS A;  2VUM B;  3TP5 A;  3K7A B;  4XOP A;  4RKL A;  3NBI A;  2VB2 X;  4JBW A;  3PUZ A;  2L0C A;  1RTN A;  1EIG A;  2H4O A;  1A3T A;  4HSV A;  1EOT A;  1PFN A;  1AW7 A;  4YEJ A;  2CW0 C;  2F0U A;  5JVH 3;  1VLY A;  3MWY W;  3HKZ B;  1DYQ A;  5COY A;  4FNF A;  2RSO A;  1WTR A;  1IKL A;  4KTA A;  5IOC A;  5G3L F;  3MZ5 A;  2B8G A;  2XSC A;  3D4R A;  1ZXT A;  3MC0 B;  5JEA H;  3NBH A;  2WII B;  3C46 A;  1WTX A;  2L4N A;  1HQM C;  3JU4 A;  4OO1 H;  1D5M C;  1STN A;  3FKI B;  2MJ8 A;  4RHR A;  3OFN A;  1PRT C;  3HZX A;  2B39 A;  1SEB D;  2WPD A;  1EY5 A;  2F0T A;  4IFD H;  2YYZ A;  2KVO A;  4KMU C;  3SK4 A;  3MA2 B;  4KKU A;  1WCM B;  1DOL A;  2FMC A;  1Y69 U;  1E43 A;  1V0F A;  4E6I A;  4TRD A;  1OXU A;  1PTO F;  2F0O A;  2F0W A;  4K2L A;  4LJZ C;  2EYM A;  1NUC A;  2WV6 D;  4H13 C;  4K2K A;  1KZL A;  1JE4 A;  2MHV A;  2PO4 A;  2K33 A;  4RGN A;  4A3E B;  1UUP A;  3KBG A;  3TDQ A;  2Q8I B;  5KND A;  1EY9 A;  5F2D A;  1VF7 A;  4K6L A;  2JP1 A;  1EL0 A;  5EJW A;  1T5E A;  1PZI D;  1EQV A;  2EYP A;  2Q8R E;  1SNC A;  2O4X A;  3I3C A;  4L6T B;  3QJY A;  1STE A;  3KBX A;  3GTP B;  4E0F A;  2IL8 A;  3M4Y A;  1DCZ A;  3CQZ B;  3R93 A;  1DON A;  3I90 A;  1NR4 A;  1JOR A;  1S4Z A;  1G2T A;  1COW A;  1Y1V B;  3FVQ A;  1FR3 A;  1GUG A;  4XYO A;  4XLA A;  1SMY D;  1SJH D;  4XDX A;  5DM7 3;  3DDY A;  5IIF A;  2ZZQ A;  4ZK9 B;  1RCV D;  1RF2 D;  4XLH A;  1VMC A;  2FHT A;  1TQO A;  4Q0F A;  1OXT A;  3DM1 A;  4XIG S;  1GUS A;  4DXG A;  3GV6 A;  3RLF A;  5I9P A;  1WPC A;  1IW7 C;  1WTQ A;  1TS2 A;  1F2Z A;  5IOD A;  1B53 A;  4QIW B;  3J81 E;  5ELC A;  4M8A A;  1MSH A;  4WJW A;  5CYU A;  2OF1 A;  4BA1 I;  5EKK A;  4G6I A;  2XND A;  2EDG A;  3N6R A;  3C1E A;  4KY6 A;  4DFA A;  4DK1 A;  4K8J A;  4XD7 A;  4DNR B;  3S15 B;  5DAU A;  4N9P A;  2Z8L A;  5JJZ A;  1B2T A;  2A69 D;  1TWH B;  2F0K A;  5C4J B;  3EQL C;  2WB1 B;  2JXM B;  3V05 A;  2NN6 H;  4C3J G;  4YXW A;  3D6C A;  2X6G A;  1E1Q A;  5JOB A;  2KVM A;  3K6O A;  4XYQ A;  1I4P A;  1V1P A;  4CHT B;  4RH6 A;  4WFN 3;  2MGS A;  1I4G A;  4EQO A;  2ZZG A;  2XRS D;  4DA2 A;  1GHJ A;  4HMI A;  1DM0 B;  5E3F A;  1X32 A;  1FNV A;  4IFD G;  1D1I A;  3MEH A;  4ZRZ A;  3S16 B;  2Q8T A;  4KY5 A;  2R7Z B;  3OMG A;  4KHV A;  4HSP A;  2JA7 B;  5CC4 A;  1B4O A;  3EA6 A;  3OHX C;  4XT3 B;  1WVL A;  1CFM A;  2KEC A;  1LV9 A;  1BUV T;  1B1Z A;  3DWP A;  3GTQ B;  4ZUI A;  2KED A;  1WTO A;  1EEI D;  3NHH A;  5ELF A;  2A5H A;  1SYG A;  2F0L A;  1NAP A;  2OXP A;  3P7J A;  3DEO A;  5J1Z A;  4IUN A;  5KYL A;  1HUN A;  1HZE A;  2KCC A;  4R8I A;  2N55 A;  1EIH A;  1EWC A;  2WZP P;  4RGT A;  3P75 A;  4PNY A;  3IFT A;  2K03 A;  1Z6H A;  5K36 H;  1F9S A;  5D3D A;  3PV0 A;  1XTC D;  4A3M B;  1HTL D;  2WJY A;  1LLR D;  4CKE A;  1EQT A;  1SMY C;  5A35 A;  4XN0 A;  1ET9 A;  1KDC A;  5JPM C;  1SYE A;  3HAG A;  1BOS A;  2EZV A;  1SND A;  4QUC A;  3SR1 A;  5DN6 A;  2QDB A;  1Y8O B;  2EPB A;  2R92 B;  3S2H B;  2F0S A;  1QB5 D;  4DNT B;  1HHV A;  4EVO A;  4RGM A;  3R2T A;  3L9A X;  3GV3 A;  3Q0A A;  3S1M B;  3HOW B;  3N52 A;  1A2U A;  1SBB B;  1SYC A;  3TZD A;  4BY1 B;  2EOT A;  5C5M A;  3HOZ B;  1CA5 A;  5G3L D;  2SOB A;  2A69 C;  2EYH A;  2BE5 D;  4N9T A;  1HFN A;  1FX0 A;  1FNU A;  1STA A;  2IW3 A;  3S9W A;  3H91 A;  2X85 A;  3H0G B;  4X3K A;  2X6Y A;  1V43 A;  2RBM A;  3D4D A;  3MVV A;  2RDH A;  3NE5 B;  3E5S A;  3PIO 3;  3CHB D;  5FLX E;  1RDP D;  1ESF A;  5M3M B;  2EE1 A;  3J7A F;  3F2U A;  3OW7 A;  2NN6 G;  3NTK A;  3KLR A;  1AFP A;  4H0L C;  1I4R A;  1TS5 A;  2IX1 A;  1ICW A;  2M00 A;  1PLF A;  3X3M A;  2D3L A;  2JJ1 A;  2EJF C;  3D31 A;  4PQX A;  3SK6 A;  3BDL A;  2WSS A;  3DWQ A;  4XTC S;  2L12 A;  3AB9 A;  3IL8 A;  5JVG 3;  2XNA C;  1GUN A;  3LWE A;  2RQX A;  2X6L A;  5KNL A;  3SK5 A;  1F9R A;  5KYI A;  4X3T A;  3KK7 A;  1C4Q A;  5J39 A;  4R8N A;  1WD1 A;  2HCC A;  3L3O C;  2XZO A;  1SE2 A;  2KHS A;  1JOQ A;  4G7O C;  5KNB A;  2D3N A;  4KN7 C;  3VA5 A;  5C4H A;  2C5C A;  5I2Y A;  3A8K E;  1JOO A;  3FMC A;  4XMY A;  4C1N I;  2B2Y A;  2JA5 B;  1SYD A;  3TP8 A;  2DNE A;  4FF2 A;  4WOR A;  4IQZ A;  1TVX A;  4CJ0 B;  2CW0 D;  1A6X A;  3A8I E;  5A2Q L;  2JSO A;  2ZTG A;  1EYD A;  1PTO B;  1KTK A;  1LT3 D;  1BF4 A;  2PMZ B;  5K36 G;  1ENF A;  5ELD A;  1SYF A;  5E1F A;  1SKY B;  4L63 B;  4C3J B;  2B2Y C;  2K5W A;  2ZXH A;  5IT9 L;  3V96 A;  1WP6 A;  3TP7 A;  2L9H A;  2L55 A;  2EJM A;  3GTM B;  2LMC B;  4IAL A;  4ME5 A;  4FYD A;  1H9S B;  2EYJ A;  3CRK C;  3ND9 A;  4XOT A;  4ZYS A;  2NWG A;  1K8O A;  1E2V A;  5HKK A;  1Y1W B;  4TSF A;  1W6J A;  3MXU A;  4KJN A;  1EY7 A;  4J6H A;  4IZ8 A;  3K59 A;  3M7G A;  5D65 A;  1E2Z A;  1ROD A;  4KK7 A;  5CBE E;  1U9R A;  2HCI A;  3MAQ A;  3VR3 A;  1NBM A;  1CHQ D;  1SNP A;  2SDF A;  5E4W C;  5KIX A;  1CZG A;  3OAA A;  3T51 B;  5CV7 A;  2NYZ D;  3ND8 A;  4A3G B;  3FDT A;  3H94 A;  4JK1 C;  2F1M A;  3GTK B;  3D6W A;  1QCB D;  1V8Q A;  3SE0 A;  2Z4I A;  4XLE A;  5FOB B;  4C56 C;  4Z9C B;  4RA8 A;  1BO0 A;  1KMH A;  2JEA I;  1LTB D;  3CU7 A;  5C3W A;  3BYT B;  3GQB A;  2EJG C;  2G9D A;  3ITP A;  2QCP X;  2IT1 A;  1LT6 D;  1BDO A;  2J0T D;  2D9U A;  2LY7 A;  3NSW A;  5JPN C;  2B2T A;  1LTI D;  5KNC A;  5K5P A;  4KN4 C;  1Q90 A;  1STY A;  1STH A;  4OGQ C;  1RJT A;  2VJJ A;  2I46 A;  1RTO A;  4WRD A;  4PMC A;  1JQY D;  2E75 C;  4A3J B;  1T5X D;  3OE7 A;  1LAB A;  2WJV A;  3J7A V;  1EWH A;  3A7L A;  5C0X I;  5E4X A;  4S3S A;  3T56 B;  2DY8 A;  1IW7 D;  5EBC A;  2X8K A;  2B2T C;  5TSS A;  2X6X A;  5LL6 S;  4B9W A;  4ILW A;  2F0V A;  2JDI A;  1S5E D;  4B9X A;  5C3X A;  1Z47 A;  3KF8 A;  3P1H A;  1EY8 A;  3PMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...