3OOCA

Crystal structure of the membrane fusion protein cusb from escherichia coli
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
297
structure length
297
Chain Sequence
TQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the membrane fusion protein CusB from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Cation efflux system protein cusB
total genus 40
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00529 HlyD HlyD membrane-fusion protein of T1SS
A PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3oocA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3oocA03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3oocA01
4DNTB 2BE5C 2IT1A 2K33A 1OXXK 2D62A 3T51B 1QJOA 1OXSC 2QF7A 2JXMB 2F1MA 1BDOA 1HPCA 2E75C 2D5DA 1VF7A 2AUJD 2YYZA 3A8KE 4G7ZC 2V4DA 4KN7C 4LK1C 1Y8OB 4BA1I 4BA2I 3QG1A 3VR3A 4KKTA 1FR3A 4KKUA 1CTMA 3SDZA 3NE5B 2A68C 4IQZA 1DXMA 2O5IC 1HQMC 4KN4C 2B8GA 1GUGA 2R6GA 3IFTA 2DNEA 4H0LC 2BDOA 4KI0A 3PUXA 4XTCS 2L5TA 3SE0A 3I4LA 5K36H 3I72A 2A6ED 3CRKC 3ND9A 3A7AB 1OXUA 3MXUA 1H9SB 3A8IE 1IW7C 3M85A 4OO1G 3I73A 2AWOA 1GUOA 1GUSA 2DNCA 2NN6H 4H13C 1Q1BA 2K7VA 5K36G 2EJFC 3A7LA 5C0XH 1O7LA 1Q1EA 4TQUS 2E76C 1DCZA 2PNRC 3EQLC 4H44C 1A6XA 2A69D 2PCFB 2KCCA 1CFMA 3QIAA 5BN5A 1LACA 3H94A 1E2WA 2BE5D 3LNNA 1ONLA 1VF5C 3BG3A 3PUWA 5BN4A 3DXJC 4I7ZC 1ZYRC 3ND8A 1B9MA 1Q90A 3D4RA 1Y69U 2JE6I 1GUNA 1V8QA 1IYUA 2A6HC 2EJGC 4L8JA 5A35A 2O5JC 2A6HD 3BDOA 4OGQC 3A8JE 1YNNC 3AB9A 3PUVA 2JEBI 3MFYA 3PUZA 4KMUC 3FMCA 1T5EA 1DD2A 3N6RA 2PPBC 1Y8PB 2B8FA 2LMCB 4JK1C 1Z7TA 3M4YA 2BA0A 1FYCA 1G291 4DNRB 1LABA 5BN3A 2A68D 3M7NA 1Z6HA 5C0XG 1OXTA 4G7OC 2NN6G 1GHKA 3PUYA 4OO1H 4TKOB 3CRLC 4LJZC 3VR5A 2D2CC 3T53B 1B9NA 1E2ZA 4KKSA 4RCNA 3VR4A 5JEAH 3OW7A 1K8MA 5KNCA 3HGBA 2Q8IB 1SMYC 1VDZA 1HCZA 1EWHA 2ZT9C 2BA1A 1I6VC 1YNJC 1GHJA 1H9JA 3U9SA 1Y8NB 1K8OA 3VR2A 3VA7A 1Q12A 4IFDH 2EVBA 1H9SA 1TU2B 3FPPA 3PV0A 2E74C 4PV1C 4HR7B 4XIGS 4DK0A 2JEAI 4IFDG 3OPOA 2NN6I 1H9MA 1IYVA 1VCIA 3OOCA 4JBWA 1V43A 2A69C 1CI3M 1H9KA 3VR6A 4G7HC 3GD7A 3QJYA 2DN8A 3TZUA 1ZKOA 5KNBA 5JEAG 3RLFA 2AUKA 3IKJA 2EJMA 3L7ZC 4KHZA 1TKWB 2CW0C 2K32A 3KLRA 3P20A 3WDNA 1IW7D 3W3AA 3D31A 2EDGA 2A6EC 1GUTA 3LWUA 1OXVA 1O78A 1GJXA 1E2VA 1PMRA 5KNDA 3T56B 1HTPA 3GQBA 4GZYC 4DK1A 1H9RA 2KA7A
chains in the Genus database with same CATH superfamily
1VQ5A 5IYPA 4GLXA 3M9BA 4KV6A 4P22A 4RD1A 5A2QE 2GJKA 1A3UA 2D62A 2L0CA 1BO0A 1VQ6A 4IUUA 1I3QH 1NUCA 2DJFC 2EZVA 1HPCA 1YNJD 2PI2E 5J35A 1BX0A 1STYA 1PH6A 4HJ9A 4C3JG 1EQTA 5J3BA 2CKZB 1EQQA 5T1IA 3E9IA 3RR5A 5C4XH 2Z6KA 4FO2A 1YITA 4DV4Q 4LFCQ 4G7WA 1GO2A 1N07A 2F4IA 2B8GA 5IT9L 1IHMA 3I4MH 1PH9A 3I72A 1QG7A 3CRKC 2KUMA 3A7AB 4FDBA 4ZV4A 4H13C 1GUSA 1UD5A 4RDJA 2I1LA 2Q2IA 2UXDL 1PFBA 1QILA 1QUQB 3BC9A 2YU9B 1TTTA 4YWKA 3I56A 4X07A 1KXLA 4H44C 3J81E 5IOCA 1N0UA 4WJ4A 3QIAA 5DSZA 2F0HA 1LACA 2EYMA 4Z4TA 1XNQQ 3ZZ0A 1OB5A 2WKCA 1NRKA 2YU9H 1YJ9B 1QVGA 1VHOA 1PTOH 1Q46A 3CCUB 4BY1G 4DR6L 4DV4L 1YNNC 2Q6LA 1YBYA 5A89A 3HOYH 4RG1A 1WPCA 4DUYQ 3MHPA 2EPBA 3BS1A 3I4MB 4A3JH 5DM63 3TRZA 1AFPA 3I4NB 4QIWB 3W2DA 4YHHL 1PH1A 1EU4A 3KUPA 2HIXA 1DG1G 5F2DA 5F4JA 4PC6A 3I70A 1E24A 5NUCA 3D26A 3FKSA 3V76A 2RCNA 1DM0B 4UDUC 2LXJA 3JAMc 5H5JA 4JI5L 1IJEA 1EIYB 2AQ3B 2GJRA 2VBVA 2VXWA 1FJGL 2BA1A 3GTLB 1WOPA 3ZYYX 3S15B 5JJLA 4GNXB 1S40A 1JT8A 1TS2A 4GLAC 2DY1A 3I90A 3KDFA 1X54A 3KFUA 1KNAA 4RKBA 2XSCA 3L9AX 4YY3L 2R6HA 1CM9A 4NNJA 1EYDA 4II2A 1FGUA 2BH8A 3I4NG 2VY3A 2CC2A 4BBRG 1TWCB 1F60A 2DN8A 5KYIA 1LM0A 5D3DA 3NTKA 2CW0C 3KK7A 1D1IA 1PYWD 2QW7A 4ULLA 3A35A 1AE3A 4PAAA 1PFMA 3CC7A 4XLCA 3I4OA 1E3ZA 1OXVA 5ELNA 4JI4Q 2ZXPA 1E2VA 2DY8A 2WB1B 1J6QA 2Z4HA 1NDHA 2JDIA 3J7A5 1TR5A 4CBVA 3FEWX 2M2LA 3J81k 2MGSA 2JA6B 4BY7B 1YNND 2NZHA 4DNTB 4L6TB 4HJ8A 1EZ8A 1ET9A 2KOLA 3R2IA 4LFAQ 1ELOA 2D3NA 4Z4YA 3TP6A 1B50A 4A3EH 4A3FB 1BDOA 3FKIH 1TWFB 1JWSD 4CJ1B 3A8KE 4G7ZC 4KN7C 1SNPA 1F9QA 1LTGD 1WSVA 4KKUA 2XRSD 1KD1C 2B3GA 3J7AF 3GVLA 3AFQA 4LBZA 3J80L 4NMZA 3WY9A 1U9RA 1FNUA 3MXNB 4EGVA 2ATWA 1WTHD 1V5VA 2JA5G 2DNEA 5FIUA 1CQXA 1K8AD 5FA6A 2JA6G 1NAPA 4MHEA 4JI4L 3NTIA 3MXUA 4JI1Q 1MBYA 1LT3D 4FVMA 3GTGH 1EFRA 1MIUA 3S2HB 1UD4A 3T4AC 5EQ0A 4JI7L 1NB9A 4DK3C 3A8JA 4EQOA 2XWJB 1WU8A 1DCZA 4OX9L 4R8IA 2F52A 1A3TA 2NVXH 2X6XA 4RWSC 1EWCA 2VQFL 1LO5D 4C56C 2JQOA 4LF9L 2EY1A 1QFJA 1BLIA 1BQQT 2FJ2A 5FOBB 1RKNA 1A2UA 1GR1A 3PO3B 3SJPA 3ULJA 2BPOA 5A35A 1FVIA 3J7YW 1NBMA 4DV1Q 1ENCA 3S1NH 2XTIA 4K6DA 2ZXIA 4XDXA 5CDFA 3RUZA 4NW2A 3C46A 1W0KA 3V96A 4HJAA 4A3IB 1TWGH 3FPUB 5C0XI 3OZVA 4RD4A 3WNDA 1Z6HA 1BVSA 1Z47A 5IGBA 1EFCA 2NN6G 4LAAA 1SNMA 5KW9A 4IPHA 1N34Q 4QQBX 1D5ZC 1O7IA 3HOWG 4OO1H 2GK7A 2EXZA 3GO5A 3A3GA 2BGJA 5LHY1 3Q24A 1GUWA 2I5MX 5AJ3L 3MFGA 1MHWC 2K03A 1VQJA 2F0SA 3TZDA 1GJRA 2JA5H 1R9TH 3L2PA 1YNJC 1H9JA 1HR0W 4UP9A 3AEVA 4HSPA 2C4TA 3LQ6A 1WVLA 3ZUGA 4DV7L 2NVQB 4YAUA 3NENA 3V2TA 4HTHA 4AIMA 1CI3M 2Z1CA 4KLKA 4A3EG 1R5NA 2WAQG 3F2DA 1GM5A 5JEAG 1RODA 1LTAD 1P8LA 4YXWA 2X69A 1N05A 3CCJB 1UMKA 3W2EA 2EJMA 4KHZA 2GA4B 1BCPC 3KLRA 4ID6A 4WZTA 1SR3A 1E3PA 2R7FA 2JJ1A 4A3DG 3SLDA 4QUZA 2F0OA 3T1YL 2R7DA 1C4QA 3OEHA 3CC7B 3IRBA 5JJIA 4RM0A 1S72B 4B9WA 1FJGQ 1BBUA 3GTJH 3AVUA 3OWEB 3HOXH 3DWAA 1R9TB 1TLLA 2O4XA 2IX0A 1K8AC 5DLQE 4DR3Q 1HHVA 1N06A 2HCJB 2E75C 2KVMA 1KHIA 4QB4A 2AUJD 5CC4A 1U4MA 3RN2A 1C8CA 4B4DA 1YZ6A 2ID0A 1V9PA 3I55A 4BS9A 1MJEA 3EIVA 5IYNA 2F0VA 2A68C 3GTPB 5JBQA 4FF4A 1HQMC 4XOPA 2WB1G 2Z6BD 1QUQA 2VNJA 3OSOA 2IL8A 2ZJRA 3S14B 3BY1A 2OF1A 1T6XA 1WJJA 5IYBG 1EXMA 1IXRA 1YHQB 4HSVA 4L5RC 3DHQA 3H0GH 1H9SB 3I91A 1CQVA 1D1NA 1K28D 3W1BA 3I4MG 5K36G 4PZ6A 4DR5Q 3T1HQ 2F03A 3CQZH 3KL9A 1QUFA 2FHTA 4X7DA 4YCWA 4LBWA 5C4XG 3HS0C 3BCDA 5L37A 3ASTA 5FL7A 4BY7G 1STHA 2D74A 3I1FA 3JU4A 5GROA 4EQPA 5IP9H 4HJ7A 3S2HH 1K83H 4DR7Q 1KD1D 4UP7A 4GNXA 4DV6L 1VQPA 5M5YH 3ZZTA 2XZOA 1JJGA 4EH1A 1JCKB 1N36Q 1KDBA 5EKIA 1I4XA 3K5LA 2Z6BA 1EIFA 1ZXTA 3PIP3 4AC9A 3NUCA 2EOTA 5JPMC 3OAAA 1FNVA 1E0BA 1W2BB 4GN3B 4XYOA 3ZJYC 4ABNA 2X6YA 3KF6B 4A93B 1PJ5A 1I94L 3FKIB 3SK6A 4G57A 3CMEA 4RD0A 1YNXA 1EP3B 5J1ZA 4OP7A 3BYYB 4JV5L 2L12A 2CRVA 1Y1VG 1K28A 2C5CA 1K0SA 2XEXA 4B44A 3K8AA 1KK0A 3K5NA 3AVWA 1YHBA 2L55A 4Y9UA 4IFDI 2EYHA 3OTOL 2VBUA 5IK2A 2VL6A 4JW0A 1DOLA 5IGEA 2MQHA 1RD9D 4G7HC 3D3RA 4IALA 2WAQE 5C3XA 4C3IB 2F0GA 3QFTA 1GKHA 1HH2P 5M3MG 2IWHA 4DR1L 4GLVB 1IKMA 3MXGA 1W0JA 2MP1A 2R3ZA 5LL6X 1HNZQ 3GVJA 2YTYA 2DIEA 4XLAA 2Q8TA 2UUAQ 4WZEA 3UDFA 1UE1A 4X65Q 4P3YA 1H9RA 5IYCG 1FNWA 2EYFA 2VQEL 3KJOA 3SJZA 4PC1A 2DGYA 5FO9B 5KRUA 4II3A 5TR9A 3BVZA 4JI1L 3G71A 2B2UC 2D9RA 4H7BA 2ZM6L 4POFA 4A3IH 2F0WA 4Z4RA 1LT6D 3FVQA 1E79A 3K57A 3CC4A 3I7FA 5EBCA 3CCRA 3U58A 4X62Q 5C3EG 5EMNA 3ZZUA 2VJJA 4QL5A 2BDOA 3KEWA 4Y7NH 5C4HA 4QV2A 3S9WA 4LFAL 2JA9A 1VJSA 4HIZA 1Q81D 1UAPA 3EA6A 1E43A 4YELA 4DV1L 2F0KA 1PTOB 1W6KA 1KRTA 3GTOB 1VQLA 4IOAA 5C0XH 4F7DA 1KC8C 3MHBA 1X3PA 4P1VA 2PNRC 2PCFB 1U5KA 2KCCA 2IW3A 2E2JH 4GKKL 3CCQB 1BCPF 5BN5A 3R6KA 2VB2X 4A4IA 3Q3AA 2ZM6Q 5C5LA 4HE6A 3OZWA 3QE2A 4P6YA 4R9WA 4I7ZC 3SKBA 4DAMA 4G6IA 1CQFA 1GUNA 3SK8A 1EZ6A 4TMZA 2IHEA 3OIQA 2N3SA 1LTTD 2E1BA 1L0WA 1PVOA 4JOIC 4X8IA 4ZK9B 1B7YB 4JK1C 4QJFA 4F7XA 1Z7TA 3M4YA 2F4VL 1W35A 1LTLA 3PF5A 2QEXB 3F2BA 1E1RA 2DETA 5FJ8H 3FPKA 1OXTA 2KEEA 1D7QA 5FO8B 4RD6A 3ZPNA 1NJID 2PW7A 4ZLTF 3FRPB 1D5XC 2AHOA 3Q39A 1CT1D 3IL8A 4IW3B 4LJZC 1B2TA 2LY7A 3VMFA 2VS1A 4QCLA 2N55A 2BOSA 4Z9CB 4A3LG 2RA4A 4JG2A 5D3IB 1K3RA 4DV2Q 1HTLD 1E7ZA 4A3DB 3FP9A 3SLNA 2J0TD 3I8ZA 1QZGA 1D8TA 2F43A 4PC7A 1B8AA 5KIXA 4A3IG 1MKHA 2IPKD 3H6MA 4TMWA 1O7ZA 5ELBA 4DR4L 3FJOA 3HKZE 4Q7JB 3CHBD 3CC4B 3UI2A 1IL2A 4R4CA 2PQAA 1EEFD 2Z4IA 2NZ1D 5IP7H 4JV5Q 2PZTA 3S1RB 2QKIC 3STBC 1SSOA 1BXTA 1PZKD 4OPSA 1QNUA 4JI2Q 3OZUA 1ICWA 4F87A 1QX4A 2DEUA 3CW2C 1U2RA 1VQFA 2N8NA 1A15A 1EY4A 1VF7A 3CCLA 4GQNA 2YTXA 2WJYA 1XTCD 1Q82D 4JI3L 1FR3A 2HUGA 2YTVA 1BOSA 2PMZE 1LTSD 2KECA 3TQYA 1SMYD 2X53S 5GV8A 4IFDJ 3VNUA 4KN4C 4KI0A 1HNXQ 2R6GA 3PO3G 5K36H 3S17B 1XMOL 5CMDA 4XMYA 2R7ZB 2KJXA 4NXML 1G2TA 1TS3A 2XIWA 3I73A 1JJ2B 4NB3A 1GXDC 3S2DH 1JOQA 3ES9A 4XQJA 1PH7A 4P12A 4RKLA 2F0FA 3ITPA 3S1QB 4FF1A 3SR1A 2X0KA 4DR2Q 3GVKA 3C3LA 1NE3A 3TBIB 2PYKA 1QFYA 2BE5D 2IX3A 1X3EA 3HOZG 1Q81C 3ND8A 1XFOA 2K5NA 3K81C 3E1YE 4DA2A 3CPWB 2ICIA 3L0OA 4O2DA 2LSSA 2AQ2B 3RNUA 1T5EA 1MI2A 2PPBC 1CNFA 2J7KA 1SDFA 4L5SA 3ONUA 1JOOA 1Q86D 2C4UA 1OGIA 2XRQD 4M8AA 1VQPB 4F8MA 3EJIA 5M5WB 3UDGA 4M53A 1TXYA 4M1KA 1VS0A 4C2MB 1HNWL 1JQYD 2HQLA 5B6IA 1E62A 2QEXA 3RLNA 4C3IG 4XQNA 4LC0A 2X6GA 1ENFA 1JOKA 1HQRD 4DV6Q 2D3LA 3BY2A 1K83B 1K8MA 1F2MA 2JJ2A 2L11A 1A62A 1EWHA 2JN9A 3G4SB 1RL2A 2J7ZA 1WTVA 2CK3A 3AGPA 1TWGB 1DONA 2NWGA 3K5OA 2QN6A 4NXNQ 1KL9A 2KENA 4DK6C 4ASUA 4ZKBB 4IFDG 4Z1MA 3KLWA 4PV1C 1SFOB 3T13A 2ALYB 4TMVA 1Q86C 2GREA 1LLRD 3NEMA 3PIOA 1I4PA 3CCSB 1DDGA 2F1LA 5HURA 1SFOH 5I4DA 3S14H 1Q9SA 1YLOA 2V7TA 4G5GA 3K80C 4ACAA 5EPJA 1PZJD 4JI8Q 1KAAA 3PIO3 3ER0A 3LWUA 4JC0A 5CGKA 3S1MH 1PMRA 5E3FA 3ZBTA 3QO2A 2HD3A 5HZBA 3I55B 1WOCA 2EIXA 1WFQA 4DR5L 3T1HL 2C9OA 3K58A 2R7ZH 4OIJA 1UD8A 4A3GB 3G6EB 1RQRA 1VHEA 1GVPA 1R4QB 2X3UA 5FLMG 2F1MA 1H42A 4MIUA 4TSSA 1OTCA 3GTMH 5C6AA 5LMNL 1V1PB 2SNMA 1JB7A 2UUBQ 4DR4Q 2B2VC 5G3LD 4DXGA 2M00A 1PHJA 3CCJA 2N49A 3PA1A 1VQOB 2O5IC 1WCMB 1UD3A 3NQTA 2R92H 3S16H 1PJ7A 4KJOA 1I4GA 3SE0A 1LTID 1EWYA 3IFDA 4RD2A 1OXUA 2B7CA 1M8AA 2MJ8A 1LYLA 3C1EA 4IPCA 3HOWH 3PUNA 4JOIA 4C1NK 4BXXH 4B9XA 3KJPA 4DAVA 4X64Q 4B3SL 3M3YB 2RQXA 2PE3A 3H09A 3P1HA 3NP8A 4DXFA 3NBHA 2Q2TA 4WJ3M 5ISRA 5M3FH 2QE7A 4LF7L 3ZIAA 2E2IB 3DEPA 3LVBA 4XLFA 1B1ZA 3D4RA 1TWCH 5DAUA 1VQNB 1I94Q 2EYJA 4QY7A 3G6JB 5EJWA 5IWAL 2IX1A 4OGQC 1G7CA 3PUVA 5EKKA 1TWAB 2DERA 5M3FG 3CCUA 4ZCIA 3ZBUA 1OHHA 4H9GA 3GTKH 3U6BA 2UUCQ 4M2LA 2BA0A 3CW2A 3UE0A 5BR8Q 4XD7A 1CNEA 2G9DA 4LF5L 3DLLA 2E5LQ 3BDLA 4JI7Q 3SK5A 2K5WA 4JYAL 4P9SA 2ZITA 2JN4A 2CWAA 3NSWA 2QMUA 4A3MG 4P72A 4P73A 2WJVA 1RIPA 1WOOA 1PA6A 1E22A 1DZ1A 3A5ZB 3ONAB 1T6ZA 3SEJA 2EVBA 4XIGS 3QFSA 4DK0A 1UWVA 3BZCA 4IUNA 3GDEA 4CQJA 1SJHD 3ULLA 3J81j 3AMUA 2ZXRA 2C77A 3KBXA 2F0PA 2G5DA 2RC6A 4XORA 1MABA 1BCPB 3MXNA 4FXKC 1EYGA 3HG9A 1FNMA 4LF5Q 2B7BA 4A76A 4C3IH 4YCUA 3DDYA 4A3MB 3P27A 2EDGA 1TIID 4GOPA 2EE1A 3BU2A 3E3XA 4C3JB 1S3OA 2F0DA 1HTPA 1PDQA 4PQXA 4A3JG 3MVVA 4GZYC 5KEEA 1WOSA 3OE7A 2JK8A 1PRTF 1L0XB 3W2GA 4A3EB 1UD6A 2OTLB 2MO1A 3CESA 3CCQA 1JMCA 4DV7Q 5K5PA 1EQRA 2VJIA 3HOUG 1AMOA 3QG1A 3BQJA 2M9VA 3NK9A 2RDHA 1MSHA 1J5EL 2F0IA 1KLGD 5IE8A 4ZCMA 1AZQA 3W5HA 4C0SA 3WQZA 4A75A 5IODA 3F2UA 1PFNA 3PCOB 4DV5L 4IN3A 2SNSA 4WQMA 1VQCA 4J15A 4IZ8A 2DY7A 1IW7C 2QTZA 2A74C 2PW5A 5C44B 1N32L 4X3SA 2PMDA 4ME5A 2MO0A 1O7LA 3OJXA 2L4NA 3M4PA 1TS5A 2F4VQ 3MA2B 2CW0D 2A69D 1YVCA 1S5ED 2HDMA 2K14A 4CDEC 2C5BA 4DAPA 1AP0A 4X06A 3MEHA 3P26A 4RCZA 1C48A 3BG3A 1X55A 3U4VA 4ZGQB 3GTLH 1J9ZA 5BSYA 4WFN3 2ZBVA 4PNYA 1EYCA 3VYUA 2V7VA 4DNIA 4QGUA 4BBSH 2A6HC 2OQKA 1EY9A 1SE8A 3BDOA 3MC0B 1DARA 1RJTA 2ZJPA 3HKZB 3PUZA 2CH4A 3G05A 1EFWA 5FLXE 1HUMA 4DR2L 2EYPA 4K2KA 4WZKA 1J9OA 3DMUA 1ILQA 4Z4VA 3U2QA 3ASSA 1B4OA 4HCSA 3UDXA 4OELB 3PUYA 4KD4A 3CMMA 1I6HB 1SNOA 3GTMB 3PA2A 2E1RA 3BH4A 3NBIA 4RCNA 3VR4A 3B78A 4BBRB 4CJ2C 2Q8IB 4LF9Q 1M90C 4JI6Q 2OEOA 2ZT9C 2NUCA 3A0JA 1DGSA 5FO7B 2ZTCA 2XOKA 2WYRA 4FXGC 5E7NA 4RGNA 1JWMD 2EYOA 5BR8L 3PV0A 2Q2UA 4OONA 3U50C 2B63H 1BPLA 2ZZQA 3CXCB 3NPPA 3UDIA 3HP3A 2NZOA 4HMIA 2WZNA 4A3LH 2X8KA 1JA1A 5E1FA 2YWGA 1VQMB 1ZM4A 1PTOD 4BY1B 1E1QA 1WTHA 3CCEA 1EFTA 2I46A 5C44G 1ZEQX 3TSSA 3E0EA 2PQEA 3PIPA 4JI3Q 1EY5A 1WCMH 1XXGA 4KD3A 3B82A 1S72A 2ZL5A 1GJXA 5AN9A 2TSSA 3GQBA 3H91A 4JI6L 5C4JB 1JJ2A 4CGYB 1HFGA 3U9OA 1JICA 1K3BC 3D6WA 2IT1A 4UZEA 4N8FA 3QOLA 4N8X1 5FLXL 1QJOA 2JA5B 1ML0D 4L63B 1IBML 1PYSB 4A3GH 1S5BD 1QNKA 1E1TA 2Q6IA 2V4DA 4MZ9A 1XTDA 1YHQA 2K5VA 1I4QA 3T1YQ 1WP6A 1EY8A 4C1NI 4QHYA 4YAFA 1Q7YD 3LX0A 3HOZB 5C0XJ 1EWIA 3A54A 4R4QA 4XXEA 5HXBA 5EPLA 1GUGA 4XTCS 4DUYL 3HOYG 5H59A 4UAJA 1RQPA 3ND9A 1VMPA 1EIHA 1G91A 3ASPA 2RHSB 3HOXB 3A8IE 2MNAA 5BSXA 4XQQA 3W1GA 4XQFA 3NTHA 1A0IA 4UHVA 3A7LA 2E2DC 1Q1EA 4KK7A 1VQNA 3PVDA 1HA6A 5EPKA 4K5XA 4RFBA 4OWWB 1KNEA 2K5QA 3JAML 1K9MD 1QFZA 3CCVA 2NTSA 4IURA 3DUZA 1ZYRC 3RZDH 3OFNA 3GV3A 3I56B 4S3SA 3S2DB 5D14A 4WORA 2KBNA 3WBKA 1O7YA 4EVOA 2F3IA 4HN7A 1FNDA 1LT4D 2VZLA 1C0AA 1B70B 2B8FA 4C2MH 2OCEA 2PO4A 2AQ1B 2VUMH 1G291 4DV0Q 3AVXA 4Z4SA 1YJNA 2VQFQ 2HCCA 4IOCA 5THXA 5EAYA 4XOTA 3KLSA 3RLOA 5JVG3 3CP8A 1CKMA 3CCMB 3E20A 1JB9A 1E2ZA 2F0TA 1KK3A 3GTJB 1GVHA 1PFSA 5E4XA 4E6IA 3CB4A 4QVAA 4QUCA 2QA4A 1FDRA 1S4MA 4LF8L 4K8JA 5A8AA 3BJUA 5M3MB 2XZLA 1I8DA 5GQOA 4DAYA 4J0QA 3CP2A 2EY2A 1B23P 2NB0A 3DM1A 3SK4A 3TMEA 4CDDC 2E74C 1VQ9A 2F0JA 1NNXA 3S1NB 5JPNC 1EFID 1Y1VH 5HY6A 2K01A 2KHJA 1PV4A 2E2HH 4A3GG 2QCPX 1XE1A 3BDCA 1YI2A 3URYA 5FO1A 4M1UB 1H95A 4DR3L 1KK2A 4XKWA 3WDNA 1EYAA 1IW7D 4RGOS 1SBBB 1HNXL 1HA5A 3JAME 2A6EC 2JIZA 1VQ8B 2EY6A 3BVGA 4RJLA 1WCMG 3PSIA 1C7YA 4U9UA 2B2TC 4A3BH 4MNOA 3NXWA 3G4SA 1A2TA 2F0NA 2Q6OA 3D8GA 2CBXA 3K59A 3K7AB 2KCTA 1U4PA 4P6VF 1DJRD 1AZPA 1TY0A 3T51B 3R3OA 3D4WA 4BBSG 1L2FA 3OTOQ 3A5UA 4IUTA 1RDPD 4LF7Q 2B63G 3BCFA 1STBA 2OBSA 4NCNA 1VMCA 1W9XA 2Y0SG 4L5QA 5JEAJ 5CBEE 3VDYA 1EP1B 4LBVA 3MZ5A 3SEBA 2ES2A 2PZUA 1UUPA 2K4KA 5GAGC 3DWQA 4EX5A 4IJLA 1K8GA 4ZYSA 4P26A 1NR2A 1JNYA 2DUDA 2WAQB 3I4LA 1SM4A 3I2ZA 1STNA 4IPDA 3HKZG 3A74A 1K9MC 5FNZA 4ZGNB 1GUOA 2FFKB 2C5HA 4YHBA 1NSNS 1PTOF 2OT2A 1WD0A 1P16A 2NVXB 3MWYW 4A3KH 2RSOA 2VNKA 3EROA 2O2LD 1PH8A 2HCIA 1QG0A 5C3EB 1JR0D 3LNNA 4B3MQ 2A19A 4NBSA 2R61A 3DXJC 3H3VI 2A5HA 2O5JC 1SLJA 2C2WA 1E64A 1Q3LA 3OMCA 1G2SA 3HOXG 2YWHA 1X3GA 1BUVT 3Q22A 1G7TA 1Y8PB 4B47A 4TN1A 1FYCA 4DNRB 2PQAB 2BGIA 2ZTDA 4EQ5A 1HA3A 1VQEA 5G3LF 1GHKA 4RHRA 4TKOB 4ZUJA 1PH5A 3A56A 1KRSA 3T53B 4K6LA 4BBSB 3WNBA 2K52A 4PMCA 2DJGC 3PMFA 4XN3A 1VDZA 1VQ7B 4QFMA 1KQSA 4B3ML 3S1RH 1X56A 1QWYA 5I6WA 1VLYA 3VNVA 3SXHA 3EVQA 4A3JB 4A3BB 2E2JB 4NP5A 2JEAI 4HR7B 1D8LA 2AMCB 3OIPA 3RN5A 2CH4W 1PKVA 2BF4A 4ROXA 1F2YA 1NBWA 1V43A 1EY7A 3KOJA 1FNBA 5KNLA 2AUKA 5M3FB 1TS4A 1E63A 3MTSA 3J80c 3PO2G 2OWOA 5JOBA 4A3DH 1D1KA 4OHJA 2JA8B 1KQSB 1VQ7A 1D5MC 4OXPA 2FMMA 5AFWA 1YIJA 4A93G 2GPJA 2QA4B 1IJFA 2OTJB 4KTAA 3M4OB 3DM3A 2V7QA 1VQ4A 1NMFA 3BZKA 1NJIC 3M4QA 4ME3A 1ASYA 4OOXA 2OK7A 2R92B 2YYZA 4LW1A 3TS0A 4ILWA 1W2BA 2WKDA 2NVYB 4LBYA 4QUFA 1RHPA 3VA5A 4B08A 1CHPD 2FMCA 2J4XA 1F9RA 2D0PA 2UUAL 4PC2A 1JORA 1I50B 5IYWA 1A8PA 1N33Q 4K1XA 2HHHL 4A3MH 2CQOA 4C3HH 4AYBB 3QWNA 3QSYA 3K7UC 4OO1G 2VBSA 3MCAA 1I18A 2NN6H 1STGA 4A3CH 1KDAA 3CF5A 1HUNA 4XLEA 3QFRA 2EJFC 4K5VA 3J7AV 3QOJA 1KJZA 4A3KB 3OMGA 2V31A 2R92G 4TQUS 4RCOA 1A6XA 1PRTC 3BYTB 3D4DA 4FNFA 4ZAIA 3ONYA 3GTOH 1X9NA 4PABA 1FX0A 2JP1A 1CKOA 3F8TA 3GTQB 5TSSA 1BMFA 5LMZA 1VF5C 4DUZQ 1ILPA 2WACA 1WTQA 3PUWA 1Y69U 5FLMH 3STBD 1IYUA 2F0LA 2CHBD 5CV9A 2RDFA 1B44D 1MJCA 4UY8C 3TP5A 1GAQA 4XR6A 4RA8A 1UE5A 4A93H 2HHHQ 2XZPA 1NTGA 2K04A 4RH6A 1DD2A 1QOHA 4N9PA 5D65A 3CD6B 2JSOA 2LMCB 3AVVA 1M1KD 2ZBUA 2EIFA 2F3WA 2JA8G 4RLZA 4A3CG 4G7OC 4BXXG 1H8HA 4DAYB 1XNRQ 1QH0A 4P3IA 2WFWA 1B9NA 1U4RA 2CQAA 4DFAA 4GS3A 1VQ5B 5KNCA 1LTBD 5I6YA 4DUZL 5J3OA 2NVTB 5ELCA 3WXMA 3SHLA 4JBMA 1U0LA 1JA0A 4PC3A 3W5OA 1Q12A 4PMWA 4WZLA 1H9SA 1PRTB 5C4ZA 4CJ0B 3MAQA 1PXUA 2NTTA 4P71A 1HNWQ 2NN6I 2JA7G 2KVOA 4FN5A 5IYQA 3J80i 1F9PA 2IHFA 1SN8A 3VO1A 1SYBA 1Y1VB 4ZKCB 4K8IA 4HIDA 1CKNA 5COYA 2V7WA 3PENA 5GAEC 1QGAA 2MHVA 3OJWA 5HZAA 3OW2A 1NCVA 1PZID 5CBAE 2B63B 4XL9A 3HFZB 3TP8A 3PO2H 4BPRA 2F0MA 1WTWA 3CP0A 5AJ3Q 1IZ6A 2QTLA 3HOVH 4YY3Q 1N32Q 2Q6KA 2RHQB 4RD3A 5M5XH 1KK1A 1SYCA 3Q6RA 5EGTA 2JA7B 2K33A 2R93B 1OXXK 1YEZA 3MMPA 2KHSA 3F1ZA 2IJ0A 4BBRH 2UXBQ 2Z8LA 4J6HA 1S5FD 4KHPL 1T6YA 3HOZH 1HR0L 3N52A 4BA2I 3G71B 3WWVA 1BF4A 2B2YA 2WV6D 3P75A 2OBRA 3A8IA 4FP5D 5CV4A 3S1MB 1UNSA 1TT2A 4H0LC 2ICEC 2EFGA 1IBLL 3KF8B 3RZDB 5CV6A 1XYIA 1G7RA 1WTPA 3RY8A 2DNCA 2CW5A 4LUZA 2N88A 2RBMA 3ERQA 3JAMi 5CORA 1JB3A 1XPOA 1SEBD 4DV0L 1EY6A 1HZ9A 4C43A 1MRZA 4APVA 1Q82C 1S5DD 1R5OA 4TT3A 3QFCA 1L0YB 1E2WA 2X85A 1KTVA 2KQ3A 4NDXA 3G6EA 1UE7A 1ONLA 4DV2L 2HDLA 1E3XA 3NBHB 1X3FA 2YWFA 3QB3A 4BY1H 1RTNA 3AFPA 2JYOA 2F3VA 1V8QA 1XB2A 3UE1A 3Q0AA 3RZOH 1G8ZD 2I07B 3B6YA 1MSGA 4AQYL 1LV9A 2WB1E 4O0AA 5HGQA 4MYUA 5M9OA 4NXNL 4A3BG 3AGQA 1PH4A 1LABA 2M5SA 3M7NA 1L1OB 3BZDB 3H9NA 4CDFC 4IUQA 2XN9C 3TREA 4HMJA 2PMZB 1PTOC 1W87A 2ZXHA 4X64L 1QCBD 1R4PB 4K14A 1Q7YC 2L15A 2B2TA 4B3SQ 4POGA 2XNCA 3Q23A 3U6KA 1VQ9B 1SNCA 3OW7A 4HAEA 3H15A 3PO3H 1HCZA 4CKBA 1PYBA 4NPSA 2ZZEA 3CRZA 2CNDA 4LNQA 1CZGA 4PZ8A 1TU2B 1IBMQ 4C3JH 4AQYQ 1U4LA 1BBXC 2ZL6A 2NPFA 3S1QH 1B3AA 4R8NA 1AN8A 4Q5VA 1S0UA 3DWPA 3QJYA 1VQAA 3TZUA 2NVQH 1W34A 4JMQA 3P20A 3GTQH 4YIJA 2IY5B 3WBJA 1A63A 1N34L 2PI2A 5I9PA 4JYAQ 1O80A 1Q8IA 1AIPA 1EP2B 3K0YA 3ERSX 2Z9HA 1G6ZA 4N9TA 2WZPP 3JQQA 3AVTA 3OKXA 1I4RA 4X7CA 1BNZA 2JJQA 1AEXA 1GO3E 2UU9L 4RAUC 3VYRA 4U673 2GVBA 4AF7A 5FKAC 4RGMA 4CDCC 2CCZA 4HE5A 3HAGA 4I7AA 3NE5B 4XYQA 4DR6Q 4JPBW 1CUKA 1K0RA 2VBTA 3R6JA 2KHIA 3J81L 4AYBE 1EUJA 2A6ED 4JVZA 2VW9A 2RSNA 3CD6A 5A88A 2F0UA 2TMPA 2EYLA 3R2TA 5JJZA 3WNCA 2K50A 3WYAA 1QUEA 2K7VA 5FJ8G 1YJWA 3CMEB 1KABA 4ALPA 2EY5A 5C3EH 4XNFA 3EQLC 4HIOA 1Q8KA 2K1BA 4YHHQ 2UU9Q 2A1AA 1G7SA 3GTGB 1F20A 2CFMA 3M3YH 2VNUD 2QILA 4DV5Q 1Y1WB 4P2CB 1GAWA 3KYHC 1TUIA 1QE6A 4G1VA 1XPRA 2R93H 1A8VA 2D0OA 4B3GA 2EJGC 1JE4A 1GD7A 4XT3B 1H8EA 3A3BA 1J8IA 5F4OA 1XJVA 1TWHH 3CC2B 2BDNA 1ESRA 2CWPA 1SNQA 2E8GA 3PUMA 4QMGA 1TVCA 4UPAA 3HKSA 3CCEB 2GVAA 4HCEA 1FGBD 4GN4B 1NY4A 3GSIA 2K05A 3D6CA 5C0XG 2I5LX 4LUVA 5TV2A 3Q6SA 1NR4A 4CKEA 1UD2A 2Z6KC 5IGCA 3W2IA 2ZZFA 5EBDA 4WRDA 5IWAQ 4P74A 1HRJA 2GJPA 4K5WA 4UAIA 3X3NA 4X3KA 4KJNA 2K5DA 1LT5D 1K8OA 3PGZA 1PRTD 4CHTB 3CCVB 2K6AA 5KYLA 2I0QA 1HXYD 5IGGA 3VO2A 1TWAH 3E6ZX 1IBKQ 4ZQ3A 1ZM3A 4E0FA 1VCIA 3HZXA 3CU7A 4YWMA 5M5YB 1V1PA 1N0VC 3CPXA 1STAA 1YX2A 3OEEA 3U4ZA 2L1BA 3CMAB 2R93G 2WIIB 4I65A 3RMHA 2VNIA 3K5MA 4P25A 1XPUA 5LMUL 3V7AA 4R4TA 1XMOQ 2BVNA 4R1JA 1V0EA 4X0CA 3HOUB 2WINB 1KDCA 4UZUA 1OGJA 2C78A 2LXKA 1WTRA 1PH2A 4LF8Q 5M3MH 2BE5C 1IBLQ 3J80E 4RDKA 3FDTA 4DV3L 4MTNA 2ENBA 2W6JA 2WSSA 5IP9G 4GKJQ 4DR1Q 1JE5A 3J81c 4UP8A 3K7AH 3OYYA 3C2PA 4BY7H 5DS0A 4ZUIA 4BA1I 3VR3A 4LF4Q 1B2RA 3H3VC 3H3VH 3SDZA 5M5WH 2V1CC 1OB2A 4QVJA 1SXTA 2LFNA 3CPFA 4JBJA 1W3SA 3BNWA 2QDLA 5GV7A 1VQGA 3PUXA 5GAHC 1WYDA 1YHAA 4KY7A 1CA6A 5ELOA 4RPBA 1EY0A 2VZAA 4X65L 5FLXc 5M5XB 4WWVA 1Q1BA 1JC7A 1HR0Q 1G51A 3B8HA 2FXQA 2CVRA 1IKLA 1CFMA 1HFNA 1EOVA 4PMBA 2XNDA 1D2EA 2BSAA 5BN4A 1AW7A 4X66Q 4H02A 1Q90A 1AH9A 4MN3A 3A1PA 3CTAA 3OW2B 2GK6A 2F0QA 5HKKA 1WTOA 1NMGA 3A8JE 3KDFB 4OIKA 2LKVA 2BV3A 4RCYA 1VQOA 1S4ZA 4ACBA 3JQRA 4KY6A 1ESFA 3FHWA 3HOVG 5IYDH 3V05A 4TRDA 2VUMB 2QDXA 4UZFA 3BVMA 4JI8L 3CRLC 2NBFA 1X6OA 3H0GG 2SEBD 1IHZA 3VR5A 1F2LA 1GOZA 4RMFA 1ZUNB 1VQHA 3F2CA 1Y1WG 1ENAA 5JEAH 5IYBH 4PG3A 4J8QA 3HGBA 2HIVA 2ZXOA 2QDBA 1IL8A 2P3MA 3R8BA 1BQEA 1HNZL 3VR2A 3J81i 5LL6S 4YAWA 4Y7CA 2MUYA 3AVYA 3HOUH 4TMTA 1XWEA 3EFXD 3OPOA 3CKIB 1CK1A 2ZTGA 2RC5A 2V7UA 1EQVA 1OB0A 2UXCQ 1SE4A 1H9KA 4X3UA 2I5HA 4A3FG 1D2BA 4HEDA 3KBGA 3J7ZC 5KNBA 1K73C 1N8RC 2UXBL 3RLFA 1XQBA 4O1NA 1TQOA 5I9OA 4LMQD 2KCNA 3D31A 1M4VA 5EKLA 3TP7A 2PIAA 2RVLA 4ZRZA 3O13A 1J5EQ 1NB0A 1UE6A 3GTPH 3GIRA 3CAMA 3T56B 4X05A 4IJHA 3TS2A 3MEFA 1ZM2A 2Y0SB 1ICFB 1EFUA 1R5BA 2RKSA 1BCPD 4B43A 1OXSC 4FYDA 2QF7A 2VB3X 3LO8A 1XMQQ 4JI0L 4R71A 2JA7H 1IBKL 1E1OA 1I6HH 2KEDA 3ASRA 1I50H 1Y8OB 4RGTA 5C3WA 1TVXA 5IT9c 4ZCLA 3ISXA 4RDLA 1CTMA 2LS01 1SMXA 5DN6A 4IQZA 5IGDA 5F4MA 1UEBA 1KLUD 1MGSA 5TY0A 1SYDA 4DQLA 1M90D 2VQEQ 1SNDA 3LGJA 2MFIA 4OOVA 1TWHB 4GOPB 2ASBA 2YWEA 1AE2A 1CSPA 2JA6H 1CZWA 1CA5A 5ELDA 2E5LL 1L1OA 1LUZA 3TDQA 2Z0SA 2X6WA 2JA8H 2SDFA 2NV4A 4B3XA 4Z4UA 1YIJB 4B3TQ 4LFBQ 1T9HA 3LQEA 4M4SA 4PZ7A 2V7XA 1RTOA 3W2FA 1YJWB 5I2XA 3FKIG 1JWUD 2JE6I 2MPMA 1YITB 4XKVA 2A6HD 3AB9A 4O42A 5JVH3 4KMUC 2NYZD 2HT1A 4Y7NB 5I2YA 1KMHA 3K6OA 4L5TA 2AKWB 1QVGB 1YJ9A 4JCVE 4DGZA 5J22A 4NXMQ 5BN3A 3S15H 1HZEA 4GKKQ 2HDNB 2EQSA 4Q0FA 2ZTEA 3CMAA 2UXDQ 3E0JA 5FK9C 5CYUA 2F4NA 4X66L 4OX9Q 1SE3A 1VQLB 1KAWA 2B29A 2PNHA 4ODGA 1VLOA 1WDTA 4OWTB 4KKSA 1SYGA 4C3HG 1X65A 4LFBL 1W6JA 1XNQL 1WD1A 4B3RL 2BM1A 4B48A 3HEJA 3ASQA 5KGUA 3I4NH 4ZCKA 2YV5A 4HJ5A 4IFDH 1SKQA 2B2WC 3L3OC 2DCUA 3ICEA 4FK8A 2Y0SE 3FPPA 4GNXC 1QZHA 4DKAC 1VQKB 4F88A 5CR3A 3OOCA 3OHXC 4JBWA 1X3QA 2RDGA 2XWBB 3NWTA 3VR6A 1D6EC 3Q8DA 1PJ6A 2R7ZG 4LWCA 1Y1WH 1C9OA 4N3NA 3L7ZC 4X62L 1L1OC 3VYTA 4MTKA 4JI5Q 5TRDA 2H4OA 5IGFA 4QIWE 1ASZA 1SJED 1Z9FA 2OK8A 2F0EA 1O78A 4P75A 4HIKA 3OWFA 2OTLA 1DYQA 1SRUA 2KCMA 5IYDG 1Y0YA 3CCMA 2K5HA 3CC2A 2H1EA 2OTJA 2DOGA 1K73D 1N8RD 4K2LA 4OL7A 2OBTA 1WORA 1HJPA 2XGTA 1TWFH 2FVGA 2C35B 3G7LA 4FXUA 4A3FH 3W5VA 4TVAB 3GP7A 2JXMB 5H1SE 3M4OH 3VYSA 3TEHB 4AF6A 4AYBG 5LMNW 2D5DA 1WTXA 4FWTA 3K0XA 2Q2HA 4IUVA 2K75A 4CKCA 1RCVD 1XX8A 1IYJB 4FF3A 4X6AH 5JJKA 4A3KG 1SROA 3NELA 1DOMA 1I5FA 3WOEA 3CCRB 1SYEA 2L5TA 5IYRA 4TSFA 3W5UA 4DV3Q 5E4WC 2AWOA 2WP8J 2DYIA 2HLDA 4KHVA 1FRNA 1VQ6B 5CV8A 2E76C 1QVCA 4LF4L 1H85A 2W6IA 5GADC 1VQMA 5FO0A 4OO1I 2SOBA 3G48A 2WPDA 4B3FX 1KZLA 4V190 1FNCA 1HVXA 1I4HA 5LMNQ 1LTRD 4AH6A 1HZCA 3GV6A 1VQBA 1STEA 1B9MA 1EIGA 1DOKA 4G4KA 2E2HB 4FF2A 2BCOA 1RF2D 2JEBI 3MFYA 3FMCA 4XM3A 5IIFA 4R4IA 1FRQA 4Z4WA 4TMXA 1YI2B 2A68D 1CSQA 2AWNA 1B3QA 4J1MA 3HRZC 5IP7G 2A8VA 3GTKB 1BR9A 1I7PA 1F2ZA 4G7XA 3HOYB 3EBEA 3PQIA 4QF4A 5J39A 3SVMA 1V1OA 2X6LA 1SKYB 1A3VA 2D2CC 1S5CD 2FINB 3EN2A 2LZJA 4IPGA 4IUPA 2VYQA 1SMYC 4JI2L 1KIXA 1FD7D 1GHJA 1SAPA 1VQ4B 3JC66 4YEJA 4YCVA 4HIMA 2E2IH 2UUCL 1ET6A 2XVSA 2GN5A 3HOVB 2QGGA 4DU9A 1EOTA 2Q8RE 2CF4A 2XNAC 3A55A 1N9WA 5T1GA 2QGQA 1EU3A 4K0KL 3RZOB 3CPWA 4X7EA 1QVFB 1CKNB 3GD7A 4RHSA 1DDIA 4Y52H 1ZKOA 1XMQL 4XONA 4GKJL 1VQIA 1TKWB 2B2UA 1ZM9A 1VQKA 4OOSA 1OO9B 3S16B 4YWLA 3SGIA 2PLFA 2OXPA 1X32A 5C4XB 3CQZB 4YAOA 1N33L 1IB0A 4B3RQ 2K28A 3IAYA 2N78A 3NHHA 1Y14B 1EEID 3H0GB 1PH3A 4RPDA 3DEOA 2OYNA 3D0FA 1I3QB 5DEHA 3P7JA 2L9HA 2VNHA 3WOFA 2PZWA 5E6TA 2B5OA 5JAVA 4K0KQ 1G6PA 4LK1C 4P2NA 4IO9A 1VQDA 4KKTA 5IY0A 2RF4A 2WR8A 2H5XA 4B3TL 1MD2D 4V0BA 1DXMA 4OWXB 1SYFA 2BH2A 2ZZGA 3TN2A 1FL0A 1II3A 4FXDA 1JJCB 5L46A 2G9HD 3IFTA 4NKLA 4R4OA 4Z4ZA 5CV5A 3W2HA 1V1QA 4JI0Q 4OPOA 3M85A 2ZTNA 3MXPA 5C4JH 2ZL7A 3AYHB 2ZJQA 3PO2B 2UUBL 4JBKA 2VUMG 2QEJC 2AHOB 1UEAB 1HZBA 4AVZA 3I3CA 1PLFA 3H94A 4KHPQ 3ZC3A 3HOWB 4OPVA 3AQQA 1T5XD 3ULPA 3E9HA 4Y9RA 4LF6Q 1N08A 4XT1B 4L8JA 1YJNB 2B2YC 2XNJA 3CXCA 3A8KA 4C3HB 3NWSA 3PF4A 5IYCH 3N6RA 3JQPA 4M0LA 4N3GA 3OP1A 5KSWB 1QVFA 1BBWA 5ELEA 2HQEA 3M7GA 1P4MA 3QR8A 3NQIA 4KY5A 1EL0A 4XLHA 2NVTH 4BWGB 2A73B 1V0FA 1Y0RA 1TY2A 2D9UA 5DNFA 1HZAA 2NVYH 4OEMB 4DQKA 4X3TA 5LMUQ 2UXCL 4LUOA 1B53A 1CHQD 3Q6QA 3RD4A 2B2WA 5ELFA 3Q38A 5IT9E 4GOPC 4G1BA 2HMAA 1N36L 3C1FA 4U68A 1I6VC 4DPGA 3U9SA 1Y8NB 4XN0A 4LF6L 1QB5D 3R93A 1QGZA 3VA7A 4DR7L 4PGOA 4WJWA 2B39A 3E5SA 1BKBA 1F77A 3X3MA 1QGYA 3T16A 1KTKA 1WI5A 2GQFA 2FX3A 1COWA 1H9MA 1ZYRD 5C5MA 4DN4M 5A2QL 1M1KC 2A69C 1IYVA 2OQ0A 3CCLB 1F9SA 1VQ8A 1XNRL 1KC8D 2B2VA 4X7FA 4DF7A 3IKJA 4LFCL 2K32A 3KF8A 4YALA 3AU7A 5CV7A 1KRHA 2R9VA 3S24A 2XGJA 3KF6A 3W3AA 5HGTA 3CCSA 3S17H 3LWEA 2P5ZX 4MYTA 1WSRA 1GUTA 2BM0A 2RCFA 1BJKA 3C2QA 4GN5A 2BN4A 1SE2A 3KLSX 5KNDA 2EXDA 4DK1A 2BMWA 5DM73 4EQNA 1BX1A 5C44H 2KA7A
chains in the Genus database with same CATH topology
4KV6A 4P22A 5A2QE 2GJKA 1A3UA 2D62A 2L0CA 1BO0A 4IUUA 1NUCA 2EZVA 1HPCA 1YNJD 1STYA 4C3JG 1EQTA 5T1IA 4FO2A 4G7WA 2F4IA 2B8GA 5IT9L 3I72A 1QG7A 3CRKC 2KUMA 3A7AB 4H13C 1GUSA 1UD5A 1PFBA 1QILA 3BC9A 2YU9B 4H44C 3J81E 5IOCA 3QIAA 2F0HA 1LACA 2EYMA 2WKCA 1NRKA 1PTOH 1YNNC 1WPCA 2EPBA 3BS1A 3I4MB 5DM63 1AFPA 3I4NB 4QIWB 3W2DA 1EU4A 3KUPA 5F2DA 3I70A 5NUCA 3FKSA 1DM0B 4UDUC 2AQ3B 2GJRA 3GTLB 2VXWA 2BA1A 3ZYYX 3S15B 1TS2A 3I90A 1KNAA 4RKBA 2XSCA 3L9AX 1CM9A 4NNJA 1EYDA 4II2A 1TWCB 2DN8A 5KYIA 5D3DA 3NTKA 2CW0C 3KK7A 1D1IA 1PYWD 4ULLA 3A35A 1PFMA 4XLCA 1E3ZA 1OXVA 2ZXPA 1E2VA 2DY8A 2WB1B 2Z4HA 2JDIA 1TR5A 4CBVA 3FEWX 2M2LA 2MGSA 2JA6B 4BY7B 1YNND 4DNTB 4L6TB 1EZ8A 1ET9A 2KOLA 3R2IA 3TP6A 2D3NA 1B50A 4A3FB 1BDOA 1TWFB 1JWSD 4CJ1B 3A8KE 4G7ZC 4KN7C 1SNPA 1F9QA 1LTGD 4KKUA 2XRSD 3J7AF 3GVLA 3J80L 4NMZA 4EGVA 1U9RA 1FNUA 1WTHD 2DNEA 1NAPA 4MHEA 3NTIA 3MXUA 1MBYA 1LT3D 4FVMA 3S2HB 1EFRA 1UD4A 3T4AC 5EQ0A 4EQOA 2XWJB 1DCZA 4R8IA 1A3TA 2X6XA 4RWSC 1EWCA 1LO5D 4C56C 2EY1A 1BLIA 1BQQT 2FJ2A 5FOBB 1RKNA 1A2UA 3PO3B 5A35A 3J7YW 1NBMA 1ENCA 4K6DA 2ZXIA 4XDXA 5CDFA 3RUZA 4NW2A 3C46A 1W0KA 3V96A 4A3IB 3FPUB 5C0XI 1Z6HA 1Z47A 5IGBA 2NN6G 4LAAA 1SNMA 1D5ZC 4OO1H 2GK7A 2EXZA 3GO5A 3A3GA 3Q24A 5LHY1 1GUWA 3MFGA 2K03A 2F0SA 3TZDA 1YNJC 1H9JA 4HSPA 1WVLA 2NVQB 3V2TA 4HTHA 1CI3M 2Z1CA 5JEAG 1RODA 1LTAD 4YXWA 2X69A 4KHZA 2EJMA 2GA4B 1BCPC 3KLRA 4ID6A 2JJ1A 2F0OA 1C4QA 3OEHA 4B9WA 3OWEB 3DWAA 1R9TB 2O4XA 2IX0A 1HHVA 2KVMA 2E75C 4QB4A 2AUJD 5CC4A 1U4MA 1C8CA 2ID0A 4BS9A 2F0VA 2A68C 3GTPB 4FF4A 1HQMC 4XOPA 2Z6BD 3OSOA 2IL8A 3S14B 2OF1A 4HSVA 3DHQA 1H9SB 3I91A 1CQVA 1K28D 5K36G 2F03A 2FHTA 3HS0C 3BCDA 5FL7A 1STHA 3JU4A 4EQPA 2XZOA 1JCKB 1KDBA 5EKIA 1I4XA 3K5LA 1ZXTA 3PIP3 3NUCA 2EOTA 5JPMC 3OAAA 1FNVA 1E0BA 4XYOA 4ABNA 2X6YA 4A93B 3FKIB 3SK6A 4G57A 5J1ZA 3BYYB 2L12A 2C5CA 3K5NA 2L55A 4IFDI 2EYHA 5IK2A 1DOLA 5IGEA 1RD9D 4G7HC 3D3RA 4IALA 5C3XA 4C3IB 2F0GA 2IWHA 1IKMA 3MXGA 1W0JA 2MP1A 2R3ZA 5LL6X 3GVJA 2DIEA 4XLAA 2Q8TA 1H9RA 1FNWA 2EYFA 5FO9B 5KRUA 4II3A 3BVZA 2B2UC 4H7BA 2F0WA 1LT6D 3FVQA 1E79A 3K57A 5EBCA 2VJJA 2BDOA 3KEWA 5C4HA 3S9WA 1VJSA 4HIZA 1UAPA 3EA6A 1E43A 4YELA 2F0KA 1PTOB 1W6KA 3GTOB 5C0XH 3MHBA 1X3PA 2PNRC 2PCFB 2KCCA 2IW3A 1BCPF 5BN5A 2VB2X 5C5LA 4R9WA 4I7ZC 4G6IA 1CQFA 3SK8A 1GUNA 1EZ6A 3OIQA 1LTTD 2E1BA 4ZK9B 4JK1C 4F7XA 1Z7TA 3M4YA 1E1RA 1OXTA 2KEEA 5FO8B 3ZPNA 4ZLTF 2PW7A 3FRPB 1D5XC 1CT1D 3IL8A 4LJZC 1B2TA 2LY7A 4QCLA 2N55A 2BOSA 4Z9CB 2RA4A 5D3IB 1HTLD 4A3DB 2J0TD 3I8ZA 2F43A 5KIXA 2IPKD 3H6MA 1O7ZA 5ELBA 3CHBD 3UI2A 1EEFD 2Z4IA 2NZ1D 2PZTA 3S1RB 2QKIC 1BXTA 1PZKD 1SSOA 1QNUA 1ICWA 4F87A 1A15A 1EY4A 1VF7A 4GQNA 2WJYA 1XTCD 1FR3A 2HUGA 1BOSA 1LTSD 2KECA 1SMYD 2X53S 4IFDJ 4KN4C 4KI0A 2R6GA 5K36H 3S17B 5CMDA 4XMYA 2R7ZB 2KJXA 1G2TA 1TS3A 2XIWA 3I73A 1GXDC 1JOQA 4XQJA 4RKLA 2F0FA 3ITPA 3S1QB 4FF1A 3SR1A 3GVKA 3C3LA 3TBIB 2PYKA 2BE5D 2IX3A 3ND8A 4DA2A 2ICIA 2AQ2B 1T5EA 1MI2A 2PPBC 1SDFA 1JOOA 2XRQD 4M8AA 4F8MA 3EJIA 5M5WB 4C2MB 1JQYD 4C3IG 4XQNA 2X6GA 1ENFA 1JOKA 1HQRD 2D3LA 1K83B 1K8MA 1F2MA 2JJ2A 2L11A 1EWHA 2J7ZA 1WTVA 2CK3A 1TWGB 1DONA 2NWGA 3K5OA 4ASUA 4ZKBB 4IFDG 4Z1MA 4PV1C 1SFOB 3T13A 1LLRD 1I4PA 5HURA 5I4DA 5EPJA 1PZJD 1KAAA 3PIO3 3LWUA 5CGKA 1PMRA 5E3FA 3QO2A 2C9OA 3K58A 4OIJA 1UD8A 4A3GB 1R4QB 2F1MA 4MIUA 4TSSA 5C6AA 1V1PB 2SNMA 2B2VC 4DXGA 5G3LD 2M00A 2O5IC 1WCMB 1UD3A 3NQTA 4KJOA 1I4GA 3SE0A 1LTID 3IFDA 1OXUA 1M8AA 2MJ8A 3C1EA 4C1NK 4B9XA 4DAVA 3M3YB 2RQXA 3H09A 3P1HA 3NP8A 4DXFA 3NBHA 5ISRA 2QE7A 3ZIAA 2E2IB 3DEPA 4XLFA 1B1ZA 3D4RA 5DAUA 2EYJA 5EJWA 3G6JB 2IX1A 4OGQC 3PUVA 5EKKA 1TWAB 1OHHA 2BA0A 4XD7A 2G9DA 3BDLA 3SK5A 2K5WA 3NSWA 2WJVA 1DZ1A 3ONAB 2EVBA 4XIGS 4DK0A 3AMUA 4IUNA 1SJHD 2ZXRA 3KBXA 2F0PA 4XORA 1MABA 1BCPB 3MXNA 4FXKC 3HG9A 3DDYA 4A3MB 2EDGA 1TIID 2EE1A 4C3JB 2F0DA 1HTPA 1PDQA 4PQXA 4GZYC 3MVVA 5KEEA 3OE7A 1PRTF 1L0XB 4A3EB 1UD6A 3CESA 5K5PA 2VJIA 3QG1A 2M9VA 3NK9A 2RDHA 1MSHA 2F0IA 1KLGD 1AZQA 3WQZA 5IODA 3F2UA 1PFNA 4IN3A 2SNSA 4IZ8A 2DY7A 1IW7C 2PW5A 2A74C 5C44B 4X3SA 4ME5A 1O7LA 2L4NA 1TS5A 3MA2B 2CW0D 2A69D 1S5ED 2HDMA 4DAPA 1AP0A 3MEHA 1C48A 3BG3A 4WFN3 4PNYA 1EYCA 3VYUA 2A6HC 1EY9A 3BDOA 3MC0B 1RJTA 3HKZB 3PUZA 3G05A 5FLXE 1HUMA 2EYPA 4K2KA 1J9OA 3DMUA 1ILQA 1B4OA 4HCSA 3PUYA 4KD4A 3CMMA 1I6HB 1SNOA 3GTMB 3BH4A 3NBIA 4RCNA 3VR4A 4BBRB 4CJ2C 2Q8IB 2OEOA 2ZT9C 2NUCA 5FO7B 2XOKA 4FXGC 4RGNA 1JWMD 2EYOA 3PV0A 1BPLA 2ZZQA 3NPPA 3HP3A 4HMIA 2X8KA 5E1FA 4BY1B 1PTOD 1E1QA 2I46A 1ZEQX 3TSSA 2PQEA 1EY5A 1XXGA 4KD3A 1GJXA 2TSSA 3GQBA 3H91A 5C4JB 4CGYB 1HFGA 3U9OA 1JICA 3D6WA 2IT1A 3QOLA 5FLXL 1QJOA 2JA5B 1ML0D 4L63B 1S5BD 1QNKA 2V4DA 1I4QA 1WP6A 1EY8A 4C1NI 3LX0A 3HOZB 5C0XJ 3A54A 4XXEA 5EPLA 1GUGA 4XTCS 3ND9A 1EIHA 1VMPA 1G91A 3HOXB 3A8IE 4XQQA 4XQFA 3NTHA 3A7LA 2E2DC 1Q1EA 4KK7A 1HA6A 5EPKA 4K5XA 4RFBA 1KNEA 2K5QA 3JAML 2NTSA 4IURA 3DUZA 1ZYRC 3OFNA 3GV3A 3S2DB 4S3SA 5D14A 4WORA 1O7YA 4EVOA 4HN7A 1LT4D 2B8FA 2PO4A 2AQ1B 1G291 2HCCA 5JVG3 4XOTA 3KLSA 3CP8A 1E2ZA 2F0TA 3GTJB 5E4XA 4E6IA 4QUCA 4K8JA 5M3MB 2XZLA 1I8DA 4DAYA 3CP2A 2EY2A 2NB0A 3DM1A 3TMEA 3SK4A 2E74C 2F0JA 3S1NB 5JPNC 1EFID 2K01A 2QCPX 3BDCA 3URYA 4M1UB 4XKWA 3WDNA 1EYAA 1IW7D 4RGOS 1SBBB 1HA5A 3JAME 2A6EC 2JIZA 2EY6A 3BVGA 2B2TC 3NXWA 1A2TA 2F0NA 3D8GA 3K59A 3K7AB 1U4PA 1AZPA 1DJRD 1TY0A 3T51B 3R3OA 3D4WA 4IUTA 1RDPD 3BCFA 1STBA 1VMCA 5CBEE 1W9XA 5JEAJ 3MZ5A 3SEBA 2PZUA 1UUPA 3DWQA 4ZYSA 1NR2A 3I4LA 2WAQB 1STNA 1GUOA 2FFKB 2OT2A 1NSNS 1PTOF 1WD0A 2NVXB 3MWYW 2RSOA 3EROA 2O2LD 2HCIA 5C3EB 1JR0D 3LNNA 2R61A 3DXJC 2A5HA 2O5JC 1Q3LA 3OMCA 1G2SA 1BUVT 3Q22A 1Y8PB 1FYCA 4DNRB 5G3LF 1GHKA 4RHRA 4TKOB 4ZUJA 3A56A 3T53B 4K6LA 4BBSB 4PMCA 3PMFA 4XN3A 1VDZA 1QWYA 5I6WA 1VLYA 3SXHA 3EVQA 4A3JB 4A3BB 2E2JB 4NP5A 2JEAI 4HR7B 3OIPA 1PKVA 1F2YA 1V43A 1EY7A 5KNLA 2AUKA 5M3FB 1TS4A 3MTSA 5JOBA 1D1KA 4OHJA 2JA8B 1D5MC 2FMMA 5AFWA 4KTAA 3M4OB 2V7QA 2R92B 2YYZA 4ILWA 2WKDA 2NVYB 4QUFA 1RHPA 3VA5A 4B08A 1CHPD 2FMCA 2J4XA 1F9RA 1JORA 1I50B 4AYBB 3QWNA 4OO1G 1I18A 2NN6H 1STGA 1KDAA 1HUNA 4XLEA 2EJFC 4K5VA 3J7AV 3QOJA 4A3KB 3OMGA 2V31A 4TQUS 4RCOA 1A6XA 1PRTC 3BYTB 3D4DA 4FNFA 4ZAIA 1FX0A 2JP1A 3GTQB 5TSSA 1BMFA 1ILPA 1VF5C 2WACA 1WTQA 3PUWA 1Y69U 1IYUA 2F0LA 2CHBD 5CV9A 2RDFA 1B44D 3TP5A 4XR6A 4RA8A 2XZPA 2K04A 4RH6A 1DD2A 1QOHA 4N9PA 5D65A 2JSOA 2LMCB 2F3WA 4G7OC 1H8HA 1B9NA 1U4RA 2CQAA 4DFAA 5KNCA 1LTBD 5I6YA 2NVTB 5ELCA 3SHLA 1Q12A 4PMWA 1H9SA 1PRTB 5C4ZA 4CJ0B 3MAQA 1PXUA 2NTTA 2NN6I 2KVOA 1F9PA 1SYBA 4ZKCB 1Y1VB 4K8IA 5COYA 2MHVA 1NCVA 1PZID 5CBAE 2B63B 4XL9A 3TP8A 2F0MA 1WTWA 1SYCA 5EGTA 2JA7B 2K33A 2R93B 1OXXK 2KHSA 2IJ0A 2Z8LA 4J6HA 1S5FD 4BA2I 3N52A 1BF4A 2B2YA 2WV6D 3P75A 4FP5D 5CV4A 3S1MB 1UNSA 1TT2A 4H0LC 2ICEC 3RZDB 5CV6A 1XYIA 1WTPA 2DNCA 2N88A 2RBMA 3ERQA 5CORA 1JB3A 1SEBD 1EY6A 1S5DD 4TT3A 1E2WA 2X85A 1L0YB 2KQ3A 4NDXA 1ONLA 2HDLA 1E3XA 3QB3A 1RTNA 2JYOA 2F3VA 1V8QA 3Q0AA 1G8ZD 2I07B 1MSGA 1LV9A 5M9OA 1LABA 2M5SA 3M7NA 3BZDB 4IUQA 2XN9C 4HMJA 2PMZB 1PTOC 2ZXHA 1QCBD 1R4PB 4K14A 2B2TA 3Q23A 1SNCA 3OW7A 4HAEA 1HCZA 4CKBA 2ZZEA 1CZGA 1TU2B 1U4LA 1BBXC 1B3AA 4R8NA 1AN8A 4Q5VA 3DWPA 3QJYA 3TZUA 4JMQA 3P20A 4YIJA 5I9PA 1O80A 1Q8IA 3K0YA 1G6ZA 4N9TA 2WZPP 1I4RA 1BNZA 1AEXA 4RAUC 3VYRA 4U673 5FKAC 4RGMA 3HAGA 3NE5B 4XYQA 3J81L 2A6ED 2RSNA 2F0UA 2TMPA 2EYLA 3R2TA 5JJZA 2K7VA 1KABA 2EY5A 4XNFA 3EQLC 2K1BA 3GTGB 2VNUD 2QILA 1Y1WB 4P2CB 1QE6A 2EJGC 4B3GA 4XT3B 1JE4A 1H8EA 3A3BA 1J8IA 2BDNA 1ESRA 1SNQA 4QMGA 4HCEA 1FGBD 2K05A 3D6CA 5C0XG 3Q6SA 1NR4A 4CKEA 1UD2A 5IGCA 2ZZFA 5EBDA 4WRDA 1HRJA 2GJPA 4K5WA 4UAIA 3X3NA 4X3KA 4KJNA 2K5DA 1LT5D 1K8OA 1PRTD 4CHTB 2K6AA 5KYLA 1HXYD 5IGGA 3E6ZX 4ZQ3A 4E0FA 1VCIA 3HZXA 3CU7A 5M5YB 1V1PA 1STAA 3OEEA 2L1BA 2WIIB 4I65A 3RMHA 3K5MA 1V0EA 3HOUB 2WINB 1KDCA 4UZUA 1WTRA 2BE5C 3J80E 3FDTA 2ENBA 2W6JA 2WSSA 3C2PA 4ZUIA 4BA1I 3VR3A 3H3VC 3SDZA 1SXTA 2LFNA 3PUXA 4KY7A 1CA6A 1EY0A 5M5XB 1Q1BA 1JC7A 2CVRA 1IKLA 1CFMA 1HFNA 4PMBA 2XNDA 5BN4A 1AW7A 1Q90A 4MN3A 2F0QA 2GK6A 5HKKA 1WTOA 3A8JE 4OIKA 2LKVA 1S4ZA 4KY6A 1ESFA 3V05A 4TRDA 2VUMB 3BVMA 3CRLC 2NBFA 2SEBD 1IHZA 3VR5A 1GOZA 1F2LA 1ENAA 5JEAH 4J8QA 3HGBA 2ZXOA 2QDBA 1IL8A 3R8BA 3VR2A 5LL6S 2MUYA 3EFXD 1XWEA 3OPOA 3CKIB 1CK1A 2ZTGA 1EQVA 1OB0A 1SE4A 1H9KA 4X3UA 1D2BA 4HEDA 3KBGA 5KNBA 3RLFA 4O1NA 1TQOA 5I9OA 4LMQD 2KCNA 3D31A 1M4VA 5EKLA 3TP7A 2RVLA 4ZRZA 3O13A 3T56B 2Y0SB 2RKSA 1BCPD 1OXSC 4FYDA 2QF7A 2VB3X 2KEDA 1Y8OB 4RGTA 5C3WA 1TVXA 1CTMA 2LS01 5DN6A 4IQZA 5IGDA 1KLUD 1MGSA 1SYDA 1SNDA 1TWHB 1CZWA 1CA5A 5ELDA 3TDQA 2X6WA 2SDFA 1RTOA 5I2XA 1JWUD 2JE6I 2MPMA 4XKVA 2A6HD 3AB9A 4O42A 5JVH3 4KMUC 2NYZD 4Y7NB 5I2YA 1KMHA 3K6OA 4DGZA 5J22A 5BN3A 1HZEA 4Q0FA 3E0JA 5FK9C 5CYUA 1SE3A 4ODGA 4KKSA 1SYGA 4C3HG 1W6JA 1WD1A 3HEJA 5KGUA 4IFDH 2B2WC 3L3OC 3FPPA 4F88A 5CR3A 3OOCA 3OHXC 4JBWA 1X3QA 2RDGA 2XWBB 3NWTA 3VR6A 1D6EC 3L7ZC 3VYTA 2H4OA 5IGFA 1SJED 2F0EA 1O78A 3OWFA 1DYQA 2H1EA 4K2LA 4OL7A 3G7LA 4FXUA 3GP7A 2JXMB 3VYSA 2D5DA 1WTXA 4IUVA 4CKCA 1RCVD 1XX8A 4FF3A 1DOMA 3WOEA 1SYEA 2L5TA 4TSFA 5E4WC 2AWOA 2WP8J 4KHVA 2HLDA 5CV8A 2E76C 2W6IA 4OO1I 2SOBA 2WPDA 4B3FX 1KZLA 4V190 1HVXA 1I4HA 1LTRD 3GV6A 1STEA 1B9MA 1EIGA 1DOKA 4G4KA 2E2HB 4FF2A 2BCOA 1RF2D 2JEBI 3MFYA 3FMCA 4XM3A 5IIFA 2A68D 2AWNA 4J1MA 3HRZC 3GTKB 1BR9A 1F2ZA 4G7XA 3HOYB 4QF4A 5J39A 3SVMA 1V1OA 2X6LA 1SKYB 1A3VA 2D2CC 1S5CD 2FINB 2LZJA 4IUPA 1SMYC 1FD7D 1GHJA 1SAPA 4YEJA 1ET6A 2XVSA 3HOVB 4DU9A 1EOTA 2Q8RE 2XNAC 3A55A 5T1GA 1EU3A 3RZOB 4RHSA 3GD7A 1ZKOA 4XONA 1TKWB 2B2UA 1OO9B 3S16B 2OXPA 1X32A 5C4XB 3CQZB 2K28A 3IAYA 3NHHA 3H0GB 1EEID 3DEOA 1I3QB 5DEHA 3P7JA 2L9HA 3WOFA 2PZWA 5JAVA 4LK1C 4KKTA 1MD2D 4V0BA 1DXMA 1SYFA 2ZZGA 3TN2A 1II3A 4FXDA 3IFTA 2G9HD 4NKLA 5CV5A 3M85A 2ZTNA 3MXPA 3PO2B 2QEJC 1UEAB 4AVZA 3I3CA 1PLFA 3H94A 3HOWB 1T5XD 4XT1B 4L8JA 2B2YC 4C3HB 3NWSA 3N6RA 5ELEA 2HQEA 3M7GA 4KY5A 3NQIA 1EL0A 4XLHA 4BWGB 2A73B 1V0FA 1TY2A 2D9UA 5DNFA 4X3TA 1B53A 1CHQD 3RD4A 2B2WA 5ELFA 5IT9E 3C1FA 4U68A 1I6VC 3U9SA 1Y8NB 4XN0A 1QB5D 3R93A 3VA7A 4WJWA 2B39A 3E5SA 1F77A 3X3MA 3T16A 1KTKA 1H9MA 4DN4M 1ZYRD 1COWA 5C5MA 5A2QL 1IYVA 2A69C 1F9SA 2B2VA 4DF7A 3IKJA 2K32A 3KF8A 3AU7A 5CV7A 5HGTA 2R9VA 2XGJA 3W3AA 3LWEA 1GUTA 1SE2A 3KLSX 5KNDA 4DK1A 5DM73 4EQNA 2KA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DNT B;  2BE5 C;  2IT1 A;  2K33 A;  1OXX K;  2D62 A;  3T51 B;  1QJO A;  1OXS C;  2QF7 A;  2JXM B;  2F1M A;  1BDO A;  1HPC A;  2E75 C;  2D5D A;  1VF7 A;  2AUJ D;  2YYZ A;  3A8K E;  4G7Z C;  2V4D A;  4KN7 C;  4LK1 C;  1Y8O B;  4BA1 I;  4BA2 I;  3QG1 A;  3VR3 A;  4KKT A;  1FR3 A;  4KKU A;  1CTM A;  3SDZ A;  3NE5 B;  2A68 C;  4IQZ A;  1DXM A;  2O5I C;  1HQM C;  4KN4 C;  2B8G A;  1GUG A;  2R6G A;  3IFT A;  2DNE A;  4H0L C;  2BDO A;  4KI0 A;  3PUX A;  4XTC S;  2L5T A;  3SE0 A;  3I4L A;  5K36 H;  3I72 A;  2A6E D;  3CRK C;  3ND9 A;  3A7A B;  1OXU A;  3MXU A;  1H9S B;  3A8I E;  1IW7 C;  3M85 A;  4OO1 G;  3I73 A;  2AWO A;  1GUO A;  1GUS A;  2DNC A;  2NN6 H;  4H13 C;  1Q1B A;  2K7V A;  5K36 G;  2EJF C;  3A7L A;  5C0X H;  1O7L A;  1Q1E A;  4TQU S;  2E76 C;  1DCZ A;  2PNR C;  3EQL C;  4H44 C;  1A6X A;  2A69 D;  2PCF B;  2KCC A;  1CFM A;  3QIA A;  5BN5 A;  1LAC A;  3H94 A;  1E2W A;  2BE5 D;  3LNN A;  1ONL A;  1VF5 C;  3BG3 A;  3PUW A;  5BN4 A;  3DXJ C;  4I7Z C;  1ZYR C;  3ND8 A;  1B9M A;  1Q90 A;  3D4R A;  1Y69 U;  2JE6 I;  1GUN A;  1V8Q A;  1IYU A;  2A6H C;  2EJG C;  4L8J A;  5A35 A;  2O5J C;  2A6H D;  3BDO A;  4OGQ C;  3A8J E;  1YNN C;  3AB9 A;  3PUV A;  2JEB I;  3MFY A;  3PUZ A;  4KMU C;  3FMC A;  1T5E A;  1DD2 A;  3N6R A;  2PPB C;  1Y8P B;  2B8F A;  2LMC B;  4JK1 C;  1Z7T A;  3M4Y A;  2BA0 A;  1FYC A;  1G29 1;  4DNR B;  1LAB A;  5BN3 A;  2A68 D;  3M7N A;  1Z6H A;  5C0X G;  1OXT A;  4G7O C;  2NN6 G;  1GHK A;  3PUY A;  4OO1 H;  4TKO B;  3CRL C;  4LJZ C;  3VR5 A;  2D2C C;  3T53 B;  1B9N A;  1E2Z A;  4KKS A;  4RCN A;  3VR4 A;  5JEA H;  3OW7 A;  1K8M A;  5KNC A;  3HGB A;  2Q8I B;  1SMY C;  1VDZ A;  1HCZ A;  1EWH A;  2ZT9 C;  2BA1 A;  1I6V C;  1YNJ C;  1GHJ A;  1H9J A;  3U9S A;  1Y8N B;  1K8O A;  3VR2 A;  3VA7 A;  1Q12 A;  4IFD H;  2EVB A;  1H9S A;  1TU2 B;  3FPP A;  3PV0 A;  2E74 C;  4PV1 C;  4HR7 B;  4XIG S;  4DK0 A;  2JEA I;  4IFD G;  3OPO A;  2NN6 I;  1H9M A;  1IYV A;  1VCI A;  3OOC A;  4JBW A;  1V43 A;  2A69 C;  1CI3 M;  1H9K A;  3VR6 A;  4G7H C;  3GD7 A;  3QJY A;  2DN8 A;  3TZU A;  1ZKO A;  5KNB A;  5JEA G;  3RLF A;  2AUK A;  3IKJ A;  2EJM A;  3L7Z C;  4KHZ A;  1TKW B;  2CW0 C;  2K32 A;  3KLR A;  3P20 A;  3WDN A;  1IW7 D;  3W3A A;  3D31 A;  2EDG A;  2A6E C;  1GUT A;  3LWU A;  1OXV A;  1O78 A;  1GJX A;  1E2V A;  1PMR A;  5KND A;  3T56 B;  1HTP A;  3GQB A;  4GZY C;  4DK1 A;  1H9R A;  2KA7 A; 
#chains in the Genus database with same CATH topology
 1VQ5 A;  5IYP A;  4GLX A;  3M9B A;  4KV6 A;  4P22 A;  4RD1 A;  5A2Q E;  2GJK A;  1A3U A;  2D62 A;  2L0C A;  1BO0 A;  1VQ6 A;  4IUU A;  1I3Q H;  1NUC A;  2DJF C;  2EZV A;  1HPC A;  1YNJ D;  2PI2 E;  5J35 A;  1BX0 A;  1STY A;  1PH6 A;  4HJ9 A;  4C3J G;  1EQT A;  5J3B A;  2CKZ B;  1EQQ A;  5T1I A;  3E9I A;  3RR5 A;  5C4X H;  2Z6K A;  4FO2 A;  1YIT A;  4DV4 Q;  4LFC Q;  4G7W A;  1GO2 A;  1N07 A;  2F4I A;  2B8G A;  5IT9 L;  1IHM A;  3I4M H;  1PH9 A;  3I72 A;  1QG7 A;  3CRK C;  2KUM A;  3A7A B;  4FDB A;  4ZV4 A;  4H13 C;  1GUS A;  1UD5 A;  4RDJ A;  2I1L A;  2Q2I A;  2UXD L;  1PFB A;  1QIL A;  1QUQ B;  3BC9 A;  2YU9 B;  1TTT A;  4YWK A;  3I56 A;  4X07 A;  1KXL A;  4H44 C;  3J81 E;  5IOC A;  1N0U A;  4WJ4 A;  3QIA A;  5DSZ A;  2F0H A;  1LAC A;  2EYM A;  4Z4T A;  1XNQ Q;  3ZZ0 A;  1OB5 A;  2WKC A;  1NRK A;  2YU9 H;  1YJ9 B;  1QVG A;  1VHO A;  1PTO H;  1Q46 A;  3CCU B;  4BY1 G;  4DR6 L;  4DV4 L;  1YNN C;  2Q6L A;  1YBY A;  5A89 A;  3HOY H;  4RG1 A;  1WPC A;  4DUY Q;  3MHP A;  2EPB A;  3BS1 A;  3I4M B;  4A3J H;  5DM6 3;  3TRZ A;  1AFP A;  3I4N B;  4QIW B;  3W2D A;  4YHH L;  1PH1 A;  1EU4 A;  3KUP A;  2HIX A;  1DG1 G;  5F2D A;  5F4J A;  4PC6 A;  3I70 A;  1E24 A;  5NUC A;  3D26 A;  3FKS A;  3V76 A;  2RCN A;  1DM0 B;  4UDU C;  2LXJ A;  3JAM c;  5H5J A;  4JI5 L;  1IJE A;  1EIY B;  2AQ3 B;  2GJR A;  2VBV A;  2VXW A;  1FJG L;  2BA1 A;  3GTL B;  1WOP A;  3ZYY X;  3S15 B;  5JJL A;  4GNX B;  1S40 A;  1JT8 A;  1TS2 A;  4GLA C;  2DY1 A;  3I90 A;  3KDF A;  1X54 A;  3KFU A;  1KNA A;  4RKB A;  2XSC A;  3L9A X;  4YY3 L;  2R6H A;  1CM9 A;  4NNJ A;  1EYD A;  4II2 A;  1FGU A;  2BH8 A;  3I4N G;  2VY3 A;  2CC2 A;  4BBR G;  1TWC B;  1F60 A;  2DN8 A;  5KYI A;  1LM0 A;  5D3D A;  3NTK A;  2CW0 C;  3KK7 A;  1D1I A;  1PYW D;  2QW7 A;  4ULL A;  3A35 A;  1AE3 A;  4PAA A;  1PFM A;  3CC7 A;  4XLC A;  3I4O A;  1E3Z A;  1OXV A;  5ELN A;  4JI4 Q;  2ZXP A;  1E2V A;  2DY8 A;  2WB1 B;  1J6Q A;  2Z4H A;  1NDH A;  2JDI A;  3J7A 5;  1TR5 A;  4CBV A;  3FEW X;  2M2L A;  3J81 k;  2MGS A;  2JA6 B;  4BY7 B;  1YNN D;  2NZH A;  4DNT B;  4L6T B;  4HJ8 A;  1EZ8 A;  1ET9 A;  2KOL A;  3R2I A;  4LFA Q;  1ELO A;  2D3N A;  4Z4Y A;  3TP6 A;  1B50 A;  4A3E H;  4A3F B;  1BDO A;  3FKI H;  1TWF B;  1JWS D;  4CJ1 B;  3A8K E;  4G7Z C;  4KN7 C;  1SNP A;  1F9Q A;  1LTG D;  1WSV A;  4KKU A;  2XRS D;  1KD1 C;  2B3G A;  3J7A F;  3GVL A;  3AFQ A;  4LBZ A;  3J80 L;  4NMZ A;  3WY9 A;  1U9R A;  1FNU A;  3MXN B;  4EGV A;  2ATW A;  1WTH D;  1V5V A;  2JA5 G;  2DNE A;  5FIU A;  1CQX A;  1K8A D;  5FA6 A;  2JA6 G;  1NAP A;  4MHE A;  4JI4 L;  3NTI A;  3MXU A;  4JI1 Q;  1MBY A;  1LT3 D;  4FVM A;  3GTG H;  1EFR A;  1MIU A;  3S2H B;  1UD4 A;  3T4A C;  5EQ0 A;  4JI7 L;  1NB9 A;  4DK3 C;  3A8J A;  4EQO A;  2XWJ B;  1WU8 A;  1DCZ A;  4OX9 L;  4R8I A;  2F52 A;  1A3T A;  2NVX H;  2X6X A;  4RWS C;  1EWC A;  2VQF L;  1LO5 D;  4C56 C;  2JQO A;  4LF9 L;  2EY1 A;  1QFJ A;  1BLI A;  1BQQ T;  2FJ2 A;  5FOB B;  1RKN A;  1A2U A;  1GR1 A;  3PO3 B;  3SJP A;  3ULJ A;  2BPO A;  5A35 A;  1FVI A;  3J7Y W;  1NBM A;  4DV1 Q;  1ENC A;  3S1N H;  2XTI A;  4K6D A;  2ZXI A;  4XDX A;  5CDF A;  3RUZ A;  4NW2 A;  3C46 A;  1W0K A;  3V96 A;  4HJA A;  4A3I B;  1TWG H;  3FPU B;  5C0X I;  3OZV A;  4RD4 A;  3WND A;  1Z6H A;  1BVS A;  1Z47 A;  5IGB A;  1EFC A;  2NN6 G;  4LAA A;  1SNM A;  5KW9 A;  4IPH A;  1N34 Q;  4QQB X;  1D5Z C;  1O7I A;  3HOW G;  4OO1 H;  2GK7 A;  2EXZ A;  3GO5 A;  3A3G A;  2BGJ A;  5LHY 1;  3Q24 A;  1GUW A;  2I5M X;  5AJ3 L;  3MFG A;  1MHW C;  2K03 A;  1VQJ A;  2F0S A;  3TZD A;  1GJR A;  2JA5 H;  1R9T H;  3L2P A;  1YNJ C;  1H9J A;  1HR0 W;  4UP9 A;  3AEV A;  4HSP A;  2C4T A;  3LQ6 A;  1WVL A;  3ZUG A;  4DV7 L;  2NVQ B;  4YAU A;  3NEN A;  3V2T A;  4HTH A;  4AIM A;  1CI3 M;  2Z1C A;  4KLK A;  4A3E G;  1R5N A;  2WAQ G;  3F2D A;  1GM5 A;  5JEA G;  1ROD A;  1LTA D;  1P8L A;  4YXW A;  2X69 A;  1N05 A;  3CCJ B;  1UMK A;  3W2E A;  2EJM A;  4KHZ A;  2GA4 B;  1BCP C;  3KLR A;  4ID6 A;  4WZT A;  1SR3 A;  1E3P A;  2R7F A;  2JJ1 A;  4A3D G;  3SLD A;  4QUZ A;  2F0O A;  3T1Y L;  2R7D A;  1C4Q A;  3OEH A;  3CC7 B;  3IRB A;  5JJI A;  4RM0 A;  1S72 B;  4B9W A;  1FJG Q;  1BBU A;  3GTJ H;  3AVU A;  3OWE B;  3HOX H;  3DWA A;  1R9T B;  1TLL A;  2O4X A;  2IX0 A;  1K8A C;  5DLQ E;  4DR3 Q;  1HHV A;  1N06 A;  2HCJ B;  2E75 C;  2KVM A;  1KHI A;  4QB4 A;  2AUJ D;  5CC4 A;  1U4M A;  3RN2 A;  1C8C A;  4B4D A;  1YZ6 A;  2ID0 A;  1V9P A;  3I55 A;  4BS9 A;  1MJE A;  3EIV A;  5IYN A;  2F0V A;  2A68 C;  3GTP B;  5JBQ A;  4FF4 A;  1HQM C;  4XOP A;  2WB1 G;  2Z6B D;  1QUQ A;  2VNJ A;  3OSO A;  2IL8 A;  2ZJR A;  3S14 B;  3BY1 A;  2OF1 A;  1T6X A;  1WJJ A;  5IYB G;  1EXM A;  1IXR A;  1YHQ B;  4HSV A;  4L5R C;  3DHQ A;  3H0G H;  1H9S B;  3I91 A;  1CQV A;  1D1N A;  1K28 D;  3W1B A;  3I4M G;  5K36 G;  4PZ6 A;  4DR5 Q;  3T1H Q;  2F03 A;  3CQZ H;  3KL9 A;  1QUF A;  2FHT A;  4X7D A;  4YCW A;  4LBW A;  5C4X G;  3HS0 C;  3BCD A;  5L37 A;  3AST A;  5FL7 A;  4BY7 G;  1STH A;  2D74 A;  3I1F A;  3JU4 A;  5GRO A;  4EQP A;  5IP9 H;  4HJ7 A;  3S2H H;  1K83 H;  4DR7 Q;  1KD1 D;  4UP7 A;  4GNX A;  4DV6 L;  1VQP A;  5M5Y H;  3ZZT A;  2XZO A;  1JJG A;  4EH1 A;  1JCK B;  1N36 Q;  1KDB A;  5EKI A;  1I4X A;  3K5L A;  2Z6B A;  1EIF A;  1ZXT A;  3PIP 3;  4AC9 A;  3NUC A;  2EOT A;  5JPM C;  3OAA A;  1FNV A;  1E0B A;  1W2B B;  4GN3 B;  4XYO A;  3ZJY C;  4ABN A;  2X6Y A;  3KF6 B;  4A93 B;  1PJ5 A;  1I94 L;  3FKI B;  3SK6 A;  4G57 A;  3CME A;  4RD0 A;  1YNX A;  1EP3 B;  5J1Z A;  4OP7 A;  3BYY B;  4JV5 L;  2L12 A;  2CRV A;  1Y1V G;  1K28 A;  2C5C A;  1K0S A;  2XEX A;  4B44 A;  3K8A A;  1KK0 A;  3K5N A;  3AVW A;  1YHB A;  2L55 A;  4Y9U A;  4IFD I;  2EYH A;  3OTO L;  2VBU A;  5IK2 A;  2VL6 A;  4JW0 A;  1DOL A;  5IGE A;  2MQH A;  1RD9 D;  4G7H C;  3D3R A;  4IAL A;  2WAQ E;  5C3X A;  4C3I B;  2F0G A;  3QFT A;  1GKH A;  1HH2 P;  5M3M G;  2IWH A;  4DR1 L;  4GLV B;  1IKM A;  3MXG A;  1W0J A;  2MP1 A;  2R3Z A;  5LL6 X;  1HNZ Q;  3GVJ A;  2YTY A;  2DIE A;  4XLA A;  2Q8T A;  2UUA Q;  4WZE A;  3UDF A;  1UE1 A;  4X65 Q;  4P3Y A;  1H9R A;  5IYC G;  1FNW A;  2EYF A;  2VQE L;  3KJO A;  3SJZ A;  4PC1 A;  2DGY A;  5FO9 B;  5KRU A;  4II3 A;  5TR9 A;  3BVZ A;  4JI1 L;  3G71 A;  2B2U C;  2D9R A;  4H7B A;  2ZM6 L;  4POF A;  4A3I H;  2F0W A;  4Z4R A;  1LT6 D;  3FVQ A;  1E79 A;  3K57 A;  3CC4 A;  3I7F A;  5EBC A;  3CCR A;  3U58 A;  4X62 Q;  5C3E G;  5EMN A;  3ZZU A;  2VJJ A;  4QL5 A;  2BDO A;  3KEW A;  4Y7N H;  5C4H A;  4QV2 A;  3S9W A;  4LFA L;  2JA9 A;  1VJS A;  4HIZ A;  1Q81 D;  1UAP A;  3EA6 A;  1E43 A;  4YEL A;  4DV1 L;  2F0K A;  1PTO B;  1W6K A;  1KRT A;  3GTO B;  1VQL A;  4IOA A;  5C0X H;  4F7D A;  1KC8 C;  3MHB A;  1X3P A;  4P1V A;  2PNR C;  2PCF B;  1U5K A;  2KCC A;  2IW3 A;  2E2J H;  4GKK L;  3CCQ B;  1BCP F;  5BN5 A;  3R6K A;  2VB2 X;  4A4I A;  3Q3A A;  2ZM6 Q;  5C5L A;  4HE6 A;  3OZW A;  3QE2 A;  4P6Y A;  4R9W A;  4I7Z C;  3SKB A;  4DAM A;  4G6I A;  1CQF A;  1GUN A;  3SK8 A;  1EZ6 A;  4TMZ A;  2IHE A;  3OIQ A;  2N3S A;  1LTT D;  2E1B A;  1L0W A;  1PVO A;  4JOI C;  4X8I A;  4ZK9 B;  1B7Y B;  4JK1 C;  4QJF A;  4F7X A;  1Z7T A;  3M4Y A;  2F4V L;  1W35 A;  1LTL A;  3PF5 A;  2QEX B;  3F2B A;  1E1R A;  2DET A;  5FJ8 H;  3FPK A;  1OXT A;  2KEE A;  1D7Q A;  5FO8 B;  4RD6 A;  3ZPN A;  1NJI D;  2PW7 A;  4ZLT F;  3FRP B;  1D5X C;  2AHO A;  3Q39 A;  1CT1 D;  3IL8 A;  4IW3 B;  4LJZ C;  1B2T A;  2LY7 A;  3VMF A;  2VS1 A;  4QCL A;  2N55 A;  2BOS A;  4Z9C B;  4A3L G;  2RA4 A;  4JG2 A;  5D3I B;  1K3R A;  4DV2 Q;  1HTL D;  1E7Z A;  4A3D B;  3FP9 A;  3SLN A;  2J0T D;  3I8Z A;  1QZG A;  1D8T A;  2F43 A;  4PC7 A;  1B8A A;  5KIX A;  4A3I G;  1MKH A;  2IPK D;  3H6M A;  4TMW A;  1O7Z A;  5ELB A;  4DR4 L;  3FJO A;  3HKZ E;  4Q7J B;  3CHB D;  3CC4 B;  3UI2 A;  1IL2 A;  4R4C A;  2PQA A;  1EEF D;  2Z4I A;  2NZ1 D;  5IP7 H;  4JV5 Q;  2PZT A;  3S1R B;  2QKI C;  3STB C;  1SSO A;  1BXT A;  1PZK D;  4OPS A;  1QNU A;  4JI2 Q;  3OZU A;  1ICW A;  4F87 A;  1QX4 A;  2DEU A;  3CW2 C;  1U2R A;  1VQF A;  2N8N A;  1A15 A;  1EY4 A;  1VF7 A;  3CCL A;  4GQN A;  2YTX A;  2WJY A;  1XTC D;  1Q82 D;  4JI3 L;  1FR3 A;  2HUG A;  2YTV A;  1BOS A;  2PMZ E;  1LTS D;  2KEC A;  3TQY A;  1SMY D;  2X53 S;  5GV8 A;  4IFD J;  3VNU A;  4KN4 C;  4KI0 A;  1HNX Q;  2R6G A;  3PO3 G;  5K36 H;  3S17 B;  1XMO L;  5CMD A;  4XMY A;  2R7Z B;  2KJX A;  4NXM L;  1G2T A;  1TS3 A;  2XIW A;  3I73 A;  1JJ2 B;  4NB3 A;  1GXD C;  3S2D H;  1JOQ A;  3ES9 A;  4XQJ A;  1PH7 A;  4P12 A;  4RKL A;  2F0F A;  3ITP A;  3S1Q B;  4FF1 A;  3SR1 A;  2X0K A;  4DR2 Q;  3GVK A;  3C3L A;  1NE3 A;  3TBI B;  2PYK A;  1QFY A;  2BE5 D;  2IX3 A;  1X3E A;  3HOZ G;  1Q81 C;  3ND8 A;  1XFO A;  2K5N A;  3K81 C;  3E1Y E;  4DA2 A;  3CPW B;  2ICI A;  3L0O A;  4O2D A;  2LSS A;  2AQ2 B;  3RNU A;  1T5E A;  1MI2 A;  2PPB C;  1CNF A;  2J7K A;  1SDF A;  4L5S A;  3ONU A;  1JOO A;  1Q86 D;  2C4U A;  1OGI A;  2XRQ D;  4M8A A;  1VQP B;  4F8M A;  3EJI A;  5M5W B;  3UDG A;  4M53 A;  1TXY A;  4M1K A;  1VS0 A;  4C2M B;  1HNW L;  1JQY D;  2HQL A;  5B6I A;  1E62 A;  2QEX A;  3RLN A;  4C3I G;  4XQN A;  4LC0 A;  2X6G A;  1ENF A;  1JOK A;  1HQR D;  4DV6 Q;  2D3L A;  3BY2 A;  1K83 B;  1K8M A;  1F2M A;  2JJ2 A;  2L11 A;  1A62 A;  1EWH A;  2JN9 A;  3G4S B;  1RL2 A;  2J7Z A;  1WTV A;  2CK3 A;  3AGP A;  1TWG B;  1DON A;  2NWG A;  3K5O A;  2QN6 A;  4NXN Q;  1KL9 A;  2KEN A;  4DK6 C;  4ASU A;  4ZKB B;  4IFD G;  4Z1M A;  3KLW A;  4PV1 C;  1SFO B;  3T13 A;  2ALY B;  4TMV A;  1Q86 C;  2GRE A;  1LLR D;  3NEM A;  3PIO A;  1I4P A;  3CCS B;  1DDG A;  2F1L A;  5HUR A;  1SFO H;  5I4D A;  3S14 H;  1Q9S A;  1YLO A;  2V7T A;  4G5G A;  3K80 C;  4ACA A;  5EPJ A;  1PZJ D;  4JI8 Q;  1KAA A;  3PIO 3;  3ER0 A;  3LWU A;  4JC0 A;  5CGK A;  3S1M H;  1PMR A;  5E3F A;  3ZBT A;  3QO2 A;  2HD3 A;  5HZB A;  3I55 B;  1WOC A;  2EIX A;  1WFQ A;  4DR5 L;  3T1H L;  2C9O A;  3K58 A;  2R7Z H;  4OIJ A;  1UD8 A;  4A3G B;  3G6E B;  1RQR A;  1VHE A;  1GVP A;  1R4Q B;  2X3U A;  5FLM G;  2F1M A;  1H42 A;  4MIU A;  4TSS A;  1OTC A;  3GTM H;  5C6A A;  5LMN L;  1V1P B;  2SNM A;  1JB7 A;  2UUB Q;  4DR4 Q;  2B2V C;  5G3L D;  4DXG A;  2M00 A;  1PHJ A;  3CCJ A;  2N49 A;  3PA1 A;  1VQO B;  2O5I C;  1WCM B;  1UD3 A;  3NQT A;  2R92 H;  3S16 H;  1PJ7 A;  4KJO A;  1I4G A;  3SE0 A;  1LTI D;  1EWY A;  3IFD A;  4RD2 A;  1OXU A;  2B7C A;  1M8A A;  2MJ8 A;  1LYL A;  3C1E A;  4IPC A;  3HOW H;  3PUN A;  4JOI A;  4C1N K;  4BXX H;  4B9X A;  3KJP A;  4DAV A;  4X64 Q;  4B3S L;  3M3Y B;  2RQX A;  2PE3 A;  3H09 A;  3P1H A;  3NP8 A;  4DXF A;  3NBH A;  2Q2T A;  4WJ3 M;  5ISR A;  5M3F H;  2QE7 A;  4LF7 L;  3ZIA A;  2E2I B;  3DEP A;  3LVB A;  4XLF A;  1B1Z A;  3D4R A;  1TWC H;  5DAU A;  1VQN B;  1I94 Q;  2EYJ A;  4QY7 A;  3G6J B;  5EJW A;  5IWA L;  2IX1 A;  4OGQ C;  1G7C A;  3PUV A;  5EKK A;  1TWA B;  2DER A;  5M3F G;  3CCU A;  4ZCI A;  3ZBU A;  1OHH A;  4H9G A;  3GTK H;  3U6B A;  2UUC Q;  4M2L A;  2BA0 A;  3CW2 A;  3UE0 A;  5BR8 Q;  4XD7 A;  1CNE A;  2G9D A;  4LF5 L;  3DLL A;  2E5L Q;  3BDL A;  4JI7 Q;  3SK5 A;  2K5W A;  4JYA L;  4P9S A;  2ZIT A;  2JN4 A;  2CWA A;  3NSW A;  2QMU A;  4A3M G;  4P72 A;  4P73 A;  2WJV A;  1RIP A;  1WOO A;  1PA6 A;  1E22 A;  1DZ1 A;  3A5Z B;  3ONA B;  1T6Z A;  3SEJ A;  2EVB A;  4XIG S;  3QFS A;  4DK0 A;  1UWV A;  3BZC A;  4IUN A;  3GDE A;  4CQJ A;  1SJH D;  3ULL A;  3J81 j;  3AMU A;  2ZXR A;  2C77 A;  3KBX A;  2F0P A;  2G5D A;  2RC6 A;  4XOR A;  1MAB A;  1BCP B;  3MXN A;  4FXK C;  1EYG A;  3HG9 A;  1FNM A;  4LF5 Q;  2B7B A;  4A76 A;  4C3I H;  4YCU A;  3DDY A;  4A3M B;  3P27 A;  2EDG A;  1TII D;  4GOP A;  2EE1 A;  3BU2 A;  3E3X A;  4C3J B;  1S3O A;  2F0D A;  1HTP A;  1PDQ A;  4PQX A;  4A3J G;  3MVV A;  4GZY C;  5KEE A;  1WOS A;  3OE7 A;  2JK8 A;  1PRT F;  1L0X B;  3W2G A;  4A3E B;  1UD6 A;  2OTL B;  2MO1 A;  3CES A;  3CCQ A;  1JMC A;  4DV7 Q;  5K5P A;  1EQR A;  2VJI A;  3HOU G;  1AMO A;  3QG1 A;  3BQJ A;  2M9V A;  3NK9 A;  2RDH A;  1MSH A;  1J5E L;  2F0I A;  1KLG D;  5IE8 A;  4ZCM A;  1AZQ A;  3W5H A;  4C0S A;  3WQZ A;  4A75 A;  5IOD A;  3F2U A;  1PFN A;  3PCO B;  4DV5 L;  4IN3 A;  2SNS A;  4WQM A;  1VQC A;  4J15 A;  4IZ8 A;  2DY7 A;  1IW7 C;  2QTZ A;  2A74 C;  2PW5 A;  5C44 B;  1N32 L;  4X3S A;  2PMD A;  4ME5 A;  2MO0 A;  1O7L A;  3OJX A;  2L4N A;  3M4P A;  1TS5 A;  2F4V Q;  3MA2 B;  2CW0 D;  2A69 D;  1YVC A;  1S5E D;  2HDM A;  2K14 A;  4CDE C;  2C5B A;  4DAP A;  1AP0 A;  4X06 A;  3MEH A;  3P26 A;  4RCZ A;  1C48 A;  3BG3 A;  1X55 A;  3U4V A;  4ZGQ B;  3GTL H;  1J9Z A;  5BSY A;  4WFN 3;  2ZBV A;  4PNY A;  1EYC A;  3VYU A;  2V7V A;  4DNI A;  4QGU A;  4BBS H;  2A6H C;  2OQK A;  1EY9 A;  1SE8 A;  3BDO A;  3MC0 B;  1DAR A;  1RJT A;  2ZJP A;  3HKZ B;  3PUZ A;  2CH4 A;  3G05 A;  1EFW A;  5FLX E;  1HUM A;  4DR2 L;  2EYP A;  4K2K A;  4WZK A;  1J9O A;  3DMU A;  1ILQ A;  4Z4V A;  3U2Q A;  3ASS A;  1B4O A;  4HCS A;  3UDX A;  4OEL B;  3PUY A;  4KD4 A;  3CMM A;  1I6H B;  1SNO A;  3GTM B;  3PA2 A;  2E1R A;  3BH4 A;  3NBI A;  4RCN A;  3VR4 A;  3B78 A;  4BBR B;  4CJ2 C;  2Q8I B;  4LF9 Q;  1M90 C;  4JI6 Q;  2OEO A;  2ZT9 C;  2NUC A;  3A0J A;  1DGS A;  5FO7 B;  2ZTC A;  2XOK A;  2WYR A;  4FXG C;  5E7N A;  4RGN A;  1JWM D;  2EYO A;  5BR8 L;  3PV0 A;  2Q2U A;  4OON A;  3U50 C;  2B63 H;  1BPL A;  2ZZQ A;  3CXC B;  3NPP A;  3UDI A;  3HP3 A;  2NZO A;  4HMI A;  2WZN A;  4A3L H;  2X8K A;  1JA1 A;  5E1F A;  2YWG A;  1VQM B;  1ZM4 A;  1PTO D;  4BY1 B;  1E1Q A;  1WTH A;  3CCE A;  1EFT A;  2I46 A;  5C44 G;  1ZEQ X;  3TSS A;  3E0E A;  2PQE A;  3PIP A;  4JI3 Q;  1EY5 A;  1WCM H;  1XXG A;  4KD3 A;  3B82 A;  1S72 A;  2ZL5 A;  1GJX A;  5AN9 A;  2TSS A;  3GQB A;  3H91 A;  4JI6 L;  5C4J B;  1JJ2 A;  4CGY B;  1HFG A;  3U9O A;  1JIC A;  1K3B C;  3D6W A;  2IT1 A;  4UZE A;  4N8F A;  3QOL A;  4N8X 1;  5FLX L;  1QJO A;  2JA5 B;  1ML0 D;  4L63 B;  1IBM L;  1PYS B;  4A3G H;  1S5B D;  1QNK A;  1E1T A;  2Q6I A;  2V4D A;  4MZ9 A;  1XTD A;  1YHQ A;  2K5V A;  1I4Q A;  3T1Y Q;  1WP6 A;  1EY8 A;  4C1N I;  4QHY A;  4YAF A;  1Q7Y D;  3LX0 A;  3HOZ B;  5C0X J;  1EWI A;  3A54 A;  4R4Q A;  4XXE A;  5HXB A;  5EPL A;  1GUG A;  4XTC S;  4DUY L;  3HOY G;  5H59 A;  4UAJ A;  1RQP A;  3ND9 A;  1VMP A;  1EIH A;  1G91 A;  3ASP A;  2RHS B;  3HOX B;  3A8I E;  2MNA A;  5BSX A;  4XQQ A;  3W1G A;  4XQF A;  3NTH A;  1A0I A;  4UHV A;  3A7L A;  2E2D C;  1Q1E A;  4KK7 A;  1VQN A;  3PVD A;  1HA6 A;  5EPK A;  4K5X A;  4RFB A;  4OWW B;  1KNE A;  2K5Q A;  3JAM L;  1K9M D;  1QFZ A;  3CCV A;  2NTS A;  4IUR A;  3DUZ A;  1ZYR C;  3RZD H;  3OFN A;  3GV3 A;  3I56 B;  4S3S A;  3S2D B;  5D14 A;  4WOR A;  2KBN A;  3WBK A;  1O7Y A;  4EVO A;  2F3I A;  4HN7 A;  1FND A;  1LT4 D;  2VZL A;  1C0A A;  1B70 B;  2B8F A;  4C2M H;  2OCE A;  2PO4 A;  2AQ1 B;  2VUM H;  1G29 1;  4DV0 Q;  3AVX A;  4Z4S A;  1YJN A;  2VQF Q;  2HCC A;  4IOC A;  5THX A;  5EAY A;  4XOT A;  3KLS A;  3RLO A;  5JVG 3;  3CP8 A;  1CKM A;  3CCM B;  3E20 A;  1JB9 A;  1E2Z A;  2F0T A;  1KK3 A;  3GTJ B;  1GVH A;  1PFS A;  5E4X A;  4E6I A;  3CB4 A;  4QVA A;  4QUC A;  2QA4 A;  1FDR A;  1S4M A;  4LF8 L;  4K8J A;  5A8A A;  3BJU A;  5M3M B;  2XZL A;  1I8D A;  5GQO A;  4DAY A;  4J0Q A;  3CP2 A;  2EY2 A;  1B23 P;  2NB0 A;  3DM1 A;  3SK4 A;  3TME A;  4CDD C;  2E74 C;  1VQ9 A;  2F0J A;  1NNX A;  3S1N B;  5JPN C;  1EFI D;  1Y1V H;  5HY6 A;  2K01 A;  2KHJ A;  1PV4 A;  2E2H H;  4A3G G;  2QCP X;  1XE1 A;  3BDC A;  1YI2 A;  3URY A;  5FO1 A;  4M1U B;  1H95 A;  4DR3 L;  1KK2 A;  4XKW A;  3WDN A;  1EYA A;  1IW7 D;  4RGO S;  1SBB B;  1HNX L;  1HA5 A;  3JAM E;  2A6E C;  2JIZ A;  1VQ8 B;  2EY6 A;  3BVG A;  4RJL A;  1WCM G;  3PSI A;  1C7Y A;  4U9U A;  2B2T C;  4A3B H;  4MNO A;  3NXW A;  3G4S A;  1A2T A;  2F0N A;  2Q6O A;  3D8G A;  2CBX A;  3K59 A;  3K7A B;  2KCT A;  1U4P A;  4P6V F;  1DJR D;  1AZP A;  1TY0 A;  3T51 B;  3R3O A;  3D4W A;  4BBS G;  1L2F A;  3OTO Q;  3A5U A;  4IUT A;  1RDP D;  4LF7 Q;  2B63 G;  3BCF A;  1STB A;  2OBS A;  4NCN A;  1VMC A;  1W9X A;  2Y0S G;  4L5Q A;  5JEA J;  5CBE E;  3VDY A;  1EP1 B;  4LBV A;  3MZ5 A;  3SEB A;  2ES2 A;  2PZU A;  1UUP A;  2K4K A;  5GAG C;  3DWQ A;  4EX5 A;  4IJL A;  1K8G A;  4ZYS A;  4P26 A;  1NR2 A;  1JNY A;  2DUD A;  2WAQ B;  3I4L A;  1SM4 A;  3I2Z A;  1STN A;  4IPD A;  3HKZ G;  3A74 A;  1K9M C;  5FNZ A;  4ZGN B;  1GUO A;  2FFK B;  2C5H A;  4YHB A;  1NSN S;  1PTO F;  2OT2 A;  1WD0 A;  1P16 A;  2NVX B;  3MWY W;  4A3K H;  2RSO A;  2VNK A;  3ERO A;  2O2L D;  1PH8 A;  2HCI A;  1QG0 A;  5C3E B;  1JR0 D;  3LNN A;  4B3M Q;  2A19 A;  4NBS A;  2R61 A;  3DXJ C;  3H3V I;  2A5H A;  2O5J C;  1SLJ A;  2C2W A;  1E64 A;  1Q3L A;  3OMC A;  1G2S A;  3HOX G;  2YWH A;  1X3G A;  1BUV T;  3Q22 A;  1G7T A;  1Y8P B;  4B47 A;  4TN1 A;  1FYC A;  4DNR B;  2PQA B;  2BGI A;  2ZTD A;  4EQ5 A;  1HA3 A;  1VQE A;  5G3L F;  1GHK A;  4RHR A;  4TKO B;  4ZUJ A;  1PH5 A;  3A56 A;  1KRS A;  3T53 B;  4K6L A;  4BBS B;  3WNB A;  2K52 A;  4PMC A;  2DJG C;  3PMF A;  4XN3 A;  1VDZ A;  1VQ7 B;  4QFM A;  1KQS A;  4B3M L;  3S1R H;  1X56 A;  1QWY A;  5I6W A;  1VLY A;  3VNV A;  3SXH A;  3EVQ A;  4A3J B;  4A3B B;  2E2J B;  4NP5 A;  2JEA I;  4HR7 B;  1D8L A;  2AMC B;  3OIP A;  3RN5 A;  2CH4 W;  1PKV A;  2BF4 A;  4ROX A;  1F2Y A;  1NBW A;  1V43 A;  1EY7 A;  3KOJ A;  1FNB A;  5KNL A;  2AUK A;  5M3F B;  1TS4 A;  1E63 A;  3MTS A;  3J80 c;  3PO2 G;  2OWO A;  5JOB A;  4A3D H;  1D1K A;  4OHJ A;  2JA8 B;  1KQS B;  1VQ7 A;  1D5M C;  4OXP A;  2FMM A;  5AFW A;  1YIJ A;  4A93 G;  2GPJ A;  2QA4 B;  1IJF A;  2OTJ B;  4KTA A;  3M4O B;  3DM3 A;  2V7Q A;  1VQ4 A;  1NMF A;  3BZK A;  1NJI C;  3M4Q A;  4ME3 A;  1ASY A;  4OOX A;  2OK7 A;  2R92 B;  2YYZ A;  4LW1 A;  3TS0 A;  4ILW A;  1W2B A;  2WKD A;  2NVY B;  4LBY A;  4QUF A;  1RHP A;  3VA5 A;  4B08 A;  1CHP D;  2FMC A;  2J4X A;  1F9R A;  2D0P A;  2UUA L;  4PC2 A;  1JOR A;  1I50 B;  5IYW A;  1A8P A;  1N33 Q;  4K1X A;  2HHH L;  4A3M H;  2CQO A;  4C3H H;  4AYB B;  3QWN A;  3QSY A;  3K7U C;  4OO1 G;  2VBS A;  3MCA A;  1I18 A;  2NN6 H;  1STG A;  4A3C H;  1KDA A;  3CF5 A;  1HUN A;  4XLE A;  3QFR A;  2EJF C;  4K5V A;  3J7A V;  3QOJ A;  1KJZ A;  4A3K B;  3OMG A;  2V31 A;  2R92 G;  4TQU S;  4RCO A;  1A6X A;  1PRT C;  3BYT B;  3D4D A;  4FNF A;  4ZAI A;  3ONY A;  3GTO H;  1X9N A;  4PAB A;  1FX0 A;  2JP1 A;  1CKO A;  3F8T A;  3GTQ B;  5TSS A;  1BMF A;  5LMZ A;  1VF5 C;  4DUZ Q;  1ILP A;  2WAC A;  1WTQ A;  3PUW A;  1Y69 U;  5FLM H;  3STB D;  1IYU A;  2F0L A;  2CHB D;  5CV9 A;  2RDF A;  1B44 D;  1MJC A;  4UY8 C;  3TP5 A;  1GAQ A;  4XR6 A;  4RA8 A;  1UE5 A;  4A93 H;  2HHH Q;  2XZP A;  1NTG A;  2K04 A;  4RH6 A;  1DD2 A;  1QOH A;  4N9P A;  5D65 A;  3CD6 B;  2JSO A;  2LMC B;  3AVV A;  1M1K D;  2ZBU A;  2EIF A;  2F3W A;  2JA8 G;  4RLZ A;  4A3C G;  4G7O C;  4BXX G;  1H8H A;  4DAY B;  1XNR Q;  1QH0 A;  4P3I A;  2WFW A;  1B9N A;  1U4R A;  2CQA A;  4DFA A;  4GS3 A;  1VQ5 B;  5KNC A;  1LTB D;  5I6Y A;  4DUZ L;  5J3O A;  2NVT B;  5ELC A;  3WXM A;  3SHL A;  4JBM A;  1U0L A;  1JA0 A;  4PC3 A;  3W5O A;  1Q12 A;  4PMW A;  4WZL A;  1H9S A;  1PRT B;  5C4Z A;  4CJ0 B;  3MAQ A;  1PXU A;  2NTT A;  4P71 A;  1HNW Q;  2NN6 I;  2JA7 G;  2KVO A;  4FN5 A;  5IYQ A;  3J80 i;  1F9P A;  2IHF A;  1SN8 A;  3VO1 A;  1SYB A;  1Y1V B;  4ZKC B;  4K8I A;  4HID A;  1CKN A;  5COY A;  2V7W A;  3PEN A;  5GAE C;  1QGA A;  2MHV A;  3OJW A;  5HZA A;  3OW2 A;  1NCV A;  1PZI D;  5CBA E;  2B63 B;  4XL9 A;  3HFZ B;  3TP8 A;  3PO2 H;  4BPR A;  2F0M A;  1WTW A;  3CP0 A;  5AJ3 Q;  1IZ6 A;  2QTL A;  3HOV H;  4YY3 Q;  1N32 Q;  2Q6K A;  2RHQ B;  4RD3 A;  5M5X H;  1KK1 A;  1SYC A;  3Q6R A;  5EGT A;  2JA7 B;  2K33 A;  2R93 B;  1OXX K;  1YEZ A;  3MMP A;  2KHS A;  3F1Z A;  2IJ0 A;  4BBR H;  2UXB Q;  2Z8L A;  4J6H A;  1S5F D;  4KHP L;  1T6Y A;  3HOZ H;  1HR0 L;  3N52 A;  4BA2 I;  3G71 B;  3WWV A;  1BF4 A;  2B2Y A;  2WV6 D;  3P75 A;  2OBR A;  3A8I A;  4FP5 D;  5CV4 A;  3S1M B;  1UNS A;  1TT2 A;  4H0L C;  2ICE C;  2EFG A;  1IBL L;  3KF8 B;  3RZD B;  5CV6 A;  1XYI A;  1G7R A;  1WTP A;  3RY8 A;  2DNC A;  2CW5 A;  4LUZ A;  2N88 A;  2RBM A;  3ERQ A;  3JAM i;  5COR A;  1JB3 A;  1XPO A;  1SEB D;  4DV0 L;  1EY6 A;  1HZ9 A;  4C43 A;  1MRZ A;  4APV A;  1Q82 C;  1S5D D;  1R5O A;  4TT3 A;  3QFC A;  1L0Y B;  1E2W A;  2X85 A;  1KTV A;  2KQ3 A;  4NDX A;  3G6E A;  1UE7 A;  1ONL A;  4DV2 L;  2HDL A;  1E3X A;  3NBH B;  1X3F A;  2YWF A;  3QB3 A;  4BY1 H;  1RTN A;  3AFP A;  2JYO A;  2F3V A;  1V8Q A;  1XB2 A;  3UE1 A;  3Q0A A;  3RZO H;  1G8Z D;  2I07 B;  3B6Y A;  1MSG A;  4AQY L;  1LV9 A;  2WB1 E;  4O0A A;  5HGQ A;  4MYU A;  5M9O A;  4NXN L;  4A3B G;  3AGQ A;  1PH4 A;  1LAB A;  2M5S A;  3M7N A;  1L1O B;  3BZD B;  3H9N A;  4CDF C;  4IUQ A;  2XN9 C;  3TRE A;  4HMJ A;  2PMZ B;  1PTO C;  1W87 A;  2ZXH A;  4X64 L;  1QCB D;  1R4P B;  4K14 A;  1Q7Y C;  2L15 A;  2B2T A;  4B3S Q;  4POG A;  2XNC A;  3Q23 A;  3U6K A;  1VQ9 B;  1SNC A;  3OW7 A;  4HAE A;  3H15 A;  3PO3 H;  1HCZ A;  4CKB A;  1PYB A;  4NPS A;  2ZZE A;  3CRZ A;  2CND A;  4LNQ A;  1CZG A;  4PZ8 A;  1TU2 B;  1IBM Q;  4C3J H;  4AQY Q;  1U4L A;  1BBX C;  2ZL6 A;  2NPF A;  3S1Q H;  1B3A A;  4R8N A;  1AN8 A;  4Q5V A;  1S0U A;  3DWP A;  3QJY A;  1VQA A;  3TZU A;  2NVQ H;  1W34 A;  4JMQ A;  3P20 A;  3GTQ H;  4YIJ A;  2IY5 B;  3WBJ A;  1A63 A;  1N34 L;  2PI2 A;  5I9P A;  4JYA Q;  1O80 A;  1Q8I A;  1AIP A;  1EP2 B;  3K0Y A;  3ERS X;  2Z9H A;  1G6Z A;  4N9T A;  2WZP P;  3JQQ A;  3AVT A;  3OKX A;  1I4R A;  4X7C A;  1BNZ A;  2JJQ A;  1AEX A;  1GO3 E;  2UU9 L;  4RAU C;  3VYR A;  4U67 3;  2GVB A;  4AF7 A;  5FKA C;  4RGM A;  4CDC C;  2CCZ A;  4HE5 A;  3HAG A;  4I7A A;  3NE5 B;  4XYQ A;  4DR6 Q;  4JPB W;  1CUK A;  1K0R A;  2VBT A;  3R6J A;  2KHI A;  3J81 L;  4AYB E;  1EUJ A;  2A6E D;  4JVZ A;  2VW9 A;  2RSN A;  3CD6 A;  5A88 A;  2F0U A;  2TMP A;  2EYL A;  3R2T A;  5JJZ A;  3WNC A;  2K50 A;  3WYA A;  1QUE A;  2K7V A;  5FJ8 G;  1YJW A;  3CME B;  1KAB A;  4ALP A;  2EY5 A;  5C3E H;  4XNF A;  3EQL C;  4HIO A;  1Q8K A;  2K1B A;  4YHH Q;  2UU9 Q;  2A1A A;  1G7S A;  3GTG B;  1F20 A;  2CFM A;  3M3Y H;  2VNU D;  2QIL A;  4DV5 Q;  1Y1W B;  4P2C B;  1GAW A;  3KYH C;  1TUI A;  1QE6 A;  4G1V A;  1XPR A;  2R93 H;  1A8V A;  2D0O A;  4B3G A;  2EJG C;  1JE4 A;  1GD7 A;  4XT3 B;  1H8E A;  3A3B A;  1J8I A;  5F4O A;  1XJV A;  1TWH H;  3CC2 B;  2BDN A;  1ESR A;  2CWP A;  1SNQ A;  2E8G A;  3PUM A;  4QMG A;  1TVC A;  4UPA A;  3HKS A;  3CCE B;  2GVA A;  4HCE A;  1FGB D;  4GN4 B;  1NY4 A;  3GSI A;  2K05 A;  3D6C A;  5C0X G;  2I5L X;  4LUV A;  5TV2 A;  3Q6S A;  1NR4 A;  4CKE A;  1UD2 A;  2Z6K C;  5IGC A;  3W2I A;  2ZZF A;  5EBD A;  4WRD A;  5IWA Q;  4P74 A;  1HRJ A;  2GJP A;  4K5W A;  4UAI A;  3X3N A;  4X3K A;  4KJN A;  2K5D A;  1LT5 D;  1K8O A;  3PGZ A;  1PRT D;  4CHT B;  3CCV B;  2K6A A;  5KYL A;  2I0Q A;  1HXY D;  5IGG A;  3VO2 A;  1TWA H;  3E6Z X;  1IBK Q;  4ZQ3 A;  1ZM3 A;  4E0F A;  1VCI A;  3HZX A;  3CU7 A;  4YWM A;  5M5Y B;  1V1P A;  1N0V C;  3CPX A;  1STA A;  1YX2 A;  3OEE A;  3U4Z A;  2L1B A;  3CMA B;  2R93 G;  2WII B;  4I65 A;  3RMH A;  2VNI A;  3K5M A;  4P25 A;  1XPU A;  5LMU L;  3V7A A;  4R4T A;  1XMO Q;  2BVN A;  4R1J A;  1V0E A;  4X0C A;  3HOU B;  2WIN B;  1KDC A;  4UZU A;  1OGJ A;  2C78 A;  2LXK A;  1WTR A;  1PH2 A;  4LF8 Q;  5M3M H;  2BE5 C;  1IBL Q;  3J80 E;  4RDK A;  3FDT A;  4DV3 L;  4MTN A;  2ENB A;  2W6J A;  2WSS A;  5IP9 G;  4GKJ Q;  4DR1 Q;  1JE5 A;  3J81 c;  4UP8 A;  3K7A H;  3OYY A;  3C2P A;  4BY7 H;  5DS0 A;  4ZUI A;  4BA1 I;  3VR3 A;  4LF4 Q;  1B2R A;  3H3V C;  3H3V H;  3SDZ A;  5M5W H;  2V1C C;  1OB2 A;  4QVJ A;  1SXT A;  2LFN A;  3CPF A;  4JBJ A;  1W3S A;  3BNW A;  2QDL A;  5GV7 A;  1VQG A;  3PUX A;  5GAH C;  1WYD A;  1YHA A;  4KY7 A;  1CA6 A;  5ELO A;  4RPB A;  1EY0 A;  2VZA A;  4X65 L;  5FLX c;  5M5X B;  4WWV A;  1Q1B A;  1JC7 A;  1HR0 Q;  1G51 A;  3B8H A;  2FXQ A;  2CVR A;  1IKL A;  1CFM A;  1HFN A;  1EOV A;  4PMB A;  2XND A;  1D2E A;  2BSA A;  5BN4 A;  1AW7 A;  4X66 Q;  4H02 A;  1Q90 A;  1AH9 A;  4MN3 A;  3A1P A;  3CTA A;  3OW2 B;  2GK6 A;  2F0Q A;  5HKK A;  1WTO A;  1NMG A;  3A8J E;  3KDF B;  4OIK A;  2LKV A;  2BV3 A;  4RCY A;  1VQO A;  1S4Z A;  4ACB A;  3JQR A;  4KY6 A;  1ESF A;  3FHW A;  3HOV G;  5IYD H;  3V05 A;  4TRD A;  2VUM B;  2QDX A;  4UZF A;  3BVM A;  4JI8 L;  3CRL C;  2NBF A;  1X6O A;  3H0G G;  2SEB D;  1IHZ A;  3VR5 A;  1F2L A;  1GOZ A;  4RMF A;  1ZUN B;  1VQH A;  3F2C A;  1Y1W G;  1ENA A;  5JEA H;  5IYB H;  4PG3 A;  4J8Q A;  3HGB A;  2HIV A;  2ZXO A;  2QDB A;  1IL8 A;  2P3M A;  3R8B A;  1BQE A;  1HNZ L;  3VR2 A;  3J81 i;  5LL6 S;  4YAW A;  4Y7C A;  2MUY A;  3AVY A;  3HOU H;  4TMT A;  1XWE A;  3EFX D;  3OPO A;  3CKI B;  1CK1 A;  2ZTG A;  2RC5 A;  2V7U A;  1EQV A;  1OB0 A;  2UXC Q;  1SE4 A;  1H9K A;  4X3U A;  2I5H A;  4A3F G;  1D2B A;  4HED A;  3KBG A;  3J7Z C;  5KNB A;  1K73 C;  1N8R C;  2UXB L;  3RLF A;  1XQB A;  4O1N A;  1TQO A;  5I9O A;  4LMQ D;  2KCN A;  3D31 A;  1M4V A;  5EKL A;  3TP7 A;  2PIA A;  2RVL A;  4ZRZ A;  3O13 A;  1J5E Q;  1NB0 A;  1UE6 A;  3GTP H;  3GIR A;  3CAM A;  3T56 B;  4X05 A;  4IJH A;  3TS2 A;  3MEF A;  1ZM2 A;  2Y0S B;  1ICF B;  1EFU A;  1R5B A;  2RKS A;  1BCP D;  4B43 A;  1OXS C;  4FYD A;  2QF7 A;  2VB3 X;  3LO8 A;  1XMQ Q;  4JI0 L;  4R71 A;  2JA7 H;  1IBK L;  1E1O A;  1I6H H;  2KED A;  3ASR A;  1I50 H;  1Y8O B;  4RGT A;  5C3W A;  1TVX A;  5IT9 c;  4ZCL A;  3ISX A;  4RDL A;  1CTM A;  2LS0 1;  1SMX A;  5DN6 A;  4IQZ A;  5IGD A;  5F4M A;  1UEB A;  1KLU D;  1MGS A;  5TY0 A;  1SYD A;  4DQL A;  1M90 D;  2VQE Q;  1SND A;  3LGJ A;  2MFI A;  4OOV A;  1TWH B;  4GOP B;  2ASB A;  2YWE A;  1AE2 A;  1CSP A;  2JA6 H;  1CZW A;  1CA5 A;  5ELD A;  2E5L L;  1L1O A;  1LUZ A;  3TDQ A;  2Z0S A;  2X6W A;  2JA8 H;  2SDF A;  2NV4 A;  4B3X A;  4Z4U A;  1YIJ B;  4B3T Q;  4LFB Q;  1T9H A;  3LQE A;  4M4S A;  4PZ7 A;  2V7X A;  1RTO A;  3W2F A;  1YJW B;  5I2X A;  3FKI G;  1JWU D;  2JE6 I;  2MPM A;  1YIT B;  4XKV A;  2A6H D;  3AB9 A;  4O42 A;  5JVH 3;  4KMU C;  2NYZ D;  2HT1 A;  4Y7N B;  5I2Y A;  1KMH A;  3K6O A;  4L5T A;  2AKW B;  1QVG B;  1YJ9 A;  4JCV E;  4DGZ A;  5J22 A;  4NXM Q;  5BN3 A;  3S15 H;  1HZE A;  4GKK Q;  2HDN B;  2EQS A;  4Q0F A;  2ZTE A;  3CMA A;  2UXD Q;  3E0J A;  5FK9 C;  5CYU A;  2F4N A;  4X66 L;  4OX9 Q;  1SE3 A;  1VQL B;  1KAW A;  2B29 A;  2PNH A;  4ODG A;  1VLO A;  1WDT A;  4OWT B;  4KKS A;  1SYG A;  4C3H G;  1X65 A;  4LFB L;  1W6J A;  1XNQ L;  1WD1 A;  4B3R L;  2BM1 A;  4B48 A;  3HEJ A;  3ASQ A;  5KGU A;  3I4N H;  4ZCK A;  2YV5 A;  4HJ5 A;  4IFD H;  1SKQ A;  2B2W C;  3L3O C;  2DCU A;  3ICE A;  4FK8 A;  2Y0S E;  3FPP A;  4GNX C;  1QZH A;  4DKA C;  1VQK B;  4F88 A;  5CR3 A;  3OOC A;  3OHX C;  4JBW A;  1X3Q A;  2RDG A;  2XWB B;  3NWT A;  3VR6 A;  1D6E C;  3Q8D A;  1PJ6 A;  2R7Z G;  4LWC A;  1Y1W H;  1C9O A;  4N3N A;  3L7Z C;  4X62 L;  1L1O C;  3VYT A;  4MTK A;  4JI5 Q;  5TRD A;  2H4O A;  5IGF A;  4QIW E;  1ASZ A;  1SJE D;  1Z9F A;  2OK8 A;  2F0E A;  1O78 A;  4P75 A;  4HIK A;  3OWF A;  2OTL A;  1DYQ A;  1SRU A;  2KCM A;  5IYD G;  1Y0Y A;  3CCM A;  2K5H A;  3CC2 A;  2H1E A;  2OTJ A;  2DOG A;  1K73 D;  1N8R D;  4K2L A;  4OL7 A;  2OBT A;  1WOR A;  1HJP A;  2XGT A;  1TWF H;  2FVG A;  2C35 B;  3G7L A;  4FXU A;  4A3F H;  3W5V A;  4TVA B;  3GP7 A;  2JXM B;  5H1S E;  3M4O H;  3VYS A;  3TEH B;  4AF6 A;  4AYB G;  5LMN W;  2D5D A;  1WTX A;  4FWT A;  3K0X A;  2Q2H A;  4IUV A;  2K75 A;  4CKC A;  1RCV D;  1XX8 A;  1IYJ B;  4FF3 A;  4X6A H;  5JJK A;  4A3K G;  1SRO A;  3NEL A;  1DOM A;  1I5F A;  3WOE A;  3CCR B;  1SYE A;  2L5T A;  5IYR A;  4TSF A;  3W5U A;  4DV3 Q;  5E4W C;  2AWO A;  2WP8 J;  2DYI A;  2HLD A;  4KHV A;  1FRN A;  1VQ6 B;  5CV8 A;  2E76 C;  1QVC A;  4LF4 L;  1H85 A;  2W6I A;  5GAD C;  1VQM A;  5FO0 A;  4OO1 I;  2SOB A;  3G48 A;  2WPD A;  4B3F X;  1KZL A;  4V19 0;  1FNC A;  1HVX A;  1I4H A;  5LMN Q;  1LTR D;  4AH6 A;  1HZC A;  3GV6 A;  1VQB A;  1STE A;  1B9M A;  1EIG A;  1DOK A;  4G4K A;  2E2H B;  4FF2 A;  2BCO A;  1RF2 D;  2JEB I;  3MFY A;  3FMC A;  4XM3 A;  5IIF A;  4R4I A;  1FRQ A;  4Z4W A;  4TMX A;  1YI2 B;  2A68 D;  1CSQ A;  2AWN A;  1B3Q A;  4J1M A;  3HRZ C;  5IP7 G;  2A8V A;  3GTK B;  1BR9 A;  1I7P A;  1F2Z A;  4G7X A;  3HOY B;  3EBE A;  3PQI A;  4QF4 A;  5J39 A;  3SVM A;  1V1O A;  2X6L A;  1SKY B;  1A3V A;  2D2C C;  1S5C D;  2FIN B;  3EN2 A;  2LZJ A;  4IPG A;  4IUP A;  2VYQ A;  1SMY C;  4JI2 L;  1KIX A;  1FD7 D;  1GHJ A;  1SAP A;  1VQ4 B;  3JC6 6;  4YEJ A;  4YCV A;  4HIM A;  2E2I H;  2UUC L;  1ET6 A;  2XVS A;  2GN5 A;  3HOV B;  2QGG A;  4DU9 A;  1EOT A;  2Q8R E;  2CF4 A;  2XNA C;  3A55 A;  1N9W A;  5T1G A;  2QGQ A;  1EU3 A;  4K0K L;  3RZO B;  3CPW A;  4X7E A;  1QVF B;  1CKN B;  3GD7 A;  4RHS A;  1DDI A;  4Y52 H;  1ZKO A;  1XMQ L;  4XON A;  4GKJ L;  1VQI A;  1TKW B;  2B2U A;  1ZM9 A;  1VQK A;  4OOS A;  1OO9 B;  3S16 B;  4YWL A;  3SGI A;  2PLF A;  2OXP A;  1X32 A;  5C4X B;  3CQZ B;  4YAO A;  1N33 L;  1IB0 A;  4B3R Q;  2K28 A;  3IAY A;  2N78 A;  3NHH A;  1Y14 B;  1EEI D;  3H0G B;  1PH3 A;  4RPD A;  3DEO A;  2OYN A;  3D0F A;  1I3Q B;  5DEH A;  3P7J A;  2L9H A;  2VNH A;  3WOF A;  2PZW A;  5E6T A;  2B5O A;  5JAV A;  4K0K Q;  1G6P A;  4LK1 C;  4P2N A;  4IO9 A;  1VQD A;  4KKT A;  5IY0 A;  2RF4 A;  2WR8 A;  2H5X A;  4B3T L;  1MD2 D;  4V0B A;  1DXM A;  4OWX B;  1SYF A;  2BH2 A;  2ZZG A;  3TN2 A;  1FL0 A;  1II3 A;  4FXD A;  1JJC B;  5L46 A;  2G9H D;  3IFT A;  4NKL A;  4R4O A;  4Z4Z A;  5CV5 A;  3W2H A;  1V1Q A;  4JI0 Q;  4OPO A;  3M85 A;  2ZTN A;  3MXP A;  5C4J H;  2ZL7 A;  3AYH B;  2ZJQ A;  3PO2 B;  2UUB L;  4JBK A;  2VUM G;  2QEJ C;  2AHO B;  1UEA B;  1HZB A;  4AVZ A;  3I3C A;  1PLF A;  3H94 A;  4KHP Q;  3ZC3 A;  3HOW B;  4OPV A;  3AQQ A;  1T5X D;  3ULP A;  3E9H A;  4Y9R A;  4LF6 Q;  1N08 A;  4XT1 B;  4L8J A;  1YJN B;  2B2Y C;  2XNJ A;  3CXC A;  3A8K A;  4C3H B;  3NWS A;  3PF4 A;  5IYC H;  3N6R A;  3JQP A;  4M0L A;  4N3G A;  3OP1 A;  5KSW B;  1QVF A;  1BBW A;  5ELE A;  2HQE A;  3M7G A;  1P4M A;  3QR8 A;  3NQI A;  4KY5 A;  1EL0 A;  4XLH A;  2NVT H;  4BWG B;  2A73 B;  1V0F A;  1Y0R A;  1TY2 A;  2D9U A;  5DNF A;  1HZA A;  2NVY H;  4OEM B;  4DQK A;  4X3T A;  5LMU Q;  2UXC L;  4LUO A;  1B53 A;  1CHQ D;  3Q6Q A;  3RD4 A;  2B2W A;  5ELF A;  3Q38 A;  5IT9 E;  4GOP C;  4G1B A;  2HMA A;  1N36 L;  3C1F A;  4U68 A;  1I6V C;  4DPG A;  3U9S A;  1Y8N B;  4XN0 A;  4LF6 L;  1QB5 D;  3R93 A;  1QGZ A;  3VA7 A;  4DR7 L;  4PGO A;  4WJW A;  2B39 A;  3E5S A;  1BKB A;  1F77 A;  3X3M A;  1QGY A;  3T16 A;  1KTK A;  1WI5 A;  2GQF A;  2FX3 A;  1COW A;  1H9M A;  1ZYR D;  5C5M A;  4DN4 M;  5A2Q L;  1M1K C;  2A69 C;  1IYV A;  2OQ0 A;  3CCL B;  1F9S A;  1VQ8 A;  1XNR L;  1KC8 D;  2B2V A;  4X7F A;  4DF7 A;  3IKJ A;  4LFC L;  2K32 A;  3KF8 A;  4YAL A;  3AU7 A;  5CV7 A;  1KRH A;  2R9V A;  3S24 A;  2XGJ A;  3KF6 A;  3W3A A;  5HGT A;  3CCS A;  3S17 H;  3LWE A;  2P5Z X;  4MYT A;  1WSR A;  1GUT A;  2BM0 A;  2RCF A;  1BJK A;  3C2Q A;  4GN5 A;  2BN4 A;  1SE2 A;  3KLS X;  5KND A;  2EXD A;  4DK1 A;  2BMW A;  5DM7 3;  4EQN A;  1BX1 A;  5C44 H;  2KA7 A; 
#chains in the Genus database with same CATH homology
 4KV6 A;  4P22 A;  5A2Q E;  2GJK A;  1A3U A;  2D62 A;  2L0C A;  1BO0 A;  4IUU A;  1NUC A;  2EZV A;  1HPC A;  1YNJ D;  1STY A;  4C3J G;  1EQT A;  5T1I A;  4FO2 A;  4G7W A;  2F4I A;  2B8G A;  5IT9 L;  3I72 A;  1QG7 A;  3CRK C;  2KUM A;  3A7A B;  4H13 C;  1GUS A;  1UD5 A;  1PFB A;  1QIL A;  3BC9 A;  2YU9 B;  4H44 C;  3J81 E;  5IOC A;  3QIA A;  2F0H A;  1LAC A;  2EYM A;  2WKC A;  1NRK A;  1PTO H;  1YNN C;  1WPC A;  2EPB A;  3BS1 A;  3I4M B;  5DM6 3;  1AFP A;  3I4N B;  4QIW B;  3W2D A;  1EU4 A;  3KUP A;  5F2D A;  3I70 A;  5NUC A;  3FKS A;  1DM0 B;  4UDU C;  2AQ3 B;  2GJR A;  3GTL B;  2VXW A;  2BA1 A;  3ZYY X;  3S15 B;  1TS2 A;  3I90 A;  1KNA A;  4RKB A;  2XSC A;  3L9A X;  1CM9 A;  4NNJ A;  1EYD A;  4II2 A;  1TWC B;  2DN8 A;  5KYI A;  5D3D A;  3NTK A;  2CW0 C;  3KK7 A;  1D1I A;  1PYW D;  4ULL A;  3A35 A;  1PFM A;  4XLC A;  1E3Z A;  1OXV A;  2ZXP A;  1E2V A;  2DY8 A;  2WB1 B;  2Z4H A;  2JDI A;  1TR5 A;  4CBV A;  3FEW X;  2M2L A;  2MGS A;  2JA6 B;  4BY7 B;  1YNN D;  4DNT B;  4L6T B;  1EZ8 A;  1ET9 A;  2KOL A;  3R2I A;  3TP6 A;  2D3N A;  1B50 A;  4A3F B;  1BDO A;  1TWF B;  1JWS D;  4CJ1 B;  3A8K E;  4G7Z C;  4KN7 C;  1SNP A;  1F9Q A;  1LTG D;  4KKU A;  2XRS D;  3J7A F;  3GVL A;  3J80 L;  4NMZ A;  4EGV A;  1U9R A;  1FNU A;  1WTH D;  2DNE A;  1NAP A;  4MHE A;  3NTI A;  3MXU A;  1MBY A;  1LT3 D;  4FVM A;  3S2H B;  1EFR A;  1UD4 A;  3T4A C;  5EQ0 A;  4EQO A;  2XWJ B;  1DCZ A;  4R8I A;  1A3T A;  2X6X A;  4RWS C;  1EWC A;  1LO5 D;  4C56 C;  2EY1 A;  1BLI A;  1BQQ T;  2FJ2 A;  5FOB B;  1RKN A;  1A2U A;  3PO3 B;  5A35 A;  3J7Y W;  1NBM A;  1ENC A;  4K6D A;  2ZXI A;  4XDX A;  5CDF A;  3RUZ A;  4NW2 A;  3C46 A;  1W0K A;  3V96 A;  4A3I B;  3FPU B;  5C0X I;  1Z6H A;  1Z47 A;  5IGB A;  2NN6 G;  4LAA A;  1SNM A;  1D5Z C;  4OO1 H;  2GK7 A;  2EXZ A;  3GO5 A;  3A3G A;  3Q24 A;  5LHY 1;  1GUW A;  3MFG A;  2K03 A;  2F0S A;  3TZD A;  1YNJ C;  1H9J A;  4HSP A;  1WVL A;  2NVQ B;  3V2T A;  4HTH A;  1CI3 M;  2Z1C A;  5JEA G;  1ROD A;  1LTA D;  4YXW A;  2X69 A;  4KHZ A;  2EJM A;  2GA4 B;  1BCP C;  3KLR A;  4ID6 A;  2JJ1 A;  2F0O A;  1C4Q A;  3OEH A;  4B9W A;  3OWE B;  3DWA A;  1R9T B;  2O4X A;  2IX0 A;  1HHV A;  2KVM A;  2E75 C;  4QB4 A;  2AUJ D;  5CC4 A;  1U4M A;  1C8C A;  2ID0 A;  4BS9 A;  2F0V A;  2A68 C;  3GTP B;  4FF4 A;  1HQM C;  4XOP A;  2Z6B D;  3OSO A;  2IL8 A;  3S14 B;  2OF1 A;  4HSV A;  3DHQ A;  1H9S B;  3I91 A;  1CQV A;  1K28 D;  5K36 G;  2F03 A;  2FHT A;  3HS0 C;  3BCD A;  5FL7 A;  1STH A;  3JU4 A;  4EQP A;  2XZO A;  1JCK B;  1KDB A;  5EKI A;  1I4X A;  3K5L A;  1ZXT A;  3PIP 3;  3NUC A;  2EOT A;  5JPM C;  3OAA A;  1FNV A;  1E0B A;  4XYO A;  4ABN A;  2X6Y A;  4A93 B;  3FKI B;  3SK6 A;  4G57 A;  5J1Z A;  3BYY B;  2L12 A;  2C5C A;  3K5N A;  2L55 A;  4IFD I;  2EYH A;  5IK2 A;  1DOL A;  5IGE A;  1RD9 D;  4G7H C;  3D3R A;  4IAL A;  5C3X A;  4C3I B;  2F0G A;  2IWH A;  1IKM A;  3MXG A;  1W0J A;  2MP1 A;  2R3Z A;  5LL6 X;  3GVJ A;  2DIE A;  4XLA A;  2Q8T A;  1H9R A;  1FNW A;  2EYF A;  5FO9 B;  5KRU A;  4II3 A;  3BVZ A;  2B2U C;  4H7B A;  2F0W A;  1LT6 D;  3FVQ A;  1E79 A;  3K57 A;  5EBC A;  2VJJ A;  2BDO A;  3KEW A;  5C4H A;  3S9W A;  1VJS A;  4HIZ A;  1UAP A;  3EA6 A;  1E43 A;  4YEL A;  2F0K A;  1PTO B;  1W6K A;  3GTO B;  5C0X H;  3MHB A;  1X3P A;  2PNR C;  2PCF B;  2KCC A;  2IW3 A;  1BCP F;  5BN5 A;  2VB2 X;  5C5L A;  4R9W A;  4I7Z C;  4G6I A;  1CQF A;  3SK8 A;  1GUN A;  1EZ6 A;  3OIQ A;  1LTT D;  2E1B A;  4ZK9 B;  4JK1 C;  4F7X A;  1Z7T A;  3M4Y A;  1E1R A;  1OXT A;  2KEE A;  5FO8 B;  3ZPN A;  4ZLT F;  2PW7 A;  3FRP B;  1D5X C;  1CT1 D;  3IL8 A;  4LJZ C;  1B2T A;  2LY7 A;  4QCL A;  2N55 A;  2BOS A;  4Z9C B;  2RA4 A;  5D3I B;  1HTL D;  4A3D B;  2J0T D;  3I8Z A;  2F43 A;  5KIX A;  2IPK D;  3H6M A;  1O7Z A;  5ELB A;  3CHB D;  3UI2 A;  1EEF D;  2Z4I A;  2NZ1 D;  2PZT A;  3S1R B;  2QKI C;  1BXT A;  1PZK D;  1SSO A;  1QNU A;  1ICW A;  4F87 A;  1A15 A;  1EY4 A;  1VF7 A;  4GQN A;  2WJY A;  1XTC D;  1FR3 A;  2HUG A;  1BOS A;  1LTS D;  2KEC A;  1SMY D;  2X53 S;  4IFD J;  4KN4 C;  4KI0 A;  2R6G A;  5K36 H;  3S17 B;  5CMD A;  4XMY A;  2R7Z B;  2KJX A;  1G2T A;  1TS3 A;  2XIW A;  3I73 A;  1GXD C;  1JOQ A;  4XQJ A;  4RKL A;  2F0F A;  3ITP A;  3S1Q B;  4FF1 A;  3SR1 A;  3GVK A;  3C3L A;  3TBI B;  2PYK A;  2BE5 D;  2IX3 A;  3ND8 A;  4DA2 A;  2ICI A;  2AQ2 B;  1T5E A;  1MI2 A;  2PPB C;  1SDF A;  1JOO A;  2XRQ D;  4M8A A;  4F8M A;  3EJI A;  5M5W B;  4C2M B;  1JQY D;  4C3I G;  4XQN A;  2X6G A;  1ENF A;  1JOK A;  1HQR D;  2D3L A;  1K83 B;  1K8M A;  1F2M A;  2JJ2 A;  2L11 A;  1EWH A;  2J7Z A;  1WTV A;  2CK3 A;  1TWG B;  1DON A;  2NWG A;  3K5O A;  4ASU A;  4ZKB B;  4IFD G;  4Z1M A;  4PV1 C;  1SFO B;  3T13 A;  1LLR D;  1I4P A;  5HUR A;  5I4D A;  5EPJ A;  1PZJ D;  1KAA A;  3PIO 3;  3LWU A;  5CGK A;  1PMR A;  5E3F A;  3QO2 A;  2C9O A;  3K58 A;  4OIJ A;  1UD8 A;  4A3G B;  1R4Q B;  2F1M A;  4MIU A;  4TSS A;  5C6A A;  1V1P B;  2SNM A;  2B2V C;  4DXG A;  5G3L D;  2M00 A;  2O5I C;  1WCM B;  1UD3 A;  3NQT A;  4KJO A;  1I4G A;  3SE0 A;  1LTI D;  3IFD A;  1OXU A;  1M8A A;  2MJ8 A;  3C1E A;  4C1N K;  4B9X A;  4DAV A;  3M3Y B;  2RQX A;  3H09 A;  3P1H A;  3NP8 A;  4DXF A;  3NBH A;  5ISR A;  2QE7 A;  3ZIA A;  2E2I B;  3DEP A;  4XLF A;  1B1Z A;  3D4R A;  5DAU A;  2EYJ A;  5EJW A;  3G6J B;  2IX1 A;  4OGQ C;  3PUV A;  5EKK A;  1TWA B;  1OHH A;  2BA0 A;  4XD7 A;  2G9D A;  3BDL A;  3SK5 A;  2K5W A;  3NSW A;  2WJV A;  1DZ1 A;  3ONA B;  2EVB A;  4XIG S;  4DK0 A;  3AMU A;  4IUN A;  1SJH D;  2ZXR A;  3KBX A;  2F0P A;  4XOR A;  1MAB A;  1BCP B;  3MXN A;  4FXK C;  3HG9 A;  3DDY A;  4A3M B;  2EDG A;  1TII D;  2EE1 A;  4C3J B;  2F0D A;  1HTP A;  1PDQ A;  4PQX A;  4GZY C;  3MVV A;  5KEE A;  3OE7 A;  1PRT F;  1L0X B;  4A3E B;  1UD6 A;  3CES A;  5K5P A;  2VJI A;  3QG1 A;  2M9V A;  3NK9 A;  2RDH A;  1MSH A;  2F0I A;  1KLG D;  1AZQ A;  3WQZ A;  5IOD A;  3F2U A;  1PFN A;  4IN3 A;  2SNS A;  4IZ8 A;  2DY7 A;  1IW7 C;  2PW5 A;  2A74 C;  5C44 B;  4X3S A;  4ME5 A;  1O7L A;  2L4N A;  1TS5 A;  3MA2 B;  2CW0 D;  2A69 D;  1S5E D;  2HDM A;  4DAP A;  1AP0 A;  3MEH A;  1C48 A;  3BG3 A;  4WFN 3;  4PNY A;  1EYC A;  3VYU A;  2A6H C;  1EY9 A;  3BDO A;  3MC0 B;  1RJT A;  3HKZ B;  3PUZ A;  3G05 A;  5FLX E;  1HUM A;  2EYP A;  4K2K A;  1J9O A;  3DMU A;  1ILQ A;  1B4O A;  4HCS A;  3PUY A;  4KD4 A;  3CMM A;  1I6H B;  1SNO A;  3GTM B;  3BH4 A;  3NBI A;  4RCN A;  3VR4 A;  4BBR B;  4CJ2 C;  2Q8I B;  2OEO A;  2ZT9 C;  2NUC A;  5FO7 B;  2XOK A;  4FXG C;  4RGN A;  1JWM D;  2EYO A;  3PV0 A;  1BPL A;  2ZZQ A;  3NPP A;  3HP3 A;  4HMI A;  2X8K A;  5E1F A;  4BY1 B;  1PTO D;  1E1Q A;  2I46 A;  1ZEQ X;  3TSS A;  2PQE A;  1EY5 A;  1XXG A;  4KD3 A;  1GJX A;  2TSS A;  3GQB A;  3H91 A;  5C4J B;  4CGY B;  1HFG A;  3U9O A;  1JIC A;  3D6W A;  2IT1 A;  3QOL A;  5FLX L;  1QJO A;  2JA5 B;  1ML0 D;  4L63 B;  1S5B D;  1QNK A;  2V4D A;  1I4Q A;  1WP6 A;  1EY8 A;  4C1N I;  3LX0 A;  3HOZ B;  5C0X J;  3A54 A;  4XXE A;  5EPL A;  1GUG A;  4XTC S;  3ND9 A;  1EIH A;  1VMP A;  1G91 A;  3HOX B;  3A8I E;  4XQQ A;  4XQF A;  3NTH A;  3A7L A;  2E2D C;  1Q1E A;  4KK7 A;  1HA6 A;  5EPK A;  4K5X A;  4RFB A;  1KNE A;  2K5Q A;  3JAM L;  2NTS A;  4IUR A;  3DUZ A;  1ZYR C;  3OFN A;  3GV3 A;  3S2D B;  4S3S A;  5D14 A;  4WOR A;  1O7Y A;  4EVO A;  4HN7 A;  1LT4 D;  2B8F A;  2PO4 A;  2AQ1 B;  1G29 1;  2HCC A;  5JVG 3;  4XOT A;  3KLS A;  3CP8 A;  1E2Z A;  2F0T A;  3GTJ B;  5E4X A;  4E6I A;  4QUC A;  4K8J A;  5M3M B;  2XZL A;  1I8D A;  4DAY A;  3CP2 A;  2EY2 A;  2NB0 A;  3DM1 A;  3TME A;  3SK4 A;  2E74 C;  2F0J A;  3S1N B;  5JPN C;  1EFI D;  2K01 A;  2QCP X;  3BDC A;  3URY A;  4M1U B;  4XKW A;  3WDN A;  1EYA A;  1IW7 D;  4RGO S;  1SBB B;  1HA5 A;  3JAM E;  2A6E C;  2JIZ A;  2EY6 A;  3BVG A;  2B2T C;  3NXW A;  1A2T A;  2F0N A;  3D8G A;  3K59 A;  3K7A B;  1U4P A;  1AZP A;  1DJR D;  1TY0 A;  3T51 B;  3R3O A;  3D4W A;  4IUT A;  1RDP D;  3BCF A;  1STB A;  1VMC A;  5CBE E;  1W9X A;  5JEA J;  3MZ5 A;  3SEB A;  2PZU A;  1UUP A;  3DWQ A;  4ZYS A;  1NR2 A;  3I4L A;  2WAQ B;  1STN A;  1GUO A;  2FFK B;  2OT2 A;  1NSN S;  1PTO F;  1WD0 A;  2NVX B;  3MWY W;  2RSO A;  3ERO A;  2O2L D;  2HCI A;  5C3E B;  1JR0 D;  3LNN A;  2R61 A;  3DXJ C;  2A5H A;  2O5J C;  1Q3L A;  3OMC A;  1G2S A;  1BUV T;  3Q22 A;  1Y8P B;  1FYC A;  4DNR B;  5G3L F;  1GHK A;  4RHR A;  4TKO B;  4ZUJ A;  3A56 A;  3T53 B;  4K6L A;  4BBS B;  4PMC A;  3PMF A;  4XN3 A;  1VDZ A;  1QWY A;  5I6W A;  1VLY A;  3SXH A;  3EVQ A;  4A3J B;  4A3B B;  2E2J B;  4NP5 A;  2JEA I;  4HR7 B;  3OIP A;  1PKV A;  1F2Y A;  1V43 A;  1EY7 A;  5KNL A;  2AUK A;  5M3F B;  1TS4 A;  3MTS A;  5JOB A;  1D1K A;  4OHJ A;  2JA8 B;  1D5M C;  2FMM A;  5AFW A;  4KTA A;  3M4O B;  2V7Q A;  2R92 B;  2YYZ A;  4ILW A;  2WKD A;  2NVY B;  4QUF A;  1RHP A;  3VA5 A;  4B08 A;  1CHP D;  2FMC A;  2J4X A;  1F9R A;  1JOR A;  1I50 B;  4AYB B;  3QWN A;  4OO1 G;  1I18 A;  2NN6 H;  1STG A;  1KDA A;  1HUN A;  4XLE A;  2EJF C;  4K5V A;  3J7A V;  3QOJ A;  4A3K B;  3OMG A;  2V31 A;  4TQU S;  4RCO A;  1A6X A;  1PRT C;  3BYT B;  3D4D A;  4FNF A;  4ZAI A;  1FX0 A;  2JP1 A;  3GTQ B;  5TSS A;  1BMF A;  1ILP A;  1VF5 C;  2WAC A;  1WTQ A;  3PUW A;  1Y69 U;  1IYU A;  2F0L A;  2CHB D;  5CV9 A;  2RDF A;  1B44 D;  3TP5 A;  4XR6 A;  4RA8 A;  2XZP A;  2K04 A;  4RH6 A;  1DD2 A;  1QOH A;  4N9P A;  5D65 A;  2JSO A;  2LMC B;  2F3W A;  4G7O C;  1H8H A;  1B9N A;  1U4R A;  2CQA A;  4DFA A;  5KNC A;  1LTB D;  5I6Y A;  2NVT B;  5ELC A;  3SHL A;  1Q12 A;  4PMW A;  1H9S A;  1PRT B;  5C4Z A;  4CJ0 B;  3MAQ A;  1PXU A;  2NTT A;  2NN6 I;  2KVO A;  1F9P A;  1SYB A;  4ZKC B;  1Y1V B;  4K8I A;  5COY A;  2MHV A;  1NCV A;  1PZI D;  5CBA E;  2B63 B;  4XL9 A;  3TP8 A;  2F0M A;  1WTW A;  1SYC A;  5EGT A;  2JA7 B;  2K33 A;  2R93 B;  1OXX K;  2KHS A;  2IJ0 A;  2Z8L A;  4J6H A;  1S5F D;  4BA2 I;  3N52 A;  1BF4 A;  2B2Y A;  2WV6 D;  3P75 A;  4FP5 D;  5CV4 A;  3S1M B;  1UNS A;  1TT2 A;  4H0L C;  2ICE C;  3RZD B;  5CV6 A;  1XYI A;  1WTP A;  2DNC A;  2N88 A;  2RBM A;  3ERQ A;  5COR A;  1JB3 A;  1SEB D;  1EY6 A;  1S5D D;  4TT3 A;  1E2W A;  2X85 A;  1L0Y B;  2KQ3 A;  4NDX A;  1ONL A;  2HDL A;  1E3X A;  3QB3 A;  1RTN A;  2JYO A;  2F3V A;  1V8Q A;  3Q0A A;  1G8Z D;  2I07 B;  1MSG A;  1LV9 A;  5M9O A;  1LAB A;  2M5S A;  3M7N A;  3BZD B;  4IUQ A;  2XN9 C;  4HMJ A;  2PMZ B;  1PTO C;  2ZXH A;  1QCB D;  1R4P B;  4K14 A;  2B2T A;  3Q23 A;  1SNC A;  3OW7 A;  4HAE A;  1HCZ A;  4CKB A;  2ZZE A;  1CZG A;  1TU2 B;  1U4L A;  1BBX C;  1B3A A;  4R8N A;  1AN8 A;  4Q5V A;  3DWP A;  3QJY A;  3TZU A;  4JMQ A;  3P20 A;  4YIJ A;  5I9P A;  1O80 A;  1Q8I A;  3K0Y A;  1G6Z A;  4N9T A;  2WZP P;  1I4R A;  1BNZ A;  1AEX A;  4RAU C;  3VYR A;  4U67 3;  5FKA C;  4RGM A;  3HAG A;  3NE5 B;  4XYQ A;  3J81 L;  2A6E D;  2RSN A;  2F0U A;  2TMP A;  2EYL A;  3R2T A;  5JJZ A;  2K7V A;  1KAB A;  2EY5 A;  4XNF A;  3EQL C;  2K1B A;  3GTG B;  2VNU D;  2QIL A;  1Y1W B;  4P2C B;  1QE6 A;  2EJG C;  4B3G A;  4XT3 B;  1JE4 A;  1H8E A;  3A3B A;  1J8I A;  2BDN A;  1ESR A;  1SNQ A;  4QMG A;  4HCE A;  1FGB D;  2K05 A;  3D6C A;  5C0X G;  3Q6S A;  1NR4 A;  4CKE A;  1UD2 A;  5IGC A;  2ZZF A;  5EBD A;  4WRD A;  1HRJ A;  2GJP A;  4K5W A;  4UAI A;  3X3N A;  4X3K A;  4KJN A;  2K5D A;  1LT5 D;  1K8O A;  1PRT D;  4CHT B;  2K6A A;  5KYL A;  1HXY D;  5IGG A;  3E6Z X;  4ZQ3 A;  4E0F A;  1VCI A;  3HZX A;  3CU7 A;  5M5Y B;  1V1P A;  1STA A;  3OEE A;  2L1B A;  2WII B;  4I65 A;  3RMH A;  3K5M A;  1V0E A;  3HOU B;  2WIN B;  1KDC A;  4UZU A;  1WTR A;  2BE5 C;  3J80 E;  3FDT A;  2ENB A;  2W6J A;  2WSS A;  3C2P A;  4ZUI A;  4BA1 I;  3VR3 A;  3H3V C;  3SDZ A;  1SXT A;  2LFN A;  3PUX A;  4KY7 A;  1CA6 A;  1EY0 A;  5M5X B;  1Q1B A;  1JC7 A;  2CVR A;  1IKL A;  1CFM A;  1HFN A;  4PMB A;  2XND A;  5BN4 A;  1AW7 A;  1Q90 A;  4MN3 A;  2F0Q A;  2GK6 A;  5HKK A;  1WTO A;  3A8J E;  4OIK A;  2LKV A;  1S4Z A;  4KY6 A;  1ESF A;  3V05 A;  4TRD A;  2VUM B;  3BVM A;  3CRL C;  2NBF A;  2SEB D;  1IHZ A;  3VR5 A;  1GOZ A;  1F2L A;  1ENA A;  5JEA H;  4J8Q A;  3HGB A;  2ZXO A;  2QDB A;  1IL8 A;  3R8B A;  3VR2 A;  5LL6 S;  2MUY A;  3EFX D;  1XWE A;  3OPO A;  3CKI B;  1CK1 A;  2ZTG A;  1EQV A;  1OB0 A;  1SE4 A;  1H9K A;  4X3U A;  1D2B A;  4HED A;  3KBG A;  5KNB A;  3RLF A;  4O1N A;  1TQO A;  5I9O A;  4LMQ D;  2KCN A;  3D31 A;  1M4V A;  5EKL A;  3TP7 A;  2RVL A;  4ZRZ A;  3O13 A;  3T56 B;  2Y0S B;  2RKS A;  1BCP D;  1OXS C;  4FYD A;  2QF7 A;  2VB3 X;  2KED A;  1Y8O B;  4RGT A;  5C3W A;  1TVX A;  1CTM A;  2LS0 1;  5DN6 A;  4IQZ A;  5IGD A;  1KLU D;  1MGS A;  1SYD A;  1SND A;  1TWH B;  1CZW A;  1CA5 A;  5ELD A;  3TDQ A;  2X6W A;  2SDF A;  1RTO A;  5I2X A;  1JWU D;  2JE6 I;  2MPM A;  4XKV A;  2A6H D;  3AB9 A;  4O42 A;  5JVH 3;  4KMU C;  2NYZ D;  4Y7N B;  5I2Y A;  1KMH A;  3K6O A;  4DGZ A;  5J22 A;  5BN3 A;  1HZE A;  4Q0F A;  3E0J A;  5FK9 C;  5CYU A;  1SE3 A;  4ODG A;  4KKS A;  1SYG A;  4C3H G;  1W6J A;  1WD1 A;  3HEJ A;  5KGU A;  4IFD H;  2B2W C;  3L3O C;  3FPP A;  4F88 A;  5CR3 A;  3OOC A;  3OHX C;  4JBW A;  1X3Q A;  2RDG A;  2XWB B;  3NWT A;  3VR6 A;  1D6E C;  3L7Z C;  3VYT A;  2H4O A;  5IGF A;  1SJE D;  2F0E A;  1O78 A;  3OWF A;  1DYQ A;  2H1E A;  4K2L A;  4OL7 A;  3G7L A;  4FXU A;  3GP7 A;  2JXM B;  3VYS A;  2D5D A;  1WTX A;  4IUV A;  4CKC A;  1RCV D;  1XX8 A;  4FF3 A;  1DOM A;  3WOE A;  1SYE A;  2L5T A;  4TSF A;  5E4W C;  2AWO A;  2WP8 J;  4KHV A;  2HLD A;  5CV8 A;  2E76 C;  2W6I A;  4OO1 I;  2SOB A;  2WPD A;  4B3F X;  1KZL A;  4V19 0;  1HVX A;  1I4H A;  1LTR D;  3GV6 A;  1STE A;  1B9M A;  1EIG A;  1DOK A;  4G4K A;  2E2H B;  4FF2 A;  2BCO A;  1RF2 D;  2JEB I;  3MFY A;  3FMC A;  4XM3 A;  5IIF A;  2A68 D;  2AWN A;  4J1M A;  3HRZ C;  3GTK B;  1BR9 A;  1F2Z A;  4G7X A;  3HOY B;  4QF4 A;  5J39 A;  3SVM A;  1V1O A;  2X6L A;  1SKY B;  1A3V A;  2D2C C;  1S5C D;  2FIN B;  2LZJ A;  4IUP A;  1SMY C;  1FD7 D;  1GHJ A;  1SAP A;  4YEJ A;  1ET6 A;  2XVS A;  3HOV B;  4DU9 A;  1EOT A;  2Q8R E;  2XNA C;  3A55 A;  5T1G A;  1EU3 A;  3RZO B;  4RHS A;  3GD7 A;  1ZKO A;  4XON A;  1TKW B;  2B2U A;  1OO9 B;  3S16 B;  2OXP A;  1X32 A;  5C4X B;  3CQZ B;  2K28 A;  3IAY A;  3NHH A;  3H0G B;  1EEI D;  3DEO A;  1I3Q B;  5DEH A;  3P7J A;  2L9H A;  3WOF A;  2PZW A;  5JAV A;  4LK1 C;  4KKT A;  1MD2 D;  4V0B A;  1DXM A;  1SYF A;  2ZZG A;  3TN2 A;  1II3 A;  4FXD A;  3IFT A;  2G9H D;  4NKL A;  5CV5 A;  3M85 A;  2ZTN A;  3MXP A;  3PO2 B;  2QEJ C;  1UEA B;  4AVZ A;  3I3C A;  1PLF A;  3H94 A;  3HOW B;  1T5X D;  4XT1 B;  4L8J A;  2B2Y C;  4C3H B;  3NWS A;  3N6R A;  5ELE A;  2HQE A;  3M7G A;  4KY5 A;  3NQI A;  1EL0 A;  4XLH A;  4BWG B;  2A73 B;  1V0F A;  1TY2 A;  2D9U A;  5DNF A;  4X3T A;  1B53 A;  1CHQ D;  3RD4 A;  2B2W A;  5ELF A;  5IT9 E;  3C1F A;  4U68 A;  1I6V C;  3U9S A;  1Y8N B;  4XN0 A;  1QB5 D;  3R93 A;  3VA7 A;  4WJW A;  2B39 A;  3E5S A;  1F77 A;  3X3M A;  3T16 A;  1KTK A;  1H9M A;  4DN4 M;  1ZYR D;  1COW A;  5C5M A;  5A2Q L;  1IYV A;  2A69 C;  1F9S A;  2B2V A;  4DF7 A;  3IKJ A;  2K32 A;  3KF8 A;  3AU7 A;  5CV7 A;  5HGT A;  2R9V A;  2XGJ A;  3W3A A;  3LWE A;  1GUT A;  1SE2 A;  3KLS X;  5KND A;  4DK1 A;  5DM7 3;  4EQN A;  2KA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...