3OOMA

Crystal structure of the acvr1 kinase domain in complex with the imidazo[1,2-b]pyridazine inhibitor k00507
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
297
structure length
297
Chain Sequence
b'TVARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activin receptor type-1
publication title Crystal structure of the ACVR1 kinase domain in complex with the imidazo[1,2-b]pyridazine inhibitor K00507
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 102
structure length 297
sequence length 297
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3oomA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3oomA01
3I81A 4IX4A 3TNWA 4YTFA 4KSPA 2R3IA 1Q41A 3FQSA 2XP2A 3DA6A 3P0MA 5LMKC 4TWPA 4HNFA 2QOIA 1Q8WA 2W9ZB 3LFNA 4QPAA 3UPZA 3ZRLA 2H9VA 2P55A 4OBOA 3GUBA 4GFGA 1L8TA 1Q3DA 3I7BA 4R7IA 4NTTA 1M7NA 4ANNA 4WT6A 3SDJA 1OM1A 4FZDB 2WB8A 2WMQA 3LFEA 5DT4A 4BN1A 4Y5HA 3PTGA 4IW0A 5L6WL 4BTFA 4EYMA 4X0MA 4EHGA 3L9NA 2CGVA 3P4KA 4P5QA 4BBMA 4BDFA 2ITXA 4GCJA 5CSVA 3FJQE 2WQMA 4S34A 4FZ7A 3TEIA 4D4RA 4IJPA 5IA3A 2QHNA 5AAEA 2HOGA 4PNIA 5JRSA 4BDIA 5JRQA 5HHWA 1E1XA 3ZEWA 4NEUA 5DIAA 3TNHA 2ZVAA 4JR3A 4OT6A 4U80A 2XBAA 3DLZA 3HL7A 4BWKA 3FI8A 4ZZNA 2FH9A 3UIMA 3EZRA 3D4QA 2UW5A 2UZLA 3C4FA 3LM5A 3ODZX 4TRLA 1JSTA 1F0QA 4FZ6A 1MRUA 2GQRA 5KHXA 4H05A 3QD3A 4QTEA 3FXWA 4QP6A 2J50A 3B2WA 4BWPA 4BCQA 5CZHA 4H58A 3VJOA 3QRIA 2B4SB 2VN9A 4LMNA 3MS9A 3R7GA 1WBTA 3FC1X 2CN8A 4YGAA 5IMEA 4BWXA 2YM5A 3BYUA 3VBXA 1XR1A 4L3JA 1IRKA 3ZXTA 4DH8A 4EH4A 3ZONA 2BDWA 3EH9A 4GS6A 3FMNA 3KMWA 1NVSA 4FODA 4OR5A 3ETAA 4FKPA 5F1ZA 3CS9A 2XKFA 2P0CA 3BHTA 4UXQA 4XG6A 4ACMA 5BMSA 4ZTRA 4OAVB 4C0TA 2ZV9A 4EYJA 5IZFA 5EW9A 3HUBA 2XK8A 5I9UA 2W1ZA 4AOTA 5G1XA 3NYVA 1HOWA 2GTMA 5AP6A 3VAPA 4ZTNA 3ZDUA 4PF4A 3O7LB 4FTOA 3DCVA 4JAJA 3KXHA 4FKVA 5EI2A 4PV0A 2R3FA 1Y6BA 2CCHA 2OGVA 5D10A 5AAGA 5DT3A 2YWPA 2XIYA 1JKKA 2DYLA 4L7SA 2J0KA 3RZBA 2YA9A 4U8ZA 3E8CA 4I24A 4ZY6A 4UALA 4IBMA 3EQHA 4HVGA 3WIKA 3DK6A 3SRVB 4BDGA 4TN6A 4GVJA 3ZO2A 1W0XC 2QD9A 3UOJA 5EK7A 4EK6A 2OG8A 4G3CA 4U97A 4LOPA 2CN5A 3K2LA 3FI4A 3R7UA 3PVBA 4G3GA 3GCSA 1G8SA 4L42A 5C8NA 2C6MA 2ZDTA 3FV8A 2ERZE 3IPHA 3BLHA 4H3PA 4KKHA 4AGCA 4RT7A 4YPDA 4CLJA 1UV5A 4D2VA 2ZDUA 4IX3A 1YXVA 3NW7A 4I6QA 4JDKA 4K6ZA 3W2RA 3KGAA 4O38A 3JXWA 4PMMA 5CAPA 4RQKA 4XRJA 5HOAA 3FKOA 2C0TA 2WTDA 3GEQA 1Q3WA 5EM8A 4ZSGA 1YHVA 3HZTA 5A4TA 4OTFA 2PE1A 4KKGA 4AP7A 2XIZA 4AZEA 3D94A 3LCOA 3FMHA 3TNPC 3CXWA 3V5QA 4F08A 3OOMA 3E8NA 3NVKI 5K3YA 4W9WA 4ZZOA 3TI1A 3IW7A 5TOZA 3C5UA 1R39A 4XBUA 1IG1A 4IHPA 3V8SA 2HXQA 3KB7A 2WTVA 5IF1A 3S3IA 1IAHA 3VRYA 1CTPE 5HO7A 4WNPA 3UIXA 5CVHA 4FOBA 5A4EA 3ZYAA 3OWPA 3SKCA 5EDQA 3NW5A 2VWWA 1G8AA 3FQHA 4EH8A 2C3KA 3AC2A 3MB6A 1OPKA 1H1PA 4PL4A 4F6WA 4QMUA 1T45A 1V0BA 3FZ1A 3IS5A 4CT2A 3VUHA 3EQFA 2VO0A 1GZKA 2YDIA 2BR1A 2XBJA 3FZRA 3GXLA 4GIIA 4L00A 5AP0A 2P4IA 2YZAA 4P5ZA 4PUZA 2YLEA 1H1RA 5EYDA 1V0PA 4EZ7A 5EOLA 3IDBA 4HOKA 2H96A 3UC4A 3BE9A 4KA3A 5HE2A 1Y8GA 2ITWA 3PIYA 3VS2A 2WFYA 3VUDA 5A14A 2WOUA 2YAAA 5AEPA 3VBYA 3WZDA 4RIOA 3DNDA 3UNKA 4B8LA 5ANGA 1KE5A 1YI3A 3A61A 4ZZMA 4FKQA 1OL1A 2EXCX 4FTAA 5J95A 1A06A 2QLUA 2X6EA 4DEHA 1UNGA 4U7ZA 5LVOA 3KULB 3R00A 3LOKA 4IX5A 4WKQA 1M14A 3R2BA 3WF9A 3WILA 5C8KA 2NRYA 1H27A 3FLWA 4BICA 1QPCA 2A19B 1XBCA 2PMIA 4IWDA 4V0GB 1FVRA 5IQBA 1SM2A 3HAMA 3VUGA 2UZEA 2C5OA 4JG8A 5FM3A 1YDRE 3A7JA 5AR7A 4NH1A 1EH4A 2ZM3A 3ZC6A 4D2PA 3TZ9A 4EHVA 4CFXA 3NSZA 3T3UA 5KUPA 1XBBA 4FV4A 2F4JA 3BZ3A 3QTIA 4A7CA 2DQ7X 4JL9A 1JQHA 4WIHA 2GMXA 1O9UA 2ZB0A 5LCKA 2VAGA 2W9FB 3QA8A 2EWAA 1CSNA 1Y57A 2WMBA 3D5UA 3LLTA 2XCHA 3CR0A 5M4CA 2PY3A 4FSUA 3LMIA 4O7RA 3E64A 1OMWA 4BCGA 2VTMA 1H1QA 3RMFA 4Z16A 4MAOA 5HCZA 3VS5A 5KBRA 3IKAA 3UC3A 5L4QA 5IQGA 2XNGA 4KKEA 5KMKA 3PPZA 4FYOA 2UZDA 1L3RE 2X8DA 4G5PA 2Z2WA 1FINA 2W4JA 3Q6WA 1OUYA 4IEBA 4E4NA 2HWOA 2NO3A 4HZSA 4UB7A 3CP9A 4HGEA 1U5RA 3E7VA 2F49A 4NCTA 3IO7A 2FGIA 2Z7RA 4MQ2A 4PX6A 5CT7A 5CXZA 4FNWA 2YJRA 2UZTA 4XP0A 4CRLA 3FLQA 1MRYA 4DF3A 4AN3A 4QMSA 4YTIA 3ZOSA 2YCRA 5DEWA 2ZB1A 4YP8A 4OGRA 4O22A 3RINA 3D7TB 4CZYB 1QL6A 2R7IA 3QYZA 4Z7GA 4FTMA 3ZLYA 3QD0A 2EXEA 3FSKA 3HLLA 5AM6A 3PIZA 4UY9A 4X6QC 4CSVA 4H36A 4L9IA 1FVVA 5A54A 4J1RA 2EU9A 4CKJA 5J5TA 3UG1A 2R3MA 5BYLA 4ZSEA 4DFBA 1NA7A 3MB7A 2XM9A 2O8YA 3E87A 4RX5A 4D2SA 4F6UA 4RC4A 1KE7A 3JY9A 3W8LA 4HYHA 5IEYA 5C1QB 2RFDA 1XH4A 3CLYA 2VTOA 5KMMA 4ITHA 4FA2A 1H00A 3QXPA 5EM7A 2ZYBA 2R3OA 4FUYA 3GQIA 5HG8A 4O83A 2FO0A 1Q8ZA 3Q52A 2ERKA 2FSLX 4FK6A 3ANRA 5DFPA 4FIFA 1H01A 1PMNA 4TZRA 4BC6A 4BZNA 2R3PA 3LCKA 3U6JA 1Q5KA 3G6HA 2HW7A 4TWNA 4NKAA 3W18A 3OWLA 5FLFA 4XH6A 3O0GA 3IOKA 3QF9A 4MF1A 3W1FA 3FMMA 1R78A 3FDNA 2J4ZA 3E88A 4O27B 2XK4A 5K5NA 3EN6A 3K54A 3UGCA 5CU4A 2ACXA 4C4EA 2OIDA 1Q8YA 3BCEA 3C4CA 3LXPA 3R28A 1F5QA 2C6TA 2WGJA 4IVAA 4U40A 1U59A 3COHA 2I40A 4UWBA 3R8ZA 3RI1A 3U4UA 5M44A 2NNWB 4W4VA 3CY3A 5FUTA 4CG8A 2GHMA 4F4PA 3E93A 4NM0A 2ETKA 4A06A 4C4FA 3I5ZA 4YLKA 3I60A 4O7LA 4JQ8A 3THBA 4ZMEA 4FKIA 4ZAUA 3ZBFA 3QQGA 3O51A 4E6CA 4K0YA 3NYNA 4USDA 3KXZA 3MTFA 3LMGA 1XWSA 5ANEA 2DUVA 1ZOHA 1Q97A 2PVMA 2F7ZE 3HMOA 5D7VA 4RWKA 4G17A 2CLXA 2UZBA 3FZOA 3I7CA 1NW1A 1QPJA 5K9IA 4IAFA 2V7OA 3E3PA 3ID6C 3DB6A 3DZOA 3EQIA 4D28A 2OBJA 3ANQA 5EYKA 2QURA 4FV6A 2GCDA 5EYMA 4M0ZA 4UYNA 4HCTA 2BUJA 4F7NA 5EDPA 4FTUA 4IC8A 5E8WA 3PY1A 4DEAA 2QR8A 4M3QA 3HEGA 1REKA 3BKBA 4ANMA 3OEFX 4QP2A 2C4GA 4ALVA 4L45A 4HVHA 1YWRA 1PYXA 4RX8A 1KOAA 5CY3A 1J3HA 3G33A 5HIEA 2B53A 5CANA 1WBOA 5HCYA 4Y95A 4DEEA 4ERWA 2PSQA 5AP2A 5IG1A 4L7FA 5CT0A 4MCVA 5TT7A 5HG9A 2B9HA 2JIIA 3MI9A 4I4FA 1OIUA 2WMUA 3PVGA 1FPUA 4QTBA 4NJDA 4HYIA 3HMNA 2XJ0A 3BBTB 2OKRA 2CKOA 4I94A 3WZJA 3ALNA 3H0YA 5FGKA 2HZ0A 3HGKA 2VTJA 3A4PA 4AFEA 3R04A 1GNGA 1XJDA 4R3CA 4PP9A 2VTLA 3R8MA 1K3AA 2FSOX 3MJ2A 1VR2A 3S95A 4PPBA 3OD6X 4EUUA 4FV5A 3KULA 3E8DA 2XVDA 3H4JA 1VYZA 5D1JA 2JDTA 4D58A 4RQVA 3HYHA 3O71A 4TNBA 4V0GA 3WZUA 4ALUA 4CRSA 1JOWB 4RIWB 1CDKA 4DFYA 5DI1A 3V51A 4CFUA 1IASA 5BMMA 4DAWA 3GU6A 3BELA 3LQ3A 1YQJA 3VW6A 3MFUA 1I44A 3FZPA 4QYHA 4Q9ZA 1OIRA 2QOOA 3O7LD 4G3EA 4EH6A 4ZS4A 1ZLTA 3D5XA 3PWDA 3UTOA 4PDPA 4YZCA 3FL5A 4DHFA 2YZLA 2V62A 1UU7A 3ENHA 4LFIA 5HTIA 2JKKA 5C01A 5JGAA 2ZJWA 4XV9A 3Q9XA 5BQ0A 4DGLC 4FT0A 3QTUA 4BFMA 3DJ7A 2WTKC 3GU8A 4I20A 4EH7A 2UVYA 4FEQA 1XH5A 5JZNA 3AC8A 3UZTA 3U9NA 2UW6A 4BYJA 4G31A 5IKWA 3EJ1A 3R8VA 4A9RA 2RSVA 3RWPA 1DAWA 1XH6A 2CKPA 1H1WA 4M69B 4G6LA 2JEDA 4G1WA 4EOLA 2YIQA 3GCPA 1IAJA 2OFUA 5CEQA 3ELJA 2BZJA 2Q83A 3DBFA 1UU3A 5AWMA 2VRXA 1H1SA 3UQFA 4FEVA 1NVRA 4L3LA 3NCZA 5J1WA 3EFWA 3NUNA 1U54A 3ZFMA 2X9FA 3MY1A 4EBVA 1R1WA 4W4YA 3LXKA 4B8MA 5DRBA 2GPHA 2GNLA 4BHZA 4BDKA 2UZVA 3NNVA 2JAVA 4FKGA 3H3CA 4O0RA 5CVFA 5DLSA 1MQ4A 4GUEA 3DBQA 4O1PA 3PY3A 5GJFA 1NVQA 1JKSA 5AFVA 4ZXTA 3D7TA 3RCDA 1J1CA 4G9CA 1PKGA 4FIIA 2B1PA 2EVAA 3QA0A 4OT5A 4R77A 3OCGA 1OI9A 3GB2A 1Q8TA 4UWYA 5EHYA 1JKLA 1XBAA 4XOYA 5E8UA 3F5XA 4E4MA 5I9ZA 3ZO4A 1BYGA 5KZ0A 3COMA 4GV1A 3TZ8A 1URWA 4FGRA 5CEOA 3O8TA 5HORA 4KS7A 4USFA 5BPYA 4M68A 4MVFA 5FTQA 2F9GA 3PZEA 3QD2B 3QHWA 4E1ZA 4E6AA 1PJKA 3WYXA 3BGZA 2SRCA 1QCFA 2QKWB 5IEVA 4QP3A 4QTDA 3UYTA 4O6EA 5IH6A 4ONAA 2W1FA 2VWVA 2C69A 4PTGA 4O7WA 3DK7A 2XIRA 1PY5A 2C0OA 4CKRA 3DB8A 4YHFA 4DH3A 4RIXB 3S0OA 3FYKX 1ZYJA 3D14A 3TDVA 3KRRA 4O82A 4JI9A 4AZVA 1KV2A 2JKOA 3QKLA 4MD9E 3A2CA 3ZUUA 3VUTA 4C62A 3DXPA 3ATTA 1JSUA 4GRBA 2JDVA 2WTJA 4J98A 3NIEA 3SHEA 5E8VA 4BHNA 2G15A 2PZRA 3OUNB 4DG0E 3KC3A 1OPJA 5F20A 4B99A 1VYWA 5JFXA 5M4IA 2HENA 3H30A 3I79A 2XK7A 2R3LA 3KVXA 5I3OA 1SNUA 2I0YA 3PXYA 3QTZA 3HMPA 4GU6A 4PY1A 4OTIA 4BIDA 1H4LA 3W16A 3PDTA 1VJYA 3BE2A 3PY0A 2X39A 1XHAA 4QPSA 4H1JA 4KSQA 4MH7A 1T46A 5DWRA 5TR6A 1H08A 3PPJA 3O23A 2ONLA 3ORKA 1SYKA 3A7IA 3KK8A 3QRUA 3D5VA 5AP7A 4E7WA 2UUEA 2F2CB 5CSWA 1ZYSA 4IB5A 2QODA 4HYSA 3CJGA 4WRSA 3GC8A 4GG5A 4FIJA 4E5AX 4K18A 5A4LA 1ZOGA 3LCTA 4FKOA 4RSSA 3ZDIA 4LGDA 4Y73A 1UWHA 2BRMA 3GCQA 3Q4CA 4BCFA 3WYYA 5CEKA 1V0OA 4N4SA 4EQUA 3F5GA 1S9IA 3GCVA 2QU5A 3QUPA 5HNBA 2NPQA 3F3WA 3ZS5A 5AUXA 5LMBA 2PMOX 4RG0A 2YLFA 1YRPA 4I4EA 4ZOGA 3KCKA 1GZNA 2OJJA 3FKNA 2QOHA 3ZH8A 4EKLA 1OIYA 3CD8A 3DBEA 3PE1A 2IW8A 3NIZA 3PJCA 3NUUA 2J6MA 2UW8A 2PZ5A 2VNWA 3IW4A 3JUHA 3NUYA 2PE2A 4TYGA 5HBJA 5AR8A 5CAVA 3SC1A 3ZM9A 5FP5A 2YDJA 2OH4A 2Y4IC 4UWCA 5AUZA 4D1SA 2X7FA 3OHTA 5HGIA 2GHGA 5JZJA 1YDTE 3EN7A 4FEXA 1ZAOA 2Q0NA 5IQAA 4DT9A 1CMKE 2ITTA 4II5A 3SW7A 3QKMA 4OUCA 4KBCA 4D0XA 4XS2A 5F95A 4EHZA 4F64A 2REIA 4S33A 5LJJA 1PXIA 2WD1A 4F7SA 1YI6A 1GIHA 3VHKA 3VUIA 3R71A 2WNTA 4DBNA 1YOJA 5JGDA 3FY2A 2YJSA 5JFSA 1PXPA 2VNYA 3QLFA 4EOMA 1VZOA 3IGOA 4Z3VA 5HQ0A 4BTMA 4QOXA 3ZSHA 4I22A 3RHXA 5J9LA 3ATSA 3FPMA 4YPSA 4AN9A 2OJFE 4ASEA 1PRYA 4RIWA 4O91A 2YITA 4Y8DA 2QOCA 2C1BA 4F7LA 1OPLA 5ETIA 2YIRA 4EOQA 4GT4A 3PA3A 4RC3A 1J7IA 2CKQA 4C3RA 1P4FA 3H9OA 1Q62A 3PJ1A 1YWNA 3PA5A 3Q6UA 4GH2A 4GL9A 4HGSA 5HD7A 4FG7A 3VC4A 3D0EA 5L6PA 3A7FA 3V8WA 2W5AA 2XNPA 3BPRA 3QKKA 2OJ9A 2WIPA 4ZTQA 1SVEA 2B54A 2A4LA 2WU6A 3E7OA 4L3PA 4QMPA 2GFCA 4K8AA 4XJ0A 3F66A 3QTQA 4JBVA 4Q5HA 5ACBC 4BCPA 4FNYA 4YZNA 2C0IA 2JC6A 1IR3A 5T6KA 3CJFA 3NWWA 1Y6AA 3HA8A 3OFMA 3R73A 4YLLA 5ANOA 3OC1A 5EYCA 5D9HA 4C57A 4CFFA 5IU2A 3EQBA 1OKWA 4MTAA 3R1NA 4DA5A 3REPA 3QCYA 4MXXA 4F9CA 4JOAA 5CU0A 4AGDA 3VW8A 1V1KA 4RJ6A 3SGCA 2J2IB 2OIBA 4Y5QA 4ZIMA 3TIYA 4PDYA 2XYUA 3NNUA 4FV1A 2BZIB 3AQVA 1OB3A 2YIXA 5BVKA 2GNJA 2JGZA 2V5QA 5J9ZA 3MESA 1GOLA 2Z7LA 3HP5A 3LJ0A 4J99A 4JIAA 5DPVA 4NSTA 5HEZA 1Y91A 2A0CX 3OT3A 2R3QA 2P33A 5TKDA 3ZO1A 3EZVA 4BIEA 4GUBA 3VS0A 2X6DA 4OTGA 2ZMDA 3GCUA 1ZMVA 3BRBA 3BHYA 4I0TA 4MBIA 4BI1A 3C0GA 4CFNA 2C3LA 2XKDA 4EC9A 1MP8A 3DTWA 3FHIA 1JPAA 4ASZA 5HG5A 2QOFA 5LMAA 3VULA 5IUGA 4ASDA 3G6GA 4YLJA 4IAKA 2EB3A 4GK2A 5LCJA 2VWZA 3BU6A 2Z8CA 2G1TA 1X8BA 2IZRA 2GQGA 3MVMA 1WAKA 3ODYX 3LKMA 3R8UA 3KF7A 4JIKA 3F61A 5B0XA 3RWQA 3AT3A 4N6ZA 2XEZA 4IB3A 5A9UA 5HG7A 3C7QA 3DKOA 3POZA 3QCXA 1YOMA 3AC5A 4ZK5A 4XG8A 3QALE 3BU3A 3DQXA 4YZMA 3EN5A 4MBLA 5H2UA 3QX4A 4GYIA 4AGUA 2V55A 3ULIA 4BCHA 1SMHA 5AX9A 3U6HA 3TCPA 2JFLA 4KAOA 1ZY4A 2HY81 4WO5A 3SAYA 3B2TA 4C4HA 4B0GA 2F7EE 3MH2A 3BYOA 5IISA 1UVRA 3LXLA 4KBAA 3WI6A 2BDJA 1URCA 5IQDA 3R83A 3S4QA 2C6LA 1B6CB 4GEOA 2B9IA 5H9BA 3PXFA 4JRVA 4DG2E 2WMVA 4O0YA 4W9XA 2C3JA 4QMXA 5CSHA 4O0TA 5KMJA 1P14A 4DLIA 4YO4A 4PP7A 5AADA 1WBPA 2WMRA 4QO9A 5GZ9A 5M56A 2G2FA 3SXSA 2IJMA 4I5CA 4NWMA 4LOQA 2ITPA 5H8GA 4F99A 2PUIA 5JKGA 3C4XA 4FOCA 4PMPA 3MH0A 1ZARA 2VWUA 3KN6A 4IAZA 4TXCA 4BDEA 5EDRA 5IMXA 3QZHA 4FKWA 3ORXA 2FSTX 3Q4UA 5M08A 4QQ5A 5HE1A 1W83A 4E4XA 4DH5A 2PE0A 4DEIA 4ZJIA 5FBNC 2X2KA 3I1AA 4IACA 3GI3A 4FF8A 3ZU7A 1DAYA 1WFCA 3OTUA 3ZFXA 4R78A 2PWLA 5AP1A 4DT8A 4QPMA 5AJQA 4AN2A 3F6XA 5KCVA 1BL7A 2A2AA 5AR5A 2QOKA 4BKYA 1JVPP 4BTJA 4TYHA 5C03A 3TACA 3NLBA 3ET7A 4F6SA 4I5PA 4C34A 4APCA 4O7VA 3MIAA 4FI1A 3AC3A 2I0HA 2YCQA 5A3XA 3SQQA 1WVYA 4AF3A 4UEUA 3WARA 3NAYA 4LRKA 3TZMA 4JRNA 2IVUA 2YAKA 3ZZWA 4EORA 4GU9A 1J1BA 3PJ8A 4G16A 1BLXA 1XQZA 4ZTSA 3BWFA 4D4YA 3GVUA 3F7WA 4HPUE 4J8MA 3HV4A 2J5FA 3B8RA 4QMTA 4FSRA 4CV8A 5IQFA 2J5EA 2YM7A 4W8DA 3PXQA 4RGJA 1QPEA 2WAJA 4QMMA 4EUTA 3AT2A 3ENMA 3DGKA 3HRFA 4IC7A 5FXQA 1CKIA 5IA1A 3NUPA 4FT3A 4YUQA 4H1MA 1STCE 4MF0A 3OCTA 3S1HA 4M12A 3OVVA 3IDCA 4TY1A 1I09A 4BTKA 4MXCA 4RWJA 5KMNA 1SZMA 2GS7A 3I4BA 5HVYA 4PNKA 3QGWA 3WZEA 4D4VA 3R6XA 2WKMA 4RBLA 3TV6A 4ZMFA 4MKCA 3HDMA 5KMLA 5EH0A 5JGBA 4DFZE 5B2KA 4D5KA 2UV2A 3BBWA 5LMKA 4PPCA 3PVUA 4YC3A 2VTRA 2VWIA 3HV7A 3UDBA 3BHUA 3QFVA 4K9YA 1GZOA 2LGCA 5IQEA 4YURA 3W10A 5L2QA 4DBXA 3JVRA 5B7VA 3Q2MA 4YJOA 4JVGA 3EIDA 2HXLA 3OMVA 3QZGA 3R1SA 4FG8A 5GJGA 4AW2A 3OS3A 1ERKA 3VF8A 3R7IA 3R7VA 3AC4A 3VS6A 5IQCA 4EOIA 4I3ZA 3WBLA 4BKZA 2GNFA 3LAUA 3F2AA 2H34A 4EKKA 3BYSA 3Q3BA 5J1VA 2PULA 5DEYA 4MD8E 2JFMA 5LVPA 3MW1A 5EW8A 4O81A 4BY9E 5F94A 4U3YA 2GTNA 2OU7A 3PP1A 4L53A 2C5YA 4EJNA 1Q8UA 2WQBA 2CLQA 5ETFA 5C4KA 3JVSA 4APPA 2EUFB 4FL3A 5EKOA 2W1HA 3R1QA 4FSMA 5DGZA 2Y8OA 2O3PA 4FBXA 3JY0A 4BB4A 1OBDA 4I41A 3F3VA 4ZSJA 3AD5A 4HNIA 4HPTE 5HTBA 5ANDA 4V04A 1OBGA 3AD4A 4MNEB 2G9XA 3DY7A 1YXSA 5IUIA 4BDJA 2B55A 1GIJA 4BGHA 4EC8A 5GINE 4IADA 2WQEA 1WCCA 2OXXA 3NR9A 2YM6A 4CFWA 4JBQA 3U8WA 3GOPA 3CY2A 3TUDA 4MYGA 4R1VA 5EI8A 4K11A 2OF4A 4DFLA 4QMNA 4FV7A 2C47A 4ZJJA 3KA0A 3KMMA 2F2UA 4GJ3A 3MIYA 1YDSE 2CGXA 3IW8A 4XV3A 4BGQA 1BL6A 1OL7A 1PXLA 2C6DA 2GNGA 2HELA 2ZMCA 3M42A 4MQ1A 3TV7A 4AW1A 5JQ8A 3MFRA 3NS9A 2R64A 4JQEA 4L8MA 5CF8A 4F1MA 4F7JA 3OBJA 5FDXA 5JEBA 4PL3A 1MQBA 2BALA 4IMYA 5K0XA 4JNWA 5HIDA 5TO8A 3ZTXA 2W1CA 4DGOA 2RFNA 2WZJA 2UW3A 3ORPA 4D2RA 2VO6A 3RTPA 1GY3A 3LCSA 2HW6A 3MN3A 4ZTHA 3WE8A 2WIHA 4J97A 3QCQA 3ZLXA 1ZZLA 4PL5A 4MXYA 4FT9A 2G2IA 3LM0A 4XCUA 4WG5A 3QQKA 4L46A 4Y83A 4BBEA 3ZLSA 4OAUC 3Q2JA 2X9EA 3IQ7A 5DOSA 1BKXA 4C2WA 3IG7A 2OZOA 1F3MC 2QR7A 3MFTA 2BRGA 4NKSA 4F1OA 2QU6A 2YABA 3MV5A 4ANBA 5BVDA 4Q9SA 1WVXA 3G2FA 3A62A 5HE0A 2ZM1A 5JH6A 1OECA 2WMAA 3F82A 4ZJVA 4RA5A 2QOQA 3KRLA 5M4FA 2ITYA 3SRVA 3TL8A 2UW9A 4FC0A 3UVQA 3ZC5A 3R22A 4NIFB 3P9JA 4EL9A 3FC2A 3QQHA 3VN9A 1OITA 4IFGA 5I4NA 3WZKA 1PXMA 4RJ7A 2IVSA 3QZFA 5AR4A 4YJRA 4ZP5A 2C30A 4WBOA 3EWHA 3R01A 2W1DA 3EN4A 3VRZA 4XP2A 3W2OA 3RPRA 5I5ZA 3KU2A 3QQUA 4FKSA 2O65A 4FIGA 3Q9WA 1GAGA 2EB2A 2W17A 4U41A 4C8BA 5EW3A 2OWBA 3IONA 3VBTA 4QP9A 3QAME 2XNNA 3L8VA 4NM3A 4HW7A 4L44A 3R21A 3BU5A 4XX9A 5GHVA 4BCIA 5H8BA 5HCXA 5CALA 4MNFA 1TQPA 3R63A 2Y4PA 1QPDA 2JKMA 4M67A 3O8UA 3UO5A 2XNBA 3QQFA 2QO7A 2C5VA 1E1VA 3HP2A 2R3NA 3SD0A 4EH3A 3SVVA 3LFSA 3L8PA 1W84A 4BI2A 5FTGA 3PPKA 2G2HA 4BGGA 2XIKA 5HLNA 2RG6A 4EOPA 4WNMA 5CNNA 3ZUVA 2CPKE 2Q0BA 4ZS0A 2CSNA 2XRWA 3H10A 5E1SA 5J7BA 4WHZA 4EK5A 3NW6A 2WTWA 4KBKA 5GNKA 4RVLA 3PLSA 4JAIA 3RJCA 2X2MA 4G9RA 1HCLA 4WUAA 4MEDA 4X3JA 4LV5A 3ORTA 3OP5A 4FMQA 2Y0AA 3TKIA 5JQ5A 2ZV8A 3TTJA 5L3AA 4MXZA 3SX9A 3TUCA 4FEUA 4ARKA 5KKRC 4QQJA 3P7BA 1H25A 4NFNA 4F9AA 5JT2A 3HV3A 1NXKA 1ZY5A 4J96A 3JYAA 2ITQA 3LJ1A 4MK0A 2X4ZA 3O96A 4R1YA 4JBPA 1XH8A 4JX3A 3L8XA 3ZO3A 4FV2A 5DG5A 1RE8A 2VWBA 4JXFA 3NZ0A 4P7EA 3D83A 3RVGA 3LJ2A 2WTIA 3V6SA 2FSMX 2XF0A 3UBDA 3VS7A 3D5WA 4UMTA 3A4OX 4HGLA 4XUFA 3H9FA 2FB8A 3WF5A 3HDNA 1FGIA 2E9PA 4AE6A 3NX8A 3QD4A 2X7OA 4A9TA 1W98A 5KO1A 5F4NA 4CYIA 4BCMA 3FMLA 3OXZA 5E92A 1CKJA 5CI7A 2XMYA 2Y6MA 4X2JA 4O7YA 1PMUA 1XH9A 1Z5MA 2QVSE 1M7QA 2BVAA 4ZTMA 2W1EA 1IA8A 2YIWA 4RVKA 4EJ7A 2BAJA 2R3RA 3F7ZA 3PSBA 3C9WA 4G34A 1W8CA 1JLUE 4KD1A 4C58A 3QRJA 4DEDA 3UOLA 5KMIA 2WTKB 3ORMA 3TTIA 3W2QA 4C7TA 1Q4LA 3RP9A 4RJ8A 5JK3A 3CEKA 1BI7A 4XRLA 4YJPA 3OCBA 4F0IA 5B2LA 5KE0A 4NTSA 3JPVA 4CYJA 2I6LA 4MXOA 4YSJA 5FWKK 3P79A 4CFMA 4LL5A 4QYEA 2C6IA 4R3PA 5L6OA 2UZNA 2FYSA 2R0UA 2W05A 2BAQA 4O7TA 1AGWA 3CGOA 4WNOA 3EKNA 4X21A 4EK4A 2GHLA 4AAAA 4C4IA 5JFVA 4M13A 4QMLA 3QRKA 2WMXA 4OTQA 4EWHA 3P78A 5C9CA 5EQEA 4ZSAA 4NU1A 2O5KA 4UMPA 1FQ1B 4Q2AA 3RAKA 4CXAA 5LWMA 4O7SA 3HAVA 4XMOA 3MH1A 4OTHA 5CLPA 5BUJA 4HYUA 3EKKA 4MNEA 4C37A 2BKZA 3MA3A 3HMMA 3PSDA 4BDBA 4NL0A 4O6LA 2IN6A 4EONA 1OUKA 3SG9A 5M51A 3C13A 3CKXA 3NYXA 3Q9ZA 3V04A 4DFXE 2PVYA 5HIBA 3CD3A 4TL0A 5AP3A 3MPTA 5DHJA 3UQCA 3TN8A 3UQGA 3A8XA 3IECA 3QRTA 4EH9A 2GNIA 4E4LA 3AGMA 3DQWA 3TT0A 2W1IA 2Y6OA 4O96A 4UV0A 4E5BA 4TYIA 1O6LA 3MJ1A 2C5NA 2ETRA 3CE3A 3RK9A 5J9YA 4YU2A 3BLQA 3QLGA 5CU6A 2KTYA 2OI4X 4E5WA 5I0BA 4UBAA 4FV8A 4A9SA 3U54A 2UZWE 4I0RA 4IB0A 5I9VA 2AC5A 2PVRA 3DKFA 5CNOA 2XJ1A 3HKOA 4IFCA 4DEBA 1JSVA 2UVXA 1REJA 2CKEA 3LFDA 1OL2A 3OROA 3A60A 3PFQA 4A4XA 5ETCA 4YTCA 3P23A 5DH3A 4RLLA 2H8HA 3EFKA 4ERKA 4RJ3A 4FYNA 2CNVA 3GC9A 2E9NA 3FMEA 1YWVA 4CCBA 2OIQA 3PVWA 3QUDA 3OCSA 4X3FC 3F9NA 5D11A 2X4FA 5CAQA 2Z7SA 4B9DA 2R2PA 4LM5A 2VGPA 3ACJA 3TJCA 4FL2A 5DMZA 5B2MA 5FTOA 3FZSA 5J5SA 4NW6A 3EOCA 4WA9A 2GU8A 3PWYA 5AUUA 4NIFA 4U81A 4XV1A 3VJNA 4DH7A 4AS0A 5EG3A 3VBQA 1RJBA 3LFCA 2FVDA 4L43A 2X8EA 4PTEA 3D7ZA 3NPCA 4LUDA 1O6YA 3SXFA 2LAVA 5LARA 4GG7A 3ZEPA 5IPJA 3DKCA 4WSQA 4J95A 4IZAA 4FZAB 4J53A 3M11A 3KY2A 4I5MA 1R3CA 4LGHA 3WOWA 5CTPA 4RFYA 5CX9A 1UNLA 2VTHA 3BLRA 3HECA 4NZWB 4EZ3A 1XO2B 4G3FA 3FE3A 4FSYA 3W2SA 2JD5A 2ITUA 2HYYA 3FWQA 3CC6A 2YCSA 1WZYA 3DAJA 5HNGA 5EHOA 4ZLOA 5BVEA 5HZNA 5CQUA 3BHVA 4OTWA 1OZ1A 3F3UA 3U9CA 4TT7A 2RG5A 4ITJA 5G6VA 3EQRA 3O2MA 2XNMA 4KS8A 3UYSA 3VF9A 3BGPA 3IOPA 3MBLA 4M0YA 3NEWA 5DRDA 2Y4IB 3BEGA 4O84A 3KMUA 2QG7A 5AM7A 3IGGA 4C4GA 3TG1A 3UOKA 3K5UA 3L8SA 5BVFA 2B9FA 1U46A 2QCSA 1DI8A 4KIQA 4PQNA 4IH8A 2E2BA 2XNEA 4TW9A 4F09A 4RZVA 2VTPA 4RPVA 4YR8A 4IVBA 4H39A 3V6RA 1TQIA 3M2WA 5K0KA 1APME 4E93A 2OJIA 4K1BA 4FT7A 3C4WA 4QYFA 3BYMA 3KK9A 2PUNA 3RCJA 3HVCA 4GT3A 4CCUA 3KKVA 2BDFA 2FA2A 2HZNA 2BTRA 4DLJA 5AMNA 5HBEA 1UKHA 1PXJA 4ORKA 4BDAA 4DCEA 3RPYA 3WF7A 2V7AA 1BUHA 1LUFA 3BX5A 3RNIA 1B38A 4EOJA 5JFWA 3VO3A 3PA4A 3N51A 5CI6A 4IX6A 3UJGA 4BDHA 4UMUA 4FL1A 5DE2A 2X0GA 3DU8A 2HZ4A 3DNEA 4DFUA 4NJ3A 2RFSA 2HWPA 4FG9A 4A9YA 4S32A 4DTKA 4R7HA 3AMBA 4TPTA 2IWIA 4CNHA 2ZV2A 4M14A 3FI2A 3OF0A 3MH3A 3BI6A 3Q60A 3HX4A 1P4OA 4DEGA 5M09A 4AE9A 3PYYA 4DGGA 3EHAA 3RHKA 3UZRA 3ZHPC 3R9DA 5BUIA 3G0EA 3F3TA 4KRDA 3HRBA 4W8EA 5IH4A 4U79A 1UKIA 3AD6A 4AX8A 4FSZA 1DS5A 3PXKA 3Q53A 5L8LA 5EQYA 5DT0A 3HV6A 5E8SA 4M97A 4ZY4A 5L2IA 4FV9A 2CHLA 1ZYCA 3MGYA 4YC6A 1M2PA 4AA4A 4D55A 3EN9A 3QX2A 2X2LA 3QCSA 5GZ8A 1WMKA 3AGLA 4U5JA 2JLDA 4JG7A 5IEXA 4QD6A 4O2PA 4O86A 4RWIA 4PPAA 5FG8A 1TVOA 1O6KA 2VU3A 4C02A 5HICA 4WUNA 3GNIB 4AG8A 4QYGA 5EHLA 4AT5A 3OUKA 3VNTA 2PPQA 3Q04A 4ACCA 5EOBA 4KUJA 2W96B 4EHEA 3QC9A 5L2WA 3K5VA 3MFSA 3MY5A 1OIQA 4M69A 3LIJA 4ZTLA 3AXWA 5E8YA 3VS1A 3UO6A 3F88A 4OBQA 4P90A 3RPVA 2YWVA 3M1SA 3BV2A 4DYMA 4HVSA 3LFFA 3MA6A 4FZFB 4JLCA 4WG4A 4KIOA 2VD5A 4TYJA 3ZBXA 3ZZEA 5E8XA 4LI5A 4WRGA 4X6RA 5EFQA 3TDWA 2GSFA 3QU0A 3MY0A 4GW8A 3BYVA 3ROYA 4BCJA 1JWHA 3DAEA 4D4SA 2PTKA 3NCGA 3C50A 3RPOA 4EZ5A 3F69A 5ANKA 4O2ZA 5FXSA 3DFCB 3TZ7A 4WD5A 4ACGA 1HCKA 2X7GA 3TKUA 3TKHA 5LOHA 4O0WA 2W1GA 5E90A 3ZRMA 4CQGA 4GKHA 3AT4A 4PTCA 4UXLA 2DWBA 2OK1A 2WEIA 4WNKA 2ZM4A 4BL1A 3EQGA 5EM5A 3UIBA 5AUTA 5C26A 2YACA 3HUCA 3DPKA 3N9XA 3BHHA 5AV0A 5L8JA 4XG4A 4CEGA 3C5IA 4D1ZA 3I0OA 2IO6A 2XK3A 3OEZA 2NRUA 4QMQA 2XJ2A 4EOOA 3FLSA 3W55A 2HCKA 4QYYA 4U45A 3DJ6A 3WF8A 3L9LA 5HESA 1PXOA 2R4BA 2VZ6A 4G6NA 4PMTA 1J7UA 5D12A 3QQJA 3C0HA 3OY3A 1PKDA 2XIXA 3VBVA 3W32A 5K5XA 3ZM4A 4DH1A 2PUPA 4IDTA 4OTRA 1P2AA 2BTSA 2C6OA 2BMCA 4PDOA 4RIXA 1Z57A 2PZYA 4W4XA 2PVHA 3LZBA 4RX7A 3SW4A 3ZRKA 4DC2A 3HA6A 4TKSA 4YHJA 5DR6A 1K9AA 4RRVA 4C36A 5LVMA 5AP5A 3UP2A 4YMJA 3OWKA 5DR2A 4FTCA 4L6QA 4FNXA 4A07A 5IA2A 5L2TA 2R3JA 4ENYA 3ORLA 5AUYA 4ZY5A 4CVAA 2CDZA 1U5QA 2Y7JA 3CQWA 2C5XA 3KRXA 3CTJA 3RGFA 3JR1A 3N4UA 2QNJA 4O0SA 4J52A 5K4IA 1GIIA 3KXGA 3R9RA 4YJSA 1SVGA 3GC7A 1J7LA 3FI3A 3V5PA 3EFLA 3F5UA 5CF4A 1WVWA 4IDVA 2CMWA 1WBWA 4XOZA 3PUPA 3EQCA 4IWOA 4L01A 1YXXA 5BX0A 2WPAA 1YOLA 5DYJA 3OZ6A 4UX9A 3MVHA 4NCTC 5E8TA 4AUAA 2WQOA 1BMKA 4CTCA 4BDCA 4FX3A 3EL7A 4GMYA 4JQ7A 5BVWA 1M52A 2BKKA 3FMJA 2E9VA 5CS6A 5F9EA 1OKVA 2RF9A 3PXZA 4IM0A 5IA0A 3R8LA 4A9UA 3K3JA 4BZOA 5HLPA 3OG7A 2OLCA 3F5PA 4GIHA 2OXYA 4CFVA 2QO2A 3EQPA 4IAYA 4AQCA 4BI0A 3FQEA 3R2YA 5CF6A 3CSVA 1WBNA 2OW3A 5AV4A 3N4VA 3G9LX 5BNJA 5H3QA 4UMRA 5BYYA 1KE6A 1LPUA 2RKUA 4JS8A 4FICA 3W33A 2ZV7A 5A4CA 4TTHB 4K77A 3UODA 5FDPA 2IZTA 2J0MB 1ZWSA 3LE6A 2O64A 5CSXA 4N57A 3U51A 4FTRA 3GU5A 4F63A 2PHKA 3PE2A 3W8QA 3GQLA 4IM3A 2P2HA 4ANQA 4FSWA 3U55A 2BZHB 4B6LA 5GIPE 2WHBA 2PVLA 4XG7A 5CAOA 4AZFA 3H0ZA 5AIRA 4YBKA 4RFMA 2CCIA 4BR3A 4GFMA 2GDOA 2DS1A 2PUUA 3FSFA 3KXXA 2VTIA 4FV3A 4K33A 4S30A 5FD2A 3TXOA 4B7TA 2Z02A 2P2IA 3C0IA 4RVMA 4X2GA 2KULA 4DGMA 4E6QA 5AAFA 3GFWA 4FKUA 4MX9A 4CMTA 5I9YA 1ZOEA 1SNXA 2XYNA 3PRFA 2BIYA 3QXOA 4J8NA 5CEIA 2QG5A 3FUPA 1TQMA 3QTRA 4MD7E 4FE2A 3FLZA 5FP6A 5BUEA 4FEWA 4IAAA 3UPXA 1AD5A 1MRVA 3ERKA 3AC1A 4GK3A 3QYWA 4IXPA 4U44A 2YCFA 4I5HA 3VS4A 5ITAA 3E8EA 3OWJA 5CF5A 1OL5A 4Y72A 2V0DA 4DITA 3K3IA 5E91A 3PSCA 4AZSA 5HVJA 3LFBA 1SVHA 3ORIA 4DCAA 3Q4TA 3C4EA 4LRJA 4CD0A 3S00A 2BFXA 1PMVA 4BCNA 2CJMA 3R9HA 4A4OA 4AW0A 4ITIA 2XK6A 3LPBA 1B39A 2W5BA 1YKRA 3CGFA 2JITA 4EOSA 4IAIA 2J0JA 1W82A 4RLKA 5DBXA 4Z9LA 4NFMA 3V5JA 4OLIA 3ZFYA 2VGOA 3ZXZA 4JT3A 4CKIA 2BIKB 2R9SA 4YHTA 3KCFA 3QC4A 5HI2A 5LWNA 3G15A 3A7HA 2CGWA 2QOLA 5A4QA 1KE8A 4E20A 2AUHA 3DFAA 3Q5ZA 4G2FA 4I1ZA 5AR3A 4DN5A 4LUEA 4XG9A 4BCOA 1RW8A 2H6DA 5FQDC 2B0QA 4FVRA 1PF8A 1DM2A 3G9NA 3QZIA 3VWAA 5ETAA 3GBZA 5EQPA 4Z55A 4J71A 2J51A 4BYIA 3Q9YA 4IIRA 4R5SA 4I92A 3V5WA 3PJ3A 3R0TA 4C3FA 3A99A 2RL5A 4PWNA 5FBOA 4CG9A 2C6KA 2GNHA 3BQCA 1BX6A 5ICPA 4GT5A 2JAMA 4RA4A 3MPMA 4X2KA 5CU3A 3OT8A 3D15A 4P2KA 2Y9QA 1XH7A 3UE4A 3FLNC 3CQUA 2VWYA 2BILB 2J7TA 3C1XA 4ASXA 5HNIX 2XUUA 2UW4A 3DBDA 1NT2A 2IW9A 2VTNA 5FEDA 2XM8A 5AV3A 5TF9A 4AACA 5LQFA 3ALOA 3W2PA 3LCDA 4E6DA 5AP4A 2CGUA 4G3DA 4JJRA 2XKCA 2BHHA 4QQTA 2VTAA 2UW0A 2UZOA 4JDIA 1KUTA 4O1OA 5FEEA 5JSMA 3CIKA 4NT4A 4IM2A 1OVEA 3AMYA 4AT3A 5CQWA 4CZTA 5KHWA 2OF2A 4R6VA 3P7AA 4FSQA 3E5AA 4XYFA 1XKKA 5FRIA 2WMSA 5DA3A 2R0IA 3V5TA 3W2CA 2IG7A 3EQDA 3WIGA 3EFJA 4JG6A 4W4WA 4ANSA 4D0WA 4QTAA 3DTCA 4EQCA 4HZRA 3V3VA 4ENXA 4EQMA 1AQ1A 2BZKB 2X81A 3AOXA 3CPCA 2VO7A 4R3RA 2QHMA 4QMWA 4N0SA 3UVPA 3V01A 5A6NA 4F9WA 3KXNA 3RZFA 2JKQA 4AA0A 4I93A 4U0IA 2OO8X 1FBNA 3GU7A 2ZOQA 4M15A 4KB8A 3E63A 4F9BA 3U87A 4L68A 3L9MA 1WBSA 1UU8A 4I23A 3SG8A 1YI4A 2PMLX 2YN8A 1U54B 2IZSA 3IW6A 4PMSA 1YHSA 3B8QA 3LHJA 4FK3A 4QP7A 1ND4A 2OZAB 4FT5A 3KL8A 4DG3E 5HE3A 4KNBA 3DT1A 4RMZA 2OH0E 2BAKA 4Z7HA 3T3VA 3GOKA 5CEMA 5J79A 2BRHA 3A8WA 1ZXEA 4M8TA 2GFSA 4KIKB 2IZUA 3G0FA 3SA0A 4PRJA 3RBWA 5C8MA 4AGWA 3R7YA 3ITZA 2WELA 4F70A 5CYIA 3ORZA 1LP4A 1KV1A 3I0QA 2WO6A 4Y85A 4C59A 2FUMA 2YFXA 5KBQA 5L8KA 1H8FA 3BIZA 2HAKA 4UN0C 2VUWA 4LQMA 1YW2A 4IB1A 2J9MA 3MPAA 3COIA 4FTKA 3T8OA 4YNOA 2PZIA 2AC3A 5DR9A 5CAUA 4S31A 3OW3A 3TWJA 1KOBA 4EWQA 3U6IA 3PRIA 2VX1A 5E9EA 4RIYB 2W06A 3C51A 4FUXA 4C35A 5HX8A 3QTSA 2VX3A 3FYJX 2R3GA 3GU4A 4FTNA 3PP0A 5CWZA 2RFEA 5JN2A 3DAKA 5D7AA 5DN3A 3I5NA 3GFEA 3FBVA 2VX0A 4QMYA 3VUKA 3G51A 3AG9A 4EOKA 4D5HA 4FTQA 4RVTA 3KXMA 3UNZA 2I7QA 4HCUA 3ORNA 4R7BA 4B4LA 2B9JA 1YXUA 4F0GA 3PG1A 5AA8A 3ROCA 5BYZA 4FSNA 3P86A 3ZMMA 3OXTA 1VEBA 3EYHA 5GIOE 2R7BA 4P4CA 2QONA 4D9TA 3IK3A 3DZQA 5KKRB 2HZIA 1H0WA 4G5JA 2WEVA 4OW8A 2XS0A 3VBWA 4CT1A 4V05A 3TM0A 2A1AB 4YZ9A 3FPQA 4C61A 4AZTA 2AYPA 3EB0A 4FTTA 4XNEA 2ITVA 2PMNX 4C4JA 1H28A 3V8TA 1QMZA 3C4ZA 2R5TA 1H26A 3LFQA 3IDPA 4H3QA 3WE4A 4BVUA 1RQQA 3LW0A 4USEA 1CKPA 3AMAA 5KX8A 5C4LA 2BROA 2HY0A 3D9VA 3FZTA 1ATPE 1UA2A 2XKEA 3DK3A 3CTQA 4O21A 4LV8A 4RFZA 4RWLA 3KRJA 4WOVA 3BWJA 4V01A 4XLVA 1LEZA 3ULZA 3I6UA 1JKTA 3E3BX 4KWPA 3GGFA 3FLYA 4CTBA 1JNKA 2UW7A 4KABA 4DE4A 2IW6A 4KIPA 1Q99A 2IVVA 3QGYA 4XV2A 2VWXA 2JBPA 5DNRA 5HVKA 4A4LA 2YHVA 3CQEA 4L67A 5A6OA 3MTLA 4IVCA 3NGAA 3DLSA 5CEPA 3Q5IA 5IDNA 4E3CA 4LG4A 5AR2A 2XEYA 4CQEA 5HBHA 3L1SA 2HIWA 3MWUA 3HNGA 4N70A 4XEYA 5FXRA 4IVDA 3PG3A 4RX9A 2IPXA 4IANA 3Q96A 1M2RA 5IQIA 2W0JA 2ONLC 3EL8A 3TJDA 3LMHA 2PVKA 2JBOA 4NW5A 3SOCA 5CU2A 5J8IA 3F2RA 4FVQA 3N4TA 3VQHA 1ZYLA 4C38A 4YC8A 2RGPA 4M7IA 4FKJA 4C2VA 4FIEA 3UP7A 4ACDA 5I9WA 3GENA 1KSWA 4RC2A 3RK7A 5M57A 5AUWA 4LMUA 2P3GX 3O8PA 4YJTA 2W5HA 2YERA 5ANJA 5HU9A 1WBVA 2OICA 2W4KA 4N6YA 3KN5A 4TNDA 3KQ7A 3NYOA 1OL6A 4QP1A 4BRXA 1A48A 4AFJA 1G3NA 5HX6A 3MDYA 2E9OA 3EMGA 3RM6A 5TE0A 2BRBA 3FL4A 4FSTA 4I6BA 3RKBA 4EI4A 4E8AA 4XP3A 3ZLWA 4JDHA 5I9XA 2BRNA 3KF4A 1Q24A 3PZHA 4MWIA 5CZIA 3R7EA 3R02A 4KINA 1OKYA 3NUSA 2PVNA 2XCKA 3MYGA 4I6FA 4IJ9A 4YTHA 4O7NA 4Y46A 3NDMA 1FGKA 3FMKA 2OXDA 1YXTA 4QNAA 4O0VA 4YO6A 5E8ZA 2JIVA 4I0SA 2ITNA 3BV3A 3HRCA 4GJ2A 3DDQA 2JDOA 3R9NA 2YM8A 3FY0A 2JIUA 5HLWA 3FKLA 4GYGA 5L2SA 1NY3A 3COKA 4RJ5A 2NP8A 1J91A 4YZBA 4QRCA 3PJ2A 4H3BA 3WF6A 4BDDA 4GSBA 5FM2A 3SXRA 3OXIA 1ZMUA 3DV3A 2GQSA 2QO9A 1YHWA 3FXXA 4AXAA 2OSCA 1U4DA 3FXZA 2XH5A 4X2FA 3T9TA 5J7HA 3TV4A 4IQ6A 3T9IA 4FTJA 5M06A 4QMOA 1P5EA 4YZDA 4ALWA 3OTVA 5EM6A 5CXHA 4LRMA 1G5SA 4RZWA 4IZYA 1BI8A 4QMZA 3LFAA 2EXMA 2R3KA 5IA4A 1W7HA 4X3FB 4QP4A 3VHEA 3RAHA 1JAMA 5HO8A 5HU3A 1ZYDA 4X7QA 3RAWA 2BCJA 2WMTA 3VQUA 2VTSA 3JS2A 1PW2A 3RM7A 5AIKA 2F7XE 3O17A 1ZZ2A 2F57A 1ZRZA 4JDJA 1Q61A 3UIUA 4D2WA 4WG3A 2OZAA 4RJ4A 1MUOA 5T3QA 4HVDA 5M53A 1R0EA 3D2KA 3QWKA 4AOIA 2W99B 4LOOA 2G01A 4GVAA 3UMWA 3UO4A 4EK8A 4MBJA 2V22A 4QQCA 5FEQA 4BZDA 4CZUA 4KIKA 5HO6A 5HD4A 2PL0A 3UNJA 5M4UA 3KREA 3ZSIA 3V5LA 5LVLA 4K2RA 5DVRA 3ZUTA 3DJ5A 3L9PA 3TUBA 3DS6A 4AZWA 3PXRA 4FVPA 4FIHA 4IWQA 2O2UA 4HCVA 2YDKA 2B52A 2I1MA 4QNYA 4U3ZA 5IA5A 4CMOA 1IA9A 3P5KA 3G90X 4M66A 1UWJA 3UOHA 2QLQA 4R5YA 2VTQA 3DDPA 4ANOA 3QUEA 1GJOA 4HJOA 5IDPA 3BGQA 3CTHA 3OW4A 3LQ5A 4QMVA 4QT1A 2B7AA 5AX3A 3DXNA 2WOTA 2YM3A 4RIYA 5J87A 5EKNA 5KMOA 3G5DA 2I0VA 4EH2A 4F1TA 4GKIA 1YVJA 2RIOA 3FAAA 2ZAZA 4AA5A 5C27A 4BIBA 3CPBA 4JR7A 2WU7A 3RAIA 3DKGA 4IZ7A 4EEVA 3U4WA 3OOGA 3QTWA 4CMUA 4E26A 3LLAA 3FMDA 4O7ZA 4ID7A 5EI6A 4IZ5A 5HKMA 4YJNA 4AOJA 4BKJA 2X8IA 4WBBB 3NUAA 4S2ZA 1PXKA 1DI9A 3UZPA 4ACHA 2C6EA 2O63A 3CCNA 3QTXA 3F2NA 4DGNA 1LEWA 4FTLA 2ETMA 1RDQE 3NAXA 3ZCLA 3E92A 4FKRA 1S9JA 2VO3A 3ACKA 3MVLA 2W7XA 4L52A 4PDSA 1PYEA 2GS6A 1UU9A 2OJGA 2QC6A 3MVJA 5AV2A 2J0LA 3SV0A 1E9HA 1ZMWA 3R9OA 2CNQA 1PXNA 3II5A 4R8QA 3GT8A 4BF2A 4XG3A 3NVMB 4DFNA 2BHEA 2JDRA 4U42A 4ZLYA 3VIDA 3NRMA 5KZIA 3QWJA 5I3RA 4ZSLA 5M55A 2R3HA 3NNWA 3SLSA 2WXVA 3VS3A 4GFOA 4CGAA 5E1EA 3GP0A 3UVRA 2QOBA 4X2NA 2O0UA 2XZSA 2VV9A 5AV1A 4NK9A 2Z7QA 5CSPA 4NUSA 4U6RA 5LVNA 4ZEGA 4F9YA 4MWHA 1H24A 4UZDA 5IQHA 3R8PA 4D1XA 3RALA 3Q4ZA 4JBOA 5HTCA 3ZSGA 5JMSA 4BCKA 4UZHA 3KFAA 3NNXA 4XG2A 1Y8YA 3PLAE 3KRWA 4M84A 5BVNA 1KWPA 4DTAA 1PMEA 3RNYA 3EYGA 4YJVA 2W4OA 3VVHA 4MXAA 3DOGA 5D41A 2ITZA 5H8EA 5LXMA 3QHRA 2HK5A 2YIYA 3R7OA 3UG2A 4TYEA 2OFVA 3P08A 4IWPA 4QTCA 4FKLA 2QQ7A 2PU8A 3QL8A 2C68A 4C3PA 2UZUE 4TYHB 1H0VA 4F0FA 3OY1A 1JBPE 4EBWA 2PVFA 2PYWA 3HV5A 2WQNA 2I0EA 1K2PA 3RK5A 2YISA 5ANIA 5IH5A 3UMXA 1GZ8A 4I21A 1KE9A 1FOTA 2ESMA 2X1NA 3LVPA 4GK4A 4CV9A 3D2IA 3TIZA 4C33A 5M07A 5AUVA 4FNZA 2XRUA 1TKIA 4AU8A 3DXQA 4FV0A 4AWIA 3NMUF 4JX7A 4UMQA 4EK3A 4Q5EA 4FKTA 4FTIA 4FGBA 4LL0A 2J90A 3LXNA 3P7CA 4KRCA 5E7RA 1M2QA 4XLIA 4YJQA 2C3IB 4ANLA 4DTBA 1M17A 2UVZA 2GS2A 3HMIA 3KVWA 3LQ8A 3O50A 4HGTA 2XNOA 2J0IA 4E73A 4AT4A 2QKRA 4NYEA 4J7BA 3S2PA 3BEAA 3A7GA 2PVJA 2PZPA 4TWCA 3TNQB 5BVOA 2VTTA 5KNJA 1Z9XA 2WTCA 4G6OA 4D9UA 3I6WA 3R30A 5CVGA 4OTDA 5CENA 4YNEA 3RPSA 3P1AA 4XBRA 4XHKB 4TWOA 3SOAA 2E9UA 4HVIA 2C1AA 3DBCA 2ITOA 4F65A 1OKZA 2YEXA 3GC0A 1FVTA 3R1YA 4O0UA 5A46A 4LYNA 5E4HA 4U9AA 1FMOE 1UNHA 2Z60A 3PIXA 1R0PA 4I6HA 4DINA 5IUHA 2CNUA 4CLIA 1PHKA 1A9UA 4UYAA 3CBLA 3QBNA 4YBJA 5GZAA 4OBPA 3KEXA 3MSSA 4MHAA 2BPMA 3OBGA 4LGGA 4O0XA 4WSYA 4QP8A 3H9RA 3TNIA 3CKWA 4U43A 2WMWA 3F3ZA 1IEPA 4NM5A 4ZLZA 2A27A 4FR4A 2XB7A 4OTPA 2XA4A 4NM7A 5GJDA 2PK9A 4AW5A 2BFYA 3NUXA 4YJUA 2IVTA 5CASA 3VUMA 4X3FA 4YSMA 4EH5A 4IE9A 1OGUA 5K4JA 1FMKA 2JDSA 2QI8A 3Q32A 3E62A 5ACKA 3FEGA 1LR4A 4BBFA 3POOA 3BQRA 3QQLA 5T68A 1H07A 1CM8A 3FHRA 2YM4A 2XK9A 3IW5A 4D2TA 5AA9A
chains in the Genus database with same CATH superfamily
3W0SA 3I81A 4IX4A 3TNWA 4YTFA 4KSPA 2R3IA 1Q41A 3FQSA 2XP2A 3DA6A 3P0MA 5LMKC 4TWPA 4HNFA 2QOIA 1Q8WA 2W9ZB 3LFNA 4QPAA 3UPZA 3ZRLA 2H9VA 2P55A 4OBOA 3GUBA 4GFGA 1L8TA 1Q3DA 3I7BA 4R7IA 4NTTA 1M7NA 4ANNA 4WT6A 3SDJA 1OM1A 4FZDB 2WB8A 2WMQA 3LFEA 5DT4A 4BN1A 4Y5HA 3PTGA 4IW0A 5L6WL 4BTFA 4EYMA 4X0MA 4EHGA 3L9NA 2CGVA 3P4KA 4P5QA 4BBMA 4BDFA 2ITXA 4GCJA 5CSVA 3FJQE 2WQMA 4S34A 4FZ7A 3TEIA 4D4RA 4IJPA 5IA3A 2QHNA 5AAEA 2HOGA 4PNIA 5JRSA 4BDIA 5JRQA 5HHWA 1E1XA 3ZEWA 4NEUA 5DIAA 3TNHA 2ZVAA 4JR3A 4OT6A 4U80A 2XBAA 3DLZA 3HL7A 4BWKA 3FI8A 4ZZNA 2FH9A 3UIMA 3EZRA 3D4QA 2UW5A 2UZLA 3C4FA 3LM5A 3ODZX 4TRLA 1JSTA 1F0QA 4FZ6A 1MRUA 2GQRA 5KHXA 4H05A 5BV3A 3QD3A 4QTEA 3FXWA 4QP6A 2J50A 3B2WA 4BWPA 4BCQA 5CZHA 4H58A 3VJOA 3QRIA 2B4SB 2VN9A 4LMNA 3MS9A 3R7GA 1WBTA 3FC1X 2CN8A 4YGAA 5IMEA 4BWXA 2YM5A 3BYUA 3VBXA 1XR1A 4L3JA 1IRKA 3ZXTA 4DH8A 4EH4A 3ZONA 2BDWA 3EH9A 4GS6A 3FMNA 3KMWA 1NVSA 4FODA 4OR5A 3ETAA 4FKPA 5F1ZA 3CS9A 2XKFA 2P0CA 3BHTA 4UXQA 4XG6A 4ACMA 5BMSA 4ZTRA 4OAVB 4C0TA 2ZV9A 4EYJA 5IZFA 5EW9A 3HUBA 2XK8A 5I9UA 2W1ZA 4AOTA 5G1XA 3NYVA 1HOWA 2GTMA 5AP6A 3VAPA 4ZTNA 3ZDUA 4PF4A 3O7LB 4FTOA 3DCVA 4JAJA 3KXHA 4FKVA 5EI2A 4PV0A 2R3FA 1Y6BA 2CCHA 2OGVA 5D10A 5AAGA 5DT3A 2YWPA 2XIYA 1JKKA 2DYLA 4L7SA 2J0KA 3RZBA 2YA9A 4U8ZA 3E8CA 4I24A 4ZY6A 4UALA 4IBMA 3EQHA 4HVGA 3WIKA 3DK6A 3SRVB 4BDGA 4TN6A 4GVJA 3ZO2A 1W0XC 2QD9A 3UOJA 5EK7A 4EK6A 2OG8A 4G3CA 4U97A 4LOPA 2CN5A 3K2LA 3FI4A 3R7UA 3PVBA 4G3GA 3GCSA 1G8SA 4L42A 5C8NA 2C6MA 2ZDTA 3FV8A 2ERZE 3IPHA 3BLHA 4H3PA 4KKHA 4AGCA 4RT7A 4YPDA 4CLJA 1UV5A 4D2VA 2ZDUA 4IX3A 1YXVA 3NW7A 4I6QA 4JDKA 4K6ZA 3W2RA 3KGAA 4O38A 3JXWA 4PMMA 5CAPA 4RQKA 4XRJA 5HOAA 3FKOA 2C0TA 2WTDA 3GEQA 1Q3WA 5EM8A 4ZSGA 1YHVA 3HZTA 5A4TA 4OTFA 2PE1A 4KKGA 4AP7A 2XIZA 4AZEA 3D94A 3LCOA 3FMHA 3TNPC 3CXWA 3V5QA 4F08A 3OOMA 3E8NA 3NVKI 5K3YA 4W9WA 4ZZOA 3TI1A 3IW7A 5TOZA 3C5UA 1R39A 4XBUA 1IG1A 4IHPA 3V8SA 1VLRA 2HXQA 3KB7A 2WTVA 5IF1A 3S3IA 1IAHA 3VRYA 1CTPE 5HO7A 4WNPA 3UIXA 5CVHA 4FOBA 5A4EA 3ZYAA 3OWPA 3SKCA 5EDQA 3NW5A 2VWWA 1G8AA 3FQHA 4EH8A 2C3KA 3AC2A 3MB6A 1OPKA 1H1PA 4PL4A 4F6WA 4QMUA 1T45A 1V0BA 3FZ1A 3IS5A 4CT2A 3VUHA 3EQFA 2VO0A 1GZKA 2YDIA 2BR1A 2XBJA 3FZRA 3GXLA 4GIIA 4L00A 5AP0A 2P4IA 2YZAA 4P5ZA 4PUZA 1TFFA 2YLEA 1H1RA 5EYDA 1V0PA 4EZ7A 5EOLA 3IDBA 4HOKA 2H96A 3UC4A 3BE9A 4KA3A 5HE2A 1Y8GA 2ITWA 3PIYA 3VS2A 2WFYA 3VUDA 5A14A 2WOUA 2YAAA 5AEPA 3VBYA 3WZDA 4RIOA 3DNDA 3UNKA 4B8LA 5ANGA 1KE5A 1YI3A 3A61A 4ZZMA 4FKQA 1OL1A 2EXCX 4FTAA 5J95A 1A06A 2QLUA 2X6EA 4DEHA 1UNGA 4U7ZA 5LVOA 3KULB 3R00A 3LOKA 4IX5A 4WKQA 1M14A 3R2BA 3WF9A 3WILA 5C8KA 2NRYA 1H27A 3FLWA 4BICA 1QPCA 2A19B 1XBCA 2PMIA 4IWDA 4V0GB 1FVRA 5IQBA 1SM2A 3HAMA 3VUGA 2UZEA 2C5OA 4JG8A 5FM3A 4FRFA 1YDRE 3A7JA 5AR7A 4NH1A 4JMQA 1EH4A 2ZM3A 3ZC6A 4D2PA 3TZ9A 4EHVA 4CFXA 4I6LA 3NSZA 3T3UA 5KUPA 1XBBA 4FV4A 2F4JA 3BZ3A 3QTIA 4A7CA 2DQ7X 4JL9A 1JQHA 4WIHA 2GMXA 1O9UA 2ZB0A 5LCKA 2VAGA 2W9FB 3QA8A 2EWAA 1CSNA 1Y57A 2WMBA 3D5UA 3LLTA 2XCHA 3CR0A 5M4CA 2PY3A 4FSUA 3LMIA 4O7RA 3E64A 1OMWA 4BCGA 2VTMA 1H1QA 3RMFA 4Z16A 4MAOA 5HCZA 3VS5A 5KBRA 3IKAA 3UC3A 5L4QA 5IQGA 2XNGA 4KKEA 5KMKA 3PPZA 4FYOA 2UZDA 1L3RE 2X8DA 4G5PA 2Z2WA 1FINA 2W4JA 3Q6WA 1OUYA 4IEBA 4E4NA 2HWOA 2NO3A 4HZSA 4UB7A 4DHJA 3CP9A 4HGEA 1U5RA 3E7VA 2F49A 4NCTA 3IO7A 2FGIA 2Z7RA 4MQ2A 4PX6A 5CT7A 5CXZA 4FNWA 2YJRA 2UZTA 4XP0A 4CRLA 3FLQA 1MRYA 4DF3A 4AN3A 4QMSA 4YTIA 3ZOSA 2YCRA 5DEWA 2ZB1A 4YP8A 4OGRA 4O22A 3RINA 3D7TB 4CZYB 1QL6A 2R7IA 3QYZA 4Z7GA 4FTMA 3ZLYA 3QD0A 2EXEA 3FSKA 3HLLA 5AM6A 3PIZA 4UY9A 4X6QC 4CSVA 4H36A 4L9IA 1FVVA 5A54A 4J1RA 2EU9A 4CKJA 5J5TA 3UG1A 2R3MA 5BYLA 4ZSEA 4DFBA 1NA7A 3MB7A 2XM9A 2O8YA 3E87A 4RX5A 4D2SA 4F6UA 4RC4A 1KE7A 3JY9A 3W8LA 4HYHA 5IEYA 5C1QB 2RFDA 1XH4A 3CLYA 2VTOA 5KMMA 4ITHA 4FA2A 1H00A 3QXPA 5EM7A 2ZYBA 2R3OA 4FUYA 3GQIA 5HG8A 4O83A 2FO0A 1Q8ZA 3Q52A 2ERKA 2FSLX 4FK6A 3ANRA 5DFPA 4FIFA 1H01A 1PMNA 4TZRA 4BC6A 4BZNA 2R3PA 3LCKA 3U6JA 1Q5KA 3G6HA 2HW7A 4TWNA 4NKAA 3W18A 3OWLA 5FLFA 4XH6A 3O0GA 3IOKA 3QF9A 4MF1A 3W1FA 3FMMA 1R78A 3FDNA 2J4ZA 3E88A 4O27B 2XK4A 5K5NA 3EN6A 3K54A 3UGCA 5CU4A 2ACXA 4C4EA 2OIDA 1Q8YA 3BCEA 3C4CA 3LXPA 3R28A 1F5QA 2C6TA 2WGJA 4IVAA 4U40A 1U59A 3COHA 2I40A 4UWBA 3R8ZA 3RI1A 3U4UA 5M44A 2NNWB 4W4VA 3CY3A 5FUTA 4CG8A 2GHMA 4F4PA 3E93A 4NM0A 2ETKA 4A06A 4C4FA 3I5ZA 4YLKA 3I60A 4O7LA 4JQ8A 3THBA 4ZMEA 4FKIA 4ZAUA 3ZBFA 3QQGA 3O51A 4E6CA 4K0YA 3NYNA 4USDA 3KXZA 3MTFA 3LMGA 1XWSA 5ANEA 2DUVA 1ZOHA 1Q97A 2PVMA 2F7ZE 3HMOA 5D7VA 4RWKA 4G17A 2CLXA 2UZBA 3FZOA 3I7CA 1NW1A 1QPJA 5K9IA 4AXFA 4IAFA 2V7OA 3E3PA 3ID6C 3DB6A 3DZOA 3EQIA 4D28A 2OBJA 3ANQA 5EYKA 2QURA 4FV6A 2GCDA 5EYMA 4M0ZA 4UYNA 4HCTA 2BUJA 4F7NA 5EDPA 4FTUA 4IC8A 5E8WA 3PY1A 4DEAA 2QR8A 4M3QA 3HEGA 1REKA 3BKBA 4ANMA 3OEFX 4QP2A 2C4GA 4ALVA 4L45A 4HVHA 1YWRA 1PYXA 4RX8A 1KOAA 5CY3A 1J3HA 3G33A 5HIEA 2B53A 5CANA 1WBOA 5HCYA 4Y95A 4DEEA 4ERWA 2PSQA 5AP2A 5IG1A 4L7FA 5CT0A 4MCVA 5TT7A 5HG9A 2B9HA 2JIIA 3MI9A 4I4FA 1OIUA 2WMUA 3PVGA 1FPUA 4QTBA 4NJDA 4HYIA 3HMNA 2XJ0A 3BBTB 2OKRA 2CKOA 4I94A 3WZJA 3ALNA 3H0YA 5FGKA 2HZ0A 3HGKA 2VTJA 3A4PA 4AFEA 3R04A 1GNGA 1XJDA 4R3CA 4PP9A 2VTLA 3R8MA 1K3AA 2FSOX 3MJ2A 1VR2A 3S95A 4PPBA 3OD6X 4EUUA 4FV5A 3KULA 3E8DA 2XVDA 3H4JA 1VYZA 3UDSA 5D1JA 2JDTA 4D58A 4RQVA 3HYHA 3O71A 4TNBA 4V0GA 3WZUA 4ALUA 4CRSA 1JOWB 4RIWB 1CDKA 4DFYA 5DI1A 3V51A 4CFUA 1IASA 5BMMA 4DAWA 3GU6A 3BELA 3LQ3A 1YQJA 3VW6A 3MFUA 1I44A 3FZPA 4QYHA 4Q9ZA 1OIRA 2QOOA 3O7LD 4G3EA 4EH6A 4ZS4A 1ZLTA 3D5XA 3PWDA 3UTOA 4PDPA 4YZCA 3FL5A 4DHFA 2YZLA 2V62A 1UU7A 3ENHA 4LFIA 5HTIA 2JKKA 5C01A 5JGAA 2ZJWA 4XV9A 3Q9XA 5BQ0A 4DGLC 4FT0A 3QTUA 4BFMA 3DJ7A 2WTKC 3GU8A 4I20A 4EH7A 2UVYA 4FEQA 1XH5A 5JZNA 3AC8A 3UZTA 3U9NA 2UW6A 4BYJA 4G31A 5IKWA 3EJ1A 3R8VA 3UDZA 4A9RA 2RSVA 3RWPA 1DAWA 1XH6A 2CKPA 1H1WA 4M69B 4G6LA 2JEDA 4G1WA 4EOLA 2YIQA 3GCPA 1IAJA 3AKKA 2OFUA 5CEQA 3ELJA 2BZJA 2Q83A 3DBFA 3UDTA 1UU3A 5AWMA 2VRXA 1H1SA 3UQFA 4FEVA 1NVRA 4L3LA 3NCZA 5J1WA 3EFWA 3NUNA 1U54A 3ZFMA 2X9FA 3MY1A 4EBVA 1R1WA 4W4YA 3LXKA 4B8MA 5DRBA 2GPHA 2GNLA 4BHZA 4BDKA 2UZVA 3NNVA 2JAVA 4FKGA 3H3CA 4O0RA 5CVFA 5DLSA 1MQ4A 4GUEA 3DBQA 4O1PA 3PY3A 5GJFA 1NVQA 1JKSA 2IEWA 5AFVA 4ZXTA 4O4BB 3D7TA 3RCDA 1J1CA 4G9CA 1PKGA 4FIIA 2B1PA 2EVAA 3QA0A 4OT5A 4R77A 4AAYA 3OCGA 1OI9A 3GB2A 1Q8TA 4UWYA 5EHYA 1JKLA 1XBAA 4XOYA 5E8UA 3F5XA 4E4MA 5I9ZA 3ZO4A 1BYGA 5KZ0A 3COMA 4GV1A 3TZ8A 1URWA 4FGRA 5CEOA 3O8TA 5HORA 4KS7A 4USFA 5BPYA 4M68A 4MVFA 5FTQA 2F9GA 3PZEA 3QD2B 3QHWA 4E1ZA 4E6AA 2XARA 1PJKA 3WYXA 3BGZA 2SRCA 1QCFA 2QKWB 5IEVA 4QP3A 4QTDA 3UYTA 4O6EA 5IH6A 4ONAA 2W1FA 1TZDA 2VWVA 2C69A 4PTGA 4O7WA 3DK7A 2XIRA 1PY5A 2C0OA 4CKRA 3DB8A 4YHFA 4DH3A 4RIXB 3S0OA 3FYKX 1ZYJA 3D14A 3TDVA 3KRRA 4O82A 4JI9A 4AZVA 1KV2A 2JKOA 3QKLA 4MD9E 3A2CA 3ZUUA 3VUTA 4C62A 3DXPA 3ATTA 1JSUA 4GRBA 2JDVA 2WTJA 4J98A 3NIEA 3SHEA 5E8VA 4BHNA 2G15A 2PZRA 3OUNB 4DG0E 3KC3A 1OPJA 5F20A 4B99A 1VYWA 5JFXA 5M4IA 2HENA 3H30A 3I79A 2XK7A 2R3LA 3KVXA 5I3OA 1SNUA 2I0YA 3PXYA 3QTZA 3HMPA 4GU6A 4PY1A 4OTIA 4BIDA 1H4LA 3W16A 3PDTA 1VJYA 3BE2A 3PY0A 2X39A 1XHAA 4QPSA 4H1JA 4KSQA 4MH7A 1T46A 5DWRA 5TR6A 1H08A 3PPJA 2XAMA 3O23A 2ONLA 3ORKA 1SYKA 3A7IA 3KK8A 3QRUA 3D5VA 5AP7A 4E7WA 2UUEA 2F2CB 5CSWA 1ZYSA 4IB5A 2QODA 4HYSA 3CJGA 4WRSA 3GC8A 4GG5A 4FIJA 4E5AX 4K18A 5A4LA 1ZOGA 3LCTA 4FKOA 4RSSA 3ZDIA 4LGDA 4Y73A 1UWHA 2BRMA 3GCQA 3Q4CA 4BCFA 3WYYA 5CEKA 1V0OA 4N4SA 4EQUA 3F5GA 1S9IA 3GCVA 2QU5A 3QUPA 5HNBA 2NPQA 3F3WA 3ZS5A 5AUXA 5LMBA 2PMOX 4RG0A 3O5AA 2YLFA 1YRPA 4I4EA 4ZOGA 3KCKA 1GZNA 2OJJA 3FKNA 2QOHA 3ZH8A 4EKLA 1OIYA 3CD8A 3DBEA 3PE1A 2IW8A 3NIZA 3PJCA 3NUUA 2J6MA 2UW8A 2PZ5A 1W2CA 2VNWA 3IW4A 3JUHA 3NUYA 2PE2A 4TYGA 5HBJA 5AR8A 5CAVA 3SC1A 3ZM9A 5FP5A 2YDJA 2OH4A 2Y4IC 4UWCA 5AUZA 4D1SA 2X7FA 3OHTA 5HGIA 2GHGA 5JZJA 1YDTE 3EN7A 2X0PA 4FEXA 1ZAOA 2Q0NA 5IQAA 4DT9A 1CMKE 2ITTA 4II5A 3SW7A 3QKMA 4OUCA 4KBCA 4D0XA 4XS2A 5F95A 4EHZA 4F64A 2REIA 4S33A 5LJJA 1PXIA 2WD1A 4F7SA 1YI6A 1GIHA 3VHKA 3VUIA 3R71A 3TYKA 2WNTA 4DBNA 1YOJA 5JGDA 3FY2A 2YJSA 5JFSA 1PXPA 2VNYA 3QLFA 4EOMA 1VZOA 3IGOA 4Z3VA 5HQ0A 4BTMA 4QOXA 3ZSHA 4I22A 3RHXA 5J9LA 3ATSA 3FPMA 4YPSA 4AN9A 2OJFE 4ASEA 1PRYA 4RIWA 4O91A 2YITA 4Y8DA 2QOCA 2C1BA 4F7LA 1OPLA 5ETIA 2YIRA 4EOQA 4GT4A 3PA3A 4RC3A 1J7IA 2CKQA 4C3RA 2AQXA 1P4FA 3H9OA 1Q62A 3PJ1A 1YWNA 3PA5A 3Q6UA 4GH2A 4GL9A 4HGSA 5HD7A 4FG7A 3VC4A 2XALA 3D0EA 5L6PA 3A7FA 3V8WA 2W5AA 2XNPA 3BPRA 3QKKA 2OJ9A 2WIPA 4ZTQA 1SVEA 2B54A 2A4LA 2WU6A 3E7OA 4L3PA 4QMPA 2GFCA 4K8AA 4LV7A 4XJ0A 3F66A 3QTQA 4JBVA 4Q5HA 5ACBC 4BCPA 4FNYA 4YZNA 2C0IA 2JC6A 1IR3A 5T6KA 3CJFA 3NWWA 1Y6AA 3HA8A 3OFMA 3R73A 4YLLA 5ANOA 3OC1A 5EYCA 5D9HA 4C57A 4CFFA 5IU2A 3EQBA 1OKWA 4MTAA 3R1NA 4DA5A 3REPA 3QCYA 4MXXA 4F9CA 4DDGA 4JOAA 5CU0A 4AGDA 3VW8A 1V1KA 4RJ6A 3SGCA 2J2IB 2OIBA 4Y5QA 4ZIMA 3TIYA 4PDYA 2XYUA 3NNUA 4FV1A 2BZIB 3AQVA 1OB3A 2YIXA 5BVKA 2GNJA 2JGZA 2V5QA 5J9ZA 3MESA 1GOLA 2Z7LA 3HP5A 3LJ0A 4J99A 4JIAA 5DPVA 4NSTA 5HEZA 1Y91A 2A0CX 3OT3A 2R3QA 2P33A 5TKDA 3ZO1A 3EZVA 4BIEA 4GUBA 3VS0A 2X6DA 4OTGA 2ZMDA 3GCUA 1ZMVA 3BRBA 3BHYA 4I0TA 4MBIA 4BI1A 3C0GA 4CFNA 2C3LA 2XKDA 4EC9A 1MP8A 3DTWA 3FHIA 1JPAA 4ASZA 5HG5A 2QOFA 5LMAA 3VULA 5IUGA 4ASDA 3G6GA 4YLJA 4IAKA 2EB3A 4GK2A 4AXDA 5LCJA 2VWZA 3BU6A 2Z8CA 2G1TA 1X8BA 2IZRA 2GQGA 3MVMA 1WAKA 3ODYX 3LKMA 3R8UA 3KF7A 4JIKA 3F61A 5B0XA 3RWQA 3AT3A 4N6ZA 2XEZA 4IB3A 5A9UA 5HG7A 3C7QA 3DKOA 3POZA 3QCXA 1W2FA 1YOMA 3AC5A 4ZK5A 4XG8A 3QALE 3BU3A 3DQXA 4YZMA 3EN5A 4MBLA 5H2UA 3QX4A 4GYIA 4AGUA 2V55A 3ULIA 4BCHA 4MUQA 1SMHA 5AX9A 3U6HA 3TCPA 2JFLA 4KAOA 1ZY4A 2HY81 4WO5A 3SAYA 3B2TA 4C4HA 4B0GA 2F7EE 3MH2A 3BYOA 5IISA 1UVRA 3LXLA 4KBAA 3WI6A 2BDJA 1URCA 5IQDA 3R83A 3S4QA 2C6LA 1B6CB 4GEOA 2B9IA 5H9BA 3PXFA 4JRVA 4DG2E 2WMVA 4O0YA 4W9XA 2C3JA 4QMXA 5CSHA 4O0TA 5KMJA 1P14A 4DLIA 4YO4A 4PP7A 5AADA 1WBPA 2WMRA 4QO9A 5GZ9A 5M56A 2G2FA 3SXSA 2IJMA 4I5CA 4NWMA 4LOQA 2ITPA 5H8GA 4F99A 2PUIA 5JKGA 3C4XA 4FOCA 4PMPA 3MH0A 1ZARA 2VWUA 3KN6A 4IAZA 4TXCA 4BDEA 5EDRA 5IMXA 3QZHA 4FKWA 3ORXA 3AKLA 2FSTX 3Q4UA 5M08A 4QQ5A 5HE1A 1W83A 4E4XA 4DH5A 2PE0A 4DEIA 4ZJIA 5FBNC 2X2KA 3I1AA 4IACA 3GI3A 4FF8A 3ZU7A 1DAYA 1WFCA 3OTUA 3ZFXA 4R78A 2PWLA 5AP1A 4DT8A 4QPMA 5AJQA 4AN2A 3F6XA 5KCVA 1BL7A 2A2AA 5AR5A 2QOKA 4BKYA 1JVPP 4BTJA 4TYHA 5C03A 3TACA 3NLBA 3ET7A 4F6SA 4I5PA 4C34A 4APCA 4O7VA 3MIAA 4FI1A 3AC3A 2I0HA 2YCQA 5A3XA 3SQQA 1WVYA 4AF3A 4UEUA 3WARA 3NAYA 4LRKA 3TZMA 4JRNA 2IVUA 2YAKA 3ZZWA 4EORA 4GU9A 1J1BA 3PJ8A 4G16A 1BLXA 1XQZA 4ZTSA 3BWFA 4D4YA 3GVUA 3F7WA 4HPUE 4J8MA 3HV4A 2J5FA 3B8RA 4QMTA 4FSRA 4CV8A 4AXCA 4DHIB 5IQFA 2J5EA 2YM7A 4W8DA 3PXQA 4RGJA 1QPEA 2WAJA 4QMMA 4EUTA 3AT2A 3ENMA 3DGKA 3HRFA 4IC7A 5FXQA 1CKIA 5IA1A 3NUPA 4FT3A 4YUQA 4H1MA 1STCE 4MF0A 3OCTA 3S1HA 4M12A 3OVVA 3IDCA 4TY1A 1I09A 4BTKA 4MXCA 4RWJA 5KMNA 1SZMA 2GS7A 3I4BA 5HVYA 4PNKA 3QGWA 3WZEA 4D4VA 3R6XA 2WKMA 4RBLA 3TV6A 4ZMFA 2AEGA 3W0NA 4MKCA 3HDMA 5KMLA 5EH0A 5JGBA 4DFZE 1W2DA 5B2KA 4D5KA 2UV2A 3BBWA 5LMKA 4PPCA 3PVUA 4YC3A 2VTRA 2VWIA 3HV7A 3UDBA 3BHUA 3QFVA 4K9YA 1GZOA 2LGCA 5IQEA 4YURA 3W10A 5L2QA 4DBXA 3JVRA 5B7VA 3Q2MA 4YJOA 4JVGA 3EIDA 2HXLA 3OMVA 3QZGA 3R1SA 4FG8A 5GJGA 4AW2A 3OS3A 1G8KA 1ERKA 3VF8A 3R7IA 3R7VA 3AC4A 3VS6A 5IQCA 4EOIA 4I3ZA 3WBLA 4BKZA 2GNFA 3LAUA 3F2AA 2H34A 4EKKA 3BYSA 3Q3BA 5J1VA 2PULA 5DEYA 4MD8E 2JFMA 5LVPA 3MW1A 5EW8A 4O81A 4BY9E 5F94A 3TMOA 4U3YA 2GTNA 2OU7A 3PP1A 4L53A 2C5YA 4EJNA 1Q8UA 2WQBA 2CLQA 5ETFA 5C4KA 3JVSA 4APPA 2EUFB 4FL3A 5EKOA 2W1HA 3R1QA 4FSMA 5DGZA 2Y8OA 2O3PA 4FBXA 3JY0A 4BB4A 1OBDA 4I41A 3F3VA 4ZSJA 3AD5A 4HNIA 4HPTE 5HTBA 5ANDA 4V04A 1OBGA 3AD4A 4MNEB 2G9XA 3DY7A 1YXSA 5IUIA 4BDJA 2B55A 1GIJA 4BGHA 4EC8A 5GINE 4IADA 2WQEA 1WCCA 2OXXA 3W0MA 3NR9A 2YM6A 4CFWA 4JBQA 3U8WA 3GOPA 3CY2A 3TUDA 4MYGA 4R1VA 5EI8A 4K11A 2OF4A 4DFLA 4QMNA 4FV7A 2C47A 4ZJJA 3KA0A 3KMMA 2F2UA 4GJ3A 3MIYA 1YDSE 2CGXA 3IW8A 4XV3A 4BGQA 1BL6A 1OL7A 1PXLA 2C6DA 2GNGA 2HELA 2ZMCA 3M42A 4MQ1A 3TV7A 4AW1A 5JQ8A 3MFRA 3NS9A 2R64A 4JQEA 4L8MA 5CF8A 4F1MA 4F7JA 3OBJA 5FDXA 5JEBA 4PL3A 1MQBA 2BALA 4IMYA 5K0XA 4JNWA 5HIDA 5TO8A 3ZTXA 2W1CA 4DGOA 2RFNA 2WZJA 2UW3A 3ORPA 4D2RA 2VO6A 3RTPA 1GY3A 3LCSA 2HW6A 3MN3A 4ZTHA 3WE8A 2WIHA 4J97A 3QCQA 3ZLXA 1ZZLA 4PL5A 4MXYA 4FT9A 2G2IA 3LM0A 4XCUA 3W0OA 4WG5A 3QQKA 4L46A 4Y83A 4BBEA 3ZLSA 4OAUC 3Q2JA 2X9EA 3IQ7A 5DOSA 1BKXA 4C2WA 3IG7A 2OZOA 1F3MC 2QR7A 3MFTA 2BRGA 4NKSA 4F1OA 2QU6A 2YABA 3MV5A 4ANBA 5BVDA 4Q9SA 1WVXA 3G2FA 3A62A 5HE0A 2ZM1A 5JH6A 1OECA 2WMAA 3F82A 4ZJVA 4RA5A 2QOQA 3KRLA 5M4FA 2ITYA 3SRVA 3TL8A 2UW9A 4FC0A 3UVQA 3ZC5A 3R22A 4NIFB 3P9JA 4EL9A 3FC2A 3QQHA 3VN9A 1OITA 4IFGA 5I4NA 3WZKA 1PXMA 4RJ7A 2IVSA 3QZFA 5AR4A 4YJRA 4ZP5A 2C30A 4WBOA 3EWHA 3R01A 2W1DA 3EN4A 3VRZA 4XP2A 3W2OA 3RPRA 5I5ZA 3KU2A 3QQUA 4FKSA 2O65A 4FIGA 3Q9WA 1GAGA 2EB2A 2W17A 4U41A 4C8BA 5EW3A 1ST0A 2OWBA 3IONA 3VBTA 4QP9A 3QAME 2XNNA 3L8VA 4NM3A 4HW7A 4L44A 3R21A 3BU5A 4XX9A 5GHVA 4BCIA 5H8BA 5HCXA 5CALA 4MNFA 1TQPA 3R63A 2Y4PA 1QPDA 2JKMA 4M67A 3O8UA 3UO5A 2XNBA 3QQFA 2QO7A 2C5VA 1E1VA 3HP2A 2R3NA 3SD0A 4EH3A 3SVVA 3LFSA 3L8PA 1W84A 4BI2A 5FTGA 3PPKA 2G2HA 4BGGA 2XIKA 5HLNA 2RG6A 4EOPA 4WNMA 5CNNA 3ZUVA 2CPKE 2Q0BA 4ZS0A 2CSNA 2XRWA 3H10A 5E1SA 5J7BA 4WHZA 4EK5A 3NW6A 2WTWA 4KBKA 5GNKA 4RVLA 3PLSA 4JAIA 3RJCA 2X2MA 4G9RA 1HCLA 4WUAA 4MEDA 4X3JA 4LV5A 3ORTA 3OP5A 4FMQA 2Y0AA 3TKIA 5JQ5A 2ZV8A 3TTJA 5L3AA 4MXZA 3SX9A 3TUCA 4FEUA 4ARKA 5KKRC 4QQJA 3P7BA 1H25A 4NFNA 4F9AA 5JT2A 3HV3A 1NXKA 1ZY5A 1XMMA 4J96A 3JYAA 2ITQA 3LJ1A 4MK0A 2X4ZA 3O96A 4R1YA 4JBPA 1XH8A 4JX3A 3L8XA 3ZO3A 4FV2A 5DG5A 1RE8A 2VWBA 4JXFA 3NZ0A 4P7EA 3D83A 3RVGA 3LJ2A 2WTIA 3V6SA 2FSMX