3OOMA

Crystal structure of the acvr1 kinase domain in complex with the imidazo[1,2-b]pyridazine inhibitor k00507
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
297
structure length
297
Chain Sequence
TVARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activin receptor type-1
publication title Crystal structure of the ACVR1 kinase domain in complex with the imidazo[1,2-b]pyridazine inhibitor K00507
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 102
structure length 297
sequence length 297
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3oomA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3oomA01
2RKUA 4AFEA 3UVRA 5M51A 3CTJA 1FPUA 3EJ1A 4IB0A 4IEBA 4O7RA 5J5TA 4D1SA 3I0QA 2QOIA 3NDMA 3DGKA 3R28A 5AUYA 3K3JA 3NGAA 2YDJA 3QD2B 4JOAA 3ZLXA 2VWUA 4FSRA 2RFEA 3VS4A 4RIXB 4F6WA 4QYEA 4LOPA 4BGQA 3F7ZA 4CFVA 4MWIA 1JQHA 3GQLA 2JD5A 1NT2A 1M2QA 2XZSA 5FEDA 4F0IA 3IK3A 1RE8A 2ITQA 5TR6A 1CM8A 3G9LX 3ORXA 1KSWA 1U59A 1GIJA 3ZXZA 4HYHA 3UMWA 3U9CA 2OF2A 5HU3A 4FNWA 3HMOA 1QL6A 5DN3A 2R3KA 4FTCA 3U6IA 2RF9A 2VO7A 4KABA 5A14A 3CPBA 4CLJA 4NEUA 2WTKB 1QPCA 3KC3A 4I41A 3A8WA 4PL4A 4CMTA 4TWCA 4DGLC 3W2OA 4BKYA 4WNOA 1Q3DA 3SRVB 3CKWA 3UVPA 5CF6A 1YI4A 2CGXA 3HMNA 2CCIA 3SDJA 4C62A 4G1WA 4RX9A 4PP7A 3V8TA 4DBNA 4F9YA 2JBOA 2DYLA 5FXQA 4JXFA 2PSQA 3S0OA 2XP2A 3A7IA 4BWXA 4D28A 2Z7LA 3A99A 3ETAA 1KV1A 2YA9A 2XMYA 3TKUA 5J1WA 3EN9A 5HO7A 3R1SA 2YN8A 3QHRA 3LCTA 5D7AA 1H4LA 1P14A 3IGGA 1NVQA 5L2SA 5I4NA 3LQ3A 4UB7A 3ZUUA 1QPJA 5JFVA 5F9EA 4FTUA 3F69A 5AR5A 3QQJA 3GBZA 3KRRA 4RX8A 4ZTQA 4ASEA 2Z7QA 3ZO2A 2RFDA 4ZTRA 3UO5A 5HNGA 4FVRA 3R9RA 2QOOA 3ZFMA 2XNOA 3PSBA 4YGAA 5AM7A 5CS6A 4BZDA 4BDGA 4FSTA 5HU9A 1ZYCA 3BYMA 3R22A 5E9EA 3F5UA 2R3QA 2VO3A 3GC8A 2OXXA 5ANIA 4AW1A 4C58A 2EU9A 3IONA 2F7ZE 1IEPA 2IVUA 1ZOGA 2XKFA 4KA3A 2V0DA 3KGAA 4DINA 2FSMX 4QTBA 4IWDA 4E4XA 3FMEA 3SLSA 4UYNA 4CD0A 1OL5A 2QU6A 4HYIA 1W7HA 2CCHA 4IMYA 4X3FB 5HICA 1PW2A 3E8DA 3V5TA 3R0TA 3RCJA 5CEOA 4PRJA 3FY0A 2NO3A 3POZA 3OHTA 3P9JA 3VW8A 4GJ2A 1XH8A 4AOJA 3R9DA 4GW8A 4MBJA 3VHEA 2ZV8A 3KB7A 4RC2A 3D0EA 1YOMA 4O7VA 3F9NA 2Z60A 4IWQA 3R7IA 4A4OA 2J6MA 2UZEA 4TPTA 4TW9A 4EONA 3DAEA 3EYHA 5FTGA 2B55A 5EOBA 4NKSA 3L9NA 1YWNA 1ZXEA 2VNWA 3PJ2A 3SRVA 4BHZA 1J7UA 5BNJA 3UIUA 3ATSA 4X3JA 4DEIA 4FIHA 1OITA 1W82A 2J2IB 4KS7A 5EOLA 3ZLYA 2QOLA 4EBVA 5EM5A 3Q5ZA 2HCKA 2JKMA 3VUMA 1XH5A 4D4SA 2C3IB 4ONAA 1UNHA 4TZRA 5IPJA 2CSNA 5DMZA 1SM2A 3F66A 2QOFA 4FBXA 3RK5A 3R9NA 2JDOA 3KN5A 3PXFA 5GJFA 3TEIA 3WF6A 3DAKA 4YPDA 2PE0A 1TQMA 3EN7A 2YCFA 3KXXA 4LOQA 4E6AA 2UZNA 3TIYA 4XP3A 3WOWA 4CKJA 4HVSA 3CQEA 3KN6A 3R73A 3KVWA 3ZH8A 4FNXA 4A9TA 3BWJA 2R5TA 3C13A 4O7YA 2BIYA 4FIGA 4HCTA 4YJQA 4D2RA 1RDQE 5JEBA 3G5DA 3O23A 2HXLA 3H10A 3NUUA 3HYHA 4W4YA 4X7QA 3BWFA 3R8LA 4ANQA 5A6NA 5J1VA 4EOQA 2GQSA 4DGGA 4BDCA 2Y6OA 3GGFA 1FVTA 1PMNA 4UYAA 3ATTA 4GS6A 4FSMA 2OO8X 1DAWA 1H8FA 1PMEA 2W96B 1UU9A 5AR8A 2OXDA 4EH7A 3GC7A 5EG3A 4LMNA 1F3MC 3R9OA 2WMUA 3RPSA 4FZDB 4C2WA 3PY3A 3PJCA 2BKKA 4W9WA 2GNHA 2G01A 1ND4A 3QTZA 2HELA 4JQEA 1PXMA 5B2KA 4A06A 2P55A 5DRBA 4X3FA 5B2LA 3O2MA 1R3CA 3LFFA 5CY3A 3VUGA 3KQ7A 4C4FA 4X6QC 3FJQE 2YFXA 3L8PA 1VYWA 2PULA 3HRFA 5HLWA 3KEXA 4P2KA 3R8ZA 2WQNA 5EHYA 4Q5HA 2EB2A 4TL0A 5H3QA 5HBJA 2R3JA 3ORPA 4I4FA 4A4XA 2A0CX 3D15A 3ROYA 3W1FA 2O0UA 4LGHA 4QP7A 2WOUA 3QUPA 4XCUA 1AGWA 3ZSGA 2YITA 3WIKA 4GH2A 1WFCA 4LL0A 4RX7A 4BDJA 3E7OA 4EH8A 2EXCX 4FZ7A 4GK2A 5AP6A 4P5QA 2XNBA 4WHZA 4E6CA 3CR0A 1SYKA 2FYSA 4RWLA 3E8NA 4PX6A 5CVFA 1GY3A 3A60A 4EK4A 3HVCA 2PPQA 1WBPA 5J7HA 4DT8A 5IH5A 2ITZA 3MY0A 3W33A 4G6OA 3V01A 4BBMA 4FTMA 2Y0AA 1HOWA 3V5LA 3FWQA 2UVYA 2ACXA 2CDZA 4X2JA 3BLHA 4HGEA 4AGUA 2W1EA 4O81A 4LGGA 4O27B 2WMSA 4O22A 3GOPA 5M53A 4FODA 2UW7A 1PYEA 1VZOA 5DYJA 2HK5A 3IS5A 4RT7A 4DCEA 4KBCA 4PMTA 3UBDA 4JNWA 3OWLA 4QMXA 2HZ0A 3FV8A 5IA2A 4KNBA 5KZ0A 4BCKA 5IEXA 3RM7A 2C0OA 3HX4A 3TUCA 4Z9LA 4LL5A 3MPTA 5EQEA 2BIKB 3C4EA 3FLWA 2WXVA 3NSZA 4G3DA 4GG5A 4EYJA 1B39A 2WO6A 4EHGA 5AAEA 1WZYA 2C0IA 5IEVA 5LMAA 1Q24A 4QRCA 3GB2A 3TDWA 3GT8A 4D9UA 3QGWA 1MRVA 2IG7A 2LAVA 3GOKA 4O2ZA 3PIZA 3L8SA 4DLIA 3ZC6A 4DEAA 5I3OA 4O0RA 3FLSA 1Y91A 2WTWA 4ZOGA 5ANOA 4AQCA 4OTPA 5BMSA 1Y57A 4ZZNA 3H3CA 5D11A 3T3UA 4FTIA 1ZAOA 3DBDA 2AC5A 3OCBA 2V62A 3QCXA 2BILB 4G2FA 1A9UA 5BVDA 3CS9A 4QMSA 5DEWA 1ZZ2A 2JAMA 2WIPA 2C5VA 3KULA 4M14A 5IA5A 4FVQA 4IJPA 2WD1A 4XG3A 4XUFA 1G8SA 3NUYA 2W06A 3COMA 3UIXA 4NJDA 2JDSA 3DJ6A 2GHGA 4QMQA 3R2BA 4PTCA 1VYZA 3F5XA 4LRJA 4NIFA 4IM2A 5ANKA 5CZIA 4S31A 4KSPA 4FSWA 4O7SA 1M17A 3D5UA 3VS7A 2JDVA 5BQ0A 4BTKA 3SHEA 3C5IA 4RLLA 3QTUA 3OUKA 3EQPA 3SVVA 4JDKA 3PJ3A 3QQUA 3UP7A 3OBJA 1KE6A 5KX8A 4G9RA 3S4QA 4BI1A 4J52A 2Y4IB 3LFDA 4NSTA 5ETCA 4BCOA 2FSOX 4M3QA 3H0YA 3FKNA 4LM5A 3V5PA 2QKRA 3UG2A 3OC1A 4ZXTA 4Y8DA 1PY5A 4FTKA 1BYGA 4KIPA 3FI3A 3WZUA 2WTIA 4DFLA 2GPHA 4GV1A 3A4OX 2JKKA 2QR8A 4YLLA 4K33A 3Q5IA 4DG0E 4G16A 2VTJA 4JBQA 2XKCA 3CQWA 4HGTA 4XMOA 4A9SA 2VWXA 3W32A 4CT1A 4YR8A 2JBPA 4BYJA 3GVUA 1F0QA 4CV8A 4O84A 1STCE 4ZZMA 3AQVA 4D1XA 3GC0A 5E1EA 3R8VA 3ZRKA 4PWNA 4ASDA 2XM8A 4QP4A 4ARKA 4ZSAA 4XG7A 4TYGA 4YNEA 3QRUA 1BKXA 1YHSA 1J7LA 3QCYA 2I0HA 2YACA 2CN5A 1PMUA 4AP7A 2YIYA 4YU2A 2OW3A 3LM5A 4O7LA 5CSXA 2BDFA 3KY2A 4DEGA 4PPAA 3IW8A 3GCUA 4BWKA 5C26A 4CCBA 3NLBA 2OSCA 3AC2A 1O6KA 3SW7A 1LPUA 4BTMA 2YLFA 4QMNA 5DE2A 2NP8A 5DIAA 4BCJA 4AT5A 5CU4A 4EOIA 4H58A 3QTRA 1FQ1B 2YWVA 1YDRE 3U8WA 3Q9XA 4ACMA 5LQFA 2ZM3A 3D5VA 2XNGA 5E90A 3VUTA 3PE2A 4IVBA 3WZEA 3FLZA 4QMOA 3RAHA 1YKRA 2C6DA 2VWBA 4DAWA 5AUUA 4Z7GA 1YOLA 3BRBA 4YJPA 3RAWA 3TIZA 5DA3A 2I7QA 4AS0A 2I6LA 3VF9A 5JGAA 1OKWA 3HDNA 3R71A 3BIZA 5KMJA 2VZ6A 4A9YA 5D1JA 4F4PA 2QD9A 3LJ1A 4CVAA 2W9ZB 4HW7A 2WTKC 1SNUA 3N4UA 4Y5QA 4P7EA 5HTCA 3JVRA 3P7AA 2ETRA 3PXQA 4PMMA 1Y6BA 2JEDA 3BKBA 4FZFB 3MGYA 4N0SA 5HEZA 4CMOA 5L6OA 4EJNA 3TZMA 2FO0A 5FXRA 4RGJA 4I3ZA 3DS6A 3MBLA 4B9DA 2VWVA 3MJ2A 1XWSA 4CRSA 4I0TA 2E9NA 4TWPA 1ZZLA 3DNEA 5M57A 4M97A 4XOZA 1JKTA 2QURA 3QTSA 5AV3A 4CYJA 5FTOA 4QT1A 3I7CA 2Z8CA 4JIKA 2RFSA 4E4MA 2A2AA 4QMYA 5AR2A 4C4EA 3SXRA 3FHRA 1H27A 2ESMA 3C5UA 3OBGA 5HD7A 5JN2A 2PE2A 4JRVA 1ERKA 3VBVA 3SA0A 1JAMA 1YI6A 2PL0A 3A62A 3LVPA 4ZTMA 1UU3A 5IA4A 1FMKA 3FY2A 3NRMA 3T9TA 4D2VA 5IG1A 4KIQA 1GIIA 3MB6A 4HCUA 4YHFA 5IKWA 1UV5A 2ZMDA 3FZ1A 5IH4A 4D2WA 4DEDA 4AZSA 2PHKA 4L44A 1MP8A 3BBTB 3E8EA 5AA9A 4FE2A 3DKOA 2VTLA 4MHAA 2OIBA 4ZP5A 5CZHA 4PMPA 2G2HA 3MVMA 1DM2A 1DI9A 3VS1A 5HQ0A 4FV6A 3GI3A 2OG8A 2J9MA 1GZNA 5ACBC 1REKA 4R1VA 3HKOA 3KRXA 5HO8A 3DK6A 4XRJA 3UYTA 4FG9A 4YHTA 4FIIA 4X3FC 4C4IA 3PLAE 3LFQA 4L68A 5DT0A 5KMNA 2HYYA 3I81A 2Q83A 4RWKA 4ZSJA 3MV5A 4BDBA 1K3AA 1GZKA 3DLSA 3QZFA 4YZDA 5C1QB 2YIWA 4N6ZA 2RFNA 5HE2A 3UMXA 5EYCA 5M4FA 4B99A 2PVNA 4HCVA 2P4IA 2BZHB 2BRMA 2G2FA 4EHEA 2UW9A 1O9UA 2BRNA 4JT3A 4IQ6A 2UW4A 3A7FA 5HKMA 2UZVA 3KL8A 4WUNA 5I0BA 4RPVA 5AR7A 1JWHA 2EVAA 3QWKA 1XH6A 3ALOA 4L6QA 4U79A 5LCJA 4HJOA 4L42A 2C30A 4AZWA 4EOOA 5L2WA 5L8KA 1HCLA 3EKNA 3NNVA 3ENMA 4BL1A 5IQBA 2WU7A 3G6HA 5ETAA 3D7TB 4EC8A 3MYGA 3BHYA 3VN9A 5IQIA 2WU6A 3MY1A 3ZZEA 5JMSA 3CTQA 4OW8A 3TG1A 4D0WA 4O7ZA 2REIA 3Q4ZA 5LARA 3VUDA 4I6HA 4TWOA 5J9YA 2BRHA 2HY0A 2HWOA 1YWVA 4DHFA 4AOIA 2R3NA 4YURA 3P1AA 3V8SA 2XS0A 4DF3A 2XH5A 3UQFA 2VTQA 3FZOA 5EI6A 3OT3A 4QQCA 2DWBA 4TYJA 1H28A 3LXLA 1JOWB 3TWJA 3V8WA 1KOBA 5I5ZA 1IAJA 1PRYA 5HVYA 4AN2A 4FSZA 2YJRA 1UNGA 5DBXA 4JR7A 4M7IA 3CKXA 3AC3A 2VU3A 4IM0A 5KHXA 3POOA 3FZPA 1BI8A 1OIRA 5F95A 4GT5A 1QPDA 2XK3A 1JKKA 4NWMA 2CGVA 4FT7A 1IAHA 4QMZA 3LM0A 2VRXA 2OBJA 3MIAA 5IEYA 3HL7A 4MXYA 2HAKA 5CU6A 4ZS0A 3MH0A 1LR4A 3OP5A 4FICA 2YM6A 3UC3A 4DGOA 1H1WA 3MS9A 4FEUA 4OT5A 2OFVA 1Q62A 4UMTA 4FKGA 1WBSA 2YIRA 4E6DA 4DFYA 4AZEA 3E87A 2B9IA 4RZWA 1RJBA 4LRKA 4A07A 2XIYA 4XG2A 3BEGA 2X2LA 3NNXA 1Q8WA 4ZSEA 4DGMA 2BZKB 3Q96A 3UZRA 3HRBA 3DXQA 2YIQA 4MNFA 4QMVA 3KF7A 4XBUA 1JSTA 1NVSA 5C9CA 4NM5A 3GFEA 5BVWA 4PTEA 4IZ7A 3D7TA 4O6LA 3R8MA 1XO2B 4PV0A 5CQUA 1FVVA 3VAPA 1CKIA 2X9FA 4MF1A 1RW8A 1V0PA 3ACKA 2P33A 5HHWA 4DFXE 1ZARA 3QTIA 4YO6A 4KBKA 3HP5A 4BDKA 4GYIA 5C8NA 3QX2A 3T9IA 5CI7A 4RVMA 4BIBA 4U42A 1PYXA 5F4NA 2VX1A 2E9UA 3ULZA 1H25A 2Z7RA 4PDYA 5CSPA 5GZ8A 4NCTC 4AACA 4F9AA 3PZHA 4WNMA 3OVVA 4BC6A 4CTBA 1A48A 3F3VA 3NIEA 3M2WA 3SAYA 4IXPA 1IA8A 2OZAB 2OFUA 4KUJA 3O8PA 3ET7A 5BYYA 3CPCA 3VHKA 3KA0A 4KS8A 2PK9A 4AGDA 4YZCA 5GZAA 3LQ5A 3BQRA 4LOOA 3ORLA 4FKRA 2ZMCA 4FYOA 4QMMA 4MBIA 4C02A 2PTKA 3QRJA 5EQPA 3PPJA 3FMLA 5C27A 3BV3A 3OROA 2XIXA 2JIIA 3RMFA 3B8QA 3IDCA 2QO2A 4JBOA 4M8TA 1OPLA 4LFIA 4IB3A 3IDBA 4C36A 5GZ9A 1IA9A 3GCSA 3FC1X 2XA4A 4FF8A 4QYFA 5AM6A 2UZBA 4OUCA 3CXWA 5GNKA 4ZTLA 2IO6A 4G31A 2XK9A 3E62A 4OTHA 3PXZA 3UDBA 3R00A 3L9MA 3ZFXA 2QKWB 3V3VA 4FIEA 3FKLA 3HECA 2WMBA 3VUKA 4BBFA 1WAKA 5DT4A 4DA5A 1YDSE 2EWAA 4QP1A 2GNLA 4KIOA 2HW7A 4WG4A 3VRYA 3RNYA 1R0EA 5LOHA 2JIUA 5FEQA 3FQSA 4IAAA 5CT0A 4N70A 3AC1A 1BMKA 3IO7A 3Q04A 1YHWA 3LCSA 1UU7A 4H1MA 3MFRA 4ZLYA 3C51A 1UWJA 1XBAA 3OFMA 2GHMA 3PXRA 4TKSA 2WHBA 4XH6A 5D9HA 1OGUA 2G1TA 2XKDA 3CTHA 4L00A 3CD8A 4FV1A 2O8YA 4M12A 3VQUA 1YXTA 4QTAA 3U6JA 5IA3A 2YCSA 3DQWA 2XK6A 4IC8A 5FTQA 3KVXA 3LE6A 3QYWA 5JT2A 1F5QA 3GU7A 2BRBA 1YXVA 3MH1A 4GT4A 3KXZA 3SC1A 1UWHA 3KRLA 4OTQA 4XV1A 1OPKA 2Y4IC 4FKSA 4GFGA 4RC4A 3QUDA 4RIYA 3LKMA 1W84A 3EFJA 1AQ1A 5CT7A 3FZRA 3UPZA 4U44A 3Q3BA 2V7AA 5CXZA 2Y9QA 3EH9A 1ZOHA 3R1QA 4R78A 2JFLA 2OZAA 5L2IA 4BCQA 4C61A 2WPAA 2BHHA 3RKBA 1XR1A 4G3CA 3MFTA 2CLQA 3BHVA 3KMWA 5AP2A 3VJOA 4AT4A 4H1JA 3ZHPC 3TT0A 5H8BA 2BROA 3FI2A 5IA0A 3DJ5A 1UU8A 1ZYLA 1ZYDA 5IMXA 4MXOA 3GP0A 5CSVA 3RZBA 4AN3A 3MESA 5DEYA 4U45A 4P4CA 2C6MA 2YWPA 3VUHA 3LMGA 2X8EA 4EJ7A 1H1SA 4FKVA 3F82A 4D5KA 4IB5A 3Q6WA 4XV2A 2I1MA 3PRFA 3QU0A 4O1OA 4BDHA 3NS9A 5J5SA 2A4LA 4TWNA 4KIKB 4FV9A 4M15A 3LMIA 1G3NA 4OBPA 4GMYA 4U7ZA 5EYKA 2DQ7X 2F7EE 2R3RA 4L43A 3OMVA 4RJ3A 2VTTA 3UOJA 3HGKA 2VNYA 2GS2A 2G2IA 5EW8A 5FM2A 3EQIA 3IPHA 5IZFA 3Q2MA 4AZFA 2PZRA 2R0UA 3VWAA 5HCZA 4F6SA 4FZAB 4GU6A 5B7VA 2OF4A 4KD1A 5HVJA 5LVLA 4ZY6A 2KTYA 4K18A 2ZYBA 2QLUA 3QC9A 3S2PA 4BIDA 4E7WA 2WEIA 4YHJA 5FP5A 1QCFA 3LCOA 2A1AB 2CMWA 3OEFX 4NUSA 2UZWE 3DFCB 2LGCA 2V7OA 4RIOA 1DI8A 4QYYA 3UODA 4GRBA 3ZO4A 2PUUA 4XG6A 4JVGA 2OJ9A 3MA6A 2SRCA 3QZIA 4J95A 3GC9A 1YHVA 2PVMA 3DTWA 5M07A 3BQCA 2Y4PA 4RIXA 1APME 4WKQA 4AZVA 4IW0A 3U54A 4ACGA 4IIRA 3RALA 3O0GA 4GFOA 2P2HA 4WOVA 3IW5A 3CJFA 5T68A 4HNFA 1CKJA 1Q99A 2GMXA 2JITA 3LOKA 4NM7A 4RSSA 1J7IA 1OL2A 4UMRA 3BE2A 4YP8A 4PMSA 2CKEA 4EEVA 4FT9A 5AFVA 1LEWA 4I92A 4IFCA 3TKIA 5CEMA 2W4KA 4EK6A 3ANRA 2OICA 3LFBA 2ITXA 2W1GA 4XNEA 1J91A 2PZYA 3ACJA 3OWPA 4R8QA 4B6LA 5CVHA 5BMMA 4PNIA 4D4VA 3ORZA 4CGAA 2J0JA 2BAQA 3G0EA 3QQLA 5HI2A 3UJGA 4IZYA 4DH5A 2PZPA 3I6WA 3QQHA 3NWWA 4HZSA 5CTPA 5FRIA 1ZMWA 4CFWA 2UZOA 5JQ5A 2O5KA 2VWYA 4BICA 5K3YA 4AA5A 5HX6A 3D94A 5DGZA 3VJNA 4JR3A 4F6UA 4LQMA 2VX3A 2J0MB 4KIKA 3V51A 3W10A 2O63A 4AA4A 4AGCA 3PLSA 1OL7A 2YEXA 4IAZA 4QPMA 3ZRLA 3EQHA 3MN3A 2H96A 4YTCA 3ZSHA 3PA3A 2F2CB 2PZIA 2UV2A 5E8VA 1ZLTA 1FGKA 2PVHA 5CNOA 1U4DA 2IWIA 3OW3A 4IX6A 3MVLA 3N51A 4C4HA 4IDTA 4MNEB 3TV7A 2J0IA 1OKZA 4K9YA 4YZMA 1XH7A 4J8MA 3C0HA 4A7CA 5HCXA 1H1RA 1P2AA 3DBQA 4BDDA 4J98A 3ZOSA 2PVFA 5J95A 3U4WA 4ENXA 5E8YA 3R1YA 2QO9A 4YJVA 4I21A 2IW8A 3TZ7A 4ACCA 4BDEA 5KMIA 4ZMEA 3QXOA 4QNAA 1H0VA 4YNOA 2Z7SA 4GVAA 2PUPA 3BLRA 4KRCA 3DZQA 2IVSA 4ZAUA 1YDTE 5IA1A 4F9BA 3P0MA 5CYIA 3C4CA 3G2FA 4RWIA 4CXAA 4YBKA 2E9OA 4I20A 4O21A 5KKRB 1W8CA 4X2NA 4IDVA 3QCQA 4QQ5A 5ACKA 2UZTA 4CLIA 2BAJA 5BVNA 4WBBB 3ZM4A 2HW6A 3DV3A 3FL4A 2A27A 5J9ZA 5GINE 4FUYA 5DH3A 5GIPE 5HTIA 3ZRMA 4R7BA 2QHMA 4BFMA 4GSBA 3D2KA 5CASA 5GIOE 5LVMA 3OXIA 5ANDA 4MWHA 4BDFA 5IISA 3SD0A 3P08A 4PP9A 3DQXA 2PMNX 2WMXA 3G51A 2W5HA 3SKCA 4EC9A 2OZOA 4KKEA 2E9PA 4LUDA 4MF0A 3O8UA 2R7BA 2WTVA 5E8TA 3BYVA 4ZJIA 2OK1A 4XRLA 3CGOA 3VQHA 3ZDIA 1OBGA 2X2KA 5DR9A 1XHAA 2OWBA 4L3PA 4NTTA 3O8TA 2IJMA 2BZIB 5IQGA 1R0PA 1CDKA 4W9XA 4M0ZA 5E8WA 4F99A 4O96A 1PMVA 2GSFA 2EXMA 4ZZOA 3VS3A 3S1HA 4NL0A 5HZNA 2BPMA 1HCKA 3PVGA 4PL5A 3PSCA 5KUPA 3AD5A 4G34A 5K4JA 4FV7A 3UOLA 1V1KA 3GQIA 3DU8A 4EWHA 5CALA 3U4UA 2GNFA 4U6RA 5EDRA 4FEWA 1OMWA 3Q4CA 1ZYJA 3FPMA 1ZMUA 3DPKA 5JFXA 1KWPA 3AOXA 2YM7A 2JAVA 2ZVAA 3MTFA 4II5A 3E8CA 5AR4A 3WIGA 1Z5MA 1GNGA 3LIJA 3BI6A 3P4KA 5AWMA 3G6GA 4S32A 3SV0A 3T3VA 5E4HA 4I24A 4GKIA 3W2RA 4BI0A 5I3RA 4WNPA 5K5XA 1YOJA 3C4ZA 4ITHA 3NEWA 5CF8A 4P90A 2YZLA 3RM6A 3DLZA 1CSNA 5EI8A 1IRKA 4EH4A 4H39A 3B8RA 2WMWA 3NYNA 4WO5A 1MRUA 3S3IA 3SOCA 3PY0A 1VEBA 3AMBA 4C3PA 1Q8UA 4ERKA 2WMVA 1IASA 1X8BA 4C57A 4O0SA 1W98A 2VTNA 4RVKA 2PU8A 2VGOA 2WMQA 3BELA 3I5ZA 3SG9A 1SVEA 5BPYA 2BZJA 5BVKA 1CMKE 2UW5A 3OXZA 3H9FA 3MFUA 4D2SA 5IUHA 5AV1A 1BUHA 2ETMA 4XG8A 4EQCA 1XH9A 1ZWSA 5CF5A 2CKQA 4I93A 5IQDA 3AC5A 5FD2A 3BYOA 1PKDA 3PG3A 4K1BA 2B9FA 1JBPE 3BV2A 4YTFA 3COKA 4FTLA 2P0CA 3NUNA 5EKNA 4EZ5A 4AXAA 2VTRA 4LRMA 4XLVA 3HMPA 4IWPA 5T6KA 3VBYA 2O65A 4BVUA 3K5VA 3R01A 2IZUA 1FVRA 1S9JA 1JVPP 1H1QA 5LCKA 2W05A 3RWQA 2DS1A 5IUIA 4C35A 2R64A 2XIRA 3QUEA 3V04A 5A9UA 3A4PA 2E9VA 2C5NA 3PG1A 2ITUA 3DOGA 4GFMA 5AMNA 4Z7HA 3AGLA 2C1BA 4CTCA 5A54A 1Y6AA 4IACA 2GFSA 5EW3A 4K11A 4O0UA 3H0ZA 4XYFA 1ZY4A 3AXWA 4L9IA 3EYGA 4YJNA 3WF7A 3F61A 3DXNA 4KB8A 5CANA 4EH3A 3VBTA 3PE1A 4FMQA 1TQIA 5CI6A 3GXLA 3PUPA 4FTRA 2OH0E 3RPVA 5LMKA 3UNKA 3Q6UA 4JDJA 3RNIA 4J99A 3EN6A 2ITVA 3DJ7A 4L8MA 2WTCA 2OGVA 5B2MA 1Q61A 2I40A 2XK4A 3ZTXA 2B9HA 3CEKA 3RK9A 3VIDA 3RJCA 5DI1A 3WYXA 4L67A 4OT6A 5M4IA 4GK4A 4JAIA 5L2QA 4IE9A 3JVSA 4JDIA 4EHVA 4D5HA 2W5AA 4USDA 3MTLA 3C4XA 3HAMA 4E5BA 2VN9A 3E93A 5LVOA 4W8EA 2YZAA 3VC4A 5J9LA 3F2NA 4Z3VA 5I9YA 2R3MA 2FUMA 5JRSA 5M44A 4BTFA 3GCVA 4I23A 1I09A 2F4JA 5D10A 5I9WA 2Y6MA 2ZDTA 3LXPA 4MBLA 2WFYA 3NCGA 5AP1A 4XS2A 3RPOA 3QWJA 1LEZA 3LLTA 4FSNA 4HNIA 2RIOA 2X39A 2ZAZA 1O6YA 3Q2JA 1U54B 4UMPA 3Q9YA 3EB0A 2BFYA 3GEQA 3ZONA 5LVNA 4R3RA 1E1XA 5K9IA 4XP2A 4U5JA 4CFXA 3VS6A 3U9NA 1NXKA 4EOLA 3DDPA 3L8XA 3RZFA 3BU6A 3GUBA 3OUNB 5A4EA 1OI9A 4I22A 4AFJA 4RJ6A 3R83A 3E92A 2C3JA 2OJGA 3RAKA 3KRJA 3TNPC 5KZIA 5M55A 2C4GA 5DVRA 4C34A 1PJKA 5IF1A 3NR9A 4YZNA 5A46A 2JGZA 1TQPA 4BY9E 2BALA 3FBVA 3NIZA 5BYZA 1OKYA 3UQGA 2QHNA 3Q4UA 3Q9WA 3TJCA 4BGGA 4K8AA 2C6LA 5HESA 3IQ7A 2FSLX 3UG1A 4CQGA 3Q53A 4FL2A 3L8VA 4JX7A 5IQAA 4UXLA 4RJ8A 1CKPA 2WQOA 5H8EA 3R63A 5A4CA 5HLNA 5LWNA 4MQ2A 4KBAA 3SOAA 4IZAA 3VS2A 4ZY5A 4WUAA 2XJ2A 2XNPA 2XEZA 3KXHA 3UNZA 4ALUA 3LAUA 1E9HA 3HZTA 4WIHA 2VTSA 5HNIX 2XKEA 4K77A 3HP2A 5E8UA 3B2TA 4JG7A 4EQMA 4FIFA 1BL7A 2XBAA 4FK6A 2ERZE 5AUVA 2WGJA 2RSVA 1H1PA 3PIYA 4ZTHA 3R7VA 4BI2A 4JLCA 2C68A 3FL5A 2R3LA 1ZRZA 1BX6A 2VTHA 4I1ZA 3FPQA 3D9VA 4IANA 2W9FB 2GHLA 3WZKA 3B2WA 4RFMA 2HZNA 4EOJA 2ITNA 1XBCA 3F2RA 3RCDA 4BCNA 3NVKI 1OL1A 2R4BA 2FSTX 4CZUA 3LXKA 4K6ZA 2WELA 1M7QA 1SZMA 4QD6A 4RVTA 3IECA 3P5KA 4PL3A 3OOGA 2BDJA 3HV6A 2W99B 2VO6A 2IPXA 3D4QA 1KE7A 4CG9A 1XH4A 4W4XA 4DH7A 1YXXA 3W8LA 3MVJA 3TL8A 5E8XA 3BX5A 4LV5A 3UO6A 3WF9A 2G9XA 4ALWA 4YSJA 4G17A 3TCPA 2ZM1A 3Q32A 5DR6A 4GJ3A 3BYUA 5TF9A 2ERKA 4AE6A 4AZTA 2B54A 1OKVA 3IOKA 3TNHA 3KU2A 4DFUA 2C6OA 2C6KA 2BUJA 1RQQA 4BCMA 4EZ7A 4RX5A 5F1ZA 4GG7A 4L01A 4QQTA 1OZ1A 4O2PA 3ZM9A 3BEAA 4B8MA 4M69B 5DNRA 3GENA 3BHHA 3HUBA 4TRLA 2VTOA 4BCFA 5AAGA 2W4JA 2XNNA 3MPAA 3AT4A 3EKKA 2QG7A 2YHVA 4O83A 3N9XA 5IH6A 4CG8A 3SGCA 4NH1A 2J7TA 2EB3A 2XIKA 3MH2A 5DPVA 3RGFA 3MSSA 4FUXA 5CNNA 3TZ8A 4L7SA 3QBNA 5EI2A 4FG8A 2PWLA 4U43A 5HGIA 5AAFA 1PHKA 4DYMA 3LMHA 2W17A 2XM9A 4C37A 2W1DA 3DA6A 3QKLA 5AUTA 1Q4LA 3EQRA 3I7BA 5BX0A 3MWUA 3P7CA 4MKCA 5DG5A 2B0QA 3FMKA 5AUWA 4IFGA 2YM4A 2IVVA 2W1HA 2UZLA 5HLPA 1P4OA 4EK8A 4RMZA 4Y95A 2X7OA 1OBDA 2WQMA 2W1CA 3O71A 1FOTA 4EUUA 4GIHA 5CAVA 4GKHA 5HO6A 4PNKA 2O64A 1UNLA 4XBRA 4D2TA 3HA8A 2WIHA 3R7YA 2W1IA 3S95A 3OG7A 2QODA 3UZPA 2YDKA 5AEPA 4ZK5A 4DTKA 4EK5A 2QCSA 1O6LA 3KKVA 3EN4A 3KXNA 2BCJA 2W1ZA 3I79A 5C8MA 1FMOE 3QRKA 3WE4A 4ZY4A 1VR2A 3HV5A 5JSMA 2XCHA 3HV4A 4I5CA 2VV9A 3ZCLA 2XJ0A 4PDSA 4C33A 2B7AA 3JPVA 5AV2A 3EZVA 3TUDA 4GCJA 4JS8A 4FK3A 5J79A 5BUJA 2G15A 4APPA 5TKDA 5AJQA 2XYUA 4PTGA 3NYVA 3UIBA 3DNDA 2CNQA 4OAUC 4JBPA 3PVUA 2CGUA 4ID7A 4YO4A 3C4WA 1GJOA 4OTIA 1MRYA 5BUIA 3H9OA 3KRWA 5KBQA 1LUFA 5EQYA 2RG5A 4QP3A 5AR3A 4AF3A 2WTDA 2HWPA 5EFQA 4CZYB 1K2PA 2UW3A 2XNEA 2HOGA 4I5HA 3ZUTA 2WNTA 3C50A 4GEOA 4FTJA 2AYPA 2JFMA 3MDYA 4HYUA 1WBWA 4AG8A 1YVJA 2VO0A 4TYHB 3KFAA 4M13A 4M69A 2AUHA 4UWBA 3GU4A 3AD6A 3ZBXA 4AT3A 4DTAA 3MFSA 3R7EA 3TACA 3L9PA 2C6TA 2Z2WA 3QZHA 4E73A 3LHJA 5FGKA 2GFCA 4F1MA 2XJ1A 3FZTA 4QTEA 4J8NA 1GAGA 2R7IA 4AU8A 1YW2A 3A2CA 4MXAA 3R6XA 4FV0A 2JDTA 4X2GA 4I0SA 4N57A 4H3QA 4F0FA 5ANGA 3SXFA 3WF8A 2ETKA 5CAPA 3DK7A 3I1AA 4QMLA 4E4NA 4L45A 5EM7A 4ZLZA 4IX3A 4C4JA 2BDWA 4AAAA 4F7NA 2FB8A 4U3YA 3ZU7A 3ZS5A 2ZV7A 2C6EA 4MVFA 3ZYAA 4FYNA 4D9TA 4J96A 3O96A 4LUEA 5EHOA 3ANQA 4FC0A 4ZS4A 3VVHA 2GTNA 4RRVA 4QNYA 3RAIA 3VBWA 5E8SA 1GOLA 2B53A 3E88A 4QYGA 3AC8A 5DR2A 3C4FA 3ZDUA 2X9EA 4YLJA 5HE3A 5JQ8A 3KREA 4JJRA 3FLNC 4D55A 2O3PA 4FKOA 4IAFA 2E2BA 5TT7A 2BMCA 4DEBA 4IWOA 4JBVA 5EH0A 4F1TA 4AA0A 4UWYA 4FL1A 4GT3A 5HG5A 2WMAA 3QRTA 3UZTA 4EQUA 2X81A 4W4VA 5LMKC 2KULA 2PY3A 3NW6A 4D2PA 4Y73A 4XX9A 1GZOA 1VJYA 4XEYA 3LFEA 3OWJA 4QMPA 3OCGA 5TOZA 4C4GA 2X4FA 2XIZA 3P79A 2UVZA 2ZJWA 5CU0A 3OXTA 3BYSA 5HE0A 3OTUA 2XB7A 4JG6A 5HG8A 4QP2A 2C5XA 4BGHA 3R1NA 4AOTA 3NUAA 2CGWA 3ORTA 5EYDA 4ANMA 5HIEA 1PF8A 5JH6A 3TDVA 2PVRA 3DK3A 2QQ7A 4YTHA 3VS5A 3F6XA 3NUSA 5CXHA 3F3ZA 3EQFA 5M06A 3TKHA 4MX9A 3DBEA 3EFLA 5M4UA 2QOHA 4ZTNA 3WI6A 4ZEGA 2H34A 3FDNA 4EL9A 4BCGA 4RFYA 4QPAA 2ZM4A 5HE1A 3W2PA 2JKOA 4A9RA 3OY1A 2VTMA 4U0IA 5D12A 2ZOQA 1OM1A 4FKUA 4KKGA 5FBOA 2WQBA 3QD4A 2PVLA 3TM0A 3PVBA 2UUEA 1PXKA 3EL8A 3E63A 5A4QA 4QO9A 5KBRA 5BYLA 4EHZA 4RQVA 2QC6A 4FTNA 3CP9A 3LJ0A 5C4KA 3PXYA 5I9UA 2B1PA 5AUZA 4QMUA 3PSDA 4USFA 4KINA 3ZSIA 4CSVA 4QTDA 4RJ4A 4QYHA 4AW0A 4UBAA 3ELJA 3JS2A 4WSYA 3NW5A 3ZO3A 4U41A 4D1ZA 3BCEA 3ZMMA 3FXZA 4AWIA 2IZRA 3MB7A 4BCPA 3CY3A 3R8PA 2JC6A 4S33A 4M68A 1UKIA 3NAYA 3R7GA 4BR3A 4XG9A 3R7UA 3QAME 3VF8A 4DH1A 5M09A 4WG5A 3FHIA 4EH9A 2Z02A 4J97A 1PXJA 3QRIA 4UMQA 4D0XA 1P4FA 4BB4A 3PP1A 4R3CA 4TT7A 5HNBA 1YQJA 2BKZA 3MH3A 4FL3A 4E4LA 2H9VA 3GNIB 4FKJA 5IUGA 1XQZA 3G0FA 3QLGA 2W5BA 5EYMA 1WBNA 4V01A 2QLQA 4I4EA 4C2VA 5KNJA 3FMNA 4QP6A 3HUCA 1ZOEA 4O6EA 4UN0C 5CU2A 3WILA 4ZTSA 5A6OA 5FDXA 2XF0A 4EYMA 4NJ3A 4X21A 3QL8A 2XK8A 4XOYA 3ZLSA 5BVFA 1LP4A 2X8IA 2UW8A 4KAOA 3PXKA 4F09A 3LZBA 4U81A 3F2AA 5M56A 2J50A 4XJ0A 2VWWA 1B6CB 3GCQA 4I5PA 5KE0A 3W16A 1WMKA 4RWJA 4LGDA 4O1PA 3RPRA 2JIVA 4FV8A 3P86A 3ZFYA 3PPKA 4D4RA 3PFQA 1M52A 4FTOA 5TO8A 5KMOA 4GVJA 4YC3A 4I0RA 2GS7A 2YERA 3G9NA 5DHJA 4MXZA 1OB3A 1H24A 5I9ZA 4IB1A 4BDIA 1IG1A 3NZ0A 3MW1A 4XV3A 3QA8A 3CC6A 2XVDA 4HGSA 3D5XA 4R7IA 4FR4A 5AUXA 3LQ8A 2O2UA 4KKHA 4QOXA 3L9LA 5TE0A 4MXXA 1V0BA 1WVYA 4I94A 4NK9A 4UXQA 3R30A 4CKRA 4G5PA 4BCHA 4QP8A 3RPYA 1XJDA 1URCA 4IVCA 3TI1A 4F9WA 4TYEA 4CCUA 3ZUVA 3HEGA 1E1VA 2YDIA 3DB6A 2YJSA 2CLXA 4G6LA 2WZJA 3UP2A 2WMTA 1JSUA 3QTWA 4H3BA 4XP0A 4BYIA 4DH3A 2QOBA 5G6VA 4B7TA 5CEIA 3OCSA 1JNKA 2UW0A 2HY81 2XRWA 3QA0A 1UA2A 3IW7A 4DC2A 5D7VA 2YCRA 3CIKA 4M0YA 4MD9E 4B8LA 4C3FA 4DCAA 3F5GA 5D41A 2J0KA 3HAVA 4ANBA 1R39A 2DUVA 3PDTA 3PRIA 3IOPA 4HOKA 3BPRA 4ASXA 5DFPA 2R0IA 3PWYA 4CFFA 4J7BA 1R1WA 3TTIA 4DEEA 4E20A 1WVWA 3HV3A 4L46A 2P3GX 1U5QA 4YPSA 3E64A 3FLYA 4IBMA 5HBHA 5HG9A 5HG7A 4YJSA 2PE1A 3PA5A 2OXYA 2OH4A 3MPMA 5HX8A 4DT9A 3PA4A 1FINA 4UV0A 4LG4A 1H0WA 2GU8A 3CSVA 3C0GA 2WKMA 4BKJA 4MYGA 3LXNA 4R6VA 4W8DA 4FGBA 3DKFA 2AC3A 4EKLA 3FZSA 3F3UA 1JKLA 5LMBA 1KUTA 2V55A 2IN6A 2WTJA 3A7JA 3AT2A 1QMZA 4NFNA 2IZTA 4J71A 4F08A 2WEVA 2C3LA 2XYNA 3UIMA 3GCPA 1URWA 3N4TA 3FMMA 2VX0A 4RQKA 5CLPA 4AN9A 1Q5KA 3L1SA 5JRQA 4AUAA 5CEQA 5L8LA 2B52A 3DFAA 3ITZA 1UVRA 2BTRA 4O0XA 3DBFA 4FT3A 3WBLA 4YLKA 4M67A 3UGCA 4EBWA 1U5RA 3I4BA 3R2YA 3LLAA 5CEPA 2CKOA 1Q3WA 4FSUA 3HNGA 5GJGA 2OLCA 2VUWA 4BTJA 2PZ5A 3OW4A 4AX8A 4Y85A 2QOCA 3K5UA 3ODZX 3VULA 4HYSA 2ITWA 3QXPA 4U80A 3DBCA 2XBJA 3E7VA 3ERKA 4XG4A 5EDPA 4C59A 2C3KA 2C1AA 5CSWA 3FMJA 2BVAA 2X0GA 4JX3A 4TTHB 4JIAA 4RFZA 3RP9A 2QG5A 4KWPA 5HTBA 3NUXA 5G1XA 3KK8A 4NKAA 4E3CA 3CY2A 3F3TA 4ASZA 2RGPA 2GS6A 4XV9A 2X4ZA 5CENA 4OLIA 4CT2A 4YUQA 3BHUA 4DFZE 3DAJA 3F7WA 3R21A 4BZNA 1CTPE 4OAVB 3HRCA 2R2PA 4RLKA 2X7GA 3LJ2A 4OTFA 4O7NA 2GQGA 1OUKA 4FNYA 4CFUA 3NNWA 3NVMB 1Z57A 4FKWA 4DGNA 3F5PA 2EXEA 3M11A 2YABA 4HGLA 5BUEA 5LVPA 4FKIA 3RK7A 3IKAA 1Q41A 4Z16A 3FSKA 3TNIA 2YLEA 3NCZA 5BVEA 4GU9A 2C0TA 2BRGA 2ITOA 5K5NA 3AG9A 1S9IA 4YTIA 2A19B 2X2MA 4PPCA 3ZLWA 2ZB0A 4ALVA 4FSYA 1H08A 3EQGA 4U8ZA 1BL6A 3DT1A 1W0XC 3LCDA 3QALE 4WRSA 4YJUA 3V6RA 4X0MA 5H2UA 4DFNA 5IQEA 4W4WA 3QX4A 1OECA 3FXWA 5DOSA 4FKPA 3HDMA 4X2KA 4Y83A 5KMKA 4HVIA 1KE5A 3NAXA 5EW9A 2VWIA 2CJMA 5CF4A 4NW5A 5K4IA 3DTCA 1ZMVA 2W7XA 5AP5A 5L3AA 3DB8A 3JUHA 4ITIA 4ZSLA 3A7GA 3C0IA 3WZJA 4RBLA 4EOMA 3KXMA 4HPTE 4FGRA 3QQKA 4MD7E 1G8AA 3ORMA 4WG3A 3TZ9A 4H3PA 3U51A 1YXUA 1OIYA 4KRDA 1OIQA 4IVAA 5AIKA 1OL6A 3FYKX 5E7RA 5J7BA 2RG6A 5C01A 3LPBA 3I6UA 3JR1A 4Q9ZA 3GU6A 4ANLA 4RJ7A 3FI4A 3HV7A 3CBLA 4AE9A 4BKZA 3I0OA 5ETIA 3P23A 3BBWA 4OBOA 4Q5EA 4LI5A 1KV2A 4O0WA 3KULB 4MNEA 3ZO1A 3HA6A 4GIIA 4EORA 3HMMA 4ZSGA 4FV3A 3TV6A 4ZIMA 1Q8TA 5JFWA 1Y8GA 4I6FA 4R77A 4OTWA 3FEGA 3UVQA 2JKQA 3BU3A 4WSQA 3EZRA 2V5QA 2PYWA 1G5SA 4TXCA 2OIDA 3OY3A 4WRGA 4N6YA 4NIFB 2GNIA 3EWHA 5F20A 4E93A 4ZJVA 4ANOA 5FWKK 4FIJA 3LFAA 3VRZA 3OF0A 2PMOX 5KMMA 2QOKA 4IJ9A 5EK7A 2CPKE 3BGZA 4A4LA 5EKOA 1FGIA 1IR3A 4PPBA 1TKIA 4DITA 1ZY5A 4QTCA 3SG8A 4U3ZA 2FA2A 3OEZA 3ZEPA 2XRUA 1YWRA 5DRDA 3EFKA 3UYSA 4FEVA 2ONLA 4FT5A 4E26A 5A4TA 2YM5A 3V5WA 5CX9A 3R7OA 4FKLA 1PXOA 3LCKA 4MTAA 4J53A 4F63A 5JFSA 1OUYA 3WE8A 1PXNA 3MY5A 3M1SA 2R3IA 2Q0BA 2QI8A 2X7FA 4DEHA 3ODYX 4FKTA 4C0TA 3OOMA 3EMGA 5F94A 5IU2A 3KCKA 1Q8ZA 2YCQA 2QO7A 4F9CA 2FH9A 3FXXA 3OWKA 3PTGA 3QLFA 4CRLA 3VBXA 4HVHA 4O7TA 4CV9A 3BLQA 2CNUA 4APCA 3MA3A 5JKGA 3V5QA 3D7ZA 1ATPE 2Q0NA 2QONA 2X1NA 4OTGA 4AGWA 1J1BA 3M42A 4NTSA 3P78A 2R3PA 4ZLOA 3FUPA 5AX3A 3QFVA 2QR7A 4PQNA 3UOHA 4H05A 3IGOA 4PUZA 5E92A 4FEXA 2F2UA 4G5JA 4YC6A 4OBQA 5EDQA 4CFMA 1L8TA 3TJDA 2QOQA 4MQ1A 5HD4A 2IVTA 3E5AA 3UQCA 2HXQA 2VTIA 4P5ZA 4TN6A 4UEUA 3D2IA 4M66A 2YM8A 3FMDA 4FI1A 1H01A 4BDAA 2HZ4A 4U97A 2JLDA 3AD4A 4PF4A 4CNHA 1GZ8A 4WT6A 3D14A 2VD5A 5FXSA 3O7LD 4YC8A 4E8AA 2I0VA 4U40A 3RTPA 4EZ3A 2WOTA 3H4JA 1H07A 4V05A 4YSMA 3CLYA 5H9BA 4NYEA 4X2FA 2VAGA 4F7JA 3D5WA 4Y5HA 4C3RA 3PPZA 1DS5A 3DKCA 4DTBA 2IZSA 5AP4A 4HVDA 4O82A 5C03A 3HLLA 4FTAA 2W1FA 4O0YA 3KXGA 4GYGA 1KE9A 1NY3A 3IW4A 3A61A 3GFWA 3OT8A 4JQ8A 3V6SA 4RA4A 3THBA 4Z55A 4LMUA 4S30A 4BCIA 4NCTA 1UKHA 1MQBA 2BAKA 2P2IA 2R3HA 3G90X 3I5NA 3KK9A 3V5JA 3NYXA 3QF9A 3R8UA 5I9VA 2UW6A 4L7FA 4G3GA 4GK3A 2V22A 1OPJA 4NFMA 3R02A 1SVHA 2QU5A 3WZDA 3CQUA 4TNDA 1M2PA 3ZC5A 2F9GA 2FGIA 2I0YA 4F7LA 3VUIA 3HMIA 1L3RE 3O50A 4CKIA 4CZTA 4UX9A 5HIDA 5JZNA 1P5EA 2GNJA 1U46A 4MAOA 3GU5A 3ORNA 4UALA 1NA7A 3RHKA 4IVDA 1H00A 4DLJA 5I9XA 3COIA 2YIXA 2XK7A 4RG0A 1J1CA 3UNJA 3QTXA 2F57A 3PY1A 4R5YA 4C7TA 3D83A 4CEGA 2GTMA 2H6DA 3C7QA 4ITJA 2Y8OA 4H36A 4GUEA 5HORA 3K3IA 5ICPA 4RVLA 4ANSA 4G3EA 3QCSA 3OS3A 4GL9A 3UO4A 4WBOA 5FEEA 1XBBA 3PJ1A 4L3LA 4WNKA 4EK3A 4FV5A 2YM3A 3CGFA 2WMRA 4HZRA 3PZEA 3QD0A 3VNTA 4F65A 4DG3E 3CE3A 2J4ZA 3ALNA 4MD8E 3JXWA 3UTOA 5AX9A 4UZDA 3DKGA 4D58A 3LFNA 5CEKA 3RWPA 3W2QA 2X6EA 4YZBA 1QPEA 2F49A 3ZXTA 4ENYA 2R3OA 3FAAA 4R1YA 4TNBA 5ANJA 4UMUA 4EOKA 4TY1A 3QKKA 4FTTA 5ITAA 5DLSA 3W2SA 5KO1A 3OD6X 4FOCA 3FE3A 2GCDA 3MJ1A 2R9SA 3BZ3A 1NVRA 4MK0A 2OJFE 2WAJA 4OGRA 3RINA 4OTRA 5CAUA 3G15A 4S34A 1KOAA 2XUUA 3E3PA 5A3XA 2UVXA 1REJA 1W83A 2BTSA 5AV4A 5CAOA 5IDPA 4NM3A 5FG8A 4Y72A 1OIUA 5H8GA 3W2CA 3F88A 3FSFA 1U54A 4LYNA 5JZJA 4UWCA 3UPXA 2I0EA 4E5AX 3TN8A 5AADA 2OJJA 5LXMA 3EHAA 4C8BA 3QGYA 3LFCA 4B0GA 2BFXA 5A4LA 5KCVA 4O86A 1Q97A 3VW6A 2J5EA 2OKRA 3AC4A 3QC4A 3II5A 4NZWB 3VO3A 1WBVA 2PVKA 2HENA 4Q2AA 4R3PA 3RI1A 1PXIA 3VBQA 1DAYA 2RL5A 3NNUA 3FQEA 4G9CA 3GU8A 1SVGA 4G3FA 4V0GB 3EQDA 1AD5A 3NUPA 3DXPA 2YAKA 1I44A 1PKGA 4D4YA 3COHA 3RHXA 1Q8YA 4ACDA 4A9UA 5M4CA 3ZZWA 2PUIA 3CD3A 4NT4A 4L3JA 4EWQA 5HIBA 4IH8A 3UOKA 4YJOA 4DN5A 2CKPA 4YJRA 1M7NA 4NW6A 4RC3A 5AP0A 2BR1A 4FX3A 5ANEA 4BWPA 5FLFA 3U55A 2XCKA 3BGPA 3LW0A 3ENHA 1WCCA 3AMYA 3KMUA 3Q60A 3Q9ZA 4O91A 2ITTA 5IMEA 2VWZA 2ZDUA 4FZ6A 3UC4A 3QQFA 4RIWB 4FSQA 2F7XE 1MUOA 3E3BX 5DT3A 2J0LA 3FMHA 3RBWA 3VS0A 1JPAA 2Y7JA 2VTAA 4CFNA 5IQCA 5IQHA 2QVSE 4UZHA 2VGPA 3PIXA 2ZB1A 1JLUE 4I6BA 4F0GA 4F64A 3A7HA 4EOSA 2PMLX 5M08A 4IM3A 1Z9XA 2OIQA 4C38A 1EH4A 4JRNA 4N4SA 4ACHA 3TNWA 3QHWA 4BHNA 4XHKB 1JKSA 3DDQA 4WA9A 4X6RA 3PWDA 4PDOA 3PVWA 3F3WA 4QP9A 5FP6A 4CYIA 5E8ZA 3TTJA 3MVHA 2H8HA 4IX4A 2NRYA 4R5SA 5GJDA 4YMJA 3IG7A 3W55A 4Y46A 5AA8A 3TV4A 4FT0A 3H9RA 5LJJA 4CMUA 4DBXA 3EQCA 5HBEA 4FV4A 3ID6C 4E1ZA 3DY7A 4RJ5A 3QYZA 3PYYA 4QMTA 4BIEA 2GNGA 2FVDA 4EI4A 3AMAA 4USEA 2NNWB 2J51A 1SMHA 4EH2A 4HPUE 3ZEWA 3CJGA 1OVEA 2W0JA 4O38A 4RZVA 4V04A 5ETFA 3ZBFA 4JQ7A 4BZOA 4JAJA 1XKKA 3K54A 5CWZA 1V0OA 2C6IA 3EFWA 3NMUF 2PUNA 4V0GA 5E91A 4R7HA 5JGDA 2PVJA 4RA5A 4XLIA 2R3FA 3WF5A 2C5YA 1WBTA 2YAAA 4QQJA 2R3GA 5J8IA 4IAKA 3C9WA 2PVYA 4BRXA 4F70A 5KKRC 3PJ8A 2ONLC 2X8DA 4IC7A 1Y8YA 1T46A 1WBOA 3R04A 4AW2A 4IAIA 4IX5A 3BU5A 1A06A 4FG7A 4MEDA 3OZ6A 1GIHA 2B4SB 2NRUA 2ZV2A 3DCVA 4FA2A 3BHTA 1J3HA 1JSVA 5EM6A 4DG2E 5CU3A 1BI7A 1FBNA 3OTVA 4PY1A 2ITPA 1ZYSA 3T8OA 4ORKA 3FYJX 4ZJJA 2B9JA 3NYOA 3WARA 5L2TA 3QD3A 2EUFB 3BE9A 4JDHA 4JI9A 5EHLA 4K0YA 3BGQA 4RIWA 5AV0A 3O17A 3UE4A 4NM0A 3FI8A 3N4VA 4NU1A 4YJTA 2HIWA 5B0XA 2C5OA 3NX8A 4MXCA 3SW4A 4E6QA 3QKMA 3IDPA 5AP7A 2BHEA 1KE8A 3EIDA 5JGBA 5DWRA 5AIRA 3I60A 5JK3A 2CN8A 2C69A 5HVKA 4O0VA 4AW5A 4CQEA 5CAQA 2W4OA 3KMMA 3SXSA 4E5WA 1YXSA 3NW7A 4S2ZA 3FKOA 5CVGA 4EUTA 2QNJA 2XNMA 4FOBA 4JG8A 2YISA 4I6QA 4OR5A 5FDPA 3A8XA 5K0KA 4PDPA 2UZDA 2ZV9A 3JY9A 5HOAA 4I5MA 4IZ5A 5FM3A 4FTQA 5L8JA 4DE4A 1YRPA 3ROCA 4U9AA 4EOPA 3U6HA 3EQBA 5CQWA 1H26A 1R78A 4WD5A 4FNZA 5L6WL 4B4LA 1PXLA 1M14A 1TVOA 3O7LB 3QQGA 5BVOA 4J1RA 3AGMA 3EOCA 2PMIA 4MH7A 4QMWA 3PP0A 2NPQA 4ANNA 3Q52A 4K2RA 1BLXA 4G6NA 3ORKA 5J87A 5T3QA 3SQQA 5IDNA 4TYHA 3TUBA 4ERWA 2VTPA 4L52A 4L53A 5EM8A 4EKKA 5KHWA 5LWMA 4F7SA 3REPA 4RIYB 3O51A 3AT3A 5CSHA 3R9HA 4FKQA 2CNVA 3C1XA 4KSQA 2UZUE 4O7WA 2WB8A 4HVGA 2OU7A 3CCNA 2J5FA 3OCTA 5E1SA 3U87A 4FV2A 1YI3A 4BF2A 5L4QA 1SNXA 4BN1A 1B38A 3MIYA 5IQFA 4OTDA 3G33A 3SX9A 1M2RA 3FQHA 3P7BA 2CHLA 2J90A 3JYAA 3LFSA 4FEQA 1MQ4A 2JDRA 3TNQB 4F1OA 2WQEA 4GUBA 4DH8A 3W8QA 4IADA 5C8KA 3H30A 4FVPA 3ULIA 3JY0A 3RVGA 3EL7A 5K0XA 2X6DA 2GQRA 4DFBA 4M84A 4O0TA 5KMLA 2GDOA 4TYIA 4UY9A 3EN5A 4EH5A 3S00A 4ZMFA 3ORIA 1PXPA 2HZIA 5AP3A 3Q4TA 4IAYA 5FQDC 2OI4X 2IW9A 4BBEA 5GHVA 3WYYA 4QPSA 3NPCA 4YBJA 3W18A 3DZOA 4Q9SA 1NW1A 5C4LA 2ITYA 3KCFA 1K9AA 1T45A 3K2LA 3QZGA 4MCVA 3MI9A 5FUTA 1WVXA 5FBNC 2IW6A 4LV8A 3FC2A 3KF4A 3IW6A 4IHPA 2C47A 3FLQA 5HCYA 4EH6A 2XEYA 4JL9A 5L6PA 3QTQA 3TXOA 2OJIA 4YZ9A
chains in the Genus database with same CATH superfamily
2RKUA 4AFEA 3UVRA 5M51A 3CTJA 1FPUA 3EJ1A 4IB0A 4IEBA 4O7RA 5J5TA 4D1SA 3I0QA 2QOIA 3NDMA 3DGKA 3R28A 5AUYA 3K3JA 3NGAA 2YDJA 3QD2B 4JOAA 3ZLXA 2VWUA 4FSRA 2RFEA 3VS4A 4RIXB 4F6WA 4QYEA 4LOPA 4BGQA 3F7ZA 4CFVA 4MWIA 1JQHA 3GQLA 2JD5A 1NT2A 1M2QA 2XZSA 5FEDA 4F0IA 3IK3A 1RE8A 2ITQA 5TR6A 1CM8A 3G9LX 3ORXA 1KSWA 1U59A 1GIJA 3ZXZA 4HYHA 3UMWA 3U9CA 2OF2A 5HU3A 4FJVA 4FNWA 3HMOA 1QL6A 5DN3A 2R3KA 4FTCA 3U6IA 2RF9A 2VO7A 4KABA 5A14A 3CPBA 4CLJA 4NEUA 2WTKB 1QPCA 3KC3A 4I41A 3A8WA 4PL4A 4CMTA 4TWCA 4DGLC 4O4EA 3W2OA 4BKYA 4WNOA 1Q3DA 3SRVB 3CKWA 3UVPA 5CF6A 1YI4A 2CGXA 3HMNA 2CCIA 3SDJA 4C62A 4G1WA 4RX9A 4PP7A 3V8TA 4DBNA 4F9YA 2JBOA 2DYLA 5FXQA 4JXFA 1TZDA 2PSQA 3S0OA 2XP2A 3A7IA 4BWXA 4D28A 2Z7LA 3A99A 3ETAA 1KV1A 2YA9A 2XMYA 3TKUA 5J1WA 3EN9A 5HO7A 3R1SA 2YN8A 3QHRA 3LCTA 5D7AA 1H4LA 1P14A 3IGGA 1NVQA 5L2SA 5I4NA 3LQ3A 4UB7A 3ZUUA 1QPJA 5JFVA 5F9EA 4FTUA 3F69A 5AR5A 3QQJA 3GBZA 3KRRA 4RX8A 4ZTQA 4ASEA 2Z7QA 3ZO2A 2RFDA 4ZTRA 3UO5A 5HNGA 4FVRA 3R9RA 2QOOA 3ZFMA 2XNOA 3PSBA 4YGAA 5AM7A 5CS6A 4BZDA 4BDGA 4FSTA 5HU9A 1ZYCA 3BYMA 3R22A 5E9EA 3F5UA 3W0QA 2R3QA 2VO3A 3GC8A 2OXXA 5ANIA 4AW1A 4C58A 2EU9A 3IONA 2F7ZE 2XAOA 1IEPA 2IVUA 1ZOGA 2XKFA 4KA3A 2V0DA 3KGAA 4DINA 2FSMX 4QTBA 4IWDA 4E4XA 3FMEA 3SLSA 4UYNA 4CD0A 1OL5A 2QU6A 4HYIA 1W7HA 2CCHA 4IMYA 4X3FB 5HICA 1PW2A 3E8DA 3V5TA 3R0TA 3RCJA 5CEOA 4PRJA 3FY0A 2NO3A 3POZA 3OHTA 3P9JA 3VW8A 4GJ2A 1XH8A 4AOJA 3R9DA 4GW8A 4MBJA 3VHEA 2ZV8A 3KB7A 4RC2A 3D0EA 1YOMA 4O7VA 3F9NA 2Z60A 4IWQA 3R7IA 4A4OA 2J6MA 2UZEA 4TPTA 4TW9A 4EONA 3DAEA 3EYHA 5FTGA 2B55A 5EOBA 4NKSA 3L9NA 1YWNA 1ZXEA 2VNWA 3PJ2A 3SRVA 4BHZA 1J7UA 3O5AA 5BNJA 3UIUA 3ATSA 4X3JA 4DEIA 4FIHA 1OITA 1W82A 2J2IB 4KS7A 5EOLA 3ZLYA 2QOLA 4EBVA 5EM5A 3Q5ZA 2HCKA 2JKMA 3VUMA 1XH5A 4D4SA 2C3IB 4ONAA 1UNHA 4TZRA 5IPJA 3W0NA 2CSNA 5DMZA 1SM2A 3F66A 2QOFA 4FBXA 3RK5A 3R9NA 2JDOA 3KN5A 3PXFA 5GJFA 3TEIA 3WF6A 3DAKA 4YPDA 2PE0A 1TQMA 3EN7A 2YCFA 3KXXA 4LOQA 4E6AA 2UZNA 3TIYA 4XP3A 3WOWA 4CKJA 4HVSA 3CQEA 3KN6A 3R73A 3KVWA 3ZH8A 4I6LA 4FNXA 4A9TA 3BWJA 2R5TA 3C13A 4O7YA 2BIYA 4FIGA 4HCTA 4YJQA 4D2RA 1RDQE 5JEBA 3G5DA 3O23A 2HXLA 3H10A 3NUUA 3HYHA 4W4YA 4X7QA 3BWFA 3R8LA 4ANQA 5A6NA 5J1VA 4EOQA 2GQSA 4DGGA 4BDCA 2Y6OA 3GGFA 1FVTA 1PMNA 4UYAA 3ATTA 4GS6A 4FSMA 2OO8X 1DAWA 1H8FA 1PMEA 2W96B 1UU9A 5AR8A 2OXDA 4EH7A 3GC7A 5EG3A 4LMNA 1F3MC 3R9OA 2WMUA 3RPSA 4FZDB 4C2WA 3PY3A 3PJCA 2BKKA 4W9WA 2GNHA 2G01A 1ND4A 3QTZA 2HELA 4JQEA 1PXMA 5B2KA 4A06A 2P55A 5DRBA 4X3FA 5B2LA 3O2MA 1R3CA 3LFFA 4QEBA 4BJJB 5CY3A 3VUGA 3KQ7A 4C4FA 4X6QC 3FJQE 2YFXA 3L8PA 1VYWA 2PULA 3HRFA 5HLWA 3KEXA 4P2KA 3R8ZA 2WQNA 5EHYA 4Q5HA 2EB2A 4TL0A 1ST0A 5H3QA 5HBJA 2R3JA 3ORPA 4I4FA 4A4XA 2A0CX 3D15A 3ROYA 3W1FA 2O0UA 4LGHA 4QP7A 2WOUA 3QUPA 4XCUA 1AGWA 3ZSGA 2YITA 3WIKA 4GH2A 1WFCA 4LL0A 4RX7A 4BDJA 3E7OA 2ZFYA 4EH8A 2EXCX 4FZ7A 4GK2A 5AP6A 4P5QA 2XNBA 4WHZA 4E6CA 3CR0A 1SYKA 2FYSA 4RWLA 3E8NA 4PX6A 5CVFA 1GY3A 3A60A 4EK4A 3HVCA 2PPQA 1WBPA 5J7HA 4DT8A 5IH5A 2ITZA 3MY0A 3W33A 4G6OA 3V01A 4BBMA 4FTMA 2Y0AA 1HOWA 3V5LA 3FWQA 2UVYA 2ACXA 2CDZA 4X2JA 3BLHA 4HGEA 4AGUA 2W1EA 4O81A 4LGGA 4O27B 2WMSA 4O22A 3GOPA 5M53A 4FODA 2UW7A 1PYEA 1VZOA 5DYJA 2HK5A 3IS5A 4RT7A 4DCEA 4KBCA 4PMTA 3UBDA 4JNWA 3OWLA 4QMXA 2HZ0A 3FV8A 5IA2A 4KNBA 5KZ0A 4BCKA 5IEXA 3RM7A 2C0OA 3HX4A 3TUCA 4Z9LA 4LL5A 3MPTA 5EQEA 2BIKB 3C4EA 3FLWA 2WXVA 3NSZA 4G3DA 4GG5A 4EYJA 1B39A 2WO6A 4EHGA 5AAEA 1WZYA 2C0IA 5IEVA 5LMAA 1Q24A 4QRCA 3GB2A 3TDWA 3GT8A 4D9UA 3QGWA 1MRVA 2IG7A 2LAVA 3GOKA 4O2ZA 2X0PA 3PIZA 3L8SA 4DLIA 3ZC6A 4DEAA 5I3OA 4O0RA 3FLSA 1Y91A 2WTWA 4ZOGA 5ANOA 4AQCA 4OTPA 5BMSA 1Y57A 4ZZNA 3H3CA 5D11A 3T3UA 4FTIA 1ZAOA 3DBDA 2AC5A 3OCBA 2V62A 3QCXA 2BILB 4G2FA 1A9UA 5BVDA 3CS9A 4QMSA 5DEWA 1ZZ2A 2JAMA 2WIPA 2C5VA 3KULA 4M14A 5IA5A 4FVQA 4IJPA 2WD1A 4XG3A 4XUFA 1G8SA 3NUYA 2W06A 3COMA 3UIXA 4NJDA 2JDSA 3DJ6A 2GHGA 4QMQA 3R2BA 4PTCA 1VYZA 3F5XA 4LRJA 4NIFA 4IM2A 2X0OA 5CZIA 4S31A 4KSPA 5ANKA 4FSWA 4O7SA 1M17A 3D5UA 3VS7A 2JDVA 5BQ0A 4BTKA 3SHEA 3C5IA 4RLLA 3QTUA 3OUKA 3EQPA 3SVVA 4JDKA 3PJ3A 3QQUA 3UP7A 3OBJA 1KE6A 5KX8A 4G9RA 3S4QA 4BI1A 1ST4A 4J52A 2Y4IB 3LFDA 4NSTA 5ETCA 4BCOA 2FSOX 4M3QA 3H0YA 3FKNA 4LM5A 3V5PA 2QKRA 3UG2A 3OC1A 4ZXTA 4Y8DA 1PY5A 4FTKA 1BYGA 4KIPA 3FI3A 3WZUA 2WTIA 4DFLA 2GPHA 4GV1A 3A4OX 2JKKA 2QR8A 4YLLA 4K33A 3Q5IA 4DG0E 4G16A 2VTJA 4JBQA 2XKCA 3CQWA 4HGTA 4XMOA 4A9SA 2VWXA 3W32A 4CT1A 4YR8A 2JBPA 4BYJA 3GVUA 1F0QA 4CV8A 4O84A 1STCE 4ZZMA 3AQVA 4D1XA 3GC0A 5E1EA 3R8VA 3ZRKA 4PWNA 4ASDA 2XM8A 4QP4A 4ARKA 4ZSAA 4XG7A 4TYGA 4YNEA 3QRUA 1BKXA 1YHSA 1J7LA 3QCYA 2I0HA 2YACA 2CN5A 1PMUA 4AP7A 2YIYA 4YU2A 4DDGA 2OW3A 3LM5A 4O7LA 5CSXA 2BDFA 3KY2A 4DEGA 4PPAA 3IW8A 3GCUA 4BWKA 5C26A 4CCBA 3NLBA 2OSCA 3AC2A 1O6KA 3SW7A 1LPUA 4BTMA 2YLFA 4QMNA 5DE2A 2NP8A 5DIAA 4BCJA 4AT5A 5CU4A 4EOIA 4H58A 3QTRA 1FQ1B 2YWVA 1YDRE 3U8WA 3Q9XA 4ACMA 5LQFA 2ZM3A 3D5VA 2XNGA 5E90A 3VUTA 3PE2A 4IVBA 3WZEA 3FLZA 4QMOA 3RAHA 1YKRA 2C6DA 2VWBA 4DAWA 5AUUA 4Z7GA 1YOLA 3BRBA 4YJPA 3RAWA 3TIZA 5DA3A 2AEGA 4AS0A 2I7QA 2I6LA 3VF9A 5JGAA 1OKWA 3HDNA 3R71A 3BIZA 5KMJA 2VZ6A 4A9YA 5D1JA 4F4PA 2QD9A 3LJ1A 4CVAA 2W9ZB 4HW7A 2WTKC 1SNUA 3N4UA 4Y5QA 4P7EA 5HTCA 3JVRA 3P7AA 2ETRA 3PXQA 4PMMA 1Y6BA 2JEDA 3BKBA 4FZFB 3MGYA 4N0SA 5HEZA 4CMOA 5L6OA 4EJNA 3TZMA 2FO0A 5BV3A 5FXRA 4RGJA 4I3ZA 3DS6A 3MBLA 4F78A 4B9DA 2VWVA 3MJ2A 1XWSA 4CRSA 4I0TA 2E9NA 4O4CA 4TWPA 1ZZLA 3DNEA 5M57A 4M97A 4XOZA 1JKTA 2QURA 3QTSA 5AV3A 4CYJA 5FTOA 4QT1A 3I7CA 2Z8CA 4JIKA 2RFSA 4E4MA 2A2AA 4QMYA 5AR2A 4C4EA 3SXRA 3FHRA 1H27A 2ESMA 3C5UA 3OBGA 5HD7A 5JN2A 2PE2A 4JRVA 1ERKA 3VBVA 3SA0A 1JAMA 1YI6A 2PL0A 3A62A 3LVPA 4ZTMA 1UU3A 5IA4A 1FMKA 3FY2A 3NRMA 3T9TA 4D2VA 5IG1A 4KIQA 1GIIA 3MB6A 4HCUA 4YHFA 5IKWA 1UV5A 2ZMDA 3FZ1A 5IH4A 4D2WA 4DEDA 4AZSA 2PHKA 4L44A 1MP8A 3BBTB 3E8EA 5AA9A 4FE2A 3DKOA 2VTLA 4MHAA 2OIBA 4ZP5A 5CZHA 4PMPA 2G2HA 3MVMA 1DM2A 1DI9A 3VS1A 5HQ0A 4FV6A 3GI3A 2XAMA 2OG8A 2J9MA 1GZNA 5ACBC 1REKA 4R1VA 3HKOA 3KRXA 5HO8A 3DK6A 4XRJA 3UYTA 4FG9A 4YHTA 4FIIA 4X3FC 4C4IA 3PLAE 3LFQA 4L68A 5DT0A 5KMNA 2HYYA 3I81A 2Q83A 4RWKA 4ZSJA 3MV5A 4BDBA 1K3AA 1GZKA 3DLSA 3QZFA 4YZDA 5C1QB 2YIWA 4N6ZA 2RFNA 5HE2A 3UMXA 5EYCA 5M4FA 4B99A 2PVNA 4HCVA 2P4IA 2BZHB 2BRMA 2G2FA 4EHEA 2UW9A 1O9UA 2BRNA 4JT3A 4IQ6A 2UW4A 3A7FA 5HKMA 2UZVA 3KL8A 4WUNA 5I0BA 4RPVA 5AR7A 1JWHA 2EVAA 3QWKA 1XH6A 3ALOA 4L6QA 4U79A 5LCJA 4HJOA 4L42A 2C30A 4AZWA 4EOOA 5L2WA 5L8KA 1HCLA 3EKNA 3NNVA 3ENMA 4BL1A 5IQBA 2WU7A 3G6HA 5ETAA 3D7TB 4EC8A 4O4FA 3MYGA 3BHYA 3VN9A 5IQIA 2WU6A 3MY1A 3ZZEA 5JMSA 3CTQA 4OW8A 3TG1A 4D0WA 4O7ZA 2REIA 3Q4ZA 5LARA 3VUDA 4I6HA 4TWOA 5J9YA 2BRHA 2HY0A 2HWOA 1YWVA 4DHFA 4AOIA 2R3NA 4YURA 3P1AA 3V8SA 2XS0A 4DF3A 2XH5A 3UQFA 2VTQA 3FZOA 5EI6A 3OT3A 4QQCA 2DWBA 4TYJA 1H28A 3LXLA 1JOWB 3TWJA 3V8WA 1KOBA 5I5ZA 1IAJA 1PRYA 5HVYA 4AN2A 4FSZA 2YJRA 1UNGA 5DBXA 3KIOC 4JR7A 4M7IA 3CKXA 3AC3A 2VU3A 4IM0A 5KHXA 3POOA 3FZPA 1BI8A 1OIRA 5F95A 4GT5A 1QPDA 2XK3A 1JKKA 4NWMA 2CGVA 4FT7A 1IAHA 4QMZA 3LM0A 2VRXA 2OBJA 3MIAA 5IEYA 3NFFB 3HL7A 4MXYA 2HAKA 5CU6A 4ZS0A 3MH0A 1LR4A 3OP5A 4FICA 2YM6A 3UC3A 4DGOA 1H1WA 3MS9A 4FEUA 4OT5A 2OFVA 1Q62A 4UMTA 4FKGA 1WBSA 2YIRA 4E6DA 4DFYA 4AZEA 3E87A 2B9IA 4RZWA 1RJBA 4LRKA 4A07A 2XIYA 4XG2A 3BEGA 2X2LA 3NNXA 1Q8WA 4ZSEA 4DGMA 2BZKB 3Q96A 3UZRA 3HRBA 3DXQA 2YIQA 4MNFA 4QMVA 3KF7A 4XBUA 1JSTA 1NVSA 5C9CA 4NM5A 3GFEA 5BVWA 4PTEA 4IZ7A 3D7TA 4O6LA 3R8MA 1XO2B 4PV0A 5CQUA 1FVVA 3VAPA 1CKIA 2X9FA 4MF1A 1RW8A 1V0PA 3ACKA 2P33A 5HHWA 4DFXE 1ZARA 3QTIA 4YO6A 4KBKA 3HP5A 4BDKA 4GYIA 5C8NA 3QX2A 3T9IA 5CI7A 4RVMA 4BIBA 4U42A 1PYXA 2IEWA 5F4NA 2VX1A 1W2DA 2E9UA 1H25A 2Z7RA 3ULZA 5CSPA 5GZ8A 4PDYA 4NCTC 4AACA 4F9AA 3PZHA 4WNMA 3OVVA 4BC6A 4CTBA 1A48A 3F3VA 3NIEA 3M2WA 3SAYA 4IXPA 1IA8A 2OZAB 2OFUA 4KUJA 3O8PA 3ET7A 5BYYA 3CPCA 3VHKA 3KA0A 4KS8A 2PK9A 4AGDA 4YZCA 5GZAA 3LQ5A 3BQRA 4LOOA 3ORLA 4FKRA 2ZMCA 4FYOA 4QMMA 4MBIA 4C02A 2PTKA 3AKJA 3QRJA 5EQPA 3PPJA 3FMLA 5C27A 3BV3A 3OROA 2XIXA 2JIIA 3RMFA 3B8QA 3IDCA 2QO2A 4JBOA 4M8TA 1OPLA 4LFIA 4IB3A 3IDBA 4C36A 5GZ9A 1IA9A 3GCSA 3FC1X 2XA4A 4FF8A 4QYFA 5AM6A 2UZBA 4OUCA 1G8JA 3CXWA 5GNKA 4ZTLA 2IO6A 4G31A 2XK9A 3E62A 4OTHA 3PXZA 3UDBA 3R00A 3L9MA 3ZFXA 2QKWB 3V3VA 4FIEA 3FKLA 3HECA 2WMBA 3VUKA 4BBFA 1WAKA 5DT4A 4DA5A 1YDSE 2EWAA 4QP1A 2GNLA 4KIOA 2HW7A 4WG4A 3VRYA 3RNYA 1R0EA 5LOHA 2JIUA 5FEQA 3FQSA 4IAAA 5CT0A 4N70A 3AC1A 1BMKA 3IO7A 3Q04A 1YHWA 3LCSA 1UU7A 4H1MA 3MFRA 4ZLYA 3C51A 1UWJA 1XBAA 3OFMA 2GHMA 3PXRA 4TKSA 2WHBA 4XH6A 5D9HA 1OGUA 2G1TA 2XKDA 3CTHA 4L00A 3CD8A 4FV1A 2O8YA 4M12A 3VQUA 1YXTA 4QTAA 3U6JA 5IA3A 2YCSA 3DQWA 2XK6A 4IC8A 5FTQA 3KVXA 3LE6A 3QYWA 5JT2A 1F5QA 3GU7A 2BRBA 1YXVA 3MH1A 4GT4A 3KXZA 3SC1A 1UWHA 3KRLA 4OTQA 4XV1A 1OPKA 2Y4IC 4FKSA 4GFGA 4RC4A 3QUDA 4RIYA 3LKMA 1W84A 3EFJA 1AQ1A 5CT7A 3FZRA 3UPZA 4U44A 3Q3BA 2V7AA 5CXZA 2Y9QA 3EH9A 1ZOHA 3R1QA 4R78A 2JFLA 2OZAA 5L2IA 4BCQA 4C61A 2WPAA 2BHHA 3RKBA 1XR1A 4G3CA 3MFTA 2CLQA 3BHVA 3KMWA 5AP2A 3VJOA 4AT4A 4H1JA 3ZHPC 3TT0A 5H8BA 2BROA 3FI2A 5IA0A 3DJ5A 1UU8A 1ZYLA 4AQKA 1ZYDA 5IMXA 4MXOA 3GP0A 5CSVA 3RZBA 4AN3A 3MESA 5DEYA 4U45A 4P4CA 2C6MA 2YWPA 3VUHA 3LMGA 2X8EA 4EJ7A 1H1SA 4FKVA 3F82A 4D5KA 4IB5A 3Q6WA 4XV2A 2I1MA 3PRFA 3QU0A 4O1OA 4BDHA 3NS9A 5J5SA 2A4LA 2AQXA 4TWNA 4KIKB 4FV9A 4M15A 3LMIA 1G3NA 4OBPA 4GMYA 4U7ZA 5EYKA 2DQ7X 2F7EE 2R3RA 4L43A 3OMVA 4RJ3A 2VTTA 3UOJA 3HGKA 2VNYA 2GS2A 2G2IA 5EW8A 5FM2A 3EQIA 3IPHA 5IZFA 3Q2MA 4AZFA 2PZRA 2R0UA 3VWAA 5HCZA 4F6SA 4FZAB 4GU6A 5B7VA 2OF4A 4KD1A 5HVJA 5LVLA 4ZY6A 2KTYA 4K18A 2ZYBA 2QLUA 3QC9A 3S2PA 4BIDA 4E7WA 2WEIA 4YHJA 5FP5A 1QCFA 3LCOA 2A1AB 2CMWA 3OEFX 4NUSA 2UZWE 3DFCB 2LGCA 2V7OA 4RIOA 1DI8A 4QYYA 3UODA 4GRBA 3ZO4A 2PUUA 4XG6A 4JVGA 2OJ9A 3MA6A 2SRCA 3QZIA 4J95A 3GC9A 1YHVA 2PVMA 3DTWA 5M07A 3BQCA 2Y4PA 4RIXA 1APME 4WKQA 4AZVA 4IW0A 3U54A 4ACGA 4IIRA 3RALA 3O0GA 4GFOA 2P2HA 4WOVA 3IW5A 3CJFA 5T68A 4HNFA 1CKJA 1Q99A 2GMXA 2JITA 3LOKA 4NM7A 4RSSA 1J7IA 1OL2A 4UMRA 3BE2A 4YP8A 4PMSA 2CKEA 4EEVA 4FT9A 5AFVA 1LEWA 4I92A 4IFCA 3TKIA 5CEMA 2W4KA 4EK6A 3ANRA 2OICA 3LFBA 4LDTA 2ITXA 2W1GA 4XNEA 1J91A 2PZYA 3ACJA 3OWPA 4R8QA 4B6LA 5CVHA 5BMMA 4PNIA 4D4VA 2XANA 3ORZA 3W0PA 4CGAA 2J0JA 2BAQA 3G0EA 3QQLA 5HI2A 3UJGA 4IZYA 4DH5A 2PZPA 3I6WA 3QQHA 3NWWA 4HZSA 5CTPA 5FRIA 1ZMWA 4CFWA 2UZOA 5JQ5A 2O5KA 2VWYA 4BICA 5K3YA 4AA5A 5HX6A 3D94A 5DGZA 3VJNA 4JR3A 4F6UA 4LQMA 2VX3A 2J0MB 4KIKA 3V51A 3W10A 2O63A 4AA4A 4AGCA 3PLSA 1OL7A 2YEXA 4IAZA 4QPMA 3ZRLA 3UDZA 3EQHA 3MN3A 2H96A 4YTCA 3ZSHA 3PA3A 2F2CB 2PZIA 2UV2A 5E8VA 1ZLTA 1FGKA 2PVHA 5CNOA 1U4DA 2IWIA 3OW3A 4IX6A 3MVLA 3N51A 4C4HA 4IDTA 4MNEB 3TV7A 2J0IA 1OKZA 4K9YA 4YZMA 1XH7A 4J8MA 3C0HA 4A7CA 5HCXA 1H1RA 1P2AA 3DBQA 4BDDA 4J98A 3ZOSA 2PVFA 5J95A 3U4WA 4ENXA 5E8YA 3R1YA 2QO9A 4YJVA 4I21A 2IW8A 3TZ7A 4ACCA 4BDEA 5KMIA 4ZMEA 3QXOA 4QNAA 1H0VA 4YNOA 2Z7SA 4GVAA 2PUPA 3BLRA 4KRCA 3DZQA 2IVSA 4ZAUA 3AKKA 1YDTE 5IA1A 4F9BA 3P0MA 5CYIA 3C4CA 3G2FA 4RWIA 4CXAA 4YBKA 2E9OA 4I20A 4O21A 5KKRB 1W8CA 4X2NA 4IDVA 3QCQA 4QQ5A 5ACKA 2UZTA 4CLIA 2BAJA 5BVNA 4WBBB 3ZM4A 2HW6A 3DV3A 3FL4A 2A27A 5J9ZA 5GINE 4FUYA 5DH3A 5GIPE 5HTIA 3ZRMA 4R7BA 2QHMA 4BFMA 4GSBA 3D2KA 5CASA 5GIOE 5LVMA 3OXIA 5ANDA 4MWHA 4BDFA 5IISA 3SD0A 3P08A 4PP9A 3DQXA 2PMNX 2WMXA 3G51A 2W5HA 3SKCA 4EC9A 2OZOA 4KKEA 2E9PA 4LUDA 4MF0A 3O8UA 2R7BA 2WTVA 5E8TA 3BL7A 3W0OA 3BYVA 4ZJIA 2OK1A 4XRLA 3CGOA 3VQHA 3ZDIA 1OBGA 2X2KA 5DR9A 4DHIB 1XHAA 2OWBA 4L3PA 4NTTA 3O8TA 2IJMA 2BZIB 4O4BB 1R0PA 1CDKA 4W9XA 4M0ZA 5E8WA 4F99A 5IQGA 4O96A 1PMVA 2GSFA 2EXMA 4ZZOA 3VS3A 3S1HA 4NL0A 5HZNA 2BPMA 1HCKA 3PVGA 1W2FA 4PL5A 3PSCA 5KUPA 3AD5A 4G34A 5K4JA 4FV7A 3UOLA 1V1KA 3GQIA 3DU8A 4EWHA 5CALA 3U4UA 2GNFA 1TFFA 4U6RA 5EDRA 4FEWA 3ML1A 1OMWA 3Q4CA 1ZYJA 3FPMA 1ZMUA 3DPKA 5JFXA 1KWPA 3AOXA 2YM7A 2JAVA 2ZVAA 3MTFA 4II5A 3E8CA 5AR4A 3WIGA 1Z5MA 1GNGA 3LIJA 3BI6A 3P4KA 5AWMA 3G6GA 4S32A 3SV0A 3T3VA 5E4HA 4I24A 4GKIA 3W2RA 4BI0A 5I3RA 4WNPA 5K5XA 1YOJA 3C4ZA 4ITHA 3NEWA 5CF8A 4P90A 2YZLA 3RM6A 3DLZA 1CSNA 5EI8A 1IRKA 4EH4A 4H39A 3B8RA 2WMWA 3NYNA 4WO5A 1MRUA 3S3IA 3UDTA 3SOCA 3PY0A 1VEBA 3AMBA 4C3PA 1Q8UA 4ERKA 2WMVA 1IASA 1X8BA 4C57A 4O0SA 1W98A 2VTNA 4RVKA 2PU8A 2VGOA 2WMQA 3BELA 3I5ZA 3SG9A 1SVEA 5BPYA 2BZJA 5BVKA 1CMKE 4BJJA 2UW5A 3OXZA 3H9FA 3MFUA 4D2SA 5IUHA 5AV1A 1BUHA 2ETMA 4XG8A 4EQCA 1XH9A 1ZWSA 5CF5A 2CKQA 4I93A 5IQDA 3AC5A 5FD2A 3BYOA 1PKDA 3PG3A 4K1BA 2B9FA 1JBPE 3BV2A 4YTFA 3COKA 4FTLA 2P0CA 3NUNA 5EKNA 4EZ5A 4AXAA 2VTRA 4LRMA 4XLVA 3HMPA 4IWPA 5T6KA 3VBYA 3PFYA 2O65A 4BVUA 3K5VA 3R01A 2IZUA 1FVRA 1S9JA 1JVPP 1H1QA 5LCKA 2W05A 3RWQA 2DS1A 5IUIA 4C35A 2R64A 2XIRA 3QUEA 3V04A 5A9UA 3A4PA 2E9VA 2C5NA 3PG1A 2ITUA 3DOGA 4GFMA 5AMNA 4Z7HA 3AGLA 2C1BA 4CTCA 5A54A 1Y6AA 4IACA 2GFSA 5EW3A 4K11A 4O0UA 3H0ZA 4XYFA 1ZY4A 3AXWA 4L9IA 3EYGA 4YJNA 3WF7A 3F61A 3DXNA 4KB8A 5CANA 4EH3A 3VBTA 3PE1A 4FMQA 1TQIA 5CI6A 3GXLA 3PUPA 4FTRA 2OH0E 3RPVA 5LMKA 3UNKA 3Q6UA 4JDJA 3RNIA 4J99A 3EN6A 2ITVA 3DJ7A 4L8MA 2WTCA 2OGVA 5B2MA 1Q61A 2I40A 2XK4A 3ZTXA 2B9HA 3CEKA 3RK9A 3VIDA 3RJCA 5DI1A 3WYXA 4L67A 4OT6A 5M4IA 4GK4A 4JAIA 5L2QA 4IE9A 3JVSA 4JDIA 4EHVA 4D5HA 2W5AA 4USDA 3MTLA 3C4XA 3HAMA 4E5BA 2VN9A 3E93A 5LVOA 4W8EA 2YZAA 3VC4A 5J9LA 3F2NA 4Z3VA 5I9YA 3BL9A 2R3MA 2FUMA 5JRSA 5M44A 4BTFA 3GCVA 4I23A 1I09A 2F4JA 5D10A 5I9WA 2Y6MA 2ZDTA 3LXPA 4MBLA 2WFYA 3NCGA 5AP1A 4XS2A 3RPOA 3QWJA 1LEZA 3LLTA 4FSNA 4HNIA 2RIOA 2X39A 2ZAZA 1O6YA 3Q2JA 1U54B 4UMPA 3Q9YA 3EB0A 2BFYA 3GEQA 3ZONA 5LVNA 4R3RA 1E1XA 5K9IA 4XP2A 4U5JA 4CFXA 3VS6A 3U9NA 1NXKA 4EOLA 3DDPA 3L8XA 3RZFA 3BU6A 3GUBA 3OUNB 5A4EA 1OI9A 4AXFA 4I22A 4AFJA 4RJ6A 3R83A 3E92A 2C3JA 2OJGA 3RAKA 3KRJA