3OP4A

Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. n16961 in complex with nadp+
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
247
structure length
247
Chain Sequence
b'SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
source organism Vibrio cholerae o1 biovar el tor
molecule tags Oxidoreductase
total genus 81
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2010-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3op4A00
3DHEA 4ZQBA 2I5PO 1H93A 4J1TA 1IZ9A 1ULSA 4XDZA 4Y8VA 4DLBA 1PTJA 1K0UA 4KZPA 2C20A 1GDHA 3NX4A 3ON5A 2W2LD 3BZUA 3H2SA 3ULKA 1JVBA 5JC8A 3F3SA 4EBFA 1HDOA 5G0WA 4EUEA 1PGQA 2WD7B 1NR1A 4J0EA 3MJCA 2B5WA 2VWQA 4LVCA 5A06A 4PLFA 1QV7A 3W6ZA 2A92A 1H94A 5TJ9A 1BW9B 1E7SA 1TT5B 2HJSA 4DQXA 3ZV4A 4CUKA 3GRPA 3DAGA 3OA0A 4WCDA 4UAGA 1LDBA 4HFJA 1EK5A 1YQGA 3GOHA 3RUCA 4MP6A 3INGA 3G49A 3ZNQA 2VT2A 3PHJA 3NT4A 1T2CA 4CMJA 3QVXA 3SLGA 1MG0A 3F47A 1V3VA 2I66A 2ZB3A 2VHVA 3OSUA 1YXMA 4RF2A 1MP0A 1NHWA 2DM6A 1I24A 3E03A 2NNLD 1LDEA 1KERA 3NTQA 2B37A 2GGSA 2VZ8A 3L9WA 3NGXA 2X9NA 3NJ4A 4NBTA 2FOIA 2VTEA 2XAAA 4D46A 3GGOA 3I23A 5BSGA 4UEJA 4GLLA 4EI2A 3AI1A 3F5QA 3JQFA 3MOGA 5TJHA 3RUEA 4DMLA 5H82A 2GNAA 1NVGA 2W2LA 3HWRA 2PD3A 3DBVO 1G6KA 2VWPA 3GPIA 4GLOA 3S2EA 4UEKA 1HETA 4OKNA 1BG6A 1X15A 4OM8A 3GG9A 1EQ2A 3AOGA 2HLPA 2PKRA 3PHLA 5HS4A 3GUCA 2V65A 3BTVA 4RPKA 4CODB 2W8ZA 4FS3A 3ORFA 4R4JA 1CF2O 2NSDA 4XRGA 1PGJA 3ONFA 3PHGA 3CUKA 3ZU2A 4CUZA 4K28A 4RF3A 4YAKA 4HY3A 1NQTA 4J7UA 1BRMA 1SB9A 1W4ZA 3CPSA 3PIIA 3A28A 3DFZA 4CV3A 4Z3DA 1YS4A 3SC4A 1EE9A 4YJHA 4CMKA 2WYUA 4DQVA 5L7YA 4MVJM 4UVGA 4NFYA 3TOXA 1MG5A 2FRDA 2DU8A 1LA2A 3PLRA 1QMGA 3ZWMA 1B14A 1F17A 1GQYA 4YT2A 3G17A 2VRBA 3KUXA 5FF9A 3W8DA 3E9NA 4J4BA 4IDBA 4XYEA 4WGGA 5CPBA 3V2UA 5IG2A 1ISGA 5DOZA 1EFKA 3A14A 3WB9A 1E77A 4JK3A 4IGEA 1SO8A 2H1SA 2EP7A 5TS3A 4LN1A 3WYEA 1C0IA 5C3MA 3KYCA 5L53A 3EVTA 5JAZA 3ADPA 4CM9D 1LSOA 5IXSA 1LNQA 1DLJA 2EERA 4G2NA 3ABIA 5TGDA 1J6UA 4I9NA 2EW2A 2UVDA 3B6ZA 2A9FA 4KUEA 3KLMX 1IZ0A 3PEFA 2X22A 1R66A 3OJLA 1V35A 4RPHA 4XIJA 2P9EA 5F21A 3WBFA 2QZ9A 2I6TA 2FPPA 1K6XA 4CV1A 3V1TC 5L45A 3I3OA 1N8KA 3PQEA 4A03A 2JCVA 3DOOA 1LI4A 4P22A 4PRLA 1PEDA 5K6AC 3D4OA 3F46A 1NYTA 3HHPA 4A26A 3ANMA 3DZJA 1ZJZA 1Y8QA 3BMQA 3ZGYA 2NUAA 5L51A 1PR9A 1QORA 2CFCA 4MKXA 5CEEA 4E0BA 1TVEA 3SBOA 4IPTA 2JFHA 4R69A 2IYPA 4PLPA 5JMWA 3PGXA 1Q0HA 1ZEMA 1C1DA 2AXQA 3GEDA 3H9EO 4BOYA 3NEPX 3EGOA 1YBAA 2CVQA 2GN9A 2Q4EA 1D3AA 3WR5A 4CV2A 4RJTA 4RPLA 2PZLA 4DLAA 2CVOA 1KY5A 3RFTA 5JNLA 3ENNA 1R6DA 4IJWA 3PXXA 2A94A 4AJLA 2X58A 4J9VA 4BB5A 3LVFO 3AU8A 2ZTLA 2Q2WA 5BSFA 1A7AA 3AK4A 5KVSA 4PN3A 1FMCA 3K73O 2VOEA 3IUSA 5A02A 3DR3A 2XXBA 4NBWA 1DSSG 1T1SA 2AQ8A 3CZRA 3Q0EA 3KETA 3WGOA 1KIFA 2EG9A 4XA8A 1EUDA 4G65A 4CM3A 2HK9A 4A2CA 4YJFA 4BKQA 4Z0TA 3FBGA 1CERA 2CF5A 2VUTA 5I8WA 1ADFA 1NVMB 3OJ0A 4XGIA 5F1KA 1DBVO 5BNTA 1Z45A 2QZZA 2RCYA 4EEZA 5ES3A 5KKCA 3LYLA 1A7KA 1EVIA 4LCJA 3TZCA 3W4KA 4GKVA 1JKJA 1PJQA 1DRVA 2YV2A 3CEAA 1PJ2A 5T6BA 2AEMA 5IXYA 4BMNA 1E1MA 5TC4A 5DDIP 1AGNA 5CDYA 1CJCA 1B3BA 3P7MA 5I9MA 1ZXLA 3JQAB 4XEHA 4QUKA 1Y6JA 1YOVA 2GASA 3GR6A 4Z6KA 5AXDA 2PKQO 3KTDA 3GLQA 1A4IA 3IOYA 4BO1A 3C7CB 3QVTA 2HJRA 4FPXA 2X7HA 4XYLA 1ZK4A 2IZ1A 2FN7A 2O4UX 4OOEA 3HB4X 4RDHA 4E4YA 4UUMA 3RASA 1H6CA 3WYCA 4L4SA 2EP5A 4DBVO 1R37A 1GTMA 2RHRA 2YW9A 3JQDA 4FFPA 1UDBA 1EE2A 3GZ4A 4EJMA 3C7DB 4NR0A 1UXGA 3LQFA 3RUHA 2HCTA 2QG4A 1LQTA 1TB4A 4ALKA 4J16A 2UDPA 4WPGA 2GZ2A 5ADHA 1B8PA 2QYSA 3IUPA 4CM4A 1YWGO 3TF5A 1EDOA 4M86A 3KRTA 1XA0A 5CEFA 1PIWA 2TMDA 1GYQA 1NQAO 4DPKA 3DXFA 4IXTA 5CAEA 1KS9A 2PR2A 3DOJA 2VNAA 2VQ3A 2DTDA 4PG5A 4IJVA 3TL2A 3C3XA 3PQDA 3H9UA 1EFLA 4MIOA 1NR7A 4DQUA 4DYDA 3MEQA 1YJ8A 1XDWA 4QFDA 2P9CA 1B26A 1MXHA 1UXJA 4LRTB 1EBUA 4JLWA 3WS7A 4HNHA 1P1IA 3VTZA 1D1SA 3L77A 4XGKA 4WECA 4YAGA 3AWDA 1MB4A 2AHRA 3FWZA 4BNMA 5JO9A 1UP7A 3CSDA 2D1YA 3WGYA 1H6BA 2ZTUA 5KIAA 3K8ZA 1FDTA 2VZ9A 4FBGA 1YH3A 1U3VA 3ICCA 1O9BA 4IMPA 6ADHA 3DBRA 5AXAA 3WGIA 1PJSA 3H3JA 4GWGA 1DHTA 2HK8A 2X5KO 3JQGB 2O2SA 3JYNA 3A1NA 2HMUA 2HMTA 4Y98A 1AUPA 3NDRA 1RM3A 2NVBA 1KVUA 5JFOA 2DVMA 1GPDG 1HF3A 3O03A 4FW8A 4BL5A 4B8ZA 2WMDA 4Y6RA 4N5NA 1LRLA 3DBHB 4DRYA 3L07A 2JD2A 1BGVA 2VWGA 4GMGA 3JQEA 3DO5A 1PQWA 3RC2A 1UJMA 2ZJ0A 3PFFA 1RM4A 4J4HA 4I9HA 1JQBA 3TRIA 4E5NA 5TRTA 4RPJA 4J2OA 4NK5A 3IJPA 3WIDA 1GD1O 4CM7A 3BHMA 2HMSA 2O7SA 2O50A 3KB6A 3K96A 1LC0A 4W4TA 4PCVA 1QLHA 3OH8A 2VYVA 3E1KA 5GZ1A 2PK3A 1VSUA 2Y0DA 1OMOA 1P1KA 1WP4A 5TT0A 2VHXA 2ZTVA 4WCFA 1U3TA 3INRA 2DBVO 1I3MA 3OA2A 2D8AA 4YAJA 1P44A 1YO6A 3JQBA 3R3JA 2JD1A 3FPLA 4FJ2A 4AJPA 4ZD6A 1SCUA 3B20A 4WK6A 3LT0A 5G4KA 1LUAA 1SNYA 3BXXA 3NT5A 4RZHA 5B4TA 3ZWBA 4OH1A 2AMFA 1ID1A 3GK3A 2BMAA 1Y1PA 1B8UA 4GSKA 4NBRA 3JQ9C 4A27A 4DC0A 3DHNA 1KC3A 1UXIA 4GL4A 1MC5A 4OMUA 3HFSA 4FIZA 2UAGA 2C29D 1U7HA 2PFGA 3QLJA 1YDEA 4R5HA 5LC1A 5U9CA 1PZEA 5CDSA 1ZSVA 1I2ZA 1QLJA 4HFMA 2WD8A 4GGOA 1IB6A 3IMFA 4P4NA 2BGMA 1CEQA 3KXDA 3PYMA 1EBFA 1ZIDA 3Q11A 4M49A 4YJHB 1JLLA 4NU6A 3PJEA 1PGNA 5DBIA 5B12A 2X8LA 4MDHA 1SBYA 1SAYA 5LDHA 1VSVA 1RWBA 4IS3A 4RQTA 3WTCA 1M75A 3K6JA 3PK0A 1T4DA 2OP1A 1DEHA 5AQ1A 2PZMA 5JYDA 3PI7A 4MJLA 4NBUA 4CQLA 3STHA 2PNFA 1ADGA 1O95A 2F00A 5FEUA 5I7FA 4EJ6A 1PZHA 4MVJA 1HLDA 3JD4A 4BGUA 3RQSA 1LQUA 4U6SA 1N7GA 1PL6A 4BNZA 5KCZA 2PZJA 3IJRA 2H6EA 3DL2A 3I52A 1LLCA 4CPDA 3K31A 1F12A 1YQXA 2O23A 1M67A 5JCJD 5AXBA 2R6JA 2B0JA 1WDMA 3UAGA 1LBEA 3L4BA 2G82A 5BNIA 1M66A 4IDAA 2PGJA 1P0FA 4YRDA 2NVWA 3VHRA 2AW5A 1NAIA 4XDYA 3V1YA 1EK6A 4RF5A 5T67A 4ZICA 3A06A 1BTOA 4IDGA 4AL4A 4NJMB 4I5GA 4QTZA 3LT2A 6LDHA 4PG4A 4Y9DA 1EDZA 1JKIA 5DF1A 1E0DA 1K5HA 1PQUA 1DIBA 3UFXA 1YVEI 2FP4A 3CTMA 3GA0A 4L9RA 3RC1A 1MV8A 1NWHA 3DZHA 1LDMA 2W2KB 4FFRA 1JVSA 2W90A 1PJ3A 1Y8QB 1YL6A 1DIAA 4O1MA 3AM5A 2HRBA 3Q6IA 3UOGA 2ZCUA 2RBEA 1C14A 4AJJA 1UZMA 3DAFA 4MVJG 4RVSA 3MOIA 4JQCA 4AICA 1LXCA 3AM3A 2GN4A 5BSHA 1HLPA 2VOJA 2X23A 2HRZA 3TQHA 1KEPA 3P2OA 3O8QA 5BT9A 3E5RA 4OQZA 1GADO 4XQ9A 1GAEO 3VZPA 5JAQA 3ZWAA 3BTOA 3OETA 1AN9A 1BDBA 1FDWA 2OUIA 4IS2A 3Q3CA 3KLPX 4R9SA 3DBLA 3PRJA 1U1IA 1NXQA 2EJWA 3CKYA 3QQPA 4J1SA 3FTNA 3WSWA 4ZHSA 5L4LA 1N5DA 3X2FA 1WZIA 3M1AA 3GRKA 1ZUD1 3I6IA 4CM5A 3CINA 3OIDA 5G4LA 4MO2A 1VL6A 1NPYA 2HAEA 3OQ6A 4C7JA 1OI7A 4BO9A 1B0AA 2GN6A 3I4FA 3GF4A 4PLTA 2FZWA 3GN1A 3GQVA 4YJGB 2P5UA 3AFNA 1PGPA 3ICPA 4QX6A 4ZA2A 3RBZA 3RU9A 1GY8A 3WNQA 1WMAA 1OOEA 3P5SA 1ONOA 2R00A 3AI3A 3UN1A 2BD0A 1E7RA 1BMDA 1HDYA 4R1TA 2VUSA 5HTOA 3A9WA 4O0LA 5F5NA 3WMXA 4CV0A 4IDDA 5JXWA 1UDAA 4QQRA 4E31A 4K6FA 2C2YA 1SC6A 4MINA 3V8BA 5JO0A 3GVHA 1ZJYA 3AY6A 4BNJA 5FFFA 1DB3A 3KSZO 5IZ4A 3PDUA 4AJEA 2I9PA 2EWMA 4R3WA 3MJVA 2GDZA 2DT5A 3QWHA 1DXYA 3SLKA 2CVZA 2BKAA 2AQIA 3I9KA 4MVJF 2DTXA 1DC6A 2Q1UA 4W9NC 4Q3EA 5B1YA 2VCYA 2YJZA 3QVSA 4ALJA 1J49A 3JD2A 4Q9NA 1UZLA 1UP4A 1X7GA 1OBFO 1NHGA 3WDSA 3WSVA 4TKMA 4UUPA 1Q7GA 2UYYA 2GO1A 1HE4A 4D44A 4XRRA 5EPOA 4E2XA 1R16A 3S2GA 4YBZA 1I32A 1M2WA 2IZ0A 2YDYA 1KEVA 2BI7A 4BO8A 3Q2IA 5JLAA 3G0OA 1DJNA 4FFMA 3ANLA 4HP8A 1VLLA 4IM7A 4NH4A 3H9JA 3AUUA 4L75A 2OP0A 5FYDA 1P9LA 2Q4BA 2ZIZA 3RIHA 3AOEC 3FWNA 5DBGA 4S1VA 3PWSA 4YB8A 1HE5A 3M6IA 4ALNA 4B7CA 3NAQA 3T4XA 4CLXA 2RIRA 3HJAA 4XYGA 2Q45A 1G0NA 2Q49A 3E6AA 4CM4B 4TMFA 4J43A 1OAAA 3OFSA 3ZN2A 5JMPA 1LEHA 3IDSA 2W98A 4QO8A 4BV8A 1QYVA 4B7XA 2E37A 2WEKA 3GZNA 5JW6A 2VHYA 3D1LA 3RD5A 2VHWA 1LDNA 2EV9A 1LDYA 1B8VA 2JAHA 3HUDA 4YQZA 1HDXA 4GGPA 3JQ8B 3K9QO 2G5CA 3ZZNA 4Q3CA 3BAZA 2PZKA 5KJCA 4DTIA 2ZYDA 1K2WA 4CM8B 4E30A 4I08A 2RAFA 3WXBA 1RM0A 3PVZA 1I2CA 2XOXA 1KVSA 3HB5X 1A5ZA 4UVEA 2J5QA 4WNCA 1WXDA 3H6KA 3ZHZA 4CLEA 4J90A 4IIUA 4JXKA 1J0XO 5GY7A 3D5TA 3UICA 3WGHA 4ZRNA 3FN4A 3FTPA 1NWCA 4LVUA 1UDCA 4HADA 3KYDB 3RWBA 2CZCA 2X0RA 5C5IA 1NPDA 2BELA 3DBRB 2P91A 3KV3O 1SOWA 3ADOA 2EKQA 1EQUA 4RCVA 1PQPA 2E6UX 3GAZA 4LK3A 3VH4A 4D41A 8LDHA 4TSKA 2CY0A 5COAA 4KDFA 4D43A 3K92A 5A5FA 1O0SA 4YT4A 4WNIA 4ZQFA 4F6CA 1HDRA 4DREA 5G0SA 3NGLA 1YKFA 4B4OA 3GVPA 2J3HA 2GCGA 4NG5A 1I01A 1NTOA 1JAXA 2QX7A 3EDMA 2HMVA 4Z0PA 2EJVA 3OECA 3VPGA 4NPCA 3D3WA 4U0JA 2HSDA 1ZVMA 1BXGB 1ISMA 4U8GA 2SCUA 4BNWA 5F3RA 4H15A 3ASVA 3DTYA 5KWEA 1UAYA 1HDGO 4O59O 3RJ5A 4FDAA 3EY4A 4J7XA 5H83A 3ITKA 4M87A 1K3TA 3JQFC 1HDCA 2DBQA 1R0KA 3I6QA 4GX1A 4KP7A 4Q3NA 4WOKA 5BR7A 3WGQA 3DQPA 3WWZA 4BNFA 3E5MA 2DUWA 2GZ3A 2HKIA 4IBOA 1C0LA 3KEQA 3H3FA 3D7LA 2QHXA 4BGIA 4DYVA 1LSJA 1SEPA 1T24A 2PLAA 1NX6A 2YDXA 3OEYA 1FXSA 4GWKA 1BVRA 1V0JA 1VJTA 5G4KB 1DFGA 4BGEA 5JDIC 3PP8A 4DXHA 4IZIA 1X7HA 1R4NA 1ONNA 1ADBA 2OMEA 4NU5A 4RVUA 5U1PA 2RHCA 3L4SO 1LSSA 3PZBA 4RL6A 4JP2A 2FHSA 4BV9A 3ITDA 3FPCA 3L0DA 2VYND 3SEFA 3WWYA 2YHUA 1Y8RA 4WLUA 1NPTO 5COQA 1AE1A 5ENVA 1DAOA 2CD9A 3RFVA 4BO4A 1VJ0A 3QY9A 2TMGA 4ID9A 1VI2A 3I83A 3PDJA 4TQGA 1KEWA 3OICA 5KJ6A 4E5PA 1JDJA 1E1KA 2C7GA 4I1IA 2V6BA 4JGBA 1YB1A 2YQ4A 3S1LA 5MDHA 4LRSB 1ORRA 3EZYA 5KVVA 3ROQA 3JV7A 1NFFA 5JAIA 4IDFA 4OHUA 1Y7TA 1YBVA 3NV9A 3ZHXA 3AUAA 4CMCA 4PRKA 3DZBA 4BNXA 2ZK7A 4C4OA 3RBXA 4L4RA 1JWBB 4CQLB 2PTGA 1NBOA 3T7EA 3W4IA 3JQ6A 4YCAA 3H2ZA 4XB1A 2DBZA 4H16A 2NTJA 2E49A 3TZQA 5A9TA 3HE3A 4ZJUA 3GFBA 4J91A 4XR4A 4BKRA 4M54A 5A4DA 2YV1A 2P9GA 2AE1A 1ZK0A 2P5YA 4JP3A 2OL4A 2CMDA 1ISFA 1W8DA 4UVDA 3F1KA 2IXBA 1E3WB 1ENYA 1MGOA 4K1LA 4PLZA 5AOVA 2IE0A 1UUFA 1R0LA 4EITA 2VYNA 4PLYA 5A3JA 4XYBA 3OBBA 4MIEA 1YONA 3TFOA 1U9JA 4TRNA 5TT1A 2NQTA 2H9IA 1V9LA 4C7KA 4CLDA 3U09A 3W1VA 4QO7A 3I5MA 1O5IA 2VZ0A 4BNIA 4MOWA 4JIGA 4CMIA 4XR9A 4RO0A 2IXAA 2X1HA 2EGHA 1WW8A 3EZLA 2BLLA 2V6GA 2DAPA 1KBZA 3W4JA 3PWKA 4XCVA 4JCOA 1ISIA 2EEZA 4WKGA 2V7PA 1YL5A 4CR6A 2NADA 1Q0LA 4QT0A 4CLRB 3ROMA 1NM5A 2GN8A 3C8MA 1B2LA 1JW9B 1HKUA 3HQ4O 1GZ3A 4CLOB 4BO7A 5L3ZA 2D0IA 2O2YA 3OF2A 4OKIA 4CM6A 3PTZA 2RH8A 3RJ9A 4XYMA 3F6YA 1XHLA 3D0OA 4IGFA 4GAEA 1HT0A 3ZWCA 1BSVA 2D3TA 3O8QB 2YHIA 3EHEA 2X4GA 2OGUA 1XGKA 4ZQGA 1NFRA 1QP8A 1GCUA 1FJHA 1U2DA 1UXHA 1ZO8A 1L7DA 3JSAA 5DCYA 1NAHA 1U7TA 1BHSA 3DBLB 1Y81A 1IYZA 4NMHA 1E7QA 5I7SA 1QRRA 1N7HA 1X0XA 4FFLA 1P1HA 1XIVA 2DBRA 3BYZA 3FD8A 4J6FA 3JCZA 2ZQZA 4BIIA 3E48A 4M1QA 2V6MA 4CMAA 4N7RA 5B4UA 5CDGA 4DBZA 2CUKA 3WICA 4HFNA 4E6PA 1HYEA 4F45A 4TKLA 5LDGA 4BNUA 1X13A 3CXRA 3VC7A 3TWOA 3OIFA 1DC4A 1DIGA 1GU7A 3M2TA 3DWFA 1ZMTA 2PGLA 5CFZA 1PZGA 3S2IA 4D3SA 4FC7A 3U4IA 4FD3A 3ETEA 5C7OO 3E9QA 2JD0A 4YEDA 1LSUA 3V2GA 1BXZA 1NFQA 1PWXA 2JFFA 4NZ9A 1Z7BA 4U5QA 4KWHA 3DMTC 4W82A 4L4XA 2VN8A 5T8KC 4G5HA 2EGGA 5DCUA 3BMNA 1PSDA 2X9VA 4YVFA 4D3FA 1LX6A 3AJRA 5DN9A 2RH4A 4E13A 2FSSA 2NU8A 1HE2A 2VWHA 4NI5A 3MJEA 2PD6A 4R1UA 5AXCA 1DO8A 1ISJA 1LU9A 3PYXA 4LCEA 4PLGA 1DDOA 5KNLA 1T1RA 4BQPA 3GAFA 2ZYGA 5HS6A 1U8XX 1PZFA 3QV1A 4IQ8A 3ZWWA 4PZEA 5DNAA 3GNQA 3C7AA 1CQIA 1HZZA 3UH1A 3AY7A 2Y66A 3GG2A 2EHDA 2Q3EA 5JAMA 3SXPA 3OIGA 1LRKA 3KSDO 4I8XA 2BGLA 4HXYA 4JJGA 3MWDB 4BGVA 5L9AA 3JQ7B 1X0VA 4B79A 3EC7A 3MTGA 1GEGA 2XPCA 5I7VA 1HSOA 3K5PA 3WJAA 1TT7A 3CH6A 3ZU5A 4UUOA 1Q0QA 1R4MB 4YT8A 2GF2A 1E92A 5JE8A 7ADHA 2X5JO 3ZV3A 4NDNE 3NT2A 1W0CA 3SJUA 2Y1DA 1P1FA 1C1XA 3JD0A 2YUTA 3MTJA 1DC3A 2VTDA 4Z9YA 4WOJA 1VL8A 2ZYAA 3LLSA 2QQ5A 4LW8A 5T57A 1QYCA 4MP8A 3C1OA 4J4TA 1NVTA 2JAPA 2VYVD 3N74A 4BQRA 4MVJI 1GR0A 1B16A 3RVDA 1EUCA 4FFOA 2Y0CA 3S2FA 3U9LA 3GMSA 3GZNB 1KETA 2UUPA 4J0FA 4GX2A 1K6IA 3ZCXA 1I36A 4YQYA 4F46A 1SOVA 5IF3A 2WE7A 3TL3A 3GY0A 2ZB8A 4FJ0A 4ROSA 3TN7A 2CNBA 3KEOA 2B83A 1BW9A 1TT5A 3GDFA 5IJZA 1KY4A 5KTKA 3W6UA 2DFDA 1ZH8A 3GDGA 4BNTA 3PHHA 3C85A 3R1IA 1P1JA 1Q2XA 3K30A 1QYDA 1S7CA 3OJEA 4FGWA 5AVOA 3U4DA 3Q1LA 4WE3A 4ZN6A 2HQ1A 3AFMA 3U3XA 3FCOA 1ML3A 4BO0A 4HWKA 5JPIA 1LRJA 1TA4A 1N1GA 3JYPA 4W6ZA 1HRDA 4J9UE 2D5CA 3KO8A 4EDFA 3LLVA 3ZWOA 3P2YA 2FZEA 1A71A 1LJ8A 1ZMOA 3MWEB 5TSDA 4RVDA 2FPGA 2VUUA 2PH5A 3AY3A 4GX0A 1XLTA 1L1FA 5TQVA 1E3IA 2NACA 2Q1SA 2VT3A 2PD4A 4IMRA 3IC5A 4DPLA 2I3AA 1ZZEA 3PIDA 4MVJD 3IP3A 2ZCVA 3WGZA 1Z73A 1U8FO 3JQ9A 1EUZA 2X0IA 3GVIA 2OZPA 2I76A 2Q46A 3D3WB 1YB5A 1A9YA 4W7HA 1A9ZA 3TJRA 3I9OA 5T64A 3VH1A 2G17A 4W99A 5IDYA 2XF8A 3WGGA 3A4VA 4P4LA 3ZW9A 2G1UA 4E5YA 4YAIA 3LU1A 5BSEA 1C0KA 1YRLA 1A4UA 2QRLA 3EYWA 4R1SA 1AXGA 1F14A 4Z0HO 2EXXA 4KTTE 3ST7A 2B36A 4FB5A 4PZCA 2IODA 4JX8A 3TOZA 3VZRA 5JBIA 4U0KA 2JKVA 1DPGA 1F0YA 2ZB7A 3F1LA 4MP3A 1ZSNA 1PJLA 1H2HA 5EINA 5I8ZA 3TZ6A 1PR3A 3WFIA 4ND2A 1R4NB 3AM4A 1I3LA 3I1JA 1DFIA 1EMDA 1PJBA 2XXJA 4J2HA 1JA9A 4R5MA 5IZCA 4QECA 1Y8RB 1SB8A 3ZWPA 5IDWA 5DCWA 3KYCB 2Y05A 1G0OA 3HN7A 4RPGA 3KYBA 4NQZA 4K26A 1IL0A 4E12A 3QHAA 3BIOA 2GZ1A 1EZ4A 2D4AA 4J1NA 3V1UA 2Y1CA 4BNHA 1LLUA 2B69A 3ENKA 3QWIA 2C82A 2P68A 4GSLA 5F1OA 3TZKA 4DPMA 4UULA 4BKPA 1Q7CA 5L95A 1BWSA 1W6UA 5ER9A 3ONDA 3TNLA 3FF4A 4AVYA 4PG6A 3DZIA 3WNVA 2WJPA 1IHYA 2JHGA 2NU9A 2X0JA 3QW2A 1GUFA 1KOLA 2F1KA 4EUFA 2Y1GA 2EW8A 3L4BC 2QYTA 4QFCA 4FCCA 4BNVA 4BNLA 5AYVA 3BMQB 2DPGA 1FDUA 4TRJA 3UHAA 3IS3A 3WLFA 1GQQA 2ET6A 2Y99A 4B7UA 5DZSA 2CF6A 2Y1FA 5L7WA 5F5LA 3R0IA 4OO3A 5LCXA 2O3TA 4FSHA 4IY1A 4K6CA 1C1DB 1MX3A 2OXIA 4R9RA 3RUFA 2DFVA 1E6WA 2NU7A 1E5QA 5A9SA 1YBMA 2BFPA 1L7EA 5ER6A 4LSMA 4YWJA 4AFNA 2PGDA 3UW3A 1U4OA 4R54A 3FSRA 4TVBA 1ZSYA 5DP2A 1P3DA 2C7VA 5L4SA 1GZ6A 5EMHA 1SEVA 1YL7A 1S6YA 5GMOA 4XKJA 2ZB4A 2Z5LA 1DHRA 2QRJA 3IQDB 4AJHA 3PJDA 4FR5A 3S55A 1ONPA 1E5LA 1TI7A 3DZKA 4PGFA 4GVXA 1Y5MA 4O6VA 3DMYA 4BMVA 1P77A 4NIMA 3HN2A 4ZQEA 4H7PA 2WM3A 5A03A 4TRMA 1NQ5A 2P4HX 3UKOA 5B37A 3M1LA 5KOIA 4RDIA 1V6AA 1UR5A 2OOSA 4YJFB 4BKOA 4ND4A 2ZKLA 4NJOA 4OXYA 2P4QA 3JQAA 2FWMX 4KOAA 2PKQP 2CDAA 5DBFA 4DMMA 5EIOA 3LZ6A 3PYLA 1I30A 1ADCA 4OIMA 3IIEA 1SZJG 4BUCA 2R00C 3GNSA 4L8VA 4XB2A 3WQSB 3PWZA 3PFWO 3IAHA 4YDRA 4WLFA 3INTA 3VOSA 1GUZA 1HWYA 1ZKMA 1HYGA 1YOVB 3DHYA 4FN4A 3BMCA 4UEOA 1R0SA 3M2PA 5MGBA 4ZVVA 1DRWA 1PGOA 3GPDG 2BF7A 1B15A 1BDMA 4HUJA 4BNNA 3EW7A 2AG8A 3UUWA 4EGFA 1ZBQA 5L40A 2BRUA 4BVAA 5DP1A 3QIVA 4XGNA 1NNUA 1VL0A 3JTMA 1UXKA 3GDOA 1P31A 4MKZA 2FPIA 3DEYX 3E9MA 5JDCC 8ADHA 3AOEA 1EVZA 4RVHA 3WG9A 4N5MA 3I9MA 4IQ0A 1YDWA 1ZEJA 1OZAA 3H9QA 2X86A 1E1NA 5C7LO 2BFAA 3ZHBA 1FDSA 4ALLA 1N92A 1RPNA 4NNJA 4A73A 1D4FA 1GYRA 5H81A 4B4WA 7MDHA 1R15A 2J6IA 3D4NA 3QWBA 1R12A 4KTVE 4CMEC 3FNGA 4WEQA 3N7UA 1P0CA 1LTHR 4EZBA 2AEFA 2LDXA 5L7TA 1IULA 3DB2A 1Y5RA 4CLHA 2Y68A 3I9NA 4DVJA 5A5EA 3HZZA 4AG3A 4UVHA 2EIHA 3H65A 1M6WA 4BO3A 3JYQA 1HDZA 3GEMA 4EEXA 3I9JA 2IEBA 1IOLA 3GGGA 5A3VA 5EL0A 1WMBA 3B1JA 3COSA 5THQA 1C1XB 3ZNOA 5HM8A 3EK2A 5KJ1A 1AHHA 2ZJ1A 3KZVA 1CIVA 3QVOA 2Q99A 1X14A 5U4QA 3H5NA 3WX0A 3ROKA 5A9RA 3JQGA 1I0ZA 2WDZA 5EQFA 5KJFA 1VE9A 4OQYA 3WIEA 2Z95A 5EERA 3U4CA 3MJ4A 3VPHA 2DPHA 1X7DA 1GQ2A 2C5AA 4PG7A 4KMSA 1P33A 4A10A 1DFHA 3UGKA 4IXWA 3DBHA 3D4PA 3ETGA 1I8TA 1VM6A 4FOOA 4WASA 3WYBA 4E32A 5ICMA 2J3KA 4G81A 3GC6A 4MPDA 2E48A 4OOFA 4ALMA 4D42A 5A04A 1KVTA 3KSUA 4F6LA 3PHIA 2Q2QA 1BVUA 2HO5A 3F9IA 2OO5A 3L6OO 3PGJA 4E2WA 4IJUA 3C1AA 5A05A 3MCVA 3B1FA 2C0CA 1E6EA 4Y6PA 1JTVA 1C0PA 5CHEA 3ROPA 4Z3KA 3UCEA 1E3EA 1P74A 1XG5A 2W4QA 1GUYA 5JY1A 2I3GA 2VRCA 4HFRA 1I3KA 3ZWNA 3RC9A 5HWSA 4IIVA 4OYRA 4R68A 2HUNA 3E82A 1FK8A 4R51A 4DL9A 3SX2A 4EUHA 3VZQA 1WVGA 4IDCA 4BO2A 3DDNA 2ZTMA 5C37A 4WCFB 5ITWA 3JQCA 3KOUA 3LT4A 1PS9A 4CM1A 4E5KA 1GYPA 4FC6A 2OBYA 1H6DA 2BHLA 2ZQYA 4DUPA 5IDXA 3ZWVA 3HDJA 1LLDA 5JDIA 1F06A 3NTOA 2ZATA 4TZTA 2BFMA 4A0SA 9LDTA 3HG7A 3X2EA 4YPOA 3OJOA 4URFA 2Q1WA 1HTBA 2A35A 1CDOA 4UREA 4WLOA 1T2EA 4JN6B 2DTEA 2O3SA 2OFPA 3ZWXA 1U3UA 4JROA 3O38A 3B70A 4U7WA 2C2XA 4LGVA 1GZ4A 4BS9A 2Y93A 1T2AA 2GD1O 2GPTA 3CMCO 3QWAA 3EAGA 1XKQA 4BNGA 4GI2A 2HK7A 5IAAA 1D8AA 1H6AA 5A1TA 3UCXA 3U4HA 3B1KA 3GH3A 9LDBA 1D7OA 2BI8A 3V5NA 4E33A 3ZV6A 1RYDA 2C5EA 4CMHA 3OMLA 4DGSA 3FHLA 4XZ3A 3PPIA 1HE3A 3GHHA 1O94A 4WLEA 1HL3A 5ILGA 4WLVA 3VDRA 3VH3A 1GFSA 2J5RA 5JCXA 2BGKA 3I9LA 4ND3A 5K6AA 4YYZA 4H3VA 1NP3A 3WGTA 4XIYA 4R16A 5BQFA 1UAGA 4XJTA 2B5VA 3NDJA 3PJGA 1U5AA 1KC1A 4D3DA 2FMUA 2OBNA 4ALIA 1Y9EA 2I67A 4I5DA 3HSKA 1WZEA 2DLDA 1A72A 1XYGA 1ZK2A 1ZXBA 2YQ5A 4NJMA 3FNHA 3CIFA 1DC5A 3GNTA 1XR3A 1O89A 1MA0A 4Q3AA 3ZI0A 3FNFA 1IUKA 2A4KA 3HDQA 2AA3A 2O3RA 1ZW1A 4OAQA 2AQHA 2W2KA 4DC1A 4A5OA 4AJ1A 3HADA 3OHSX 4TVOA 5K9ZA 1RM5A 3GN2A 2Y67A 2UUOA 4GX5A 3RKRA 4ESOA 2QIOA 3GHYA 3ZU3A 4XX0A 1XSEA 2YFHA 1N2SA 1YQDA 1XU7A 3ASUA 4S3MA 3WFJA 1KVQA 1I2BA 4CR8A 4DIFA 3BTSA 4P4GA 3R3SA 4CM9A 1OC2A 4GPD1 4L73A 5HBRA 4AJ4A 3BHJA 1Q7BA 3VPXA 1VKNA 1HSZA 1G1AA 4WJZA 3QVWA 4ZU3A 4YR9A 3ZW8A 2C59A 1YGYA 3WLEA 5CG1A 2E4AA 5J23A 1PL7A 5CDTA 4CQMD 4OSPA 4PLHA 5HA5A 5CP8A 5ENDA 3RI3A 1A27A 1EVYA 5I7EA 4PLWA 1T4BA 4DA9A 4L74A 4I5FA 2HDHA 5A9SB 1YE3A 1Z82A 3V2HA 3WQRA 1PJCA 4YJGA 4BNKA 1ZCJA 4IUYA 1ZNQO 3JYOA 1LLQA 4RLHA 3GVCA 4Y67A 1MXFA 5CPFA 3DFUA 2X0NA 4PLVA 4XJSA 5CDUA 1VC2A 4Z9XA 3RU7A 4TWRA 3TDKA 4LMRA 2JJYA 4HBGA 2NU6A 4WEOA 2D5AA 3K2BA 4W7IA 1B3RA 3VPFA 1VKOA 1M76A 2Y1OA 4P8RA 2B4TO 1ZK3A 5EJ2A 4Z9FA 3DMTA 2NLOA 3VPSA 5HRUA 3EVNA 4PLCA 2JHFA 4HNGA 5T8KA 4Q3BA 4B4VA 2CDCA 1V8BA 5DOVA 2B4QA 4ZGWA 4RV9A 3UCFA 4CQMA 2I99A 3QP9A 4PIVA 5G0UA 4RORA 1LDGA 1TXGA 1XQ1A 4O5OA 3SVTA 3BMOA 1N9GA 1DJQA 2IEDA 1FF9A 4EYEA 4KUGA 4TZKA 4GMFA 1W73A 1IY8A 2X6TA 1SPXA 4CJXA 3OM9A 5ICSA 1GCOA 2B4RO 1O8CA 1ENOA 3Q9NA 4BO6A 4DLLA 4ILKA 5IN5A 3ANNA 2OHXA 2UV8A 5ITVA 2B35A 4X54A 1FDVA 2EKPA 1MFZA 3BMCB 1HYHA 3OQBA 2P2SA 3HFGA 1J5PA 1Z75A 4TROA 1Q1NA 1Z7EA 1CRWG 2NVUA 2FY8A 2YV3A 4LISA 3T4EA 4BHTA 3OJFA 3PLNA 4R3NA 2NV6A 1ISHA 3FR8A 3BHIA 1ULUA 3IP1A 1HZJA 5FWNA 1E1LA 1B7GO 1KYQA 2Q2VA 4YTEA 1X1EA 2V6FA 5EESA 5CG2A 2Q1TA 1XELA 4UUNA 4YRBA 1F8FA 2GLXA 2Y0EA 3OP4A 2Z1MA 3RCBA 2E82A 3VTFA 4AJ2A 3KHUA 4JBIA 5JY6A 3FNEA 2FR1A 1CWUA 1LC3A 4FQ8A 4NBVA 2PV7A 1GPJA 4R41A 1YB4A 1E7YA 3FR7A 4KQWA 3NJ8A 4ZRMA 4UVIA 4MKRA 2EF1A 3JQ8A 4Q3DA 4P38A 1RKXA 2O7QA 1IE3A 3RUIA 3RBVA 2GYYA 2GRAA 4WLNA 5I9NA 1AXEA 1O6ZA 3CZMA 5JS6A 1PX0A 4OXNA 4CM8A 3P19A 5C7IO 3CMMA 3LF1A 2WD7A 3ONEA 3U0BA 5IFLA 1K6JA 4FOSA 2CSUA 3AI2A 1H9AA 1NASA 4EW6A 4MVJH 2YY7A 1YJQA 2GERA 2WE8A 1GV1A 1HEUA 3DONA 3GUYA 3RUAA 1QG6A 4NK4A 4YACA 3RUDA 2G76A 4D0RA 2POQX 1OFGA 4YJDA 3DZGA 1GL3A 1T25A 2C07A 1PS8A 3KYDA 4NFHA 3K2EA 4E2ZA 4RLSA 3QRWA 4GQAA 4RZIA 3CE6A 4YXFA 2J3JA 3Q2KA 4KQXA 1DOHA 3DTTA 1TLTA 1IPEA 3ZWYA 1UP6A 4B8WA 2IDZA 1XWFA 3NUGA 3L6DA 1D1TA 4GBJA 1QKIA 2I65A 2ILTA 1I33A 2H5LA 3NKLA 4AJKA 1CYDA 1MFPA 4K9DA 4M89A 4JBHA 3O26A 4ZQHA 3H7AA 5F1PA 2AQKA 1CETA 5G0VA 1WNTA 2FR8A 3C1TA 5L4NA 4CR7A 4FJ1A 3FBTA 4LSWA 4YA6A 5JYEA 1MLDA 4M55A 3PZRA 1BXGA 1T26A 2YFQA 1Z74A 1SMKA 3HNPA 5BNFA 1QYXA 2DQ4A 5GZ3A 3FRJA 1XU9A 4J1QA 4OGWA 4N5LA 5TNXA 2DKNA 3RAJA 1DRUA 2VHZA 4BB6A 3ZNPA 3O4RA 1EVJA 3TSCA 1DIHA 3C24A 5TX7A 1ARZA 4OSOA 4E2YA 3VDQA 4BKUA 2Z1NA 4WCFC 3E18A 3U49A 5KKAA 5KVQA 3WBBA 3H8VA 3JQBC 4GH5A 4JNKA 3ZHYA 4YRAA 4CMGA 1DLIA 2WSBA 3HDHA 4FGSA 3G3EA 3SJ7A 1JN0A 1UZNA 3UF0A 2LDBA 3LC7O 3ZU4A 4E21A 1H9BA 4R01A 1E6UA 4PG8A 3F4LA 1TEHA 2R2GA 4M8SA 4JJIA 4E5MA 4L76A 2AG5A 3PQFA 4I5EA 2WYVA 3WJ7A 2GUGA 3KM0A 4FFNA 2HU2A 1QXSA 4J7CA 1U5CA 3H5RA 2PA3A 5CEJA 2X5OA 4ND1A 1U3WA 2VNSA 2Y1EA 3LT1A 1PJTA 1IPFA 3ETDA 4GVLA 3AUSA 2JFGA 4MVJP 4PFJA 1BXKA 3HDYA 3TPCA 5EQDA 4A7PA 4II2A 3FI9A 3F4BA 1RYEA 3QWFA 1ZFNA 2AE2A 3VH2A 4GKBA 4II3A 4XD2A 3D3EA 4CL8A 3U5TA 1M6HA 1KEUA 1MC4A 4JJFA 3VVCA 1IHXA 4IZHA 2AEJA 1XQ6A 3U62A 4E3ZA 1QSGA 3EMKA 4Y6SA 1T2DA 1JU9A 2NWQA 3O9ZA 3WQQA 3E8XA 3NTRA 2NQ8A 4D45A 4N54A 3DOCA 1V3UA 1WLYA 2O3UA 4XWYA 4OL9A 4TRRA 3ZNNA 4F3YA 4HV4A 1H2BA 3GVXA 3R6DA 2X9GA 2JCXA 5IZCC 3LSYA 1E3WA 2BFOA 1U4SA 3AU9A 2J3IA 3NRCA 4NHEA 4RGBA 2IYOA 3JD3A 3F5SA 5IN4A 5G2OA 4O63O 4QSMA 2PH3A 1E3JA 1F8GA 4ND5A 1VRWA 3GEGA 4CUJA 4B4UA 5TF4A 1JKFA 3JD1A 3WMWA 1PJ4A 2DUUA 2J8ZA 4AJNA 4DIBA 1VJ1A 4IQGA 4N18A 2D2IA 4MVJE 3OEWA 3RSHA 4WUVA 3BA1A 4HX5A 4RF4A 3L9XA 3LF2A 3JQAD 3UXYA 4CLRA 4KUHA 2JCYA 1JWAB 4DWVA 4CMIB 2CDBA 3LK7A 4IJKA 5ILOA 3KBOA 4CLOA 4INAA 1P45A 3D64A 4PVDA 1GEEA 1QV6A 1Y9AA 4ONEA 1E3SA 3AW9A 4ITUA 1DAPA 1WPQA 2OORA 4QXMA 4BNYA 3WOHA 1N1EA 1E7WA 2O48X 5JCJA 5JSFA 3H5AA 3VAZA 2H63A 1XEAA 2IZZA 2O3QA 4KWIA 1J4AA 2Q50A 3DC2A 4MIYA 1E7MA 4Q39A 3TZHA 5T5QA 5TLSA 5JC1A 1Z6ZA 3H4VA 1U28A 1X1TA 2QRKA 4B3IA 5FI5A 3N58A 3TFQA 4D0SA 3ZDFA 4JBGA 3MJTA 3BTUA 3D5QA 3OQ1A 2YHIB 3DZFA 3IKVA 3QE3A 1I3NA 1XCBA 1VPDA 4I9UA 4B3HA 2D59A 3QJ5A 4OXKA 5IDQA 3RROA 5KVCA 4EJ0A 2IRWA 1WWKA 4XQEA 4YT5A 2YZ7A 5DT9A 1MUUA 3VZSA 1I5RA 3G1UA 4XQGA 3GFGA 1QR6A 4U6QA 4W9NA 4D7AA 1HXHA 1NQOA 3VKUA 1ENZA 3UVEA 3GGPA 4PZDA 3L6EA 2WWRA 4CL3A 1PU2A 5KJEA 3W8EA 1P1RA 4LMPA 1PWZA 2O4CA 2G0TA 4RQUA 3WTBA 3IL2A 1K89A 3RKUA 4NFSA 2GSDA 1PL8A 4IDEA 1GV0A 1OC4A 3NYWA 2QW8A 1RJWA 3G1TA 5EN4A 3DAPA 1PS0A 3LC2O 3BMNB 1WDKA 3GMDA 3LC1O 4CQMB 2EKLA 3NDIA 4R1NA 2PY6A 4J49A 2HMWA 2NTNA 4QEDA 4AJIA 5JDCA 3ZV5A 4CMBA 3MJSA 1ZK1A 1WDLA 1EEHA 5COBA 3GT0A 3MZ0A 3BMOB 1N9GB 3I4CA 1AHIA 4J3FA 3G79A 3RFXA 1T2FA 2O3JA 3IKTA 3KVOA 3JQ7A 2NTVA 4RVFA 4BMSA 3H9GA 4OJNA 4BO5A 4XQCA 1UH5A 1I10A 2FSVA 4CMEA 1R4MA 2JL1A 1U2GA 3PJFA 5FI3A 4KDEA 3SC6A 3VVBA 4B3JA 2YYYA 1QYWA 1CQJA 4YAEA 5K0ZA 3QA9A 1JAYA 2NVUB 2J5KA 2WYWA 5GZ6A 5TIIA 2BH9A 2DC1A 2WTBA 3QSGA 2PWZA 3S8MA 1C3VA 1ENPA 2GR9A 4L0QA 5G0TA 2FR0A 1E3LA 3W8FA 3T7CA 4DIOA 3JYLA 3VKVA 1H0KA 5THKA 4PVCA 4HKTA 4IINA 3RC7A 1H5QA 3AUTA 3ZH2A 5B4VA 4D79A 4RVGA 1KVRA 5DULA 1WAMA 2C54A 3EUWA 3LDHA 4AJOA 1V3TA 1DIRA 2VRCD 5I9LA 3Q9UA 2NM0A
chains in the Genus database with same CATH superfamily
1N1MA 2ZSBA 4GQBA 4ZQBA 2I5PO 3D7SA 4LOJA 1LNSA 1H93A 4J1TA 4DG9A 2AEEA 4XDZA 1A7UA 1K0UA 1DMRA 1QH0A 3FFWA 3KHTA 2N3ZA 3OEHD 4JT4A 2W2LD 3BZUA 3H2SA 3OOHA 3NHFA 4R8KA 2CLHB 3F3SA 3OJWA 3U13A 5KOHB 2KPOA 4HVTA 4OQFA 1WVMA 4EUEA 5LNK6 1PGQA 3GD7A 1U3DA 4H59A 4ASUD 1NJ5A 1OAKA 3WKAA 2CLCX 2RB5A 3LQ1A 3MJCA 4LVCA 4BN0A 2O8DA 4QFBA 5DJ5A 4G0YA 3CISA 4UU0A 1S2IA 3MD9A 4EW3A 3WK9A 1BOFA 3RRJA 1XPUA 2VI5A 1CR1A 1H94A 4WBXC 1BW9B 1E7SA 5I9BA 1QHYA 3UXEA 4DQXA 2YY6A 1INLA 1J9ZA 3GRPA 3A6LA 3W2GA 3ISVA 2ZUWA 3RUCA 3GOHA 5GONF 1ZVVA 2QG9A 3ZNQA 3G49A 1KOGA 3LQ4A 1GGVA 16PKA 4CMJA 3NT4A 1T2CA 1EAMA 3SLGA 1QRTA 4ER0A 1V3VA 3OSUA 5JADA 4Q19A 2JGLA 4GOJA 1I24A 4KMOA 2XUPA 3NVMB 1QHHA 1KERA 1MT0A 2FQ1A 3JWJA 5IEJA 3KJIA 2XCTB 1GTG1 1Y1RA 3K9LA 2DCMA 2FOIA 2DH5A 2EFJA 2VTEA 2AOTB 1R64A 2XAAA 3ELWA 3GGOA 3I23A 4TV8A 1USIA 4GLLA 3DHWC 1BE8A 5E6UB 1M7BA 5H82A 1AKUA 1NVGA 1D9ZA 2QD5A 3HWRA 3M3PA 4INOA 4MYUA 3DBVO 5AHWA 5GM1A 1A2QA 3S2EA 4UEKA 2QX8A 5LN1A 3P32A 4RNDB 1NC3A 1BG6A 5LKAA 5HS4A 2PKRA 3E15A 3UMFA 3CG0A 1PJAA 3EB9A 4G6ZA 3M81A 4ZK2A 1YULA 2V03A 2W8ZA 4BLVA 5JCOC 3ORFA 2ZIGA 4EVSA 3KOYA 5FQOA 2V4UA 5HF6A 4OP1A 4PTZA 4D3YA 4BQNA 2RC5A 2NSDA 3E61A 3M4NA 2B25A 3CU5A 1PSZA 1U8YA 3ONFA 3CUKA 1JSCA 2ICAA 5LZ8A 1Z4MA 1T36A 1ZH0A 1FTGA 4RF3A 3UMBA 4S2EA 4J7UA 3RSGA 3Q41A 1KXJA 3IMCA 4JB0A 4RE5A 2QXTA 1PFYA 3KUDA 4HLUA 3SC4A 4AUEA 3DCJA 1EE9A 4YJHA 2JLRA 3VHXA 1F48A 4C7VA 4MVJM 4ND8B 1UFVA 5EHIA 3QTTA 1SVIA 1JEQA 1Q21A 2FRDA 2XX3A 1RXCA 2HSEA 5JTUA 1M1YE 1QVAA 2AUNA 1OROA 1LA2A 2XUQA 4G0MA 4KVAA 1QMGA 3A9RA 1B14A 1F17A 3B8HA 1GQYA 3QELA 2XQIA 4RQAA 4LJ8A 3A2KA 2VRBA 2ZZNA 2XQKA 3GJYA 1ZJWA 1LB1B 1N8NA 4L8YA 5CPBA 4X91A 5JEEA 4N39A 4JLNA 5IG2A 3VNVA 1EFKA 5LA6A 1ZI6A 4HZUA 3HV0A 5A3SA 1E77A 2QD2A 3QF4B 4ZJYA 1SO8A 2H1SA 4K9MA 2A1IA 1UC5B 2OK7A 3KX2A 1C0IA 4OQNA 4G2TA 3C3MA 5C3MA 1KDYA 3ADPA 1ZP6A 4CM9D 2BF4A 2YJ4A 1EYZA 1DLJA 2PGXA 1IBRA 2PQ2A 1QDEA 3U7JA 1FVXA 1QKKA 1TQHA 1WABA 2O2JA 4EMUA 5TGDA 1JEYB 5BV7A 4IVNA 4NAHA 1J0CA 1OFUX 1JBKA 2A9FA 2QRZA 3KLMX 5K6TA 1WZUA 1W0JA 1Q1BA 1BCSB 2SKDA 2X13A 2P11A 2PNJA 2X22A 3ZZUA 4LAFA 4MUAA 4TVSA 8MHTA 5B3LA 1FU7A 2AHOA 2BE7A 1V35A 1XZPA 4XIJA 1ZM2A 2I2DA 1NOIA 5AHKA 5HKOA 3A1WA 3JWHA 2LIPA 1LS1A 3GGCA 3T5DA 3Q1KA 4HQLA 4WKPA 3IVAA 1FLAA 3PUVA 2NW6A 5AP9A 4A03A 3MUOA 3DA8A 1S0UA 2R6HA 4PRLA 3VO1A 5GV8A 5KQPA 4C4RA 2P1ZA 3D4OA 3LVQE 3OKPA 2UUAB 2I2FA 4F84A 2QVGA 3AYZB 1SVWA 1ULZA 1ZJZA 3DZJA 5K0JA 2NUAA 2R1UA 1QORA 2CFCA 2EARA 4MKXA 2BBOA 2IZOA 2O5EA 4DNXA 4EQZA 3VQTA 4B3TB 2OXRA 5I48A 2P62A 2DJIA 5DISB 2JFHA 3OT1A 5B2FA 5T7BA 3HY3A 5CB4A 4G5OA 4ZYLA 1TCCA 1GPUA 1LWNA 2QWXA 4TUYF 5C1OA 2PXXA 1U9YA 2COEA 1KZHA 4HGRA 5JMWA 1M2HA 3H9EO 1AKMA 4QTXA 1JHUA 4GICA 1L0BA 1P2GA 2GN9A 3BX1A 2Q4EA 3A6KA 4GXTA 3NHZA 2GZMA 3WR5A 1Y3DE 4C4YA 2RHDA 4ENTA 3ZR4B 3LBFA 5EXDA 4DLAA 5AK3A 1KY5A 3SF0A 4D3XA 5JNLA 1DBWA 1W1IA 2E4VA 4RC9A 3FI0A 3PXXA 2A94A 1M8JA 2P90A 2X58A 3LDGA 4UAJA 4F5WA 1J56A 4N3BA 3LVFO 3AU8A 4EHIA 3H1AA 1KH2A 1RAHA 3E1SA 2F59A 1A7AA 3KBBA 1Z5ZA 2CNOA 3HCNA 2H9YA 3QKTA 4RD3A 4C0HA 5J63A 1KPGA 4LXQA 2QVZX 3IUSA 1N4AA 4RKQA 3BFKA 3CRVA 4NBWA 2AQ8A 1N5OX 4I3HA 2Q3BA 4RCYA 1KYVA 3VC2A 4LF9B 2I4OA 4LY0A 2DLCX 4FLEA 3B52X 2ANCA 3DMNA 2PZEA 3H83A 4XA8A 3ABOB 5EKSA 4G65A 2P2NA 4CM3A 2OLEA 2YMLA 2H8KA 3U3JA 2JBHA 3OD5A 4KDRA 1M6YA 1P19A 2C8VA 1ADFA 5F1KA 2P3QA 1JG7A 1BKDR 4HAOA 3SSAA 1Z45A 2WJHA 3L46A 2GCPA 3BCRA 5ES3A 5KKCA 1EVIA 2C0QA 4FU0A 2Z5GA 4JMPA 2HWYA 3IIJA 1W76A 2VDJA 3PXEA 4GYYA 4G1VA 5JD3A 1P73A 1FYVA 1PJQA 2PBRA 2Z2IA 3AHHA 1HT3A 3F3MA 4MUYA 5CR9A 4AQYB 1FQKA 3OMXA 4CCWA 3WAGA 1YU6A 4L02A 3KL4A 3TMKA 4BMNA 4YCMA 1FMJA 1E1MA 2DPLA 3I30X 1XVVA 4YDSA 2ZVPX 1YZNA 5LA6F 3TQCA 5CDYA 1V6SA 2PLRA 4RZUA 5I9MA 3KQHA 1MD9A 2IYNA 4U2CA 4QUKA 5CJJA 3V7WA 2QT1A 2X0EA 2GASA 3ITNA 2Z8XA 4P5DA 3FHOA 4IFBA 4CF6A 3LBNA 1YCGA 1B2RA 3TXYA 1NT2A 3IOYA 1V37A 3C7CB 3QVTA 4JJAA 4BO1A 4FPXA 5KI6A 2W22A 3WXMA 5BSVA 1WNFA 1ONBA 4P0TA 3A0RB 4BKMA 5IM4F 2IIPA 3VJLA 1AO3A 4UUMA 4D4KA 5EI5A 1UBOS 3JQPA 4L4SA 2EOAA 4OHZA 3RSSA 2ZUUA 4DBVO 4YCDA 2FW6A 3F9RA 2RHRA 4WZBE 1G6Q1 3JQDA 4EHNA 1UDBA 4AIIA 4EJMA 1ZAKA 2GPSA 3C7DB 4QGGA 1NOJA 4IXNA 4K9OA 4G0VA 2P30A 2HCTA 1LQTA 2QRVB 4EB8A 5DSTA 2X2OA 3FRHA 3W5CA 5JS8A 4J16A 4YAFA 1DBRA 4WPGA 5CH8A 1NQVA 1RC0A 2J07A 2ILVA 3V4LA 4RANA 4XPIB 5ALNA 5M5BA 2WKSA 4U3JB 3P9IA 3VBCA 2H59A 2XQGA 2GPWA 3Q7SA 4Q9AA 1CF9A 3C3BA 3JQRA 4G9EA 2VK1A 1HQKA 4BLTA 5I7RA 5AUNB 1XA0A 2HFJA 2TMDA 3N0XA 2ZJ7A 2DWUA 4RY2A 4DPKA 4OQMA 2QN1A 4IXTA 4B71A 4I5IA 1KS9A 5FFMA 4JOQA 1WV0A 4YRFA 4EVQA 4KX5A 2OILA 4IJVA 4MYCA 3C3XA 3V1LA 3AW8A 2H5EA 5ELXA 4MIOA 3VKHA 2ZG6A 3THWB 3VMFA 4BXOB 4QFDA 1X7XA 4YUAA 2VP5A 4QGSA 2RK3A 1UXJA 2DH6A 4LRTB 1EBUA 5CLFA 4JLWA 3WS7A 4HNHA 4QBTA 1D1SA 1PLLA 2WY2D 2HQBA 1Z4KA 3GLSA 4QJBA 3D8SA 5EIEA 1MAWA 2O8CB 1XBTA 3E23A 2RGNA 2XUAA 1B73A 1HR0B 1RRKA 1OXKB 5BWBA 4AIRA 1QX4A 2OZLA 1FDTA 2FX5A 4BMYA 3IT0A 3ICCA 1LX7A 4LZNA 5C4MA 2WABA 3D7NA 6ADHA 4CCAA 5AXAA 3TW8A 3HR4A 3H3JA 5AW1A 3FJOA 3P0FA 1XZFA 3AL3A 1OE0A 1FOEB 1RCUA 3CUSA 3L0OA 4E2FA 5C51B 1GNTA 4L0MA 3KUCA 4WOCA 2FWBA 2HMTA 1M5UA 4LMAA 4Y98A 2DT8A 3KJNA 5FXMA 4S2UA 5E2IA 3D1VA 1RDFA 2GD6A 2DVMA 1JRLA 1HF3A 4PONA 1VSQA 4BL5A 1EUYA 4UNSA 4ZWNA 2IIVA 2L19A 1LRLA 4JL5A 3DBHB 5HCNA 4DRYA 3HEMA 4W9MC 3VYSB 3ZY2A 2X4IA 3O1LA 1C9DB 1CRLA 2DERA 4G23A 3AO0B 2IPLA 1EX1A 2ZJ0A 4CHGA 2F8TA 2EDCA 1RM4A 1WLSA 1W5TA 4MX8A 3QKWA 2P1RA 2ECPA 2WSLA 2ZSKA 4I9HA 1O6CA 4QNMA 3TRIA 4E5NA 4F06A 5CXXA 5I7UA 4J2OA 3MWGA 4NK5A 4B32A 1T1IA 5JYBA 4B87A 4CM7A 1XZCA 4EKEA 2DYKA 2XIJA 4V02A 2HMSA 5EJ4A 4HJXA 4YRTA 1G7CA 5GZ1A 2NXNA 4PCUA 4RKWA 1OT3A 1OMOA 2DHRA 4HAZA 3D02A 1JLKA 2JJQA 1WZNA 2VHXA 2ZTVA 4LXIA 4WCFA 3FROA 1WB6A 2CUNA 4TTSA 2EAUA 3UOAB 5BYKA 4NKRA 2IYZA 1ANKA 3JQBA 4GRAA 1G42A 3R40A 1Y89A 1H9CA 1QK4A 2W2VA 2OYCA 2FR8C 1SCUA 2A3NA 4KK3A 3MIZA 4N6NA 4YQFA 2Z6UA 2X77A 1XF9A 2CFRA 4KEAA 4M83A 5G4KA 1SNYA 4DSZA 2PLNA 1WE2A 2WTXA 2XB4A 3H2HA 2CMKA 2HO4A 4RZHA 4UQPA 1WXWA 1Y1PA 4DC0A 4NBRA 5AJUA 5HX7A 2CXPA 3DHNA 3MNFA 4CI9A 1AK1A 2R7AA 2OZKA 2GLUA 1WKCA 3JZMA 3QEBZ 2UAGA 2XKBA 3OE7A 2RGRA 2XJ4A 1N2OA 4JBNA 3QLJA 4FZJA 1MTOA 3LBYA 3NTUA 4R5HA 5CIYA 3DNPA 4BLPA 4ROTA 5CDSA 4DM4A 2IYUA 5CM9C 1CS0B 4D6YA 3HZRA 4HFMA 1GGJA 5KUTA 1T8UA 2ZPTX 1WF6A 2R8EA 4C5CA 4JYAB 1ACJA 1JSRA 2JFXA 5CYOA 2L42A 3BDAA 1E9FA 3F97A 1DAHA 3PYMA 3JZIA 4K2HA 1JLLA 1E1YA 4MV8A 1OI4A 5DBIA 3IV6A 2XVMA 4Y18A 4ZEXA 4X41A 3QF7A 3H42B 4KRGA 1RPTA 4IILA 2VIIA 3N76A 1DJOA 3HYCA 3EGWA 4FEEA 5ALSA 1BEZA 1Q7EA 5ECYA 2QDKA 1LQ2A 1C1HA 3WTCA 1Z17A 1VMAA 2JASA 2P9TA 5KPJA 5LUBA 5IT4A 4MJLA 4NBUA 4WNAA 2CV1A 2PNFA 2IBSA 1U2PA 3UYKA 1PZHA 4TKUB 4MVJA 4P3PA 1ZI8A 2D2EA 2GTPA 3EPRA 4C6TB 3KSAC 3E70C 1MX5A 2ZXEA 3RQSA 2OWDA 3IBGA 1AK2A 1UFQA 1E3MA 4LY3A 2WTMA 3I52A 3LUJA 1LLCA 1NMEA 4U7TB 4CPDA 3CZ5A 2YW2A 1N2IA 2V3CC 1M67A 4TTRA 5JCJD 4ZEVA 4G5FA 4V0OA 3VA7A 3ZWQA 3OCJA 3GBVA 4RHFA 3PFKA 4PZPA 2P41A 4TYPA 4DLVA 1V5FA 2GJSA 4JKYA 2V7VA 1FXWA 1YZFA 2Y1LA 4QU8A 3HVJA 2HIHA 1I3OA 4K86A 2JAWA 4X00A 4S0XA 3VHRA 4EEZA 1EK6A 1V4BA 5FADA 3A06A 5T67A 4HD8A 3GJ5A 3T9CA 4JLJA 5D1NA 1VIDA 4I5GA 2CL7X 1DKQA 2AL7A 4IRXA 4QTZA 4Y9DA 4RABA 1EDZA 3ESXA 4WXMA 5DF1A 5FI1B 2GPBA 1WMEA 4KL8S 4CVNA 4D74A 1VGRA 1ZD1A 1PQUA 5KEIA 3UH0A 3B82A 2QTTA 4YYEA 5HKBA 1XNQB 2I6QA 3CTMA 4C0LA 4Q5IA 3GA0A 4L9RA 3OC0A 3CGGA 4JQSA 2DQKA 4JS0A 2PLWA 2PV0A 2R6DA 4NBNA 4C05A 1XPOA 2AX3A 1I0LA 1HO3A 2R1VA 2W2KB 1Z8HA 2HADA 2Q5LA 4D9MA 4KITB 2JGKA 3Q6IA 1OYOA 4ZVSA 1W25A 3I2JA 4QYWA 3UOGA 3W1WA 1NNEA 2A6PA 4F9FA 1X9IA 4XX0B 4ER6A 1YNSA 3PQ3A 4GG1A 3MOIA 4RVSA 3FCUB 4RA9A 4AICA 2YNMD 4MUFA 3EIHA 5MFPA 4HDRA 5BSHA 1T3HA 2RG7A 2FSPA 1FX0B 1NYQA 5KTYA 2X23A 4I2VA 4PAQA 1KEPA 1X8JA 3TQHA 3IHTA 3O8QA 1JYSA 1JG6A 5HFAA 5BT9A 3SQOA 3N28A 1GADO 3O2SB 2M6KA 2F6RA 3T3MB 1PNQA 2MHCA 3OETA 5H3CA 4DNQA 1ZR4A 2OUIA 5JZ9A 3Q3CA 3KLPX 4R9SA 3HKCA 4U7GA 1WSAA 5E2AA 3CVYA 2EZ8A 3KQWA 2OSBA 1MH1A 3K0BA 3X2FA 1AF4A 1WZIA 3M1AA 3RTCA 1ZGAA 3O2JA 2DWPA 2YWHA 5G4LA 4AWBA 2VTKA 4UUQA 5LFAA 4P80A 1VL6A 1ZOPA 2C96A 1FJ2A 2HAEA 3OQ6A 1WXEA 4BO9A 4GBED 1B0AA 2WTAA 3W9UA 2FZWA 3GQVA 3QPBA 4YJGB 1EH5A 1PGPA 1SOAA 4KXXA 4A8PA 2XZDA 1VKRA 3MGCA 1GY8A 4LQCA 1WMAA 3TQSA 1OOEA 3WNQA 4KQEA 3ONNA 3V8RA 3GEEA 5K3DA 1QG2A 1V6CA 3HWSA 1E7RA 1EUDB 4R1TA 5AK4A 2JFWA 4L3WA 1TF7A 1QTRA 2Q4DA 2VUSA 4QUHA 4AC9A 2JVIA 2WA2A 4COOA 5F2NA 5HTOA 5ALGA 2KWIA 3QBDA 4O0LA 3OQOA 3WMXA 4CV0A 1TAHA 1P2BA 1Y1SA 5KDLA 2OMKA 3T5AA 2IUFA 3HBAA 4U1RA 1AIPA 1E61A 1DCFA 1H2WA 1L7XA 2LBPA 2BGJA 2XB8A 13PKA 1SC6A 3BS4A 3IDAA 4UZSA 4DT1B 5K2MA 1ZJYA 3AFIA 3C2QA 2Z9DA 3K0KA 3ZQ4A 4BNJA 5IZ4A 3PDUA 4JC8A 2I9PA 2FW8A 4Q18A 3ZDQA 5ICEA 2I29A 5DK6A 4ZPXA 4UXIA 5FTKA 4JITA 2DT5A 4OUDA 1QH8B 3R0ZA 4CT4B 2BWJA 2JGDA 3LRPA 3OESA 4MK4A 3SLKA 4BQQA 3FCSB 2BKAA 2C3MA 4MVJF 3HXTA 1J24A 2Q1UA 4GOLD 4Q82A 4W9NC 2IH5A 4YRRA 5B1YA 1MC8A 1L5SA 4GECA 4LA4A 4QOJA 3BVPA 1D4OA 1V1MB 1KEZA 1UZLA 2CNLA 2FKNA 2ZJYA 4P93A 2WSIA 3E2IA 4LYHA 3E35A 1IXKA 3AR5A 1Z8FA 4NP6A 4GRDA 2RHMA 1TO6A 2KS6A 4UUPA 3WLFA 4EL0A 2XBMA 1RAAA 2GO1A 1NY6A 1HE4A 3LUGA 1XPRA 3K8YA 3HUFA 3S2GA 1AH2A 1M2WA 1NVDA 2IZ0A 2QRHA 2YDYA 3BE8A 3F7MA 3KQSA 1U2ZA 3CVUA 1DTWB 3Q2IA 3EE6A 4MI9A 1DJPA 3CRW1 2PGAA 4REQB 5DLEA 3G0OA 5JROA 1BCRA 2BRUC 4G1UC 1CJBA 4A6PA 1U04A 4CG0A 1M74A 5G02A 2H2FA 3H9JA 3RK4A 1XOIA 1X8XA 2OP0A 4CG3A 1KZ9A 2FUCA 2VHUA 4L0CA 2ZIZA 2G25A 5EOVA 1T4CA 2DULA 1MO6A 3AVXA 1D8TA 3VOAA 1Z5PA 3FWNA 3MW8A 1NXPA 3DYVA 4AYWA 3KQVA 4P83A 4B34A 3PWSA 1QBGA 5J9FA 4H0NA 4K87A 1EFVA 2C9ZA 2NUBA 2X9QA 4FGZA 4XYGA 5E9AA 2BR4A 3BWYA 3S5JA 3T4XA 1G0NA 1JTEA 1F5NA 1DQYA 4XLLA 4QKQA 4EIWA 1QYIA 1CQXA 1OAAA 2FN4A 3KR0A 3NB0A 3IDSA 4O4HB 2W98A 1NLZA 4JV5B 2FSVC 1GDDA 1GG2A 4DLYA 2GVNA 5EFZA 3FPFA 2JCGA 4LIPD 3A0UA 1E6LA 4F97A 4YP7A 1S1CA 2PAFA 2E37A 4B6RA 4B7XA 3RRXA 3BXZA 3AL0C 5JNUA 2PWPA 3CPEA 1TU3A 1X8KA 1P3Y1 3LDAA 3ZHUA 3MLBA 1LDNA 2EV9A 3IO3A 1FVHA 5IH7A 2XKAA 5CLGA 4OAOA 1Q7TA 1UF9A 3JQ8B 2HRRA 1OTYA 4QPNA 2A33A 3W2TA 4DHEA 3ZZNA 5DO9A 2CLSA 2JA1A 2DWOA 2YHBA 4LBZA 2FRXA 3D2LA 1XMOB 3CNOA 3EMBA 1BVYF 1K2WA 3H5OA 3J81k 3LUAA 3NOVA 3PVZA 1I2CA 2C99A 3WNDA 2XOXA 3C39A 3KZXA 3MAGA 3QOFA 4E5VA 3DMDA 5CGZA 2BSQA 2IS6A 4WNCA 4CLEA 1AKVA 1Y8AA 2PMDA 3L04A 3IMGA 5HIJA 4BRWA 1IVSA 2ISCA 4JXKA 3KAJA 5GY7A 3T7JA 3D5TA 3S8EA 1BJTA 2XUKA 3FTPA 2Q5CA 3QVKA 4X63A 4CDGA 4EHFA 1UDCA 3ZE1B 4MS3A 2FP3A 1VIAA 2W6NA 2CZCA 3I2FA 4FHEA 2X8BA 3T95A 1FRVA 3OE1A 5C5IA 2P9YA 2IHJA 3KIPA 2ZULA 1SOWA 1CUIA 1I1OA 2Z04A 3ICWA 4AKSA 3TMYA 1U8TA 4B35A 1EQUA 1Q3HA 2E6UX 4Q24A 5IJXA 4D41A 4EUKA 1XXHE 4IIEA 2YXLA 3TAUA 1M8KA 2A9OA 4ZT7A 2EKZA 2QMOA 1FP7A 4M1ZA 1O0SA 2RFLA 3OPVA 1M0WA 4E14A 4YT4A 5CFNA 4D99A 1JIVA 3FJ1A 4XM0A 4JJKA 4IKEA 3X1YA 1JX6A 2ORWA 1T6XA 4EDHA 1E18A 3N0WA 2J67A 3A04A 4B4OA 3GVPA 6REQB 4D0GA 1TLLA 1LKZA 3V34A 1N4DA 2P2ZA 2D1SA 3GPCA 5HKAA 1I01A 4CDRA 1IAQA 2QX7A 3LSTA 3K0AB 2VJOA 2GYVA 3PEEA 4L07A 1EGQA 3L7CA 1SUCA 1ZOOA 3OECA 4X5OA 1N6LA 3W2FA 2GUWA 3D3WA 3DLPX 4HH0A 4NPCA 1EBBA 5AJVB 5DHFA 5A5GA 1BNCA 2OAQ1 1DUSA 5L3QA 2QJWA 1Y5NA 3KJHA 1XJ5A 4DGQA 2JA2A 1YJBA 2ZJOA 5J1TB 2ACEA 2VPYA 4KDCA 5F3RA 4Z1MA 4H15A 3DTYA 4F1WA 1G8JA 3PDIB 4EPVA 5B5SA 1P8AA 2QUHA 2XKJE 4O59O 2NXWA 4FDAA 4J0JA 3VNAA 5H1YA 4J7XA 3NVAA 2XW6A 1RHJA 1RIFA 2OAEA 4B9AA 4HNSA 3V9AA 4Q3NA 1W5AA 4KG7A 1GPLA 1BHO1 1X38A 3BZWA 3E5MA 4BNFA 3TOCA 1YA8A 4RX1A 4OQXA 4URVR 1ORWA 3C16C 3GJ3A 1SFRA 5D84A 4BGIA 4EW2A 1G9TA 2PLAA 1T24A 3I6MA 3CWZA 1FXSA 4GWKA 1BVRA 1KFKB 1V0JA 5B1IA 4BGEA 1SBZA 2JG3A 5LQSA 1CVLA 2OBXA 3AEUB 3F6CA 2ZRPA 1JS1X 4G8DA 4P54A 2HCBA 3A1VA 4EO7A 3RODA 4RVUA 2WWTA 2ZWOA 1JG4A 3NWPA 2I62A 3L4SO 3QXJA 1PZXA 2CMHA 3PC8A 3PNKA 2FHSA 2VYFA 4BPBA 3FPCA 4KXNA 1CY6A 3WV4A 2ZUFA 2WF7A 3ISJA 4HLUC 1VYHA 4B48A 2VPTA 4NICA 5TPZA 5K0BA 3RFVA 1A7JA 1VJ0A 3AJ8A 4C7MA 2TMGA 3C7TA 2K2WA 4ID9A 1KEWA 1K7XB 2FRDC 4E5PA 4I1IA 2V6BA 3S1LA 4C14A 2ZT8A 1OU0A 1Y8CA 2CLFB 4LYAA 3LMKA 3SP1A 1QJCA 2TMKA 4LI3X 1I7LA 4MQBA 4F5EA 3CLUC 3SS7X 1WL8A 4IFTA 3NV9A 2GVDC 4PC2A 3X1MA 1A5TA 2FTKE 1RYNA 1LZKA 1OZFA 3LTNC 4PRKA 3OCXA 4XUEA 3STUA 1ZQ1A 2J3QA 1WUKS 3AG6A 2FMKA 3VO9A 2JRCA 1ESNA 4L4RA 3P27A 4NHOA 2PN1A 2W43A 2OENG 5IARA 1K7EB 1Q74A 2X0FA 3NFYA 3T7EA 4CQLB 5C2JB 4YCLA 2HDNB 1MNQA 5FULA 1N5LA 4W8OA 4QHTA 2XDYA 3O4HA 3TD6A 4XB1A 2MSCB 2DBZA 2NTJA 3MJHA 5D5HA 4DXDA 1L7RA 5A9TA 3WP0A 4ZJUA 3IXLA 5FQNA 2HJ9A 4M54A 5FHRA 2AE1A 3DCIA 4F4FA 4JP3A 2OL4A 4UVDA 1MRNA 5M29A 4NSNA 1H4VB 4RV5A 1E3WB 1ENYA 2IXBA 2OHIA 2RMKA 4K1LA 5AOVA 4IEFB 3WLJA 3SY8A 5I7AA 1A4XA 1OIWA 1S7GA 4PLYA 3V80A 5HJEA 3LCUA 3T0IA 5JPDA 5DM2A 2CYBA 1G98A 1OWMA 1VDZA 1CUSA 1U9JA 5H70A 5SZKB 3GJRA 1M2VB 3UKJA 4B75A 4C78A 4RIIA 2XA9A 1LI7A 2UVPB 3U1VA 5IJ9B 2HEGA 1XNGA 3GIWA 2WZDA 1L3IA 2GEFA 4D4IA 3EXG2 2GFHA 5EZYA 4HO1X 4HAWA 2YVLA 3TLBA 3TEJA 1D2MA 2D13A 1USKA 2W71A 2HA0A 1XMQB 3LUKA 1C41A 3G13A 3EZLA 1K68A 2JFOA 2BLLA 3WP1B 4HUTA 1S8NA 2DAPA 2X15A 3C74A 5IK2A 4XIFA 3EWNA 1UJCA 1Z37A 4PEVA 4YPFA 2IP1A 4NEQA 4PNPA 4ZGBA 1NVKA 2EEZA 1QTIA 2GD0A 3EEIA 3K0CC 2AKEA 4R1QA 3WDMA 3IGFA 4OHOA 1NM5A 2WB4A 4PY2A 1HKUA 3C3AA 3HQ4O 1GZ3A 4PC6A 4KODA 3Q85A 3TUJC 4AZ3B 1MCZA 1YR2A 4YN3A 1SCNE 4MUHA 1SD5A 2MINB 2ZYWX 1T5SA 1XZAA 2RH8A 3FGZA 3H05A 3F6YA 4LWZA 2V59A 2OFOA 4KLZA 4GL2A 1E94E 3D0OA 2MSNA 3BDVA 3ND6A 1X87A 2BM8A 1NUSA 2GXUA 4IGFA 3OPNA 1A8PA 3GO4A 1KDVA 1HT0A 2R86A 5AW9A 1MKYA 4B5KA 2EBFX 2ZOSA 4JEUA 2XE7A 2OA0A 4Q7KA 4HDOB 1ZO8A 1FJHA 4KWCA 3T99A 1QP0A 2BV3A 2CZQA 2POCA 4Q1DA 3ETHA 5KYUB 1WS6A 1Y81A 2WG0A 5L8VA 1GUAA 3JY6A 5EEGA 1X0XA 2H2WA 4FS8A 2A5LA 4DQDA 1XZBA 1ESEA 4N03A 3E48A 2C92A 4N7RA 3OQIB 3D31A 1CE8A 5F2EA 3WICA 4HFNA 4BVEA 5K4GA 1RQNA 2NV0A 2ERXA 3EXHC 1YDMA 1Z0JA 5DV9A 1PK7A 1S02A 4BNUA 5LXTA 1QJ4A 5MN6A 1AB6A 1IHUA 2B3TA 2I0FA 4J0DA 1GU7A 2DG2A 1FY2A 5ISMA 3IEMA 2PGLA 1NKTA 1XRPA 4MUNA 3BPSA 4FC7A 2X4LA 3MT9A 4FD3A 3ETEA 4WCVA 5J2UB 1N1DA 5C7OO 3E9QA 4IV0A 5KNCD 5BRJA 3V2GA 3NHLA 1BXZA 1NMXA 5K3SA 1FJGB 3HC7A 2FEWB 3FCXA 2JFFA 4HWTA 4LG1A 4OP2A 3VJMA 3DEKA 1Z7BA 1OSNA 4U5QA 4CKWB 1II9A 4KWHA 1ULAA 1CUZA 3B6EA 3RE1A 2CFIA 2YWFA 4L5BA 3PIRA 4G5SA 4EZEA 1KO5A 2WJ6A 2BP7B 1GGNA 1SD1A 4YVFA 3MJRA 2OCBA 3AZPA 2F8SA 2WVHA 2YWDA 2FSSA 4I81A 7ABPA 1HE2A 4ZT5A 1NW4A 3QQ5A 1O97D 4ON9A 1DO8A 3CB2A 4I9GA 2B1IA 4FMDB 1LCIA 3FVTA 1KI3A 2V7XA 1DDOA 1N5JA 4WSOA 4ZVLA 1EVLA 3GAFA 4CKEA 4UFPA 3NBZC 2OVFA 3DE3X 5JD6A 1MDBA 5CA1B 1N5RA 1AKNA 4M1MA 3ZVMA 4ETNA 4DR7B 5GJBA 4OI4A 4D02A 2H06A 5H4HA 2JH9A 2ZJ4A 5KTSA 3AY7A 3GG2A 4J3NA 2O19A 5C5DA 2EHDA 2Q3EA 4GC5A 2JEOA 4C76A 3UJ9A 1LRKA 4FYJA 2B92A 3NYRA 3PCTA 4I8XA 2YJ5A 4HXYA 4JJGA 2CHEA 1X0VA 4IDQA 3CF4A 3EC7A 4E22A 4HI0E 1D0SA 3JU3A 4ESVA 1FEZA 3TI9A 2IWRA 5EP2A 3CH6A 3CY6A 2F3SA 5KOJB 3OUTA 2HZBA 1K27A 2JHPA 4K6GA 1E8MA 2PUCA 1NW9B 4YMUA 1ZM7A 1XDDA 3C48A 2G70A 2P2LA 2VPQA 4Y2YA 1M1NB 2H18A 3R6TA 5BW6B 3R7NA 3TINA 3TLMA 4J16C 2WUFA 4M1OA 5BN4A 7ADHA 4UMDA 3ZV3A 1CHNA 4NDNE 3NT2A 5EZYF 5CLJA 3K9BA 4K0KB 1PX2A 3SIRA 4X8HA 1OR8A 1EIWA 1P1FA 2B4KA 2I4MA 2YUTA 3OZGA 5CTAA 1C7QA 3MTJA 3MRTA 4Z9YA 4EGJA 1VL8A 3G5TA 1XCOA 2ZYAA 3IQZA 3PHBE 2XNCA 1VJDA 4GYKA 2XZPA 4N8SA 3R8FA 1PQYA 1F3OA 1SBNE 3O91A 5T57A 3L0ZA 4XVQA 4JDUA 1B4DA 3C1OA 3QI7A 1G18A 3ZH9B 1FVOA 4GPIB 1B1AA 1EFDN 1TRHA 2Q5IA 2FNAA 1GR0A 1AS3A 2XTNA 1NF8A 3F9CA 3HDVA 5K8LA 1JV2B 1O4WA 3U9LA 1NZFA 2CWWA 3S2FA 2Q7OE 3GMSA 5DYIA 4RTOA 2YBDA 5T3YA 1E3QA 3I37X 1NL3A 4R7ZA 3IMEA 3OPXA 2VXOA 3KJFA 3B51X 5A4JA 2D5BA 4PC3A 4RS3A 1K6IA 4XPZA 1ZGZA 3A1EA 3IR7A 3ZCXA 2J9FA 4B1FA 1HQCA 6Q21A 4DB2A 2ZXUA 1WHSA 4XJXA 2NUPA 2P0YA 3EWSA 3GAAA 4QRDA 3VSCA 1M2NA 2NV2B 2ONJA 2JIBA 2RGNC 2J59A 2VSXA 5AVJA 1RAEA 1M0EA 3VHQA 5HGXA 3O73A 4DEYA 4B43A 4B7AA 4BNTA 2AJDA 2REXB 3K30A 5AVOA 1XP5A 2LCIA 1XZIA 2DCUA 4OQLA 1TA9A 3RV3A 3F8WA 2GM9A 3K0SA 3UB4A 2PYDA 2ZBDA 3LHFA 4BO0A 2BEUB 2V7QA 1L6RA 5H8WA 3LA6A 2ZREA 3MELA 4H7HA 1N1GA 3B9BA 5JFTA 4W6ZA 3OQMA 3UAZA 1FQJA 2YRFA 4DLRA 4DR2B 4J9UE 3KO8A 5FL7D 3CS3A 4EJSC 3ZWOA 2RJNA 3MS2A 1YMQA 1FP1D 4P2BA 1I1NA 1A71A 1LJ8A 3PGLA 5TSDA 3H2GA 2BOVA 1RPJA 2K5UA 2PH5A 3BFJA 3MMSA 4GX0A 5TPWA 3PA8A 1VBNA 4KFSA 4P7JA 4C4AA 1A0OA 1E3IA 2NACA 3BWVA 5AUPB 1NMSA 4I6EA 2CLIB 5TS2A 2C97A 3IC5A 4TV8B 4L08A 5HGJA 1QH9A 3ZY3A 3DL4A 1O95D 1JHXA 2J87A 2AB0A 3NHMA 1LNZA 1FS5A 4PYQA 1HDIA 3FJYA 3MT7A 2WW8A 4H17A 1M1YB 3MFYA 4N3NA 2IY9A 2BHTA 4KYIB 1EUZA 3GUZA 4KXFB 4BEVA 1MO3A 4JR0A 4MNTA 1A9YA 3QUAA 4YCNA 2PWYA 3HFJA 1JEYA 4DC9A 3FDIA 4G5YA 1GGKA 4PGHA 3ZWWA 3C3DA 3K72B 2P4UA 3ZW9A 2JJ2D 2JKYA 4ZAYA 3LU1A 3B1YA 1T36B 1V8PA 3R4VA 1HQDA 2RHGB 3L05A 4Y2XA 5C8ZA 1HG0A 1N8SA 1Y1LA 5AIAA 4R1SA 8AT1A 1US8B 2WJ4A 1QAMA 2R5NA 1AXGA 1YQEA 3JRXA 2EXXA 4Z0HO 4QODA 3OZIA 3SOZA 3KR9A 3R2JA 2B36A 2ZIXA 5AUOB 3NHUA 3H19A 1FQWA 2WJ3A 2QEQA 4RUKA 3VVLA 3VZRA 4EABA 2LKDA 1PO7A 2BGRA 1E9AA 1VE5A 2FE4A 2FMHA 3EIUA 3HKDA 1ZSNA 3HV2A 2KMLA 2B9VA 2W93A 3UMYA 1ZR2A 3QELB 1YI0A 5P21A 2QV7A 3TZ6A 2QXYA 2WNHA 4W9RA 3RYFA 4YCJA 2WVJA 4F4IA 3AM4A 4KPYA 3U7HB 3DB1A 3BJMA 3JAMA 3FMGA 1EMDA 2XXJA 4HZUB 3M4JA 1YI8A 3A26A 1JA9A 2Q2NA 4WW0A 3TUIC 5IZCA 4HNQA 4QECA 1GQSA 3VR5D 2RDMA 5BMVA 3MJDA 2YHSA 1JQJC 2VHCA 4PC7A 4QNNA 3ZWPA 5IDWA 1KI8A 2IHBA 5FPHA 1L5NA 5TR9A 2OCKA 3L7OA 2C9CA 1EVQA 2J9GA 3KZ1E 3CX6A 4PNEA 5ADUS 4IQFA 1VFNA 3NORA 1R6XA 2XLBA 3EIWA 2XDQA 2XIQA 3EXEB 4I55A 5E4FA 1RRGA 4K26A 4US0R 3U7IA 2O05A 1GPWB 3U7FB 1IL0A 1OH8A 4YY3B 1EG2A 4LE2A 1B8OA 2FJ0A 3IB6A 3SHFA 3W04A 5B4TA 3IILA 2YN4A 4EM6A 5C32A 4Z3OA 2ZANA 2P68A 4JLMA 5I9TA 1EUQA 3L0CA 1CVRA 3MGBA 3T9BA 2NX2A 5ER9A 1KAOA 3A4MA 4ZO7A 1DQNA 3TNLA 4BECA 4OU5A 4AVYA 5EXSA 3WLOA 1IY9A 4BRUA 4Z4QA 1WMFA 2WJPA 3PFBA 1WB5A 2JHGA 3DAOA 1P3JA 1T9ZA 3CNHA 3B5IA 2MR6A 3I2KA 3KKQA 4ZT3A 5A71A 3R8XA 1BOOA 3TR5A 5K8IA 1Y4SA 1FQOA 1IATA 2YICA 4FCCA 4V2IA 5D01A 2P5SA 1H2YA 2VA8A 4ZXPA 3V7UA 4D2IA 1CEEA 4RU1A 2YWJA 3OT1B 1W85B 2Y99A 1P6UA 4B3SB 5CB4B 5DZSA 2CF6A 2GARA 1JSZA 3B60A 3QVUA 5F5LA 3R0IA 3D8UA 5KNBH 3KQNA 2A1UA 1TVKB 4K6CA 3CM0A 4G1FA 4NF2A 3AF1A 2X1MA 4HDMB 2DFVA 4KR2A 3CX4A 2CW5A 3AMVA 1E5QA 4QPJC 4XOUA 5A9SA 1YBMA 1HA3A 5IXJA 4PPFA 3N2GA 1YRYE 1TL7C 1GTSA 4YWJA 1U4OA 3UB3A 4R54A 4BFSA 3KT0A 1ZSYA 3LHDA 1P3DA 4NZOA 2GFIA 1D6SA 1Z29A 1SEVA 2CFTA 1MX9A 1S6YA 4QXPA 2HW8A 1M34A 2ZB4A 2AI3A 1T5BA 3DFFA 4LPKA 2H92A 3BN3A 3IQDB 1LBTA 3SNKA 1ONPA 3TB4A 4C07A 3F98A 1W36C 4C43A 1IQPA 4XFKA 2A9KA 3M5WA 4RIGA 3TLXA 1ZJJA 4TLMB 3FOEC 3TZKA 3H13A 3HN2A 3FB4A 4HTFA 1KMQA 4OHVA 2A0WA 5A03A 1ZD8A 3S44A 2OV4A 3K1JA 5AKEA 4H1TA 1GPAA 1PYOA 3N0TA 2AVNA 1UR5A 2OOSA 5EWJB 1P5FA 3PPWA 2ODEA 4CEIA 2ZKLA 2NP7A 3VZBA 2HK6A 3HLTA 2VDRB 2C2BA 3MCTA 2W70A 3DEZA 3R6LA 1RCTE 1KYZA 3KLOA 3TKYA 2P4QA 3JQAA 3WDLA 4EA6A 4L3OA 1MA3A 1G64A 2FWMX 3UJNA 5EKUA 1X1DA 3RAEC 1YVPA 3W5JA 5EIOA 5K45A 3PYLA 1I30A 1JZQA 1ADCA 1JXMA 3HCFA 1G60A 3IIEA 5ALXA 4FR2A 4MCJA 1XTBA 4L8VA 3WQSB 2N1BA 2FGJA 2CCKA 2GNOA 2PXCA 3DW1X 4YDRA 2BJWA 3VGJA 1T8PA 3T9FA 4ERXA 4EAAA 3INTA 3VOSA 1GUZA 1OYWA 3AF6A 1ZKMA 3A05A 5EAIA 2BUCA 3BMCA 3U80A 4EA9A 1MQAA 2JCBA 5HKKA 3INNA 5I4IA 5MGBA 1L7VC 3ZEIA 1PGOA 1LBQA 1NV8A 1Z63A 1B15A 1BDMA 3GLIE 4BNNA 4FNGA 3OJCA 1QO9A 2QVBA 2AG8A 2X42A 2PMCA 5IVD