3OP4A

Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. n16961 in complex with nadp+
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
247
structure length
247
Chain Sequence
SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
total genus 81
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2010-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3op4A00
5JDCC 3GC6A 4CMJA 1V6AA 3GAFA 1LUAA 4FQ8A 1E7WA 1J49A 4TVBA 5G2OA 3STHA 3L6DA 1E92A 3BTUA 2TMGA 4RQTA 4IDAA 4DQVA 2X0JA 5CDUA 3L6OO 1XA0A 2ZIZA 3VDQA 3ANMA 2VYVD 3CMMA 3M1LA 3V1TC 1UR5A 4XIYA 4KDFA 1C1XB 4F6CA 3GMDA 2GPTA 1KYQA 3DL2A 1ZK0A 1N9GA 1M66A 3KOUA 5EJ2A 1D1SA 1N92A 2AEFA 1OOEA 3EY4A 4R41A 4A5OA 1KEVA 3W4JA 4AL4A 4CR8A 1OI7A 1PSDA 4TQGA 5I8ZA 2YYYA 4BNKA 3ROKA 5C7OO 5I7SA 2AG5A 1DAPA 1DEHA 5COQA 4Z9XA 4OXKA 1WAMA 3ZNNA 2CDAA 4RZHA 1C1DB 2AHRA 2FSSA 1RM3A 3DHNA 1M75A 3DZHA 2CD9A 4J1NA 5A9TA 1CQIA 3VTFA 2OP1A 3E1KA 1PJ2A 1JAYA 3G3EA 1LDNA 1SOWA 3DQPA 4ZGWA 4NBRA 1DC5A 3JD3A 3ZH2A 4YJGB 5I7FA 1HXHA 1GQQA 1I8TA 1ZXLA 1HDGO 3ZWVA 2GO1A 4G5HA 1DB3A 4RPHA 3A28A 3RUAA 4ILKA 4MVJH 3ZW9A 1QV7A 4W6ZA 4QTZA 2B4QA 1U8FO 1GZ3A 2X4GA 1U4SA 3H9JA 2VRCD 3WWYA 3OJ0A 5FF9A 1E7YA 3B6ZA 1XYGA 4BO7A 3MEQA 4O5OA 1HSZA 4IMPA 4TRJA 4CMEA 4D3SA 5HRUA 4PLYA 4FD3A 3OICA 4DWVA 2WDZA 1BHSA 4JNKA 4A26A 1SCUA 4I1IA 4R01A 5G0UA 3PGXA 2OO5A 2C07A 1BRMA 2CZCA 3ZHZA 1HZJA 5JCJD 4NU5A 4QXMA 4RF2A 5T5QA 1UDCA 4GWGA 1H6DA 1LDGA 3PEFA 3ETGA 3GPDG 1TA4A 2GUGA 1WWKA 4OAQA 4RDIA 4WGGA 1T1RA 4FJ0A 4J1TA 1NVMB 4BNWA 4MP8A 4LCEA 1PGOA 2P5YA 4NQZA 1B26A 1LDYA 1ZMTA 3DDNA 5BNTA 4E5PA 1LI4A 2BGMA 1O6ZA 4N7RA 4WOJA 4JROA 3PWZA 5JS6A 4J7CA 1DLIA 1V8BA 4IUYA 3C7CB 4YJGA 2H5LA 5ENVA 2QRKA 5ILOA 3DFUA 3I6QA 3JQBA 5THQA 1LRLA 3OIFA 4I8XA 1ZK3A 3LDHA 4NJOA 4PGFA 1NFQA 1JKIA 1T1SA 3KEQA 5JAQA 3VPFA 4XGIA 5F1KA 2HRZA 1ADBA 5G0VA 4X54A 4J3FA 3UUWA 3I9JA 4FPXA 3U62A 4R1SA 2V6FA 3LVFO 3TSCA 2HKIA 3GR6A 2Q99A 3DONA 4G65A 1E1LA 4XA8A 3A1NA 4EITA 1NQTA 4WLUA 5JYDA 4XRGA 4B4WA 3IKTA 1WDMA 4UVHA 1JWAB 2C2YA 2B5WA 1MC4A 4I5GA 2WYVA 4RQUA 1RM4A 1Y8QA 1PWXA 3LC7O 1ZCJA 4O63O 1B15A 3VOSA 1TT5A 4R3NA 4PFJA 3DMTA 1PQUA 1V3VA 2D3TA 1WPQA 2UYYA 3ULKA 1ONNA 1CJCA 1JU9A 3K6JA 5JAIA 2PD3A 1GAEO 2Q45A 1GYQA 5B1YA 1YVEI 3U9LA 5ILGA 4J9UE 4YRBA 1HF3A 1NVTA 3NV9A 5KWEA 2UUPA 1UDAA 3GZ4A 2X9VA 3H3FA 1IHYA 3ONEA 1ZK1A 1YH3A 3NYWA 5L40A 1TVEA 4QO7A 3VHRA 4WJZA 2IYOA 1P9LA 1WW8A 5G4LA 1NBOA 4I9NA 1GZ6A 1KY4A 3S2EA 3U09A 5DOZA 2HMUA 3S8MA 2Y99A 2IRWA 4GX1A 5CEJA 2DFVA 5CPBA 1NXQA 5IDXA 2Q4EA 2UV8A 2ZYAA 2X9NA 2JHGA 2J3KA 1MX3A 4E4YA 3H9UA 3JQAB 2HK7A 2XAAA 1PGJA 3VH3A 3S2GA 3AUUA 2GLXA 1Q0QA 3NDJA 4W9NC 4WLVA 2DBZA 5IDYA 4KOAA 5JSFA 4IZHA 1CQJA 4BNIA 3VH2A 3PDJA 4MJLA 3RU7A 3BTSA 3FF4A 3OFSA 3WQRA 3C8MA 2YQ5A 1LC0A 4BNNA 3JYQA 1YGYA 3PHIA 4RPKA 2Q50A 4E6PA 4EGFA 4CODB 2GASA 3WMWA 3G49A 3GDGA 2W4QA 4PVDA 1M67A 2AMFA 2CNBA 3A06A 4BQPA 4E32A 4Z0PA 1DIBA 3LYLA 5DBIA 3TPCA 1ZJZA 2ET6A 2I65A 1PZGA 2C54A 2BFOA 3NGLA 4Z9YA 2J8ZA 4BV9A 3GN2A 2G82A 1OAAA 4DVJA 3SBOA 1KEWA 1CF2O 2HSDA 1I10A 4LVCA 2GSDA 2WD7A 4R5HA 4D0SA 1KVTA 2GZ3A 2RHRA 2HMWA 3BXXA 1T2EA 1JKJA 2DKNA 4NBVA 4BNLA 2FZEA 1LEHA 4BGVA 1H2HA 1U3VA 5CEEA 4HKTA 1R15A 2EW2A 2BMAA 4A2CA 2PH5A 5T8KA 1KERA 1X1EA 1IULA 1XGKA 1HDCA 2OUIA 4NG5A 1E3IA 4RV9A 9LDBA 2DC1A 1DC6A 5KCZA 4FFRA 1K3TA 3HN2A 2OHXA 3KEOA 3P5SA 1XR3A 3PFFA 1ZSVA 2P5UA 4NFSA 4MP3A 2O4UX 2NQ8A 4XZ3A 2B83A 3TWOA 2XXBA 1E7SA 2CVOA 3MJ4A 3UKOA 1HYGA 1DSSG 3T4EA 5ER6A 3ZU5A 3MOGA 3ROPA 4ZU3A 4RVHA 1KEUA 2YV2A 1X7GA 1BW9A 4II3A 5DP2A 1IY8A 2GRAA 3DR3A 4RCVA 2B36A 2A92A 4FGWA 1I24A 4YAKA 3QY9A 5HS4A 3VZPA 4CQLA 5JO0A 2BFPA 3AK4A 3E9QA 4D7AA 2J6IA 1G0OA 3IQDB 4URFA 1S6YA 2NQTA 4QEDA 1RKXA 2NNLD 3CEAA 4YDRA 2NTNA 4ID9A 1GTMA 1YL5A 3GDFA 3PYMA 3GOHA 4ND4A 2CFCA 3WSWA 3C85A 1J4AA 1XCBA 4Q39A 1I30A 4J4BA 1P45A 4I5DA 4IXWA 3JYNA 5KVCA 3AI2A 1XQ1A 3FRJA 3IIEA 4P4GA 4Y6RA 1MC5A 5AXAA 2Q1WA 1LXCA 3QP9A 4R1NA 2HRBA 3ONDA 4GGPA 2NU8A 4D0RA 2EJWA 4R54A 1AHIA 2YDXA 1GADO 3GEGA 3V1UA 1I33A 2VYVA 1XEAA 1BDBA 5TQVA 4RPJA 5ER9A 2EG9A 1LRJA 2IODA 3P2YA 1B8UA 5A5FA 2O48X 4ZN6A 2RBEA 4RF4A 1ZEMA 4D46A 2NVUB 1O95A 2RH8A 3DHEA 3OM9A 3KSUA 3P2OA 3PHHA 4ZHSA 4ALMA 1C3VA 1C14A 2RCYA 4O1MA 2WD8A 2C20A 3ORFA 2FPPA 2RH4A 3AY3A 1B8PA 3TZCA 1Y6JA 3TZ6A 5KJFA 1YQGA 3IJPA 3MOIA 4WLFA 5JO9A 2DVMA 1QYDA 3H8VA 3RFXA 3V2HA 4OJNA 4YVFA 2DBVO 3KB6A 3DZGA 4IBOA 3D5TA 1ZJYA 4HBGA 2EKQA 3ZN2A 1VL8A 1E3SA 2FOIA 3PJEA 2GN8A 4FW8A 3LT2A 1FF9A 3BMOB 5EQDA 4CLHA 4J1SA 1ZH8A 2HK8A 3ZWXA 1EQUA 4ND2A 5FI3A 2UUOA 3ZV3A 3ZWCA 3MWDB 1H9AA 2I9PA 1HKUA 3AY6A 3EAGA 1X14A 5L45A 4HFMA 2PNFA 4HY3A 4TRNA 5DZSA 3RC2A 4D79A 2FR0A 1JN0A 2C2XA 1ORRA 1Z75A 3E48A 1JQBA 3E9MA 4PZCA 4KP7A 4XQEA 4XYGA 3WQSB 3DBVO 2JAHA 2QZ9A 4A73A 2EP7A 4CM9D 1T25A 3WYCA 2PZKA 5HA5A 3JQ7A 3WTBA 4DPLA 1P44A 1M76A 1UP6A 4UUMA 1SEVA 1PEDA 1T26A 4BO2A 3ETDA 4DQUA 4R9RA 4BO9A 3GNTA 4KWIA 3WGIA 3O4RA 1K6IA 3WGOA 4GLLA 4AJ4A 4J0EA 1QV6A 4DMLA 3EMKA 3KUXA 3BA1A 4CV1A 2NADA 4Z6KA 4DC0A 3ZWPA 5LCXA 1QYVA 1XWFA 3L4SO 1EVIA 4A7PA 1G0NA 3UF0A 1ZFNA 4CLDA 1HT0A 4UAGA 7ADHA 1IZ0A 5IXYA 2FPGA 1CYDA 4IIVA 1PJTA 3QV1A 4YJDA 3T7CA 1WP4A 5CG2A 1XELA 3ZHBA 3CPSA 2WYWA 4Q3NA 4DMMA 2NU6A 1E5QA 4J0FA 4TWRA 4D41A 3N74A 3IOYA 4XX0A 3KLPX 1SBYA 4YT2A 3EZLA 1A9YA 3E5RA 2PGDA 1NHGA 3H65A 3D4PA 4CQMA 3GRPA 4II2A 4L9RA 5T57A 3CTMA 5JW6A 3ICPA 1Q0LA 1QRRA 2P9GA 1OC4A 4RVFA 3W8FA 4BV8A 1UXGA 4G81A 3I83A 1EDZA 3UOGA 4XJTA 2YFHA 2DUUA 2WTBA 1PJLA 3LF1A 1NFFA 3KSDO 4NU6A 2JCVA 4CJXA 1DDOA 3GHHA 3DO5A 3L6EA 1KOLA 5IN5A 3PWSA 1YONA 2HCTA 3TN7A 1FDUA 1PGNA 2R6JA 3LLVA 2D8AA 3BMOA 2VNSA 2AQHA 4M87A 3PJGA 1I32A 3PQFA 4BQRA 4PG4A 1H93A 3Q2KA 1PJBA 2EF1A 5BNFA 5A3JA 4OKIA 2DPHA 1OC2A 2D5AA 4N5LA 4QO8A 2WEKA 1U7HA 2YZ7A 1XLTA 4LVUA 1U5CA 1NWHA 3HDJA 1SC6A 4WLNA 4AJLA 2EKPA 4RORA 4W99A 1GY8A 1P1HA 4Y6PA 4EEZA 3L07A 4A03A 5DF1A 3NTQA 5K6AC 4KUGA 1ZUD1 3Q3CA 2BI7A 2J5RA 3FTNA 2D59A 1Y7TA 3NEPX 4YAIA 1CRWG 1GYPA 1TT5B 5BT9A 4PLPA 4CM4B 1JWBB 1DFHA 3GVHA 1QP8A 1YBMA 1BSVA 1V3UA 1P77A 3KYDB 3NAQA 4QFCA 3ZW8A 2GN9A 3EYWA 1KEPA 5EINA 5JC1A 3DBRA 2P4HX 2Q49A 3TFOA 3UCEA 3DZBA 3R0IA 1F8FA 4YJHA 4Z0HO 5KVSA 1SZJG 5KTKA 4DA9A 4NBTA 1LSUA 1E3JA 1QYWA 2D2IA 3OJFA 1N7HA 5L7TA 1X13A 1ADFA 3RQSA 3ZHYA 1DC4A 1OMOA 1V3TA 4AICA 1JTVA 4CV3A 3QVXA 4W82A 1EEHA 1Q7CA 4E5MA 5IDQA 3GVIA 1DIRA 3ONFA 1R37A 4RZIA 4BNGA 4GBJA 1NPTO 3HADA 1P33A 3JQFA 4ITUA 2Y1OA 4R51A 3PPIA 1EFLA 1GR0A 3F4LA 4OOFA 2O23A 4R4JA 1KVRA 4BB6A 4AFNA 2GD1O 3MJVA 1LTHR 3BMCB 5C7LO 1HDRA 1JLLA 4RL6A 3LT1A 1M2WA 5FI5A 3U5TA 3MJCA 4LMPA 2DTXA 1IOLA 1QORA 1U1IA 5HTOA 2IEDA 4YEDA 1I3KA 1KVSA 5T64A 4BNTA 1Z73A 1LQTA 3QWIA 4DC1A 5K6AA 2AG8A 3VPGA 2GR9A 2IZ1A 4A0SA 2DLDA 3RJ9A 8LDHA 1UZNA 5JDIC 3M6IA 4CM8B 3E8XA 4XQGA 1EUDA 4GL4A 1P74A 4GSLA 5ITWA 3TF5A 1LSSA 3QVOA 2D0IA 1D3AA 1WLYA 4W9NA 4XEHA 4ESOA 4MKXA 2JKVA 2YFQA 3PZRA 1DJNA 4A10A 1EBFA 3NRCA 1F0YA 2BH9A 1NAHA 4YXFA 4IQ8A 3PIDA 1C0LA 5ITVA 1BWSA 2C0CA 2CSUA 5H81A 4NK5A 5B4TA 2O7SA 3R1IA 1C0KA 4BIIA 1HDXA 2VT3A 3IJRA 3JV7A 3F5SA 2EJVA 2X8LA 3JQCA 1MLDA 3PHLA 4PG7A 2HLPA 4FOOA 1CERA 3TZKA 4YACA 1NTOA 5IJZA 3AM4A 4NZ9A 3RU9A 1JA9A 3FWZA 2TMDA 2Q1SA 1WMBA 3SXPA 1VI2A 4DIFA 1UXJA 3NJ4A 2H9IA 2V6GA 4ZA2A 1P1FA 4CV0A 1TB4A 3PFWO 3ZDFA 5TLSA 4FFMA 1ENOA 1AXGA 3CE6A 3JQGA 5DBGA 4WCFC 5BSEA 5A5EA 1ML3A 3OQ1A 3W6ZA 4LW8A 1Q0HA 1JW9B 3UGKA 3W6UA 1RJWA 2B37A 4IJWA 1DFIA 3OMLA 3NT2A 4YAJA 1EQ2A 4BKRA 3GHYA 3COSA 3CMCO 3CH6A 2NU7A 1YKFA 3QHAA 1O94A 5BNIA 3RROA 2FN7A 3U4IA 4YT8A 1EE9A 5ENDA 4BKQA 3I6IA 4M49A 4CMIB 5EERA 4YRDA 1GUZA 2HDHA 3PQEA 4WASA 5A06A 5L53A 3DAFA 4J6FA 3JQ6A 3HZZA 3BHJA 1MV8A 2VRCA 1AXEA 5DBFA 3OA2A 4I9HA 4LGVA 2JFFA 4Y98A 1XQ6A 3JYLA 4N18A 3UHAA 4OM8A 4WK6A 5JAMA 3VH1A 4IY1A 1DRUA 4NR0A 4B7CA 1R66A 2VUSA 2IZZA 4QECA 4CM7A 1I3LA 3Q11A 4L74A 4EUEA 2DTEA 4NHEA 4GX5A 1YQXA 3JD0A 2OL4A 3L77A 4WEQA 3DOCA 3WBFA 3HFSA 3UH1A 4J49A 2G17A 1NASA 4FFOA 3ZNOA 4RLSA 1E3WA 3E6AA 3GAZA 1P1IA 1XIVA 1YOVA 4BKOA 1UAYA 1YL7A 1HYEA 1NHWA 4E31A 5CDYA 3W4KA 1I3MA 5TT1A 3R6DA 1OFGA 1EDOA 5U4QA 4TRMA 4UEKA 3BZUA 4ZQFA 1IUKA 2DQ4A 1U7TA 4QFDA 3RBZA 3L4BC 1HYHA 4JJFA 3KBOA 1A9ZA 2ILTA 2GN4A 4L8VA 5JE8A 4LSWA 4YBZA 3H6KA 3WSVA 3H3JA 3HQ4O 4W7HA 5IDWA 3WLEA 4N5NA 3ZHXA 4PIVA 1LLDA 4TROA 4F6LA 1LNQA 1TI7A 4MIOA 3AM3A 4Y9DA 3U4DA 3N58A 4RVSA 5CP8A 1L1FA 3KYBA 3ADOA 2AE2A 3C1OA 3PTZA 4CMKA 5FWNA 2CMDA 4JX8A 2JFHA 2ZJ0A 4UUNA 1Y9AA 5EL0A 3CINA 4BGEA 4OIMA 3SLKA 3VC7A 4B8WA 2XOXA 1IZ9A 1EVJA 1ZSYA 2B5VA 2JL1A 3BAZA 3OA0A 4OXYA 3WNQA 1UP7A 2EIHA 1T2FA 1QYXA 3VKUA 2DPGA 4N5MA 4BNFA 3DWFA 1Y8RB 2EGGA 1Y5RA 4UEOA 4CUKA 3E5MA 4FS3A 2F00A 4L4RA 1WZIA 1BXGB 3GGPA 1H6AA 1AGNA 2GF2A 4HP8A 4L75A 1Y5MA 4ND1A 3L9WA 2VHWA 4F45A 4EJMA 2X86A 4CUZA 5DP1A 4WLOA 1T24A 2ZB7A 2PY6A 3A4VA 3JQ9A 5TRTA 2BI8A 3I9KA 4EZBA 3FR8A 2ZB8A 4OSPA 3ANLA 1YJQA 2PZJA 3ITKA 5DOVA 2JD0A 3CIFA 3U4CA 3C1TA 5IAAA 1N7GA 3OHSX 2JCYA 2LDBA 1K6XA 1VJ0A 5ICMA 4R68A 5CG1A 3IDSA 5LDHA 2WE7A 2Y68A 3GVPA 5EQFA 3QVWA 1A71A 3PJFA 5AYVA 4J1QA 4E12A 1M6WA 4B7XA 4B8ZA 4OH1A 3H7AA 1E3LA 3BMNA 4KQXA 3QLJA 5FEUA 3T7EA 1ISHA 4FB5A 1LDMA 5I9MA 4NIMA 3SX2A 3GH3A 1U3TA 3CKYA 2AEMA 4OXNA 4FIZA 2YHIA 3I23A 3I52A 1BDMA 2VWHA 4KWHA 3JD1A 4INAA 4WOKA 4DLAA 2W2LA 4OHUA 3AUTA 3D0OA 2CY0A 5I7VA 1X7DA 1KC3A 1FDSA 1UAGA 1ZBQA 1PGPA 1W73A 3OH8A 3FSRA 3GNSA 5DN9A 3ZCXA 1HE5A 3UVEA 1J0XO 4EDFA 2Q46A 2EGHA 4S1VA 1Y9EA 1ZNQO 2Y67A 3JD2A 2DBQA 3C7AA 1ID1A 2NTVA 3KYCA 5L7YA 3WXBA 5F21A 1H9BA 2QYTA 2OXIA 4RVGA 3ICCA 3ZWMA 1CIVA 5EESA 3JYPA 1GCOA 1XHLA 2GCGA 3ZNPA 1K2WA 4JXKA 4CMCA 4IQ0A 3KVOA 5C3MA 4XJSA 2EV9A 1Y8QB 1YRLA 3GZNA 4EJ6A 5F3RA 5CDTA 4ALJA 3H2ZA 3WGGA 2I66A 3ZU3A 1HE4A 1HRDA 4CMBA 2X58A 4WPGA 4Q9NA 4XGKA 4FC6A 1QR6A 5THKA 2HMVA 1RWBA 1SOVA 2X0RA 4KMSA 3ON5A 3EHEA 4PVCA 3NT4A 2BLLA 3DBRB 2EWMA 1NPDA 5JYEA 2CVQA 4DXHA 1SO8A 3WJ7A 4XIJA 4PG5A 2GZ2A 2Q4BA 4PZEA 1QLJA 2EERA 3PVZA 1SAYA 4AVYA 4CLOA 3AOEA 4BVAA 1GFSA 4JCOA 1AN9A 3ROQA 1YBVA 4RO0A 1LLUA 1JDJA 1PWZA 4YT4A 3ZV4A 3ASVA 4UVEA 4CM8A 1NM5A 2V65A 3WGHA 5AXBA 2P68A 1ADGA 1Q7BA 4CLRA 2D4AA 3WG9A 2FWMX 2VOEA 2PKQP 3SC6A 3WTCA 4E0BA 2E48A 4RJTA 4IJVA 4C7KA 2X0IA 4IGFA 4O59O 2VTDA 3B1JA 5GMOA 2Z1NA 3KV3O 3QVTA 4JLWA 3RC7A 4BO4A 2VNAA 3OEYA 1X1TA 1T2AA 1JKFA 3PK0A 5I9NA 4Z3KA 5GZ1A 2ZQZA 4ND3A 2R2GA 3RC9A 3VPSA 3C24A 3IMFA 3WDSA 5AVOA 2Y1EA 4FSHA 4BL5A 1GL3A 4AJEA 2OOSA 1J5PA 2GGSA 3FNFA 5KKAA 3PLRA 4PLVA 3RFVA 2P9CA 5F5LA 3I4CA 1WXDA 4C4OA 3I3OA 4PLTA 3CZRA 4YT5A 1MG0A 1SB8A 1CDOA 3GY0A 4D43A 3HJAA 1O89A 3ENKA 6ADHA 1WZEA 1MGOA 1UXKA 3WFJA 4NJMA 3GA0A 2OP0A 3GVXA 1PJ3A 4GVXA 1HSOA 1HLDA 4CLXA 4D42A 4K6CA 2O2YA 3IP3A 3PHGA 4C7JA 3QWFA 3DXFA 1T2CA 4M8SA 4YQZA 4BNXA 2QZZA 3E18A 1ENYA 3GZNB 3I9NA 3PYXA 5JPIA 5JBIA 4HADA 1NR7A 2X7HA 5TS3A 3OF2A 1ISMA 4CM4A 4AJIA 4BO1A 3ZWBA 4DPKA 3DZKA 4OMUA 5A9SB 1W0CA 3TOXA 1P1RA 2O4CA 3TQHA 1EVYA 1J6UA 2NU9A 4DLBA 2PGLA 3RFTA 4XDYA 5TNXA 1ZKMA 4GMFA 4WUVA 3F9IA 4IDBA 3VAZA 4MVJF 4NFYA 5JY1A 1VL0A 1BVUA 3NGXA 4LISA 1L7DA 3NKLA 4PRKA 3DC2A 4MVJA 4BMSA 5JMWA 4OQYA 2W2KA 4NH4A 4FGSA 3RAJA 4A27A 1JVBA 1N1GA 1PS9A 2RHCA 4HNHA 3U3XA 3H9EO 2G5CA 1PZEA 1QXSA 1VM6A 3O8QB 4RF3A 3JQEA 1U8XX 2P9EA 3FHLA 3ETEA 4XGNA 1QYCA 3I1JA 3JSAA 3TRIA 4MVJG 1LLQA 4HUJA 5JCJA 4D45A 2HAEA 1PU2A 5EIOA 4E5KA 4CV2A 5GZ3A 3AWDA 4YAEA 1H6BA 3B70A 2X6TA 3S2IA 3GFGA 3H5NA 1NPYA 4U6SA 4IGEA 3ZI0A 5JXWA 3CSDA 2FR1A 3TZHA 4NNJA 2ZCUA 4CLRB 4EUHA 3JQBC 3FR7A 2ZKLA 1FJHA 1SNYA 3EK2A 3FPCA 5CHEA 2PLAA 3PI7A 1GZ4A 1FK8A 1EFKA 3HE3A 1VPDA 4OGWA 3RWBA 2IXBA 2C59A 3NX4A 4L0QA 1ENZA 1NVGA 2I6TA 3G17A 4EBFA 2O3TA 4DTIA 2FHSA 3OEWA 4E30A 2P4QA 3ANNA 4DBZA 2NWQA 1VSUA 1GV1A 3BIOA 3RJ5A 4P4LA 1F8GA 3RKUA 5G0SA 4GSKA 4B7UA 1DJQA 1O0SA 3B20A 4CL3A 1E7RA 2DBRA 4BMVA 4MVJI 3VPXA 2YHUA 1PJ4A 3AUAA 2X0NA 1I3NA 1N9GB 3PZBA 2Z95A 5B4VA 2FPIA 1XSEA 3UN1A 1B3BA 1ISGA 2VN8A 1GEEA 2NACA 5DNAA 1O5IA 2VHVA 3Q6IA 4LMRA 3QVSA 5BQFA 1DRWA 1T4BA 2A4KA 2PR2A 3DFZA 4JQCA 4XB1A 1PJCA 2R00A 2X23A 4Y8VA 2E37A 3U4HA 3WIEA 1KS9A 3P7MA 1SB9A 3D64A 3H2SA 2FP4A 3DBLA 1HDZA 3JQAA 4WNCA 4EYEA 4J7UA 1C0IA 2E4AA 4I9UA 5TSDA 4IXTA 3WGTA 5I7EA 5L9AA 1RPNA 2YHIB 3UAGA 4L76A 4RDHA 4B3JA 4BKPA 1FDWA 3ZNQA 1KVUA 2AXQA 4EI2A 1Y81A 2GNAA 1ZK4A 4BMNA 1MP0A 1CWUA 3AJRA 4J2OA 5AQ1A 1VKOA 3HN7A 4BNZA 4N54A 2W8ZA 3S55A 2OZPA 3BMNB 2O3UA 2VZ9A 4PZDA 4XWYA 1I2CA 4BNVA 1VE9A 3UCXA 8ADHA 5GZ6A 1PZFA 3HDQA 3JCZA 1ZO8A 1ZSNA 1HL3A 3GDOA 1NQAO 1I2BA 4OO3A 2I67A 1NX6A 3RCBA 2OGUA 1LQUA 1ZK2A 3DBHB 2J3HA 5A4DA 2V6MA 4LSMA 4JP2A 3WS7A 4KTVE 1GDHA 2IXAA 3O03A 2OBNA 1X15A 4RVUA 1ZZEA 2C7VA 5TGDA 4R69A 2WWRA 4TSKA 1HWYA 4WEOA 4OYRA 4AJOA 3JQFC 3ZWAA 1HEUA 3WX0A 3DBLB 3DOOA 1E6WA 4LK3A 2Y0DA 1U3UA 2RIRA 1GV0A 2QHXA 4XYEA 3RBXA 1YDEA 3EW7A 1XKQA 3INRA 3D3EA 5HM8A 4IZIA 4W7IA 3U49A 4MIEA 3EZYA 2ZTMA 2A94A 3D4NA 2NSDA 5ES3A 4P8RA 3L4BA 4CQLB 1UXIA 1IE3A 3ASUA 1X0XA 4Y67A 1YO6A 4RLHA 3K2EA 4DGSA 4H3VA 4B3IA 4NFHA 3ADPA 1EBUA 4PCVA 4CM3A 3NUGA 4AJPA 3VPHA 1D7OA 2X1HA 4OOEA 1NFRA 3LU1A 2X22A 2DUWA 3KRTA 5JDIA 4MKRA 2XXJA 1NWCA 4WECA 4PLHA 1F14A 4HXYA 1PS0A 4R3WA 1PR3A 3UICA 4FJ1A 5G4KB 5LC1A 1KY5A 3S2FA 4RF5A 4CMAA 5JDCA 5EN4A 3WWZA 2VT2A 4CMGA 5A02A 2Q1UA 1MFZA 4I5FA 5HWSA 1R16A 3VZSA 5COAA 1LLCA 1ONPA 1BTOA 3M1AA 3NTRA 3OETA 2OFPA 2VHZA 3GF4A 5CPFA 4NBWA 3BMQB 3GRKA 3RI3A 3W8EA 3A14A 4PRLA 4BB5A 4GVLA 3EDMA 3W1VA 4CR7A 3NTOA 2B4TO 2DT5A 3OJOA 3E03A 4BOYA 4PLWA 2POQX 1PS8A 2Z1MA 3GEDA 4QUKA 1NR1A 3K8ZA 5L4NA 2PGJA 3BHMA 1FMCA 1EUCA 2HMSA 3JTMA 2VYND 2GDZA 4BNUA 4LCJA 1ULSA 1TEHA 3DMYA 2W98A 1ZEJA 4HFRA 4DLLA 3MTGA 3GNQA 3ABIA 1HDYA 2Y1GA 1DHTA 5ADHA 1Z45A 1F06A 2W90A 4M1QA 4MDHA 1QKIA 3VZQA 4DUPA 3K73O 3EUWA 1I2ZA 2HJSA 5T8KC 1NP3A 4MO2A 4ROSA 3F46A 3OJLA 3NT5A 4BNYA 1ADCA 5DT9A 3G0OA 3QSGA 4HWKA 4E21A 1YJ8A 2VHXA 4CL8A 3DAPA 4I5EA 3WB9A 1AUPA 5KJEA 4D3DA 5AXCA 1P1JA 4CM6A 1EK5A 3SC4A 5C5IA 3MZ0A 4TVOA 3RUCA 3ST7A 3H9QA 4YR9A 4Q3EA 1K0UA 5KNLA 4YJFB 1ZMOA 2FR8A 3AY7A 3DHYA 2NV6A 4Z0TA 2AE1A 5DCUA 4JP3A 1BMDA 2PKRA 1X7HA 4Q3AA 3NDIA 1ULUA 1ISIA 1VL6A 2I99A 3D3WB 3ZWOA 5I8WA 3MJTA 4UVDA 4ONEA 5L51A 4KUEA 3WR5A 1SMKA 2GZ1A 1FXSA 3RIHA 3GFBA 3ZWYA 2X5OA 3OQ6A 5JLAA 3WBBA 1HE3A 3OECA 2HO5A 3UCFA 1PIWA 3IUSA 5JAZA 2PH3A 1R0SA 5IZ4A 4R1UA 2Y0CA 4DYVA 1GEGA 1E6UA 2EXXA 2VWQA 1RYDA 3H9GA 2Q2WA 4KUHA 1JAXA 1ENPA 1F17A 2VUUA 9LDTA 3MWEB 4MPDA 3FWNA 5G0TA 3BHIA 5TF4A 2B69A 1Z7BA 2ZYGA 3AU9A 1YBAA 3IS3A 3RBVA 1HTBA 3F47A 4IJUA 2ZB4A 4DBVO 2ZB3A 3RASA 2BD0A 4Q3CA 2G0TA 1V0JA 3GPIA 1DIAA 3PIIA 1LSJA 2A35A 3DAGA 2I3AA 1P0FA 3QE3A 1TLTA 4TKLA 2B35A 4WCDA 2H6EA 4UVGA 1TT7A 4GX0A 2FZWA 2QX7A 2WMDA 4MINA 1B3RA 3AFMA 2DM6A 3RUEA 1VKNA 2IYPA 4JIGA 1K6JA 1C1XA 1YXMA 5KJ1A 4DL9A 1O8CA 4XKJA 1PL8A 3WYBA 4RPLA 1E1NA 3LT0A 4W4TA 5TX7A 1PQWA 1VSVA 3EVTA 4IDDA 2WD7B 4QSMA 4XYLA 3DTYA 1B16A 3WJAA 1GCUA 2NM0A 2X5JO 1Z6ZA 4GWKA 4QX6A 5A1TA 5IF3A 4U5QA 1GD1O 5H82A 1B7GO 4YTEA 5KJCA 3S1LA 3PGJA 5BSHA 4FCCA 4CM5A 3WLFA 4R16A 2GERA 3SVTA 1YWGO 2JD1A 4J4HA 3LZ6A 1H5QA 4MIYA 5K0ZA 2QIOA 3OBBA 2O3QA 4M55A 4OL9A 3WFIA 4ALLA 3D7LA 1LA2A 4M86A 3FNGA 1U5AA 1HDOA 1VLLA 1R12A 2VYNA 2EP5A 3DEYX 4XRRA 4YJHB 1E3WB 1BW9B 1U3WA 3GEMA 1I0ZA 1WMAA 1BXGA 3LQFA 4B3HA 2WE8A 1DOHA 5L4LA 1E6EA 3AM5A 2D5CA 4L4XA 5CFZA 1YS4A 3FNEA 4XYMA 4WKGA 4CR6A 4ZQGA 2LDXA 5JFOA 2CF6A 3AW9A 4YJFA 3KM0A 5T6BA 1B8VA 1Z7EA 3GLQA 1AHHA 3F3SA 1LU9A 3MCVA 4ZQHA 4BHTA 5U1PA 1V35A 4UUPA 2YUTA 2Y1FA 3TL3A 3U0BA 1M6HA 2YY7A 3RUDA 1Z82A 2DAPA 3HFGA 3DOJA 3M2TA 3WYEA 3BMCA 1HETA 5BR7A 3RUFA 3K9QO 4MOWA 5A3VA 5B12A 4WCFB 1D8AA 1RYEA 2FY8A 2JAPA 1IPFA 2ZQYA 3KLMX 3UXYA 3Q1LA 3V5NA 1F12A 4HX5A 2X5KO 3RKRA 1IYZA 1K89A 1PL6A 4IINA 4K26A 4K6FA 3L0DA 5IFLA 2G76A 5K9ZA 3GT0A 2ZTVA 4UUOA 1DPGA 2Y05A 4JK3A 1SEPA 2DU8A 3EVNA 1LDEA 2Y0EA 1EMDA 5KKCA 1H6CA 1AE1A 3FBGA 4B4VA 5KIAA 4ALIA 1T4DA 5TJHA 2ZK7A 5G0WA 3AI1A 4CPDA 3G79A 4JJGA 1E5LA 3Q2IA 2Y1DA 3AU8A 2C29D 4YAGA 4RPGA 3JQ8B 1U9JA 2Q3EA 1N5DA 4PLZA 1KVQA 2G1UA 2ZCVA 2O7QA 4R9SA 3KYCB 3ENNA 1ZW1A 3LK7A 4XR9A 5JY6A 3RVDA 4PN3A 1U2GA 1UZLA 3WNVA 1MXFA 1U4OA 1DAOA 5AXDA 4E2WA 2Z5LA 5CDGA 1PX0A 3GQVA 4K1LA 3QA9A 4EW6A 1PJSA 4E5YA 4JBIA 1ISJA 7MDHA 2H63A 4JGBA 5L95A 3O38A 1MXHA 1DO8A 4XDZA 3Q9UA 4KDEA 1I01A 1TXGA 2ZTUA 4FR5A 2O3SA 1OBFO 3JQ7B 4P4NA 4BO0A 2PD4A 4I08A 5IXSA 4FFPA 2WM3A 2PZMA 1E0DA 4P22A 2OORA 3LSYA 3N7UA 3NJ8A 4FFNA 1MA0A 3R3JA 4OKNA 1U2DA 3V1YA 5L4SA 1DXYA 3F1LA 3X2EA 4CMEC 1NYTA 4FDAA 4GPD1 4ND5A 1HE2A 2VWGA 3W4IA 4J7XA 3KXDA 2QW8A 4L4SA 3PRJA 4ALKA 3CZMA 3JQ9C 1NAIA 3LC1O 4GKVA 4J4TA 4LN1A 2YW9A 4DPMA 3G1TA 2AQ8A 1Q7GA 4UULA 2C5AA 5TT0A 3VVCA 3PWKA 4KZPA 2AA3A 1GU7A 3I9LA 1P31A 3JYOA 4Q3BA 1VJ1A 5CEFA 4E5NA 5C37A 2XPCA 1QLHA 3KHUA 2I76A 2E82A 4CM9A 3GVCA 3OP4A 2J3IA 3HSKA 2VUTA 3B1FA 2H1SA 3F1KA 1XU9A 4IDCA 2VZ0A 3KSZO 4Q3DA 5KJ6A 2QG4A 5G4KA 4JJIA 3O26A 3PQDA 4H15A 5JNLA 1GQYA 3F6YA 4E2YA 1H2BA 1V9LA 2NTJA 4ZRNA 1ISFA 4R1TA 2BGLA 1YB1A 2PZLA 4GGOA 3E82A 2UDPA 1EE2A 2ZJ1A 4ZJUA 3ITDA 5F5NA 3VDRA 3KYDA 5CDSA 2BKAA 3I4FA 4UREA 2Q2VA 3HHPA 5DCWA 5ICSA 1K5HA 5A05A 4F3YA 3FI9A 4GQAA 3UFXA 1NNUA 4DREA 2VQ3A 3PLNA 4LRTB 3RD5A 3INTA 3HDHA 3QIVA 2PTGA 2VZ8A 1R6DA 3GG9A 2IZ0A 4YQYA 4B4OA 2Y1CA 3FNHA 2YV3A 4TMFA 3JQ8A 4EJ0A 1NQOA 5MGBA 1PL7A 4PG8A 2F1KA 5KVQA 4Z9FA 4NK4A 3HNPA 4BO8A 4OSOA 4P38A 4NMHA 2JFGA 1DLJA 2VWPA 1UH5A 3PYLA 4O0LA 2I5PO 2J5KA 3LT4A 3JQAD 4D44A 1E3EA 4ZQBA 4B4UA 1ONOA 4GMGA 5GY7A 2BHLA 4ZICA 1R0LA 1YE3A 3IC5A 2NVUA 2WYUA 1PGQA 4GX2A 4IJKA 4U7WA 3M2PA 3PP8A 2NUAA 4FC7A 1MUUA 1BVRA 3OQBA 2O50A 2C82A 2V6BA 3G1UA 4E2XA 4YRAA 1B14A 1LBEA 2EKLA 3H4VA 1GUFA 2HUNA 3F4BA 1PZHA 1Z74A 1E77A 2PA3A 3ZZNA 4DIBA 1LDBA 3P19A 5DULA 1VC2A 5T67A 3AOEC 1PJQA 3A9WA 4IS3A 4BNJA 1EUZA 4B79A 2IEBA 1UZMA 3WGYA 3WOHA 1XG5A 1UP4A 4BGUA 2Q2QA 1R4MB 1B2LA 1P1KA 3JQDA 4ZQEA 1KETA 4YYZA 4J2HA 3IUPA 4YB8A 5IN4A 4S3MA 1ZXBA 5JC8A 1EZ4A 3SJUA 1C1DA 3QWHA 4NI5A 1FDTA 4FOSA 3HB5X 3R3SA 4Y6SA 1LX6A 3QWAA 4ZD6A 3T4XA 4QQRA 3AUSA 2O3JA 4IDFA 2HMTA 3FD8A 1QG6A 1XDWA 3KTDA 5FYDA 4GKBA 2J3JA 1DFGA 1N1EA 2JCXA 1EVZA 3DZFA 3VH4A 1ZIDA 3PJDA 5FFFA 3AFNA 5F1OA 4YA6A 3WQQA 4IQGA 4XQ9A 1N2SA 1IPEA 2AQKA 4IM7A 3WGQA 2NVWA 4BGIA 2BF7A 4AJJA 1I36A 3MTJA 2A9FA 3V2GA 2BGKA 5L7WA 2ZYDA 1XU7A 4E33A 3SJ7A 4E13A 3DTTA 4NDNE 4WE3A 4UEJA 3TFQA 1D4FA 1E1MA 5DCYA 3V2UA 4AJ1A 1YL6A 3K30A 2EEZA 3SEFA 1A7AA 1Q1NA 2HK9A 3IAHA 4ALNA 3CXRA 3FBTA 1DBVO 4TZTA 3D1LA 1A72A 3K31A 4MVJE 5EPOA 5COBA 3BYZA 3W8DA 3WMXA 3C1AA 1A4IA 3TOZA 4DIOA 5U9CA 3D4OA 1NQ5A 3HDYA 3QJ5A 1N8KA 3C3XA 3L9XA 1Q2XA 4L73A 5B37A 1OZAA 4FJ2A 3WIDA 3VTZA 1HZZA 4MVJD 4BNHA 3GUYA 4GAEA 1BXKA 1YDWA 5TC4A 3BTOA 1A4UA 5J23A 3GN1A 4GH5A 4AG3A 4J90A 2BRUA 3GUCA 4Z3DA 3BTVA 3ZV5A 5F1PA 4MP6A 1YB5A 4AJKA 3I9OA 3INGA 3PHJA 4D3FA 1GQ2A 4CM1A 2DFDA 1KIFA 4EUFA 3D5QA 2YJZA 3GGOA 3RUHA 4U0JA 2CF5A 5IZCC 5TIIA 2V7PA 4J9VA 3K5PA 2RAFA 5EMHA 1E7MA 1LSOA 3D3WA 1EK6A 4CLOB 4LRSB 4PLCA 1WDLA 2D1YA 1UDBA 2B4RO 2QQ5A 2JHFA 4G2NA 2UAGA 1W6UA 1S7CA 5LDGA 2VRBA 2AW5A 3QQPA 3DZJA 1DC3A 1ARZA 2AQIA 4FBGA 1MFPA 3LC2O 3VVBA 2X9GA 4EEXA 3RSHA 1E1KA 2FMUA 2R00C 3AOGA 4BKUA 4CMIA 5A9RA 3UW3A 1IHXA 2FRDA 3ZU4A 1ZVMA 1H94A 4J16A 1A7KA 4IS2A 3DBHA 5BSFA 1UXHA 3FTPA 3I5MA 2JJYA 1P0CA 2HU2A 3Q9NA 2GN6A 5KVVA 3QWBA 1WDKA 2BFMA 1C0PA 4BUCA 4WCFA 2VOJA 4TRRA 3IKVA 2PFGA 4NPCA 3VKVA 1UUFA 4IDEA 4J43A 4MVJM 3NDRA 2BELA 1U28A 3K2BA 1G6KA 2O2SA 3GGGA 4ZRMA 3ZWWA 1YOVB 4JN6B 1BXZA 3EGOA 3C7DB 3KO8A 1JVSA 3VZRA 3H5RA 1WNTA 2GYYA 3IL2A 4BS9A 4XYBA 1PR9A 1G1AA 4MVJP 6LDHA 1KC1A 1A5ZA 1IL0A 1UJMA 2BFAA 3GG2A 3DB2A 3TDKA 2CDCA 3PDUA 3FPLA 2YV1A 2PWZA 3Q0EA 3DZIA 1P3DA 4R5MA 1YQDA 4NJMB 3RC1A 1X0VA 4XB2A 3IP1A 3HUDA 2ZATA 2O3RA 1Y8RA 4HNGA 5KOIA 2Y66A 4QT0A 1MB4A 3FCOA 4M89A 4JBGA 1I5RA 4XD2A 2WSBA 3RUIA 3B1KA 2B0JA 4DQXA 5IZCA 4HV4A 3PXXA 3K92A 2QRLA 1Y1PA 2EW8A 1DIHA 4U0KA 4HFJA 3OIGA 2UVDA 4CLEA 1LC3A 3QRWA 2E49A 5HS6A 1PQPA 4GI2A 4KQWA 1D1TA 3JD4A 3K96A 1GYRA 1FDVA 3HWRA 2PD6A 5C7IO 3MJSA 4DRYA 1HLPA 3QW2A 4M54A 1R4NB 1BG6A 5A9SA 4IDGA 4BO5A 3TZQA 2QYSA 1B0AA 4BO6A 2PV7A 3HB4X 4F46A 3ZV6A 5I9LA 4HFNA 4YCAA 4CMHA 2Q1TA 2CUKA 2W2KB 1CETA 4PLFA 5JMPA 2YQ4A 2C5EA 4IMRA 1RM0A 4AJHA 4CQMD 3O8QA 5TJ9A 1KBZA 3EC7A 4XR4A 3LF2A 5B4UA 4E3ZA 3ROMA 4BO3A 4RVDA 2IE0A 2P2SA 3LLSA 2CDBA 1GPDG 3E9NA 3TJRA 4CQMB 3GMSA 5MDHA 4UVIA 2E6UX 2W2LD 1VJTA 4YPOA 3OIDA 5BSGA 4H7PA 4ZVVA 1GUYA 4TKMA 2CVZA 2VTEA 4DYDA 3GK3A 4AJ2A 1H0KA 1LRKA 1MG5A 1WVGA 2JD2A 3O9ZA 2I3GA 1L7EA 4E2ZA 1A27A 4YWJA 4IPTA 1PTJA 2NVBA 4FFLA 5AOVA 1VRWA 1DHRA 2PKQO 5A03A 4TZKA 3ZGYA 3OJEA 4MKZA 3WICA 3JQGB 4FN4A 5HBRA 2EHDA 3AI3A 3I9MA 2HQ1A 5IG2A 2DTDA 3DMTC 4NBUA 1CEQA 1R4NA 2Y93A 5H83A 1SPXA 4PLGA 4CUJA 1YB4A 2ZTLA 2HJRA 1DIGA 1E7QA 5DDIP 4BNMA 2P91A 3H5AA 4U6QA 1W8DA 3TNLA 3BMQA 3CUKA 4O6VA 5A04A 5CAEA 2AEJA 2SCUA 3SLGA 2VCYA 3V8BA 1R0KA 1BGVA 4GLOA 1QSGA 1T2DA 2IDZA 2YDYA 4OQZA 3KZVA 3TL2A 1QMGA 3WGZA 2XF8A 1GPJA 1R4MA 4IIUA 4XQCA 3ZWNA 2WJPA 2OBYA 2VHYA 3HG7A 3OSUA 3MJEA 2J5QA 4K28A 4KTTE 4J91A 2C7GA 1DRVA 4H16A 1IB6A 4U8GA 2NLOA 3F5QA 5JCXA 3KETA 2FSVA 2QRJA 4K9DA 5L3ZA 4RGBA 1LJ8A 1O9BA 4WLEA 3ZU2A 4WNIA 4JBHA 3X2FA 4AJNA 1W4ZA 1RM5A 3FN4A 4PG6A 4XCVA 2OMEA 2PK3A
chains in the Genus database with same CATH superfamily
1WZCA 3K0FA 2NYVA 2I3BA 2HV8A 3O82A 4MGIR 4BAZA 3EF3A 3AY0A 1REQA 1LV8A 1RI1A 4M98A 3GAFA 2CUNA 1E7WA 3L6DA 1C30A 2QN3A 5K3CA 4DQVA 1ZUNB 1E8NA 4ZXFA 1UBMS 1K7SN 3RRXA 2J3LA 1OILA 1QIDA 3IJEB 4R1OA 2VYVD 4QNRA 4H59A 5LA6F 3MGKA 1P3Y1 3A6JA 3HDGA 1DBQA 3OC6A 4ZTBA 2HRRA 4J16C 3W5VA 3L8DA 3BBLA 3KQOA 1YK0A 1CUVA 1N9GA 1PAUA 1ZK0A 4U2CA 5D6OA 7YASA 2O8EA 3KOUA 1FQKA 1SXJC 5FHQA 2QMZA 5LKRA 2AEFA 1E63A 3Q7TA 2WNIA 1T6XA 1WPRA 1C1YA 1GG5A 1DKPA 3B53X 4R41A 4QASA 3W4JA 4A5OA 5EGSA 3IRUA 2VAMA 3QKWA 5CT9A 4RKWA 4BNKA 1MAUA 5FAXA 3ROKA 2HJ9A 2YMLA 1B0ZA 3B36A 2AG5A 2BTOA 2VXOA 3NWOA 2EWVA 4Q3KA 4YCBA 4X6LA 5CBPA 2AC7A 4D8YA 1WAMA 2FWAA 3B8EA 4EL5A 2CDAA 3DE1X 3G85A 4EFDA 1HZZC 3W5BA 1R9NA 1RM3A 3KLNA 4KLCA 3UC5A 3B1XA 2CD9A 2QT1A 1TGYA 2QVXX 4J1NA 4MWDA 4AY2A 2X76A 4ZOQI 4F4IA 4B0OA 1U11A 1JJVA 2BR5A 3DV0B 3E1KA 3S8EA 5ELLA 3QTBA 1IVNA 2ODEA 3T3EA 1YBFA 5K0TA 2FX2A 3DQPA 1J25A 3ENZA 5ICMA 4PSVA 3S5JA 1I8TA 5CM8B 3ZWVA 1HDGO 1G3IA 5BW8A 3AF6A 1DB3A 4ID3A 2NUTB 4NOLA 2HIAA 4ILKA 4E14A 3ZWKA 3ZW9A 4W6ZA 1XK7A 3B1YA 1GZ3A 1STOA 2XWPA 1FYWA 1U4SA 4MMYB 1NC1A 4YP0A 2VRCD 2K6GA 4MGYR 3OHMA 1Q74A 4MS4A 3D3JA 5I51A 4BO7A 1SVNA 3MEQA 2FX3A 4O5OA 4TRJA 4OQFA 4Q24A 2VHUA 4P7BA 5A2GA 2JLXA 4PLYA 3TXXA 4FD3A 4AMBA 1YHNA 2DPYA 3B7WA 3TEFA 1M6VA 2F8SA 2QBYA 3CZ4A 4HN9A 1NC3A 1RXEA 2A0YA 3AB8A 4NJEB 5G0UA 1CX9B 1WMSA 2GH1A 1O9GA 2Z09A 2UUAB 2OO5A 1R2QA 1RYYA 2C07A 4LQDA 2C99A 1HPLA 4N3NA 3EXIB 3QFFA 1A9QA 5JCJD 1O2DA 3PFCA 4QXMA 4RF2A 2EKZA 1UDCA 4GWGA 1H6DA 3GJ3A 1OFUX 2Q6LA 4DJFC 5AK5A 4U3JB 3GP3A 3VO2A 3ROFA 2C58A 2JGEA 3JVDA 1U2ZA 3SI7A 1NVMB 4MJ7A 4FWTA 2P9QA 1PQ4A 3OKPA 3O4HA 4N6NA 5IVKA 1AQYA 4X7MA 3CLKA 1AGRA 1Z25A 3H5VA 3KCQA 4NQZA 1ZMTA 4OLHA 5FKJA 1KNQA 2FW1A 2QTHA 4G0QA 4PRZA 4E5PA 1MJFA 1Z7YA 2DHRA 2O1XA 4JROA 2X40A 4ETNA 4HNTA 1W4AA 2G71A 4DBLE 4C76A 4C4AA 3EQ7A 3B85A 4C0WA 3AJ9A 4CTKA 1A4RA 1V8BA 4IUYA 1LPPA 5BYAA 5CITA 2F8MA 4OUDA 1VP9A 2ZS9A 2O20A 5C4GB 3EA0A 3VXKA 2X8AA 2M1ZA 4YCDA 1K5PA 1NN1A 4Q66C 3DUWA 4TWIA 2QRKA 3STYA 1IAQA 3ZIDA 3DFUA 3BRWA 1LTQA 3GLKA 3OIFA 1G20A 1S5PA 2JIBA 3ENVA 3QU2A 3B78A 4NJOA 4PGFA 4P9NA 3ZJVA 1T1SA 3VPFA 1ZGJA 5F1KA 2J3DA 1G17A 1IWOA 5J9FA 1PEYA 1F9AA 5THXA 4J3FA 1AKRA 2X9LA 1YR1A 3I9JA 4FPXA 2WNHA 3UUWA 3U62A 3WI7A 5I4IA 3TSCA 2HKIA 2ZBDA 5K4AA 5KQRA 4FYVA 5E1BA 2ZIEA 4NG4A 3OPQA 5JXGA 1XAIA 3GYGA 4D4MA 2QAGB 1Y3DE 1YZLA 4Y6OA 5T4EA 1NQTA 2BDTA 2ZUWA 3TLBA 4LX8A 4TMVA 4F04A 2VP5A 3IKTA 4NCAA 1L5OA 1LZLA 2YXLA 1MC4A 3UMMA 2G8NA 3IDAA 2NMVA 2RAPA 1UXOA 4IRMA 2WYVA 1BFUA 1PQYA 4C01A 1I6LA 3AHFA 3FZGA 3LUBA 3LC7O 5BYBA 4Z0NA 4IDHA 3U3ZA 4BBAA 3EDYA 3VOSA 4NFLA 2YR0A 4FEEA 5JQWA 3CNEA 1QVZA 2VNJA 1C4XA 3GMIA 2XKAA 1BOFA 1PQUA 2EKBA 2KLBA 2UYYA 2YHAA 5FA6A 10MHA 4HTFA 1TD1A 4ZVNA 4BQEA 2DFTA 2FQ1A 5IABA 2QV7A 1GYQA 3BJEA 3LCRA 1YVEI 5KYUA 4TYNA 1E9FA 2RHGB 3AYZB 3E9CA 1HF3A 3MWLA 4O4HB 2WZBA 1QANA 3R7LA 1PW7A 3GZ4A 1PVDA 4LHVA 1LJLA 1YFZA 5EIWA 3NYWA 4F86A 3MINA 2F4VB 1TVEA 1W0JA 1Z2AA 3PXGA 4PFQA 2RGUA 3QY0A 1YQ9A 3C6KA 1NBOA 4PZZA 4AF6A 4DJAA 3RT1A 2XCSB 2FQYA 5ETJA 5FWDA 2QBYB 1YNSA 2OD9A 2QM3A 4QOEA 5KQPA 3U09A 3CKLA 3P5BA 1XZCA 1ZN9A 2BKEA 4P86A 4D25A 5IEBA 3PDIB 3A6ZA 1NRJB 4EG3A 5D3QA 4BLSA 5CPBA 1NXQA 3EXHB 4WZ6A 1GFIA 1H0SA 5DI3B 2BGRA 2IXDA 5KNDD 1YT5A 3AKDA 5EIHA 4QBIA 4QWMA 2JHGA 3A9CA 4EIWA 3LW8A 1QGDA 3MB5A 2HK7A 3TE7A 1ZA1A 5CD1A 4L8LA 1BO6A 4ARVA 4LJ6A 3M7IA 3S7TA 1V1JA 3LH5A 4M3NA 4NYJQ 1TTPB 4RJ2A 1J06A 1NRWA 5IDYA 3T9FA 2JLAA 1KI4A 3VR4A 1P7ZA 3ZHCA 4KOAA 1CUDA 3N0WA 3T5AA 4CEHB 3T1NA 2H57A 4B3FX 3V4FA 2OV3A 1MO6A 3ITEA 4ASUD 3CX3A 4IUCS 4TVKA 2OCXA 4G56A 1CZOA 4JT8A 1G9TA 3BTSA 3WQRA 5B64A 3HMQA 5AQEA 1UPXA 4BNNA 4A2PA 2OGZA 3PHIA 3Q7EA 3DAHA 4E6PA 3ICEA 1P5ZB 5B1SA 5AW2A 4OJTA 2GASA 3WMWA 2ZU6A 2AYXA 2W4QA 2AMFA 4E32A 2CNBA 3F7MA 1KU6A 2C2ZA 4NV3A 4PTYA 5EHNA 2IHBA 1VZ2A 4KIFA 4Z0PA 1Y6QA 3OPNA 2PQ0A 3D31A 2DOKA 5DBIA 1FYXA 1XNHA 4EJSC 1PZGA 4Z9YA 2PWAA 2CCKA 1ZD1A 4G23A 2WINI 4GOKA 3T8YA 1O08A 1KEWA 1JR2A 1YE8A 3GQBB 2UZ3A 2GJ8A 3D0QA 1NXSA 4D0SA 2I3ZA 4MH0R 2WUEA 2IOYA 2PUWA 2ZBQA 1JKJA 2J0EA 1KU0A 2HTFA 3U6BA 1ZR4A 3C97A 2DKNA 1GGMA 2EAUA 3ZGZA 1GQFA 3MMNA 4AP5A 1JNXX 2XYQA 1H2HA 1U3VA 4HLUA 3DDCA 5JCOC 1AK2A 4GPAA 3ZK8A 1PVVA 4RESA 3VU9B 4B83A 4JELA 1UDXA 4ZVQA 5T8KA 5L4NA 3I2IA 2OUIA 1E3IA 2DC1A 1Z6QA 3TLZA 1VYHA 2H52A 1SXGA 1K3TA 3HN2A 2OHXA 621PA 1BVHA 1XR3A 4ATNA 4DLSA 1OH8A 1GPBA 2ZT6A 2O4UX 4OLJA 1ND6A 1XL0A 1XMOB 1HYGA 1L4UA 4V0NA 2X8WA 3KTAA 3Q12A 3CRW1 4P98A 4U2GA 4OGGA 4EOGA 1Q44A 3RH0A 4ZU3A 4IEFB 5F2NA 4RVHA 3O83A 3FI0A 1KO7A 5CT6A 1RRGA 2CXSA 1IY8A 2FSFA 3DR3A 3H11B 4JT9A 4RCVA 2A92A 3WLJA 1I24A 5G02A 1X80B 4KPEC 1QKKA 2P65A 3BIWA 3CF4G 4MWGA 5D7BA 5L6LB 3NHWA 4Q4AA 4Y2UA 2D2EA 4EY5A 2J6IA 1G0OA 1V3QE 5ADVA 4NCJA 3H1EA 4YAUA 1VL2A 4L08A 1Z39A 3GW8A 4UEWA 3AERA 2ZJOA 3CEAA 1H69A 3IOEA 4YDRA 1N8SA 3AR9A 4KQ6A 3LBIA 5H3CA 1ZJ5A 1XPUA 1WA5A 3GDFA 4L8FA 2F67A 4ND4A 1MO5A 5EFZA 2ONJA 3DKPA 3MT0A 2CFCA 3FE2A 1QKJA 2OFWA 2YVUA 1XCBA 2AZDA 2W0MA 2ZRDA 2P77A 2B9VA 3JYNA 4LQLA 3AI2A 1XQ1A 3PXDA 3UWKA 2AF4C 1G7RA 1Z0IA 4Z1OA 4IGIA 5LA6A 2Q07A 1EK1A 2QG9A 4JI0B 2PQ6A 3IEKA 2HRBA 3OCXA 4MKHA 3NM5A 5TGZA 4R54A 2NU8A 1AHIA 4OAOA 3RC3A 3GEGA 4AUMA 1E6LA 1GRRA 3ICWA 1CQJB 3OIWA 5FUXA 4RPJA 1UBFA 1O58A 3ENQA 3P2YA 1XV5A 2O48X 3K8OE 3KQVA 5HDQA 4BQQA 4LJKA 4FWBA 2GPBA 4HGZA 4RF4A 2NU9B 4A36A 4HDNB 4D46A 1AKNA 3HB0A 4RV5A 1DXOA 1V16B 2CGEA 1ZJ4A 3KU4A 4WXMA 2OC9A 1Z4PX 3EXG1 4PGHA 4IXNA 3TW8B 1L4FA 4GRIA 3SKXA 1TYCA 2V03A 4GLFA 1RPZA 1Q91A 2C1XA 1I4TD 2C20A 4EATA 2I7VA 3ORFA 4ZVTA 1Z5PA 2Q0HA 3AY3A 4MUNA 3TZCA 2VTBB 2B1GA 2D0OB 2ALJA 2Q41A 1H2XA 3MOIA 4WLFA 5G53C 1V11B 3S3TA 3T3PB 3TR0A 2A9VA 3H8VA 5HJ2A 3G8YA 1EKXA 5PGMA 3V2HA 4RGVA 1QRAA 4DV6B 3DL4A 4OJNA 4K9NA 2OTCA 1K7CA 3E15A 5AKZA 3K0SA 5CT8A 4JJKA 1J5EB 3IJ5A 3AINA 3N2YA 3LX8A 2I2BA 1KDRA 4Q1EA 2J0QA 2F1IA 3KWJA 2MWMA 1SIBE 4MR8B 4MWBA 4BQFA 4X93A 3E5NA 3BMOB 1RADA 2ZSJA 2YX1A 1ZH8A 2HK8A 2GM9A 4ND2A 1P7PA 3L01A 1U0TA 1XTBA 4WNYA 1CE8A 3EEFA 4XAQA 5J2UB 3ZV3A 3FZYA 3BH6A 1GITA 2FPIB 4TWAA 5CGQB 4H1WA 1CRQA 3WHPA 1USUA 1CIJA 2ONZA 4KVZA 1BN6A 4HY3A 5DZSA 3FDZA 4FHGA 3ZDRA 1JN0A 1Y89A 2C2XA 3JAKB 4LZLA 4PANA 1VDZA 3MSCA 1LNZA 1XWIA 1V1MB 1TLFA 4KP7A 4XQEA 4RKYA 4XYGA 4EA8A 2AN4A 1PI3A 1QFZA 1JDBC 5EHQA 5F76A 2Q4TA 3WYCA 4TYYA 2PZKA 2OD7A 1E6CA 5IBRA 3TNJA 1X1QA 2GS9A 2RBKA 7REQB 3WMEA 1PEDA 4PV7A 2GESA 3AB7A 4B3BA 2ZWVA 1E58A 1PZXA 3ZDXB 3GNTA 3EC1A 3Q8WA 5BN5B 4WINA 4AJ4A 4D57A 5IF9A 3WGIA 3CVVA 1QV6A 1T8YA 3KUXA 1C41A 3W2TA 4RULA 2NADA 1E9VA 4GU5A 3DM9B 3I01M 4LWOA 5DVZA 2WYOA 4DC0A 1DBWA 1GPAA 5LCXA 1FSFA 1XWFA 2X7XA 4DA7A 5AVRA 1HLGA 3GPLA 5LP6B 4DEYA 5KC9A 1PYDA 1US8A 2P9YA 3UF0A 4IXMA 4XGQA 4KCGA 3ZY2A 4CLDA 3KVYA 4X1KA 2LWIA 3W3ZB 1AO3A 1Q21A 3SX4A 5AW8A 1YI8A 4LZOA 4XCQA 5IXYA 3KR9A 2FPGA 4GC5A 1WOMA 1M0EA 3HV2A 3OJXA 2ZIGA 3ZHBA 2JEOA 3MUFA 3NB0A 2NU6A 2Q0SA 4X65B 1IUOA 1EFAA 1Q0ZA 3GCXA 4D41A 4OU4A 3ZJ4A 4YMUA 3KL2A 4I66A 1P29A 4IHJF 2PXAA 3ND6A 5E7QA 3VGPA 4MLZA 4U00A 1PUXA 3G5TA 1JR4A 4EGQA 5JAPA 3QKSB 4MWSA 4M2LA 2HOQA 2WT4A 3ERCA 3QJYA 3GRPA 2HR1A 4XM0A 3DFFA 5T57A 3CTMA 2ZANA 5BN4A 1KRWA 3RYHB 1QRRA 1OC4A 4O4JF 2VEDA 2Z9BA 4KPFC 3RO7A 2DLCX 2WD9A 2WFLB 3VU1A 2VXCA 5IHXA 4RK1A 1FYVA 1T9DA 1UXGA 4H3KB 1VSQA 3MJRA 2XT0A 2FMKA 3HL0A 2P9JA 1D2MA 2BFCB 3HU3A 3I83A 4HH1A 3KB2A 4I99A 1EDZA 4Q7MB 2C0PA 5BVHB 3TBFA 2WTBA 4EH1A 3EPJA 1ZY2A 4FEAA 1SFRA 2IPAB 2JLSA 3LZCA 3KFVA 2YHBA 3LT5A 3I30X 1W0JD 5E9QA 6REQB 1SCIA 2REBA 5IN5A 2QX9A 3PWSA 1YONA 2IEYA 2OPHA 4WQMA 3CONA 3LLVA 2D8AA 1YS2X 1P2VA 1QOQB 1GNQA 5E6SB 2J0VA 1KI7A 1G3RA 2F8TA 3RIMA 3O47A 2PO7A 3Q2KA 4B6OA 5BNFA 4R6XA 5L3VA 2P9HA 4ZO8A 1K66A 1NIJA 2D5AA 2DPHA 2QENA 3CVJA 4N5LA 3GJZA 1WQ1R 4QO8A 3SS8A 4A8JC 2HJWA 1U7HA 2OB2A 1XLTA 1CVLA 1E2KA 2YZ7A 3FYSA 3OQIA 4PBSA 3T7AA 4YRIA 1XNRB 3F4KA 1U5CA 2E0IA 4E4TA 1PHPA 3EVCA 1Z0SA 1H8EA 4CKBA 2EX1A 2OG2A 3HK2A 3MGAA 4OTZA 1JTFA 1XCOA 3Q85A 2YJ3A 4A03A 1HC7A 4EHHA 1WMFA 2XQJA 4W7SA 3EXG2 5LB2A 1E18A 1ESZA 2CLOB 5FUVA 1P39A 1F3LA 2XVAA 4C06A 4M1YA 3FTNA 3KT6A 3KWLA 4YAIA 1QIJA 2FWRA 3OMWA 3E2MA 5BT9A 4OFWA 3L0SA 3CSUA 4CM4B 4DE5A 1U1DA 1DFHA 5K0JA 1QP8A 2OBXA 2P5SA 5HZGA 4W9RA 1P77A 4GUAA 1FU8A 2BSQA 4AYXA 2WJ4A 3QUCA 3TUJC 3UCEA 1F8FA 4UM9D 3W8NA 3Q0TA 3KSMA 2N46A 5AW5A 1QYWA 5A1JA 4YMSA 5BR8B 1YZHA 2OWDA 2YVAA 1RQRA 2I8AA 3DMGA 4M1OA 5AH0A 5FB3A 1WV1A 2VTKA 2J08A 4A0RA 3LO8A 1NVAA 2B8WA 3DMHA 1Q7CA 4DC9A 3D6UA 4QODA 4OX9B 2H11A 2NTYC 3UATA 4XFDA 2PJRA 3RGWS 1LFAA 4RZIA 1DBPA 2PO5A 4GBJA 4G01B 4BBJA 4WRRA 2J4CA 1M0SA 5F2KA 5HF6A 4DW8A 3CY6A 1EFLA 2ASVA 3KKEA 3F4LA 1YNOA 3DM5A 2Q5EA 2JCGA 1CR4A 4OHVA 1JQJC 4OOFA 1R6TA 4N6OA 3E22A 3KKLA 2Z6QA 5C7LO 1HDRA 3CNBA 2X19A 4H3HB 1RKUA 1JLLA 4RL6A 3QFRA 5EUBA 4NYMR 1ZNZA 3G89A 3A37A 1U1IA 5HTOA 1DV1A 5DRYA 1MNQA 3QWIA 2AG8A 4N40A 2GR9A 3QE4A 2DLDA 3RJ9A 1SHTX 4GR9A 4Q0MA 2VPYA 1G41A 5JDIC 1GNPA 4BATA 2A0WA 2P6PA 4X91A 3CLUC 3T9EA 1LI5A 3U7JA 3M6IA 3ZPXA 3MRTA 3OT4A 2B5OA 1V8PA 2F17A 3DTVA 1FFSA 1L8LA 3F49S 4B4KA 2BGGA 1BMQA 5K0BA 4GL4A 4GSLA 1P74A 5DU2A 3TF5A 2R1VA 2X2PA 1E1DA 2DF8A 5HKBA 3S99A 1D3AA 1CD5A 2GA9A 4M1EA 3RYIA 5K3EA 3G6KA 4YAWA 2PBRA 4XEHA 2NSHA 4L4UA 5CRIA 3OX1A 1EUQA 4MKXA 1QE5A 2GZHA 4RAQA 1DJNA 3B82A 1KP2A 4MZXA 1RZUA 1F0YA 1D6NA 1NAHA 2FA9A 1AQJA 1FYFA 4TS1A 5HIJA 4WIAA 5C31A 5HX7A 5ITVA 1KO8A 2VQDA 4A6DA 1XNJA 3BK2A 4NK5A 3WZ2A 3IE0A 3Q3HA 5FV4A 4HOYA 3UMCA 3R1IA 3R3HA 2Y71A 4MA4A 2J87A 2VT3A 4O29A 1ORDA 3C7TA 3PD0A 4KYIB 2IYVA 3C5HA 1UT5A 4UXHA 4YDHB 2CFOA 2X8LA 4XLLA 3G6WA 1T8TA 4BMOB 3D2LA 1SZPA 1RVV1 1CERA 3UO8B 1B8OA 5IJZA 1U3FA 2M9MA 2ZRKA 4NZ9A 2PX6A 2LV8A 3RU9A 3FB4A 4EVRA 4CKBB 2G6BA 2E1RA 1SPBS 1AKEA 2RBGA 1NBMA 2V5AA 3L0ZA 4ZOBA 2TMDA 1R0RE 2I03A 1TF7A 1VE7A 2H9IA 3RYFA 3ZXYA 5C34B 1LWNA 3OEHA 5K09A 2JA2A 2AT1A 3KTFA 1TB4A 3ZDFA 1PFQA 5TLSA 1W6RA 4L27A 1GAJA 3UANA 3L05A 4LGYA 3W1WA 4KSBA 3F97A 5K05A 1ML3A 5AW6A 5ESRA 1NZJA 4TS4A 3GRAA 1Q0HA 5EA2A 5ENZA 5DNWA 1RJWA 1TRKA 2B37A 1W47A 2FI1A 4PPQA 5IKEA 2ACVA 4BKRA 3COSA 3CMCO 3CZPA 1QCZA 1WE2A 3ZD7A 1HLFA 2I62A 4HSEA 3N2IA 2J9FB 5DM4A 3STXA 3UAXA 7MHTA 3REFA 3EFOB 4BZZA 1S2IA 3S2SA 1L4NA 4X64B 2ZSBA 1JKXA 5JWHA 2FN7A 4PO3X 3AFHA 4ZVSA 3UG6A 5L3SA 3HP4A 5FLKA 3ANSA 3I45A 4M49A 3WE7A 2HDHA 3PQEA 5GJWC 1MR3F 3IOBA 5L53A 1TO2E 3WL7A 4JJ6A 3JQ6A 3HZZA 3QPDA 1AXEA 4RE5A 4I9HA 3DF9A 1QBKC 4WK6A 1UJ2A 3VH1A 4IY1A 3JWEA 3RAGA 3UPTA 1JEQB 2QP4A 1O87A 3DE0X 1L4LA 1B1CA 1K5GA 1J00A 2CL5A 3GFVA 5EMKA 2Q3LA 1IOWA 3CUEF 3E7FA 1I3LA 4L74A 2B94A 2COEA 3BSYA 4ECEA 4EUEA 2GEJA 4NHEA 1S8NA 1QMPA 2OHOA 3OZVA 5AW1A 4JSTA 3L7DA 4NZYA 3WKAA 2HMAA 3JVEA 4WEQA 3DOCA 3R6LA 4OLBA 1P72A 2C97A 1NASA 2BFBB 2ZRNA 3AEQB 3EXAA 3FTCA 4KQGA 4RY2A 3F5DA 2XNHA 3GAZA 2OXTA 4MJXA 1XIVA 1YOVA 4YXWA 1UAYA 3USES 4QYIA 5LQUA 4OJQA 1BQEA 1F0PA 2YXNA 4B84A 5CDYA 3G8DA 5B57C 1G291 2XNDA 2CLIB 2ID9A 3NMUF 3KXIA 4S1TA 4IO1A 4KXVA 2SHKA 1UK7A 3INNA 2G9RA 4WJKB 1XLTC 5EEGA 4PF1A 5LBUA 3UXEA 4ZQFA 1IUKA 4I6EA 1P81A 4DR2B 1EVEA 2DQ4A 2FRDC 4I4TB 1HDIA 2IBMA 1U7TA 1ZOPA 4QFDA 1X87A 2PQMA 2GN1A 3RBZA 1E64A 4JLPA 5AIAA 3BG5A 3L4BC 3SK0A 4CQNA 4HZUB 2TECE 1XROA 4JJFA 4UNIA 2QW1A 2GN4A 4L8VA 5JE8A 2AG0A 1XAHA 3H6KA 4YBZA 3H4MA 2L2QA 4K8RB 5FCDA 4W7HA 3WSVA 3REOA 4FYPA 2O1SA 3WLEA 3GRYA 5IDWA 1S3GA 4N5NA 5JCZA 1LS1A 1QPGA 2ISQA 1V8ZA 4C07A 4G84A 4F6LA 2DQZA 4QPCA 3D1JA 1VTKA 2H7VA 1LBHA 3N58A 4I4LA 4Q48A 4P81A 2WU0A 3N0VA 4W1RA 5CP8A 3MVEA 2AE2A 1YULA 4PBRA 4X7BA 3TAUA 3RVPA 2IH2A 1NE2A 4INOA 1B74A 5JS2A 2LIVA 5FWNA 2CMDA 5BY2A 1VKJA 1ZN8A 2AOTB 2ZJ0A 3CURA 2X4LA 4BNDB 1J0BA 3UJNA 4OHMA 5M3BA 3SLKA 3VC7A 2HWUA 5KMGA 2XOXA 3ISJA 3HVRA 1NVWQ 2B5VA 2PRJA 2PTHA 3B9BA 3EDOA 3HP7A 5ECGC 3VO1A 2UYOA 1QYXA 3V00A 3X1JA 2O2CA 5BW5A 2X15A 4RWEA 2JZCA 1N6NA 1CUGA 4IOKA 1Y8RB 2EGGA 4UEOA 3OJWA 4DANA 3IUQA 2R3SA 3JZAA 5C8VA 1QRUA 4L4RA 4AWBA 2QU8A 1WZIA 2KE5A 3DEAA 3HBFA 4HAZA 5K0SA 1AGNA 2R4UA 4RK0A 2HA4A 1CY0A 3KVNA 2OM2A 3OOYA 3C14C 4P83A 3W7BA 2ZPUA 1EG2A 3T95A 1T24A 2PY6A 5GPBA 3IA2A 4JI6B 1AB6A 2R6AA 4LPKA 3CF2A 2F48A 4QVIA 1JDNA 3VR6A 1JXMA 2AOVA 2X2OA 2XE6A 3EUEA 3OX2A 4KWEA 3PD1A 3WLNA 3ZE0B 3I9KA 4C3OB 3K70C 1KMMA 4AKGA 3ANLA 3ITKA 4P0PB 1P18A 2IDMA 3C1TA 4RK6A 3W2IA 4DHWA 3QU7A 3MMZA 2Z56A 2MCFA 3OHSX 4ZAZA 2IV3A 3B51X 6ABPA 4GM1A 1DC8A 2EVWX 3HN6A 5CG1A 2WE7A 2JLWA 2DBYA 3IVCA 5D5HA 2O5RA 3LBNA 4IH4A 1U2EA 3QBTA 3OE4A 1ZOIA 2IFTA 1OX4A 2WJJA 5AJHA 3F3KA 3RF7A 2QX8A 2ORWA 3O1LA 5EKDA 2FPPB 4YASA 1XF9A 2RGNA 2XUGA 2H9YA 4KQXA 4M8IA 1H1DA 3P0IA 5EJFA 2X0FA 4F11A 1DJOA 3G0CA 4BPRA 5JXIA 4KRYA 1TUEA 1HE8B 1K5DA 3K9NA 1DZIA 1LDMA 4O4LB 1J1IA 4UPVA 1SY7A 4O2AB 4PO1A 4EFLA 4EKNB 1UQRA 1U3TA 2VUHB 1RTKA 1RRKA 3BGSA 3CKYA 3M6MD 4L72A 5DM1A 2XQGA 4FIZA 1CBUA 3ZCRA 1EP2B 2OV8A 1BDMA 2BEVB 4HRAA 3E4DA 2VWHA 3P9NA 3EMDA 3NP7A 1NUUA 1YC2A 1CR1A 4OHUA 4A9AA 5AW9A 3IAM1 2ZSAA 2WFMA 5ITZB 1H2WA 1X7DA 1ZBQA 1D2NA 1FDSA 4FCVA 3FUUA 1J2RA 3GNSA 1ESNA 1T8RA 2O52A 1HE5A 2WSYB 1L8AA 3MBKA 4RFVA 1ZNQO 2ZWPA 3JD2A 3LG2A 3IYLW 3OPMA 1II8B 3UMRA 2WV7A 5L7YA 4K03A 1UAAA 3A6LA 3FG9A 2C3PA 3OOWA 3OTGA 1AUOA 2BZ1A 2GPYA 4TTPA 5E9WA 1HI9A 2V6IA 3D6TB 5H4HA 1CIVA 3DULA 1OX6A 5KOHA 4MWEA 1NI3A 3AP1A 5EESA 5IKPA 1NRIA 3F90A 1NVXQ 3LC0A 3OIVA 4WA7A 3FMIA 3ZNPA 3KVOA 4JOQA 1JIVA 1GCGA 4HLDA 1ESEA 1CSEE 1YVRA 4TKUA 1IWBB 4EO7A 1Y8QB 4EJ6A 2CNOA 4QXAA 3WGGA 3ZU3A 4BFVA 1KAQA 1M2GA 2OQIA 3GJ4A 5ALMA 3L8YA 3D2CA 3M4YA 3LWDA 2C2MA 3PQ4A 3SS7X 4NOMA 4FBLA 3GJXC 4RD0A 1CUYA 3R0QA 1NI4A 1FSSA 4FKZA 4MV0A 1YHZA 3WGMA 1PKXA 1EXWA 4AULA 2EWMA 1QLWA 2XB6A 1QU2A 1G7SA 2ZJZA 4DXHA 4YFYA 3T94A 2HDOA 4ZCTA 6NULA 1S2DA 1T6ZA 2QNRA 2WP8J 2H2GA 5JXJA 2AF3C 3QEOA 2R1VB 4XIJA 4M0KA 3QBEA 5M5BA 3OQOA 1LJUA 1SGWA 2QY9A 2ZBRA 1P0IA 2EERA 4P34A 4C04A 5ITSA 3DV9A 1U1FA 3AOEA 2GZAA 1GFSA 1AKYA 1RPAA 4IV8A 4JCOA 1O97C 3DCJA 2CKDA 2W6OA 2ZI4A 1TKCA 3FLMA 1ZGCA 1EDEA 2KS6A 4ARAA 5DJ5A 3R24A 2QSZA 4GZLA 1ADGA 1Q7BA 4RFLA 5DYYA 3L79A 2HEGA 4DBLC 2K7FA 3T52A 4IX1A 1WZ2A 3I6YA 6AT1A 5I47A 3RU2A 2BTQB 4E0BA 1S1MA 1XYVA 2ZYUX 1OD6A 4IJVA 5B7QA 2X0IA 1CQXA 1Q1EA 2D62A 4O59O 4RU1A 1WXXA 3FETA 1MDBA 2R85A 5GMOA 3KV3O 4DV4B 2VNAA 3SLRA 4DABA 1Q1AA 1H1LB 3UB2A 4EVIA 3QXJA 1EFTA 4OQQA 3PK0A 2ENWA 3HSSA 1ZICA 5GZ1A 4ND3A 5EZYB 3U19A 1OUMA 5EE9A 3WDSA 5JNVA 3O2SB 1GL3A 4G5FA 4GM0A 4IF6A 1J5PA 4F84A 3FNFA 1WBBA 4LDJA 4GPTA 4ZKDA 2BM8A 2H2WA 3OSZA 4FLEA 3RAPR 3WB2A 2P9CA 2YC2C 1OA1A 2VAPA 4WVLA 1U31A 1ZESA 5AI9A 2GUWA 4JZYA 3I3OA 1VRVA 2CLEB 1S3IA 1BEEA 3T3MB 3ZBQA 1UQTA 2FSHA 1Z5OA 4FE3A 2O8EB 1CFZA 1GNSA 3K09C 4MR7A 3HJAA 3WB0A 1CJUC 4D43A 3ENKA 3WP0A 1V1RA 1WZEA 3U7QB 1G6OA 3DD1A 3WFJA 4NJMA 2KPOA 3BKWA 4MUHA 1NIPA 3E2PA 3NTVA 4L6AA 2G5TA 2JFOA 4CLXA 4EG0A 3N7TA 3IP3A 5KREA 3PHGA 3QWFA 1PFVA 3GUZA 4HF7A 4KN6A 4YQZA 4BNXA 3E18A 3I9NA 1ENYA 3IT1A 3U1BA 3BIFA 2FXVA 5JPIA 3EPPA 4AMVA 1M1NB 2GN0A 3ABRB 5TS3A 1U6KA 4AJIA 4BO1A 5GZ3A 3PRHA 3W5UA 3U3OA 5JSZA 1XZJA 3DZKA 2J9YB 5DHAA 1N2ZA 1LNSA 4G97A 4R3UC 1L1EA 1T8SA 2PZBA 5WRFA 1F2TB 2GZDA 3WP1B 2R68A 3N0RA 3TQHA 2PX8A 2IEIA 3AIKA 3ZQUA 3RWOA 3CVXA 3EARA 2GLTA 5IM5A 5J58A 3GXBA 4AZTA 3L8ZA 2GD0A 3UGJA 3GLUA 2ZAYA 2PCJA 4FT2A 2BKLA 4NFYA 1VL0A 1KAOA 3WYFA 2PUBA 1PT6A 5HGJA 4YUVA 3U39A 4PRKA 1KY2A 3G5AA 5EHGA 1Q17A 1QPBA 4MVJA 4Q4AB 4PSKA 4PCLA 3CX6A 1MZVA 1BD3A 1XTSA 4KQCA 5JMWA 3SQWA 2W2KA 2ZPAA 1QDLB 3Q5DA 3QLVA 4HAYA 1KQPA 4FGSA 2KLHA 1JVBA 1ZD2P 2B2XA 2M2IA 4HNHA 4Q47A 3U3XA 4UOZA 3AWIA 3C3CA 3QITA 3I9FA 1PD0A 1QXSA 3O8QB 2HBZA 2VDPB 1WCIB 4MHSA 4B17A 3EASA 2VK1A 4NNPA 4L1KA 1A4XA 4KEAA 1P3JA 3N70A 4XGNA 2XB2A 4MVJG 3WDMA 1LLQA 1TAGA 4XSGA 4R8SA 2VJYA 3ZOKA 4MGEA 4WFKA 1VE3A 1UIRA 1BAPA 5JCJA 3A9VA 5EIFA 1MT3A 1X2BA 2HAEA 4KBGA 5C3UA 1PU2A 1JQ5A 2FWJA 3M9XA 2H3EA 2K87A 3AWDA 3EQ6A 4MW6A 3RQIA 4CV2A 1WXHA 3PGMA 4KQIA 2XD4A 4JH0A 3FZEA 2FEXA 3GJSA 2G9QA 3SZLA 5EXXA 5EJMA 3H16A 4FN5A 1FP4A 1FZTA 4CLRB 1DKNA 4A1OA 4EUHA 3AKZA 3AETA 4X8OA 1ISSA 1Y7HA 1AMNA 3I2YX 3BB3A 3EK2A 3FPCA 3VMMA 2PLAA 4B40A 2OO7A 1UFKA 1FK8A 3EZNA 4AY5A 1EFKA 3F98A 1NXVA 3Q87B 2IWRA 5TPZD 3IQWA 2C59A 3NX4A 2GCOA 4L0QA 3X1WA 4NV1A 5C8YF 3L7YA 2ZE6A 4DTIA 2ZRGA 1Y80A 1EX6A 2WIAA 3BK7A 3DOFA 5IAKA 4D5EA 2P4QA 3ANNA 4YRMA 5JWRA 5KB3A 4PQRA 2ESRA 4DMGA 5I8PA 5DPMA 2G08A 2EQBA 4AY4A 3V48A 1SIOA 2FKNA 1GV1A 2WQZA 3NH9A 1K7EB 4W8GA 1C0EA 2QUIA 1GSHA 4XWKA 4LVOA 2FKAA 1N6HA 2P69A 4IVPA 4LY3A 5CR9A 1THMA 3LS2A 2P35A 5EIAA 1N0WA 2NXEA 4GOLD 4GSKA 3B20A 4GYJA 4NULA 4B7UA 3H2BA 4EMSA 5BMVB 2QRQA 4TUYB 4BMVA 4MVJI 4R6WA 3HDTA 2JIZD 1Z6GA 3MTIA 4M37A 3H4TA 4RHUA 3QFCA 2Z95A 1R5BA 2FPIA 3E53A 1A7JA 2Z9DA 3VR6H 1W36C 1GFZA 1GEEA 2XMDA 3GEIA 1RJDA 4PSUA 3SSMA 4LKOA 2JGIA 5I7AA 3Q4GA 3FJ1A 4WN9B 5CVJA 4DRXA 5BQFA 1T4BA 3CV3A 4G4IA 3EZXA 1PJCA 3MXTA 1GUDA 2I87A 2X23A 4ZALA 5IC5A 2JGFA 1L7XA 2GMWA 2CXUA 3AZPA 2J33A 4QD3A 5ALXA 2EZTA 3RIGA 2JIDA 5FUMA 4GP7A 3WIEA 1WUKS 4ZMBA 2HWWA 2XQVA 2DSTA 3DP9A 1HDZA 1EM8B 5GV7A 3M6UA 2VDNB 3R74A 4EYEA 2GBLC 4J7UA 2CJWB 2OXRA 5D00A 5L3RA 2AXPA 4LX0A 3AC0A 4YK7A 3GLHB 4QYMA 5ALYA 1ZOSA 2YMPA 4RDHA 3UAGA 4TLDA 1UEIA 3U9SA 4B3JA 1F48A 1Y81A 2GNAA 5IKOA 5FR1A 5INTA 1A8IA 3AJRA 3QW4B 3TRDA 2A59A 4MEBA 3S55A 1KSFX 3PEYA 2VZ9A 1LD3A 3HEMA 4XWYA 1J33A 1VCNA 1I2CA 1IZ7A 1GTJ1 5GIPE 1VE9A 2FDXA 2Q7XA 3WRYA 1NQVA 1TVMA 1G5PA 4PNZA 4ZT3A 1Q0SA 2C0QA 4D9KA 4DY4A 1GPYA 4OU5A 3LO5A 4Q7LA 1XCGB 4CBVA 4ER5A 5BV7A 4OMFG 4Z7JA 5EWMA 2J0SA 2VPPA 4D1YA 1NU6A 5DN6A 4B6FA 1CQZA 1D8TA 4GDMA 1NX6A 3RS0A 3SF8B 2F43A 2CLCX 2FH5B 5FJJA 5LD2C 2XV1A 1ORTA 2V5VA 1G21A 2BFDB 4HDOB 4X6UA 1VHJA 4LSMA 3RVJA 1K6MA 3CUYA 2VPXA 1ACMA 1RXIA 3BM5A 3G0IA 4MVWA 1QE3A 2XRMA 3KL4A 5CNJA 5DTEA 3DO8A 3L0OA 1CR6A 2GAIA 2CFRA 4DIUA 4FNAA 1Z4LA 3ZVRA 4CIBA 1X8LA 1T0JB 1SUIA 3BCUA 3N0TA 4UBOA 2G3YA 4WMLA 1TJPB 2C7VA 5TGDA 4AY3A 1OH5A 1JFTA 3KZCA 3NO4A 4FSXA 3UV3A 2O0MA 1AVTA 4AIIA 1KRHA 1G7CA 3NVAA 4P35A 3WWDA 4ZEMA 2HRCA 3BXFA 3OE1A 4OYRA 1MQ8B 2Q6IA 4XTRA 4AJOA 4KR6A 1DKUA 3WLPA 3EY9A 4GI7A 1UADA 3WX0A 3ZWAA 4Z7QB 1E6WA 1U3UA 3KJZA 4QG7A 3FKSA 3D3EA 1XXHB 3HP1A 5FULA 3F74A 1SCKA 2C00A 2CHQA 2W6QA 3D8RA 4W7IA 1IN8A 4R9NA 5DASA 5TB5A 1JEYB 2Q0XA 2ATEA 1HV8A 1WCV1 2IGBA 3D4NA 3FCYA 4FZRA 2R7NA 1DQNA 2G0NA 2I29A 3L4BA 4KXUA 4DCPA 4F38A 1X0XA 4H9GA 3TQSA 1YO6A 2WTXA 2B98A 1TZMA 3NJRA 1JHXA 2ZREA 2GPNA 1OPXA 2WJYA 1PWHA 2HEIA 1YU9A 5TY0A 4NFHA 1CY7A 1NT2A 1Y4AE 2C3UA 2EYUA 4HPXB 4IL5A 4AJPA 5DLPA 4J3JA 1D7OA 1DINA 3FUTA 2IZ5A 4OOEA 3KZKA 1WVMA 2X22A 3WL8A 3GAAA 4ENPA 4I50B 4ZCRA 4TUYA 3O7WA 5AM4A 4MKRA 3UTDA 2BFNA 2XXJA 1W52X 3QGMA 4L9SA 5D85A 5BRNA 3SIWA 4C89A 3AF3A 4PLHA 1QPZA 1DUVG 2DSNA 5DX0A 3QMWA 1CUBA 4UAJA 4WK2B 4HYTA 1PS0A 3O8DA 1FY2A 1UFVA 2BFWA 1XRMA 2VK4A 2WWGA 2RKWA 3BREA 3EUAA 2C7RA 4EARA 1RRCA 4RF5A 1E5TA 2H85A 3WNBA 2Q0QA 1L2TA 3FZQA 5KQMA 2VT2A 3JAWA 2QTVA 2NYAA 4TV9F 1M33A 1MFZA 4Q7QA 3BH0A 1JEJA 4URUR 1R18A 2G4CA 5COAA 1NI5A 1EK0A 3R7DA 4C2UA 3MWEA 1ONPA 4IDQA 4FZ5A 3G5MA 3M1AA 3L8FA 2OAP1 3CR3C 1IK6A 1PTJC 2ZDQA 3OETA 3P52A 2BBWA 3KOZA 4TV9A 2OFPA 4AJ9A 4CHGA 2BT4A 1K4MA 1N2EA 2XMSA 2NAFA 5CPFA 4OGFA 2GEVA 3QMMA 2VHQA 2WJGA 3HY4A 1GG8A 4MR8A 1D2EA 3KV1A 3A14A 4AD8A 4C4YA 4YRJA 1E2FA 1DXQA 2BMJA 2RGYA 3W1VA 4CR7A 2QJFA 3A7DA 3OJOA