3OP4A

Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. n16961 in complex with nadp+
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
247
structure length
247
Chain Sequence
SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
total genus 81
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2010-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3op4A00
4JIGA 3KOUA 3O26A 3W4IA 2HKIA 1BW9A 1N1EA 3DAFA 5CAEA 2ZCVA 1PTJA 1OOEA 1EEHA 1DLIA 1KY4A 4PFJA 4OH1A 2Q2VA 1U2DA 3F5QA 4ITUA 4K28A 1ISFA 2WYVA 5FI3A 3GN1A 2FMUA 4ROSA 2JCVA 4YRDA 3WBFA 1SB8A 4PIVA 3ZHZA 1LDEA 4D0RA 5KJFA 2HRBA 2GN6A 1RYEA 3W6ZA 4FB5A 4WUVA 1FK8A 1W0CA 3NYWA 2WE7A 1YBAA 4WOKA 4BO1A 3PJDA 2X0RA 4QX6A 1I01A 3I52A 1H6AA 2BLLA 3GVPA 3CIFA 4GVLA 1W8DA 1LDBA 1SCUA 1KVQA 1YS4A 3G49A 4OL9A 3MWEB 3DC2A 2AQIA 4CPDA 2AEMA 5CFZA 1HKUA 4BNLA 3HFGA 2P9CA 4Y67A 2QRJA 1PZEA 1GZ6A 2YDXA 1P77A 4KQWA 5K9ZA 3D7LA 5T8KC 3VZSA 3JCZA 2DLDA 5A05A 1GDHA 2VWGA 1TI7A 3DOOA 3ONDA 5KIAA 1F0YA 4GX1A 2J3IA 4LSMA 2C20A 1DBVO 4FPXA 4XA8A 5JAQA 1H93A 3ROMA 3W4JA 1X1TA 4YAEA 1JWBB 3WSWA 3O4RA 2PH5A 4CM6A 3FRJA 4BO6A 1E1NA 1R0LA 5B4VA 3X2EA 5KKCA 1VE9A 3Q0EA 2FR1A 1DEHA 4L75A 4R01A 1Y1PA 4WPGA 3EK2A 1P1HA 1UXIA 3WWZA 4XYEA 2PKQP 3D0OA 3U4HA 1R4NA 3JQ7B 4E6PA 1G0NA 3OIFA 5HWSA 3SJUA 2O7QA 4YACA 2H9IA 4NFHA 2IEDA 3LZ6A 4XGIA 1PZHA 2JAHA 2WD7B 4YWJA 1HE5A 3AOGA 4HXYA 4L76A 4DUPA 3HSKA 4W99A 4BNYA 3KEOA 4WNIA 2O23A 3VDRA 3FD8A 3E48A 1C0LA 4CQLA 2P91A 4KMSA 5ER9A 4ALMA 3I23A 1BVRA 1HE4A 3JYLA 1PS0A 4NMHA 4CMBA 3OFSA 5TF4A 3K6JA 3PJFA 2OBYA 2CVOA 2IDZA 5KVQA 3WGGA 4B3HA 1QYWA 2O3UA 4XQEA 3P2YA 4GMGA 2B5WA 4J90A 4E2YA 2VZ8A 5A4DA 4J4TA 5T8KA 2YQ5A 4MINA 1HDGO 3JYPA 1YL5A 4GLLA 3AOEA 4W82A 5I9NA 2ILTA 5ADHA 4D0SA 5KJEA 4I1IA 3RJ5A 2HU2A 3GK3A 1VPDA 3GMSA 4B4UA 1NAHA 1B14A 1SOVA 2A9FA 4HADA 4BV8A 1ZSVA 1F12A 4MVJM 3BMOA 4GMFA 4ONEA 5CEJA 3ETDA 4ESOA 3EAGA 3LC2O 4DL9A 4I5EA 1EZ4A 3QWIA 3PFWO 3QVSA 3WGQA 1JVSA 4R54A 3VOSA 3RUCA 4E2XA 3DEYX 1GAEO 4MPDA 1WAMA 3F5SA 5L4LA 4JGBA 2C0CA 4G2NA 1ADGA 4GX5A 4UEJA 4O1MA 1OZAA 1VC2A 4YJFA 3IIEA 4RQUA 3GG9A 4CUKA 1KEPA 3LC1O 1LLCA 2BHLA 4Q3BA 2GLXA 3LU1A 4YDRA 1MXFA 3P2OA 4E5MA 5CEFA 3PIDA 4J1NA 2PD3A 3DONA 2QRLA 3D3WB 3GGPA 5KVCA 3Q6IA 4BUCA 2C7GA 3SBOA 5BSHA 3H3FA 3PTZA 3CTMA 4R1UA 5JXWA 1RM3A 1U7HA 4AJIA 3JQ6A 3ROQA 3E9NA 2Y93A 3GLQA 3L4BA 4AJOA 3RJ9A 1UR5A 4D3FA 1UZMA 3L0DA 1CYDA 2FR8A 3RC9A 3W8DA 1O89A 3PLRA 3UVEA 2YFQA 3ZV4A 3WGYA 2V6FA 1NASA 1HYGA 4DBVO 4N5LA 3U49A 1R0SA 5A5EA 2CFCA 1EQ2A 4KUGA 4NPCA 1EVIA 3FPCA 2VRBA 5AXCA 4F6LA 2VYVA 4J7XA 1C14A 2OZPA 1N92A 2Q49A 2W2KA 4J7CA 3IP1A 4IZHA 4E30A 3IDSA 3F47A 3H2ZA 2BKAA 2EWMA 3AI3A 2VRCD 3C1AA 3RC2A 4LRTB 2VHVA 4CM1A 1EUDA 2O48X 2VUTA 4GI2A 4BNVA 4CV1A 3ZW9A 1MGOA 2NTNA 2BFAA 3H4VA 3NDJA 3HADA 4NJOA 2UYYA 3DAPA 5C7LO 3JQFA 3GZNA 4J3FA 4LCEA 3JQ9A 4MVJH 3WGZA 1MXHA 1KC1A 3NDRA 4ND1A 2VWHA 1D1TA 3AUUA 4UUPA 4YB8A 4B4WA 6LDHA 5JSFA 1E92A 3H9GA 1NVMB 4EZBA 4FN4A 4MVJI 1BXGB 1A5ZA 4WJZA 5EQFA 4J6FA 1KVRA 4BO8A 3ZDFA 3GMDA 4F6CA 3ZWVA 3C24A 3WTCA 4CMAA 4MP8A 4D41A 1ZEMA 3ZU4A 2PA3A 2X5OA 1MP0A 4ZN6A 2Z1MA 3ANMA 4ALLA 3T4XA 2EG9A 4NU5A 3GFBA 1DAPA 4I8XA 5IDQA 1KYQA 4HP8A 4CLXA 5BNIA 2ZKLA 4BMVA 3PHHA 5U4QA 4OOEA 4XZ3A 2YZ7A 1WZEA 2ZIZA 1XHLA 1T4DA 2ZQYA 4D45A 3NTQA 4UULA 2Q50A 1FXSA 4IIUA 4D44A 3LF2A 4AJEA 4EEZA 4N54A 4R16A 1E7SA 1PJ2A 2CY0A 4EJ6A 2C7VA 2D1YA 4IQ0A 5F21A 2OXIA 4TSKA 5TT1A 2CDBA 4I9NA 4TZKA 3RUAA 3JV7A 4I5FA 4TROA 4NG5A 1XWFA 5CHEA 1DJQA 2Z5LA 1LNQA 1WDLA 3P19A 5A9TA 3VHRA 1YBMA 4EUFA 1S7CA 3OMLA 1H9AA 5IDYA 1UXGA 1LI4A 1O0SA 3GVIA 4WEQA 4BB6A 4CM3A 2PZMA 2DTEA 1SEVA 3I9JA 3ZWXA 2WM3A 4CUZA 2I99A 1PGJA 4DLBA 3BA1A 1HE3A 4XQCA 1V0JA 1YQDA 4O63O 4YJFB 3DZGA 2JKVA 3QP9A 4FFNA 2C5EA 2HK9A 5H83A 3UCXA 1E7RA 1RWBA 2QIOA 2ZQZA 3WDSA 1GQ2A 2DT5A 1P0FA 4GGPA 3SXPA 1VL8A 1PJTA 4E13A 1I3KA 2SCUA 1DHTA 5KOIA 2GR9A 1ONOA 4CLDA 1EE9A 3K73O 4NQZA 2QX7A 4PLWA 4TKLA 5IN5A 1I3LA 3WFIA 4FBGA 5A02A 1L7EA 3PHGA 2HMSA 1G1AA 3GVXA 1RYDA 1ZSNA 1A7KA 4OXNA 5THKA 5AYVA 2OL4A 4AICA 2J5RA 5IJZA 2HMVA 3FWNA 4NBUA 1N7GA 3OEWA 1MFZA 2OP1A 5I7EA 4B4OA 5MDHA 1ZK4A 3CKYA 4PLGA 5BNFA 1SO8A 4UVIA 3LC7O 5IG2A 4ND4A 2YFHA 2PKQO 3K5PA 4OSOA 3AY3A 5B1YA 3NT2A 4Q3AA 1FMCA 5JPIA 1UXKA 1ZEJA 1GY8A 1LSSA 1PX0A 1UJMA 1ZO8A 4KOAA 5H81A 4G81A 3DZKA 3CZRA 3DMTA 4ALIA 1M6HA 2X23A 2RAFA 6ADHA 3OA0A 2EKPA 3Q2IA 1NQOA 2FSSA 1JDJA 1Z74A 4CMEA 1N9GA 3COSA 1BDBA 3K2BA 3TDKA 1AE1A 1ZJZA 5TT0A 4PG7A 2GO1A 5A3VA 4AJ2A 2R00C 1XELA 2W4QA 5T67A 1U3UA 3V8BA 3IKVA 2A92A 4GPD1 3X2FA 4W6ZA 2B4TO 1A72A 2VHZA 1L7DA 3ZNOA 1YB5A 1Z73A 1LSUA 1H5QA 5FWNA 3U3XA 4E4YA 5DCYA 4P4GA 3WYEA 3U0BA 2W2LA 5EINA 3D3WA 3AM4A 3PYMA 4OXYA 4WLNA 4I5GA 1YBVA 5C37A 5LCXA 4OOFA 3UH1A 3F1LA 4HY3A 2EJWA 1ISHA 2HRZA 4ZGWA 1R66A 2V7PA 2NU6A 4ZQBA 4BNTA 2I3AA 3ZWPA 3UOGA 4U6SA 4PN3A 3N74A 1ENPA 1WDKA 5TIIA 3CUKA 1O9BA 3R3SA 4MKXA 1R12A 5TNXA 3DHNA 1WW8A 1X7HA 4FOOA 4L0QA 1R6DA 2JCXA 3ROPA 5A1TA 5F1OA 3DFUA 3WOHA 3JQBA 1N5DA 2ZJ1A 2DBQA 4J9VA 1BWSA 2JJYA 9LDTA 3EDMA 5T64A 3QJ5A 2VHXA 4WGGA 4KP7A 4Y9DA 2D0IA 1DIGA 3VKVA 1W4ZA 1NVGA 3MZ0A 4Z0PA 4MDHA 4RORA 4H7PA 1K0UA 2BGLA 3WJAA 4HFMA 4PZEA 2WWRA 1HZJA 1A9ZA 1DFIA 3OEYA 3HDYA 1ULSA 2IZZA 2OO5A 1PL6A 2IZ1A 3KYBA 2VT3A 2OBNA 1GQYA 4D7AA 1QMGA 1C3VA 4ZQEA 4FFOA 1WPQA 1FJHA 3RFVA 3AUAA 2JFFA 3RSHA 1I2BA 5L53A 1I10A 1ENOA 1P3DA 2XF8A 1NWHA 1WDMA 2H6EA 5B37A 3B1KA 2H63A 1HDOA 3ONEA 4ZICA 1PGPA 3SC6A 4XRGA 5JNLA 2Q99A 3UCEA 1D8AA 3HNPA 4P4LA 4R68A 4II2A 1PGOA 3ZNPA 4H16A 5JYEA 1LRJA 5L9AA 1E7QA 5EERA 3PQDA 5L3ZA 4AJKA 3ETEA 3FWZA 4K6FA 4BKPA 4DQUA 5JO9A 3UICA 1EMDA 1P9LA 2Z95A 1GEEA 2GN4A 3GA0A 4C7JA 1PEDA 3G3EA 3L77A 2JD2A 4YJHB 1V3UA 4LK3A 3TZKA 1PZFA 5COQA 1ORRA 2E4AA 3ZU3A 4R3NA 3DXFA 3MTGA 5JLAA 2GRAA 1AXEA 4XIYA 3MOGA 3D5TA 4GH5A 3K31A 4XB2A 4C4OA 3ADOA 4R4JA 5JDCA 5ENDA 2NTVA 4Z3DA 4F45A 2POQX 5A9SA 2RHRA 4FC6A 4PGFA 5JY1A 3V2HA 1HETA 5JMPA 1P1RA 3F9IA 4LISA 3PZBA 3TOZA 1IPEA 3DBVO 3JQ8A 3E1KA 1PL8A 3QQPA 3DFZA 3TOXA 3NJ8A 5DF1A 3RVDA 4XYLA 4JP3A 4CL8A 2R6JA 1UP4A 1K3TA 1R15A 3ZZNA 4B8WA 2BF7A 1B0AA 1K6XA 2Z1NA 3GDFA 4R9RA 2D2IA 2AE1A 3VH1A 2V6BA 4NBVA 4KDFA 3PQFA 4HNGA 4ID9A 4EEXA 3KSZO 3VC7A 4R3WA 1ONNA 4AJPA 2VYVD 4DPKA 5U1PA 1YQGA 1JAYA 4XX0A 4CMCA 2P9EA 2V6GA 5L7TA 4R1SA 5JAMA 1GV0A 3WS7A 1I3NA 1J0XO 4CODB 3RKRA 4NJMB 1S6YA 3R3JA 3RU7A 2O7SA 3GPDG 2RIRA 3B1JA 3OP4A 3UCFA 1ZNQO 4FOSA 4MIEA 1I8TA 3ZI0A 4R69A 1SMKA 3CPSA 3IP3A 4MKZA 3WB9A 2QYSA 2RH8A 1GUZA 3RUHA 2W90A 3GEMA 1OC2A 1PQUA 1U3VA 2WJPA 3Q11A 2WYWA 1EFKA 3OQBA 2A35A 3TZHA 2X9VA 1FDUA 4JXKA 3ZWOA 3ZHXA 3PGJA 4GWKA 3RUIA 1PJCA 1YB1A 3TL3A 4K26A 1YJ8A 1LU9A 1NFQA 4URFA 1R4NB 3D4NA 4S3MA 4CM9A 4XWYA 2DVMA 4WLEA 3T4EA 2Y68A 4LMRA 4CMEC 3JQ9C 4YXFA 1UP6A 3NKLA 4Q9NA 2VZ0A 1LX6A 5F1PA 3TQHA 1T1RA 1X14A 4MVJA 4U6QA 3NV9A 1PQWA 1LRKA 3ABIA 4TVBA 3Q1LA 3VPFA 3S2FA 3BHIA 1CDOA 3DOCA 5ICMA 1GR0A 4Z6KA 4B7XA 1PSDA 3WG9A 1Q0LA 2B4RO 2I3GA 4JX8A 1SBYA 3OM9A 1NWCA 2VTDA 3VH2A 4Z9FA 2FP4A 1D3AA 2GDZA 5FFFA 5JW6A 1A27A 3B1FA 3RFXA 3A9WA 3GDOA 3ASVA 4R5HA 2H5LA 3IUSA 5KCZA 4UUMA 5K6AC 1E7WA 1Y6JA 4WASA 4WOJA 8LDHA 1MC5A 3PJEA 4IDBA 1GCUA 4LN1A 4OKIA 3ZH2A 1G0OA 1YQXA 2FR0A 3JYQA 2E37A 2AG5A 1ID1A 1LC3A 1NQTA 2AHRA 1UZLA 4ZQFA 1DHRA 4DIFA 1P1JA 1IZ0A 4FD3A 3PGXA 2G82A 5DULA 3SEFA 1TXGA 3AUTA 2YW9A 1MFPA 1P45A 5HBRA 3ONFA 2CUKA 3PHLA 2GNAA 1NM5A 2CMDA 4RGBA 3W8EA 5A9SB 2VUSA 3GRKA 3RCBA 2PGDA 3RASA 4EDFA 1X13A 3DBHB 4J0FA 4WECA 1R16A 3OIDA 2NSDA 1GTMA 1Q7CA 3PIIA 4IJVA 4M86A 1XDWA 1BXZA 3H5RA 2QRKA 1JWAB 1I30A 3CEAA 2Y0CA 3DAGA 3U9LA 4MVJP 2JD1A 3FI9A 1Y8RA 1IY8A 4B79A 2EKLA 2EV9A 2Q1UA 3BTOA 3KYCA 4O0LA 5CEEA 4E5PA 4D46A 3H5AA 1GUYA 4IUYA 4Q3EA 4EUHA 1NAIA 4CLEA 4DA9A 4UVEA 3TJRA 2VYND 3LSYA 3ETGA 1I3MA 1LSOA 2BFOA 4BNHA 5J23A 5G0UA 2NVBA 5EQDA 1LSJA 4R51A 2QZ9A 4TVOA 2Y1OA 3PK0A 2C59A 1XIVA 2X86A 4UUNA 1PIWA 3PYLA 3JQGB 4J4HA 4IJWA 3BYZA 4Z9XA 5BSFA 3U4CA 1P33A 1DIRA 4HFNA 3SLKA 5HS4A 5I7SA 4YQYA 4UUOA 1QKIA 2EP7A 4BKUA 3KVOA 4ZQHA 2AEJA 2UDPA 1PU2A 1MUUA 3NGXA 4BO3A 1XCBA 5TJ9A 1LQTA 2BMAA 3AOEC 1L1FA 3WLEA 4E5NA 1UP7A 1B2LA 2O3JA 4BS9A 1YOVB 3VPGA 3E5RA 4IJKA 1E7MA 3M2PA 4J2HA 5CDUA 1KETA 2IODA 5BT9A 2Q4BA 2X0NA 4YCAA 1O8CA 3UN1A 4TRRA 4Z0HO 1M2WA 2X0JA 5G2OA 2IEBA 5IDWA 1LLDA 5DOVA 1ZK0A 4RJTA 1E0DA 1V3VA 4BNGA 1Q0QA 4E32A 1HTBA 1HRDA 1GPJA 1I32A 4HWKA 4P4NA 2DBVO 4J1QA 3DB2A 1K6IA 2QQ5A 1EK6A 3C7DB 4GBJA 2VN8A 2PWZA 5JAZA 1UXHA 2PZJA 1R0KA 4U0KA 3GPIA 3BMNA 3PVZA 3SLGA 3V1TC 4OQYA 3C3XA 1V8BA 3IJRA 4AVYA 1O94A 5AQ1A 2BGMA 2JCYA 3KSDO 3LF1A 4LSWA 1O6ZA 4GLOA 5COBA 1DSSG 2GZ1A 2H1SA 4GX0A 1HLPA 1DC6A 1QXSA 3AFMA 1XU7A 4OHUA 3DR3A 1E1LA 1XA0A 5FF9A 2I5PO 2TMGA 1A71A 5F5NA 5C7IO 1B8UA 3NGLA 1IPFA 2OHXA 2PH3A 2X5KO 3GN2A 1DLJA 3C85A 3PYXA 4N7RA 4BKOA 3NDIA 4PCVA 1YL6A 3NAQA 4BMNA 3V1YA 3JQFC 1PS9A 3TRIA 1WP4A 1JTVA 3C8MA 1KERA 4LRSB 5DDIP 4YRAA 2AQKA 1GQQA 1ZCJA 5IDXA 3D3EA 1KIFA 1QV6A 3OHSX 3GRPA 3ZGYA 3W8FA 1YL7A 3E9QA 5ICSA 2PKRA 4HX5A 5LDHA 1GYPA 4XGKA 3QVWA 1EFLA 5KVSA 4J49A 1Y5MA 4FGSA 1HE2A 2J5KA 2OGUA 1QG6A 2J3KA 4U7WA 4IGEA 5G4KB 3QSGA 4LMPA 1JN0A 4XYBA 1YWGO 1K6JA 4WCFB 1KC3A 2JFGA 3O8QB 1BGVA 4FJ1A 4IS3A 3WYCA 4DMMA 3HN7A 3IOYA 3DHYA 3OECA 4FS3A 3W4KA 2AXQA 2OMEA 3M6IA 4A10A 3FR8A 4BNKA 3ITKA 2BH9A 1QYCA 3H6KA 4AJNA 5B4TA 1OC4A 4D3SA 2DTXA 4U0JA 3ON5A 4DRYA 1ENZA 2HQ1A 2C29D 2RBEA 4PG6A 4BHTA 1HZZA 5I8WA 4N5MA 4NK4A 1JKJA 3G0OA 3QLJA 5IZCC 1NQAO 3ZW8A 1DAOA 4GWGA 3GGGA 4XIJA 4F46A 1M6WA 1AHIA 4YJGA 4YAGA 1N7HA 2ZYDA 3WNQA 1GFSA 1D7OA 1DIHA 1E1MA 5CDSA 1F17A 4NU6A 1EBUA 4DREA 3BHMA 5F1KA 1F14A 4FFLA 2RHCA 3DOJA 3VZPA 4WLOA 5IXYA 4J9UE 4M55A 1M66A 3CH6A 2OP0A 3CMCO 1Z7EA 3DZBA 3ENNA 3DTTA 4RPLA 2X58A 4TRMA 1DFHA 2WEKA 1U2GA 5GY7A 5TSDA 1KVTA 3S55A 4DQVA 2ZTUA 2X1HA 4KQXA 4Y6PA 4CLOA 3AWDA 3GZ4A 4PLPA 1UUFA 4WLVA 1ISIA 5FI5A 3PDUA 1TA4A 1I2CA 1Y9EA 3BZUA 3IUPA 1ZJYA 2HK7A 5T6BA 4YT5A 3RWBA 4E5YA 1AHHA 2PZKA 2WYUA 5DBFA 2CF5A 3WIDA 2FPPA 3E5MA 4IDGA 4GSLA 2Y1DA 4B3IA 4MVJE 4BOYA 4DXHA 3OSUA 1X0VA 4W7HA 2YY7A 3I1JA 3VTFA 4BKRA 2Q4EA 1HYEA 3JD2A 4AJHA 4B3JA 5FEUA 3HZZA 4N18A 2JD0A 4JBHA 1XQ1A 4TWRA 2I6TA 3WYBA 1EUCA 1UDAA 2Y1GA 5EN4A 3GVHA 1T2CA 2LDBA 4PLCA 2JHFA 3KB6A 3L6EA 4L73A 3GDGA 4CM8A 3L6DA 4W9NC 1NBOA 4BNXA 1OBFO 1ISMA 3WXBA 5L40A 3PZRA 2HMTA 5I9MA 1U7TA 2DFVA 4M89A 4HV4A 4JJGA 1PQPA 1E6WA 1XSEA 1SOWA 2VYNA 2X9GA 3C1OA 1N8KA 1BDMA 3MOIA 4YAJA 4WK6A 4A7PA 4OGWA 5ILGA 4A27A 1LDMA 1TT7A 1WWKA 4MVJD 4PLTA 1TB4A 2WE8A 4PVDA 5KJ1A 4JBGA 1VM6A 3VPXA 1Y8QA 2Y1EA 1CIVA 4N5NA 3GUYA 4ND3A 3DZFA 3CSDA 1J5PA 3ITDA 1D1SA 5L51A 3VAZA 5JS6A 2I66A 4CMKA 1XKQA 2YQ4A 2OFPA 4CMJA 1C1DA 1NPTO 4AFNA 3GHYA 4CM4B 2G17A 2EXXA 2C2YA 3E8XA 1C0KA 1NNUA 4XJSA 2UUPA 3TZQA 1X7GA 3T7EA 3MJCA 1JAXA 1PS8A 4P22A 2ZTLA 3JD3A 3MTJA 4RVSA 4UVGA 5ENVA 4E3ZA 4KWIA 4TMFA 4QO7A 4ZRMA 3VDQA 4RO0A 4CMIA 3U09A 1VL6A 1SEPA 4IM7A 1OAAA 2ZTMA 2O3QA 3JSAA 4XR9A 2ET6A 5EESA 3R1IA 4HBGA 3KRTA 4Y98A 1EVZA 3JTMA 3NRCA 3G1UA 5JCJA 3FNHA 3I9LA 4UEOA 1E1KA 1I2ZA 3GUCA 1B15A 1GPDG 3TFQA 2Q1TA 3AW9A 4NFSA 3EVNA 5EL0A 3WGOA 1DXYA 5A3JA 2ZCUA 1UXJA 1J4AA 3WMXA 1E3WA 4PVCA 4HUJA 1K89A 1QORA 1YDEA 4I08A 5L4NA 3IKTA 1E5QA 2DUUA 3R6DA 4BL5A 4BGIA 4CL3A 4QEDA 5EIOA 3RBVA 1GADO 1Y81A 5A04A 1E3IA 3CMMA 4DTIA 1NYTA 3KETA 1ARZA 4Y8VA 4QFCA 3HN2A 1U9JA 4MJLA 1R37A 3H65A 4JNKA 2X7HA 4NI5A 3PRJA 1KVUA 3TNLA 1CWUA 3QVOA 4RVHA 1LDYA 4ND2A 2O3RA 3F1KA 4RF5A 5K0ZA 3A4VA 4R41A 4CR8A 1DRWA 1PZGA 3K96A 1XR3A 3QW2A 2NWQA 1UDBA 3ENKA 2HJRA 3JQ7A 1E6UA 1C1XA 2NNLD 3EY4A 1E77A 4RDHA 2O3SA 3O9ZA 2I76A 1WXDA 1GEGA 4WCFA 4X54A 4BO0A 2W98A 2YV1A 4BB5A 3K8ZA 5B12A 3GAZA 3S2IA 4A03A 2FPGA 4FC7A 5HRUA 1I33A 3KHUA 5DN9A 5B4UA 9LDBA 3OF2A 4EYEA 1Z75A 2YUTA 1U5CA 2FPIA 4RL6A 3I9NA 4PZCA 2NU7A 2HCTA 3AI1A 2CD9A 4LW8A 5BSEA 3I3OA 4IINA 3GG2A 3KEQA 3JQ8B 3U4IA 1C0IA 4NH4A 3I6QA 1LDGA 1Y7TA 2CF6A 4RPGA 3HFSA 4ND5A 5JDCC 5A03A 5JDIA 3DWFA 4GSKA 2OORA 2XPCA 1SNYA 3AK4A 4II3A 5CG2A 5IN4A 3TF5A 3BMQA 1DDOA 1B8PA 2PR2A 4IXWA 4DYVA 1PJLA 4IIVA 3H9QA 3QWHA 4BQRA 3WWYA 1LLQA 3L4SO 1GZ3A 3CE6A 1E3EA 4DWVA 3RIHA 5DT9A 1XQ6A 1EK5A 2DBRA 2DPGA 3BMCA 3EMKA 2VZ9A 5TC4A 4ZHSA 5K6AA 1N1GA 1TVEA 2PY6A 4UAGA 4WE3A 1YRLA 5ES3A 3O03A 3QVXA 2V6MA 4Z3KA 3HJAA 3JD1A 3H3JA 4IDAA 1Y5RA 2D59A 4E12A 3NTRA 4KWHA 3D64A 5DP2A 4ZVVA 1ZXBA 5DP1A 3GHHA 2J3HA 4WNCA 4CM4A 3RFTA 1GZ4A 1IULA 2BD0A 1SZJG 3D5QA 4YTEA 4BGUA 1T4BA 4Q3CA 4YBZA 3DMYA 4MIYA 2UV8A 4R1NA 1F8GA 5ITVA 2FWMX 1H6CA 1NP3A 5KJ6A 4AG3A 1Q1NA 1H2HA 4L4XA 4PG8A 1U8FO 2EIHA 2VQ3A 5EMHA 4ZD6A 1ZZEA 3WGHA 1VJ1A 1KS9A 5CDGA 4AJLA 3INGA 2GZ2A 3DDNA 3HDQA 3JQAD 4QT0A 3TZCA 1P31A 1HYHA 3GF4A 3RKUA 3IJPA 2W8ZA 4E0BA 2IRWA 3D4OA 3OH8A 4HKTA 3E82A 2HK8A 4Y6RA 2TMDA 2AMFA 3ORFA 3BHJA 4JCOA 3WFJA 4DPMA 3QA9A 2E6UX 5A06A 1OMOA 2O2YA 5TJHA 1A9YA 3DBLA 2CDAA 5JDIC 3AFNA 3K9QO 3E03A 5I7FA 3OQ6A 4BGVA 3EVTA 4CQMA 4OXKA 2P68A 4IXTA 4NJMA 5CP8A 3NX4A 3FPLA 3VZQA 3L4BC 4IS2A 4Z0TA 1GCOA 1K5HA 4XJTA 2VOJA 4CV2A 4MOWA 3MWDB 3HE3A 2X9NA 3N7UA 1DB3A 4WLFA 5KVVA 5T5QA 3VH3A 5KTKA 1BTOA 3AM3A 1HDXA 2NV6A 3V5NA 3D1LA 1DRVA 3AY7A 4XGNA 1Q0HA 2O4UX 1TT5A 1O95A 4BMSA 3OIGA 2NVUB 4E33A 1IHYA 2C5AA 3FSRA 2GYYA 3G79A 2C82A 4M49A 3BMOB 1A7AA 1O5IA 1PR9A 2W2KB 4L8VA 2FN7A 2YDYA 4QECA 1DIBA 1MA0A 1C1XB 2PGLA 2HAEA 3UKOA 1LTHR 3E9MA 3KYDB 4OMUA 1T2EA 2PD4A 1MX3A 3UXYA 4G5HA 1ISJA 1LA2A 3NEPX 4U5QA 1I0ZA 4DVJA 3L6OO 4LVCA 3TWOA 4H3VA 2XXBA 2BFMA 3DZIA 5L4SA 4FJ0A 5JYDA 2X22A 1NXQA 3DBHA 3QRWA 4O5OA 2G76A 3O38A 5IAAA 1CETA 3Q9NA 3FBTA 1MLDA 1KEWA 2PFGA 5JE8A 5DBIA 3VVBA 1BXGA 3CZMA 5AXDA 1ZVMA 3GQVA 3QY9A 5ILOA 1DIAA 2WTBA 2Y0DA 2X5JO 2CZCA 1KEVA 3EW7A 4J91A 4NHEA 4GQAA 4WCFC 3BMCB 3RUFA 2I9PA 3VVCA 2AQ8A 1J49A 1LQUA 1DPGA 3G17A 2EJVA 3OJEA 1ZUD1 1EE2A 3S8MA 2Y66A 4B7UA 3DHEA 3Q2KA 1UDCA 5KJCA 2B69A 1BHSA 2GGSA 3ZWCA 4AJ1A 1H2BA 2WDZA 4OM8A 3QVTA 4XQGA 3UUWA 1YE3A 2R2GA 3IMFA 1MG5A 2D3TA 4L4RA 1T2AA 1SC6A 4UREA 2CVZA 5G0SA 4BNJA 4CUJA 3GEDA 4GAEA 2C54A 2EF1A 1ONPA 4UVHA 1W6UA 1E3SA 3U4DA 3WGTA 4ZA2A 2PK3A 4XQ9A 3DBRA 4RVDA 1EUZA 4IDDA 4LVUA 2OUIA 3H7AA 4YT4A 3GOHA 3HDHA 1HDRA 2NVWA 1HL3A 3E18A 4MVJG 4CLRA 1T24A 3EUWA 4OYRA 2W2LD 1HWYA 2B37A 4E5KA 1ZW1A 3S2GA 1VKOA 3L9XA 5AXAA 3GZNB 4YT8A 1EVYA 1T2DA 4WLUA 1P1FA 1Y9AA 3HB4X 3ZWAA 1RM5A 4A26A 2EP5A 3AI2A 1P1KA 3MJEA 2R00A 5A5FA 1Y8RB 3LLVA 4K9DA 4BNWA 2HO5A 1EVJA 5JMWA 3V2UA 1GYRA 1XYGA 2A94A 4S1VA 5JAIA 4BO2A 3WBBA 1MB4A 1QR6A 5GZ3A 1HDYA 1B16A 1AGNA 1VJTA 2NTJA 3GR6A 2B5VA 4G65A 2Y0EA 3GFGA 3NT5A 4IDEA 1UH5A 2VHWA 2NQ8A 3R0IA 4L9RA 3HHPA 3PP8A 4J7UA 4GVXA 3I9OA 1C0PA 5U9CA 2GN9A 3W6UA 1M67A 1I36A 2ZB4A 1PJBA 3JQGA 3RAJA 2LDXA 3NJ4A 4RLHA 4Q3NA 4JP2A 5F3RA 3PQEA 3WMWA 1AXGA 4M54A 3LK7A 2PTGA 2NACA 3PHJA 1UAGA 1Q7BA 3AU9A 3FNEA 1CQIA 3H8VA 3PWZA 3U5TA 3TFOA 2EGHA 3A06A 3KTDA 4AL4A 1VLLA 2VHYA 4YA6A 1KOLA 3M1AA 3ZWYA 5L95A 4FFPA 1F8FA 1IB6A 2J8ZA 1E5LA 3P7MA 5DCWA 3I83A 3PLNA 1E3JA 1V9LA 1FDVA 1H6BA 2XXJA 3JYNA 4PRLA 4NDNE 4IQ8A 1B7GO 3WX0A 4OIMA 2Y67A 5G4KA 4EI2A 3BXXA 4OQZA 3TN7A 2VT2A 5JCJD 4YQZA 2HMWA 4MIOA 3O8QA 2VNAA 3KXDA 1XGKA 4NBWA 3RUEA 3M2TA 3ZWWA 3DBLB 4YT2A 3GY0A 4XEHA 3ZWMA 1ADCA 4BIIA 1LUAA 2B4QA 2ZB7A 5CDYA 2VRCA 5I7VA 1M76A 2HMUA 2XOXA 3AY6A 3WR5A 3VPSA 3ZWBA 4CQMB 4C7KA 3AU8A 1LDNA 3GGOA 4J1SA 3ZV5A 1K2WA 2NADA 1KEUA 2HSDA 4I5DA 3VH4A 4J1TA 2GASA 1QLJA 2F00A 3KUXA 3L07A 4XYMA 3HUDA 5G4LA 1VL0A 1ZMOA 1TT5B 3K2EA 3WQQA 3QE3A 2NQTA 2JFHA 4D3DA 3GAFA 2B35A 2DC1A 4DC0A 1B3BA 1F06A 5TRTA 1ZH8A 1PGNA 2GPTA 2DFDA 4JROA 4XCVA 1DJNA 4BNUA 4DGSA 3GC6A 4KUEA 4BNIA 3DBRB 3CXRA 1PJSA 1YKFA 3FF4A 1QP8A 4XYGA 1ZSYA 1HSZA 4DLAA 1LJ8A 1IL0A 1E3LA 1HT0A 4EW6A 4GL4A 3N58A 4ZRNA 1DC4A 1VSVA 3QWAA 1DC5A 3GNSA 2I65A 1H94A 3F4LA 3EHEA 3PWKA 2WD7A 1XG5A 3PXXA 4L74A 3ZNQA 4DIBA 1LRLA 1B8VA 2EGGA 1NFRA 1T25A 1A4IA 1HDCA 1DO8A 1T1SA 1PR3A 2FHSA 5BQFA 1Z82A 2IE0A 4RLSA 4OO3A 4TKMA 3JYOA 5JC8A 3RI3A 4YEDA 4D79A 5EJ2A 1PWZA 2YJZA 3IQDB 2AA3A 4RQTA 3UHAA 2X8LA 1XLTA 2YV3A 4EITA 4I9HA 1I24A 2P4HX 3GVCA 2ZJ0A 1U28A 3OICA 2HLPA 1V35A 4YJDA 1MG0A 1IZ9A 1M75A 2HJSA 2QG4A 4PLYA 4H15A 5G0WA 1QRRA 4CM8B 3AJRA 1FF9A 5FYDA 2I67A 4RVGA 5AXBA 2YHUA 2BRUA 3KV3O 3U62A 4Q39A 3SJ7A 3DO5A 4J4BA 3I9KA 2PD6A 4RDIA 1CERA 3AUSA 3MJVA 4JN6B 4GX2A 4ZU3A 1JKIA 5HS6A 2X0IA 1ZK1A 3RU9A 1HF3A 3V1UA 4E31A 3I6IA 4E2WA 1PJ4A 4FIZA 1NR7A 4UVDA 4DQXA 3S2EA 5JFOA 4A5OA 3RC7A 2ZTVA 3LYLA 3D4PA 3JD4A 1JVBA 1ZMTA 2D5AA 3ASUA 1YDWA 4QSMA 3M1LA 4PLHA 2CVQA 2G5CA 4IY1A 4W9NA 1PGQA 3I4FA 4P8RA 4IMRA 2VOEA 1UAYA 1GD1O 3OJFA 1P44A 3JQDA 3RUDA 3WLFA 1BVUA 1DC3A 3GH3A 4CR6A 2DQ4A 5TGDA 5C5IA 3OA2A 2BELA 1QYDA 4XKJA 3SVTA 1FDTA 5BR7A 2Q1WA 3EGOA 4YAIA 4RCVA 3ZV6A 4YRBA 3B20A 1JKFA 3KZVA 4UEKA 4BO7A 3B70A 5BSGA 1ISGA 4RPHA 3WICA 4CMIB 2O2SA 4QXMA 1BRMA 2O4CA 3I4CA 2XAAA 3H5NA 3W1VA 3LT1A 3VZRA 2G0TA 5EPOA 4NK5A 3FTPA 4YVFA 4BV9A 1JW9B 2Y1CA 1RKXA 4YPOA 2AQHA 1P0CA 2NU9A 4O59O 3F3SA 2GERA 1Y8QB 5IF3A 4K1LA 2J5QA 4MVJF 4LCJA 3ADPA 1H6DA 1X0XA 5DBGA 4CM5A 5A9RA 2EKQA 4PRKA 3JQEA 1CRWG 2PNFA 3BIOA 5IXSA 3FN4A 4CM9D 2B36A 3STHA 3ZU5A 3KO8A 4RF2A 3TSCA 3WGIA 2X4GA 4ALJA 4AJJA 1C1DB 2IZ0A 2BFPA 3PJGA 2ZB8A 2P5UA 1D4FA 1CF2O 3ICCA 4MP3A 2HDHA 1NX6A 2Q1SA 4XRRA 4XDYA 3HQ4O 2VUUA 2J3JA 1ENYA 1Z45A 1ZKMA 2EEZA 4BVAA 1MV8A 3ZHYA 4FCCA 7MDHA 4XR4A 3OETA 1EBFA 1LLUA 3BTSA 5C3MA 3RBZA 2DTDA 4PLZA 1JA9A 2FSVA 2WMDA 1E6EA 2IYPA 4EUEA 3ICPA 4KTTE 3SC4A 4HFRA 4MO2A 4EJ0A 1JU9A 3KSUA 4JLWA 4OAQA 5KKAA 2IYOA 4RVUA 1EQUA 2JL1A 2D8AA 4KUHA 1UZNA 3HB5X 4FDAA 4R1TA 2X6TA 1TLTA 2YV2A 1NTOA 3BAZA 3IC5A 5GZ1A 3LVFO 5IFLA 1ADFA 1ML3A 2D5CA 2VTEA 5L45A 2B0JA 3DZHA 4CJXA 2BI8A 4W7IA 1ZXLA 5DCUA 3BTVA 4CMHA 2QW8A 1VKNA 1XU9A 2AG8A 3KLMX 3EC7A 3H9UA 4PLVA 1I5RA 1G6KA 2NM0A 4Q3DA 2ZATA 3CINA 1ZIDA 1PL7A 4DC1A 4NR0A 5LC1A 2O50A 3ZNNA 2Y1FA 2GD1O 2AW5A 4B8ZA 3BMQB 1T2FA 3EZLA 3WTBA 1YVEI 2GN8A 3DMTC 2Y99A 1LBEA 1RM0A 3TZ6A 4BO5A 1DOHA 1P1IA 1E3WB 2DUWA 1HDZA 4XDZA 5CDTA 4IDFA 4J0EA 2NUAA 3VPHA 1VI2A 1KVSA 3Q9UA 1YXMA 3MCVA 3MJ4A 5CPFA 1FDSA 2C07A 3MJSA 2RH4A 1HEUA 2IXAA 1PJQA 2GF2A 8ADHA 2DBZA 2YHIB 4WKGA 3RBXA 1KBZA 4FGWA 3UW3A 4FSHA 2C2XA 3UGKA 2EW2A 4NBRA 5KWEA 1P74A 2DAPA 2FOIA 1LXCA 3H2SA 1U3WA 4FR5A 1BG6A 4Y6SA 1Z6ZA 5DNAA 5GZ6A 3FCOA 3PDJA 3EZYA 3QV1A 4AJ4A 5JY6A 1WVGA 3AM5A 3S1LA 5HA5A 4R9SA 4IMPA 4E2ZA 1WMBA 4TQGA 5I8ZA 3VTZA 3LT0A 5C7OO 1U1IA 3C7CB 3GNQA 2UAGA 2PZLA 2YYYA 1U4SA 4QUKA 3MJTA 2CDCA 4DBZA 2ZYAA 4A2CA 4GKBA 3JD0A 1U4OA 3TL2A 1GL3A 1VSUA 4NZ9A 3ROKA 4IPTA 5AOVA 4ALNA 3L9WA 2RCYA 2Q46A 2F1KA 4JK3A 4M87A 1EDZA 3K92A 3IAHA 2ZYGA 2B83A 1ZK2A 3P5SA 4CR7A 4CV0A 3WQRA 1NVTA 3B6ZA 3FHLA 1BSVA 3K30A 3EYWA 4D43A 3IL2A 3OQ1A 2BI7A 3LQFA 4BKQA 4F3YA 3A14A 3PPIA 3ZHBA 5MGBA 2Q3EA 4IDCA 5IZCA 4I9UA 2P4QA 2DU8A 1CEQA 4BQPA 4U8GA 1NHGA 2J6IA 2Y05A 4IGFA 4EGFA 5L7YA 3INRA 1R4MB 3PEFA 3IS3A 3DQPA 1AUPA 3JQAB 4NFYA 1ADBA 3NUGA 1YOVA 2UVDA 3NT4A 1HXHA 4RZHA 3PI7A 4CM7A 4GGOA 2O3TA 4PZDA 5JC1A 1QLHA 3WNVA 3H9JA 1CQJA 2NVUA 4ZJUA 5I9LA 3INTA 2D4AA 1QSGA 2CSUA 4IZIA 3ST7A 4ALKA 1BW9B 1B3RA 3WSVA 1XEAA 2PV7A 2JAPA 1VRWA 2PLAA 4CV3A 3OBBA 3KYDA 5BNTA 4OSPA 1IYZA 3A1NA 5DOZA 5TS3A 3UFXA 3A28A 1ZK3A 5ER6A 3V2GA 3KM0A 4Z9YA 1X15A 4MP6A 1PWXA 3KYCB 1RPNA 1WZIA 5JBIA 2GSDA 4KDEA 3FTNA 5T57A 5TX7A 3FNFA 1KY5A 4HFJA 3GT0A 3RROA 1BXKA 4DIOA 4D42A 2ZK7A 1YJQA 2Q45A 3QWBA 3ZCXA 4ZQGA 1U8XX 4GKVA 1CJCA 1DFGA 2E82A 2NLOA 2FZEA 4MKRA 4HNHA 1GU7A 5DZSA 4XB1A 2VWQA 1OI7A 4FFRA 4BO4A 2ZB3A 4R5MA 1EDOA 1YB4A 1JQBA 3LT4A 4DMLA 4YR9A 1JLLA 1U3TA 4OJNA 3FNGA 3QIVA 2FZWA 2EERA 2Q2WA 4XD2A 1V3TA 3I5MA 3HG7A 3SX2A 2WD8A 1N9GB 1WNTA 3WIEA 1H9BA 1E7YA 2GCGA 1LEHA 3I9MA 4M1QA 3OJLA 1X1EA 1GYQA 4RV9A 5GMOA 3HDJA 1WMAA 4QTZA 3DZJA 2DPHA 4IJUA 4BNFA 3T7CA 3ANNA 1GV1A 1T26A 1Q7GA 4PG5A 4QFDA 4QO8A 3PHIA 2V65A 2VCYA 1NR1A 2GZ3A 1RJWA 4QQRA 3JQBC 3NTOA 2P2SA 1QYVA 4WCDA 3BMNB 2QHXA 4TRNA 3KBOA 4IQGA 4JBIA 5F5LA 1ZBQA 2P9GA 3F4BA 4A0SA 1IE3A 2OOSA 1YO6A 3GEGA 3FR7A 4CMGA 2FY8A 4OKNA 4DYDA 3C1TA 4BNNA 1N2SA 3QWFA 3WQSB 2CNBA 4JJIA 3ZWNA 4TRJA 4WEOA 2BGKA 5L7WA 1LC0A 4J2OA 4B4VA 2VWPA 2IXBA 5JO0A 1AN9A 1SB9A 4JJFA 4KTVE 3WJ7A 2P5YA 1H0KA 3G1TA 2AE2A 1IUKA 4FW8A 5TQVA 5IZ4A 3ZV3A 3UF0A 4RF3A 1YGYA 3DL2A 5LDGA 4FFMA 4EJMA 4J16A 4RZIA 2YHIA 4NIMA 1IOLA 4J43A 4W4TA 2JHGA 1YH3A 3LDHA 4O6VA 5THQA 5HTOA 1ZFNA 3OJOA 4CLOB 3QHAA 1U5AA 1GUFA 4BO9A 2E49A 1VJ0A 4CLRB 2EHDA 4YJHA 4YYZA 4FJ2A 1Z7BA 4CLHA 1RM4A 1V6AA 2AEFA 2E48A 3LT2A 1X7DA 5H82A 4RVFA 5G0TA 3TPCA 5JCXA 3BTUA 4JQCA 3ZN2A 2VNSA 2GUGA 3FBGA 3Q3CA 1FDWA 2DM6A 3F46A 1SPXA 3KLPX 2FRDA 1IHXA 1PJ3A 4BNMA 3VKUA 4ILKA 3PFFA 4BNZA 1ULUA 1W73A 3RD5A 1NPDA 4NNJA 4E21A 4KZPA 3HWRA 4RPJA 5ITWA 4M8SA 1DRUA 3RC1A 4IBOA 4TZTA 5AVOA 5COAA 4CQMD 4INAA 3ZU2A 1A4UA 4CQLB 2A4KA 1J6UA 5TLSA 4FQ8A 1NPYA 3LLSA 2QZZA 1NHWA 2EW8A 3OJ0A 3ANLA 1NQ5A 2DKNA 7ADHA 4YJGB 5KNLA 3PWSA 4A73A 4YAKA 1SAYA 4K6CA 2Q2QA 3E6AA 1MC4A 1B26A 3H9EO 1QV7A 3ULKA 1QYXA 4DLLA 4EBFA 3UAGA 4RPKA 4PG4A 1Q2XA 4DPLA 2QYTA 4LGVA 4BGEA 1OFGA 2PGJA 3GNTA 3JQAA 4B7CA 1R4MA 1YONA 3F6YA 2HUNA 1NFFA 5CPBA 1TEHA 4RF4A 1BMDA 3MEQA 2WSBA 1HLDA 5CG1A 2UUOA 3JQCA 3C7AA 2G1UA 2NU8A 5G0VA 1HSOA 1WLYA 3DTYA 4NBTA 3RQSA 4P38A 5HM8A 4PLFA 4L4SA
chains in the Genus database with same CATH superfamily
1QANA 2Z2ZA 3KOUA 3OCWA 4UQPA 1NI5A 2QB5A 2HKIA 1XROA 1BW9A 3TLZA 3DEZA 2NT3A 2XDQB 2A0XA 5HXAA 1TZBA 1EEHA 1E0SA 4PFJA 5IM4A 2JIBA 4OH1A 1I0LA 1U2DA 2WZBA 3OZVA 3QHQA 3R0XA 4C03A 3GN1A 3GPLA 5AOCA 1IQPA 5PGMA 3R9XB 1DO0A 4WFQA 3ZHZA 1LDEA 1RWXA 1M1YB 2F90A 2QI9F 2Z3WA 3H8JA 4D0RA 4HNUA 3ZJ5A 1FFHA 2ZBGA 1RYEA 1ZI8A 4A2WA 1RPZA 2ZU0C 3OE1A 4FINA 1K98A 3TSAA 2I91A 5IAEA 2VQSA 4JYCA 4CGYA 1PFKA 4AY6A 1XFAA 3I52A 1H6AA 2HHLA 4GVLA 2I8CA 4YUAA 3LO5A 4TTAA 3ZXSA 1WV1A 2QUBA 4XE5A 1G66A 1LDBA 3TIIA 1KVQA 4EFLA 3F5DA 5CB0A 4GM4A 4R2KA 3G49A 1WE2A 1M1XB 4YMGA 3UGJA 2AQIA 4CPDA 2AEMA 1AU9A 5CH5A 1UQRA 1EGHA 1DT5A 2J7PA 2G8LA 3AKCA 3BD6A 3N6VA 2QRJA 3BB3A 1PZEA 4X84A 3IODA 5JECA 1GZ6A 1ZOLA 5CFNA 1P77A 4KQWA 1JYSA 3ELYA 2QVBA 3QXCA 2J0EA 3F8TA 2HPHA 3A7DA 3FMFA 1R5NA 2XVYA 4EMBA 1TI7A 1THGA 2FPXA 2W43A 4MLPA 4QATA 1LZKA 3IUQA 3P96A 3G7NA 4QOSA 1Z2EA 3I5YA 1RLTA 4EI8A 1KL7A 2H08A 1DBVO 1M2HA 1S2DA 1TJ4A 3GFQA 1H93A 2ECPA 2UVPB 3QMPA 4LNUA 1BWRA 1J0BA 2ODQA 5K6TA 5KYNA 3HA3A 2LR0A 2J5BA 1EWRA 4TKVB 3DULA 1Z5ZA 3WSWA 3UJCA 4BP3A 2V03A 1R0LA 3DOEA 4P2BA 3X2EA 5CK4A 1M5UA 1NJ1A 2CL6X 3CRNA 3C3PA 3KKEA 3Q3GE 5EXPA 5DGDA 3Q0EA 2FR1A 2QRGA 3HVJA 2I3BA 4I1VA 5LB2A 1Q0RA 5DJ5A 4F9TA 3ETCA 4WPGA 1P1HA 4HH3C 1U2ZA 2XJ9A 3MSXA 4Q5IA 5DXAA 4F4HA 2PKQP 4K9PA 3U4HA 2ZT5A 2PPLA 3OIFA 2ZFUA 3P94A 2BZGA 1N5MA 3RE1A 1SKYB 1LK7A 2PJZA 3A1UA 2GHTA 1TAUA 2PKCA 3LFUA 2BR5A 4KWCA 4PFQA 5TMDA 2IEDA 3LZ6A 4B80A 1VL5A 4RTQA 2GFIA 4J29A 4YWJA 3AOGA 2P2YA 5HJ7A 1HQCA 1PKEA 4DUPA 4DCJA 2PWPA 3HSKA 3AZOA 3KEOA 3OM8A 4KFSA 1QK3A 3WIUA 4NCKA 4WKPA 3EAQA 3BERA 3PNVA 2WG1A 4BZWA 5I8PA 2XIQA 3DH0A 4EH1A 1RHKA 2O0MA 3JQQA 3QYFA 4QWWA 1H1LA 1BVRA 9MHTA 1JBEA 1UCFA 3JYLA 2B8EA 2P9BA 3TZBA 2XB6A 1PUIA 1AX9A 1W93A 2W4MA 4LKRA 2VI5A 2Q41A 4C4SA 4LYAA 5DO9A 4DB2A 2O7VA 3AYXB 1E32A 4MKFA 3WGGA 1JZSA 2JJQA 4KXYA 1N2JA 2PX2A 3A26A 2JBHA 1G8GA 1SUDA 3GPBA 5D00A 4E2YA 3UBTA 1H4SA 5A4DA 5T8KA 3B7PA 3O4GA 4MINA 2ZJ5A 2WKWA 3EH1A 2YZGA 4KR2A 2FFRA 2IC5A 4HMQA 4JBYA 2C4HA 4CW7A 5MN4A 1AB5A 1YMQA 4JR2A 4D0SA 1FUUA 2VPWA 4O2LA 2V3WA 3K05A 3KR1A 3RJ5A 5CUQA 2OCGA 2QL7A 2Q8QA 4AP9A 2O0LA 3KEMA 4H6XA 2BVNA 4NEHB 1NAHA 2WJ6A 1ZH4A 3V2IA 2OXFA 5AJZA 4HNTA 2HGSA 3MM4A 1B14A 2A9FA 2B6NA 2GDJA 3N8KA 2Q9CA 5AJUA 4EY4A 1CZOA 3RAFC 3FI0A 3BMOA 1OHHD 4ONEA 3PPVA 4X60A 3AJDA 3M81A 3LC2O 1PAUA 1PR0A 3RVRA 5BR4A 4EHFA 5ARBA 2QE7A 1WXGA 1NQVA 1JVSA 2Q5JA 3HU3A 1Z5VA 3S1SA 4G97A 1YOBA 4JUCA 3RUCA 2HWYA 4OJKA 1SVUA 3BX1A 4MPDA 1WAMA 4W1RA 5FNVA 3TLGA 1UBRS 3U80A 1GGJA 2B8JA 1WDTA 2C0CA 4JS0A 5JAOA 4EMTA 5HM6A 5C32A 1GLNA 1HFJA 2FSVC 1VMEA 4OA5A 4X1YB 4UOQA 2JBWA 4NU8X 2WOJA 4X00A 3R0QA 5HYVA 2ABWA 4BEWA 3FJYA 3PIDA 3OQNA 2EZUA 4UEQA 3TQRA 1Z28A 2IGBA 1A2OA 4H7FA 5CTAA 1W4BA 1GPNA 2Q1YA 3D3WB 4G4SP 3TW0A 2YX1A 1JV2B 3GGPA 3H0CA 4DV0B 1JA1A 1Y3BE 4LOJA 4ZMSA 3S7ZA 3MGKA 4BUCA 3WLSA 2C7GA 3R0VA 4V0ME 4HNRA 2MT9A 1Q1AA 5EVJA 3AVUA 3BRCA 1GPYA 1SHUX 5DWVA 4MR9A 5JNRA 3EPKA 3L8FA 5K0SA 3E9NA 1XJCA 2QNIA 2Y93A 3PL1A 4ZV4A 1JL3A 1OYOA 3L4BA 4D3FA 3A36A 2CHQA 4PHHA 1CYDA 4ZJPA 5SYMA 1DQSA 2FR8A 4JLDA 1GPAA 1O89A 3RC9A 5HVNA 4TQAA 3L4JA 1BDIA 2D13A 4LHXA 1VBNA 1J8QA 3ZV4A 4JLVA 1DL5A 1EFCA 1XKTA 1B74A 1Z07A 2OY0A 4HGOA 4MUGA 3T3HA 3WLMA 1DWUA 3DZ8A 3JZMA 3H97A 4I4NA 4QD3A 4AS3A 1R0SA 4X1IB 3SYRA 2EGUA 2QMYA 5IM5A 1EQ2A 3OCYA 2B2XA 4NPCA 5A5EA 3AVWA 2Q8PA 5KYVA 2J9RA 3OOWA 1OT3A 3F3YA 1C14A 2OZPA 4J7XA 3OJXA 3N5CA 2NUAB 4FYIA 3B89A 3V32A 1GP2A 3ZBTA 1YVDA 4QAJA 4Z1MD 4QYSA 3TZLA 4P4UA 1VE7A 4IZHA 1KMIY 4YP1A 3IDSA 3F47A 4C29A 1CZRA 2DFKB 3AI3A 1IK4A 5HDBB 3HP1A 2QN9A 5A2QA 5ICCA 2A5DA 4ZALA 1TAQA 2E5LB 3ZW9A 1G2QA 1MGOA 1OXBB 3KJIA 4ZC8A 3KXKA 3CX3A 3IHKA 2WUFA 2V8BA 1EEXB 4NJOA 3BVPA 4C06A 4F7DA 5C8DA 5CBPA 5KBYA 4O3FA 2R6ZA 3AEZA 5C7LO 4Z4IA 1RXWA 3JQFA 4P33A 1JQLB 3CVOA 1V71A 4R0MA 2OCDA 4MVJH 4B81A 1MPTA 3NFYA 3WGZA 5BYKA 2AI3A 1QHHB 2DECA 4ND1A 1BMFA 4EKEA 1MEOA 1ESCA 1L4EA 1G5IA 2VWHA 1CQPA 4RA9B 4YB8A 1H8HA 1XCOA 2QT9A 3WMFA 1GTG1 4B34A 3LRTA 4FOTA 3M1YA 2X1VA 3L7JA 4H0NA 2BCGY 3C48A 1TAGA 2Y6VA 4Q01A 4AZ3B 1TYZA 3JASA 1J2YA 4XSHA 2G07A 3HB1A 3ZDFA 3ZWVA 4CMAA 3L7CA 4QDOA 2I2XB 4ND8B 4KO4S 2JLSA 3ZU4A 2HHAA 5DHPA 3AM1A 4ZN6A 4M8NE 2Z1MA 4EOGA 1UODA 2FQQA 4IILA 3WVNA 2CWWA 4ALLA 1MDFA 3COZA 2YJGA 1C9MA 5E1MA 4C01A 4QTXA 2NUPA 4I8XA 2NQ2C 1KYQA 4CLXA 3AHFA 2ZKLA 2CE2X 3RLFA 4BMVA 4O2BA 4DDKA 2X5XA 1RJEA 3R7SA 5KYWA 2ZIZA 2D0DA 1T4DA 3OZTA 3NTQA 4OB8A 4REQA 1FXSA 3LW7A 2H29A 3B6MA 4IEFB 4LNUB 1P2UA 4AJEA 2OV1A 4EG5A 3AP1A 2GHQA 4P7KA 3EA5A 5CK5A 3FE2A 2D1YA 5EXXA 3AKEA 5I7RA 2C94A 3AR3A 1U8CB 1I4EB 2B7CA 4H1HA 2ZYSA 3DGFC 5KC9A 2TS1A 5DK6A 2QORA 2QM3A 4DLPA 3DD5A 3VKGA 5AJHA 1GL9B 2CGEA 1XWFA 4N01A 5CHEA 1S9DA 3RFCA 4A16A 1XD2B 1YT5A 1LNQA 4ZZIA 3KQLA 3P19A 5E6SB 1YBMA 1S7CA 2G9NA 3SF8A 3HKEA 1K86A 4EGSA 2IT1A 3K70B 2ZSEA 2ZEJA 3GVIA 3N0TA 3SSMA 4D56A 5FWXB 2Q3CA 4GWLA 3OOEA 2DTEA 3L7LA 1JQKA 2XWPA 3I9JA 3ZWXA 5J5AA 2ZRLA 3BA1A 2UXBB 5EJ4A 1V0JA 1YQDA 4ZDIA 1R8YA 4YJFB 2HA6A 2FWNA 4L15A 1L6IA 2ATVA 4DY6A 5IWAB 2C5EA 3CRMA 5ANRB 2ZQZA 2RGNA 2DT5A 3GZTB 1P0FA 2H1HA 4GGPA 5DYGA 5K8CA 1WB9A 2IYQA 2HI0A 1H85A 1XZEA 4DJFC 1M6EX 2SCUA 3OFND 4WMLA 2GR9A 5KOIA 1EQAA 5JZMA 5HFNA 4AZVA 1XO1A 1H2ZA 2H2IA 1L7AA 2E4ZA 1I3LA 3A25A 2O52A 1JWLA 5AICA 5MGNA 2E1PA 1MQ8B 2HMSA 3NWBA 5AKHA 2O2GA 4HJXA 3GVXA 2ODEA 4QG3A 4OXNA 1A7KA 2Z08A 3M6LA 3TSZA 2DEUA 1U0EA 4M1WA 5LWQA 3QU5A 5JOQA 4ZQCB 4NZNA 4FMCF 4KMOA 2WM2A 3T7IA 4QZVA 1MFZA 2NTYC 1TYCA 3CPJB 3ZE8A 4AS2A 4LHYA 1MJ5A 1JDTA 3VTKA 4B4OA 4J0GA 5I7EA 3COVA 2I2BA 5FFMA 2FWIA 1CZKA 3EN0A 4L0DA 4EVSA 3D59A 1DBPA 3K1TA 4LWZA 1MENA 1SO8A 4O4JA 2N9UA 2RGRA 2PUHA 5I5GA 4CIXA 3LC7O 4A36A 1OPRA 3CVJA 3OZGA 2YFHA 5E4YA 4XH9B 1GZUA 4ZODA 3W7VA 3HBJA 4MW2A 1RXEA 2NSLA 4OSOA 5AFSA 3ONWA 4K87A 3BWCA 3NT2A 3M6WA 5B1YA 2XYQA 1FMCA 1K68A 3F74A 3G2PA 1HOTA 4Y2QA 5JPIA 1GY8A 3BXEA 5H81A 5EPUA 1A76A 3RIMA 2A0WA 3DZKA 3F6BX 4ALIA 2OGWA 5IULC 5BQPA 2PR7A 2MIIA 3HB7A 5IBCA 1MC1A 4I9GA 3AFIA 2RAFA 5F12A 4DIMA 4BVEA 4M1TA 2PKXA 2ZTSA 3Q2IA 5AHOA 4B35A 1ZU4A 3TRFA 1BMTA 1JDJA 3JVVA 1M1NB 1S3GA 3VVMA 1N9GA 2IYRA 4D8XA 16PKA 1BDBA 3COSA 4EARA 4R8LA 5TT0A 4PG7A 1ZS9A 2GO1A 5F33A 5A3VA 3ZVLA 4AJ2A 4CVNA 4O2AF 3TJMA 4D97A 1DWQA 1GT6A 1RXCA 2VXOA 2JLQA 3GLRA 4OHFA 2EX1A 3X2FA 3ZU6A 4CF4A 4Y0VA 4UBMA 2JFYA 4BBAA 1IDOA 1L7DA 1XL0A 2VHZA 1REQA 4FDTA 4YJ3A 1JEYA 4WKOA 1LSUA 1AKQA 1H5QA 2XVAA 1CB7A 1OH6A 4E4YA 3E2IA 4P4GA 1AUQA 4Z0NA 3H2YA 2GK6A 3GCGA 1FFXA 1GZHB 5EINA 5ICEA 1ZD5A 3A3PA 3KU4A 3G5LA 4LOIA 4B74A 1NN0A 2G6BA 2G6TA 3RW9A 3FTEA 2BJWA 2NW6A 3KOXA 2J4DA 4OXYA 4OP1A 4RFSA 4Z4GA 1CX9B 3UOAB 1JDVA 3ZGOA 1O9GA 3MWFA 4IICA 3GRUA 1FRZA 3ZCTA 2BFCB 3SQMA 2FOLA 1U2RA 3DD1A 5F2OA 4Q7QA 1T6ZA 3AB3A 2GVZC 3E4CA 4ZGWA 5C8YB 1XCPA 2NU6A 3KPYA 2OV2A 4PNEA 5M34A 4RTRA 3UOGA 4RIHA 1KIMA 3M6FA 1JS1X 1Y1RA 4YREA 4XIIA 1IC6A 1RAAA 4HH1A 4ZVNA 4OG2A 4UXJA 5MN6A 2IY7A 2R8ZA 1W1IA 1Q5PA 3R3SA 4FN5A 4L5AA 5TNXA 1CKEA 1BO6A 2HDWA 5AHKA 5KYTA 1HV8A 1N2HA 4C6SA 4HUQB 5F1OA 2HR1A 3JQBA 2KSQA 1F2VA 2ZJ1A 3LPNA 3W3AA 4K86A 5DLPA 4JB0A 4J9VA 4F8EA 4GR4A 1FEZA 1AHNA 5HQTA 9LDTA 4PANA 2ZRFA 4LOAA 3CUTA 4WOBA 2VHXA 4Y9DA 5FB3A 2X2EA 3VKVA 1BJRE 1NVGA 5F51A 2KBEA 2X13A 3HB9A 3OOYA 4H7PA 2GM9A 1E5VA 3L84A 3T5PA 2O2DA 3I8XA 1HZJA 2WWRA 2H2DA 4FEAA 3IEVA 1ZIYA 1KDYA 1ULSA 3ER8A 2IZZA 3PCXA 4YV0A 1SUBA 2OO5A 1PL6A 1MAUA 1V11A 2FQYA 3KYBA 4MAMA 5FR1A 4G56A 4BFZA 1Y3AA 1XLWA 3QU4A 4H3KB 1TMKA 4BVBA 3UKJA 1FJHA 4V0OA 4YGXB 3IUBA 1FY2A 2JFFA 1LPOA 3EWSA 1KYWA 3F78A 3LBNA 4O4LB 2RARA 2GZRA 3NETA 3D6HA 1NU8A 1VIYA 3G2JA 1I10A 3ID6C 1DAMA 1ENOA 1IOVA 2XF8A 4Q4HA 1LBQA 3BWMA 3HVRA 5DYIA 1VBKA 1Y80A 3VNBA 2H6EA 3BILA 3BREA 4C78A 3JASB 5B37A 1KOFA 4DGQA 3CLRC 1SXJB 3E7FA 4JEHA 2J85A 2FAXA 2W11A 4BZQA 1SN7A 1EDBA 2VSFA 5CFMA 3U19A 1Y4SA 3IQEA 3E81A 1FQWA 4Q9AA 1PGPA 4WZAB 4XRGA 4G8BA 3UCEA 3HNPA 4P4LA 2VH2A 3FB1A 2Z2IA 3LPDA 2HA5A 1UOEA 5GGYA 5FBWB 4HWPA 3ZNPA 2EVWX 1Y6ZA 4HB0A 1LRJA 2V7UA 3KKNA 3B85A 4JLNA 3PQDA 3G7SA 3KQVA 5CNKA 1XNHA 5FTWA 5L3ZA 2ESRA 5KYWB 3P2IA 4KVAA 1IEQA 3B9RA 1R2QA 3GXOA 5EFOA 3P4YA 2HNBA 3UICA 1Q1BA 1YR9A 2MHCA 2IOFK 3GA0A 1RBZA 5F5XA 1T36A 1IPHA 2W6ID 3E1GA 2JD2A 1ZOOA 2ZI9A 4UHEA 3O94A 4WXPA 1ORRA 4RFLA 2BY4A 1NXVA 3GJ7A 3JWJA 1NULA 1XD2A 3C70A 2GRAA 1MVLA 3SYKA 3FYUB 2DYKA 1NOKA 2RH9B 3LQQA 3MOGA 4MGZR 5CU7A 3VYRB 4F92B 3DZCA 2FW8A 4GC5A 4F11A 3U7GA 4N3GA 5ELXA 1THZA 4PNHA 1UFOA 5TVGA 4DSUA 2ALJA 3NKFA 3R0ZA 3U7EB 4C5AA 1P2GA 5HIJA 1NXSA 2VUIB 4C0BA 5JY1A 4BFYA 3MA0A 5CA1B 1P1RA 1XLVA 3F9IA 3PZBA 1FUIA 2PX5A 3E1KA 4RZ2A 1S2GA 3RSFA 3DFZA 3G23A 4KIJA 3HY3A 1X1CA 3HJBA 3NUZA 5THXA 4CL8A 4HC4A 3U7IA 1Z0UA 2R6JA 4NBKA 4Q7JB 1EP2B 4HNQA 3SU8A 3EFEA 5JS8A 1OXKB 5C81A 4IX1A 4N0EA 1J06A 1S2MA 1DWPA 1XDGA 2QZPA 3JQPA 1K6XA 1JHZA 1Q22A 1X39A 1UBEA 1YJAA 2AE1A 3MK31 4G8DA 4P54A 2I1VB 3S5UA 4C04A 4NBVA 1FB5A 4J75A 3UNXA 4H4CA 2JH3A 1WETA 3M89A 4FOPA 1SKYE 2H07A 1O0BA 1YQGA 2SBTA 3C87A 1HYBA 1JAYA 1BXRA 1Z15A 2ZW9A 4LXHA 1T3ZA 4MKHA 3HFRA 3TEJA 1MZPA 2V6GA 3KJXA 2CT8A 4S24A 3BBPA 4NJMB 4FGLA 3R3JA 1TJNA 1UFVA 1FFDA 4LF7B 2EARA 2XBUA 1RAHA 2RIRA 1JIXA 1L5QA 1J2RA 2OCLA 3L0IB 4HRYA 4LZPA 4FYXA 3ZCSA 1D2MA 2XZPA 3KAPA 1I8TA 3LH5A 2M9MA 2XUFA 4R69A 3TX6A 3V3KA 3CPSA 4CTKA 4MKZA 5HJEA 1U1EA 5FBRB 1J23A 3ZHRA 5BPHA 3U4MA 3ZEIA 2FRVA 2OORC 2J9XB 2QYSA 3HEAA 3U7QA 5LP6B 1KMHA 1PQUA 1U3VA 3KIPA 3KPVA 1XLUA 2XADA 4TYMA 2HBYA 4LJSA 1RYNA 1YS6A 1GU0A 1M2GA 2P2CA 3D2AA 2FSIA 3L46A 5IVIA 4EG3A 5J47A 1GKIA 1JHQA 1Y3IA 1C5KA 4K9OA 4GNRA 1DAGA 4A6PA 3RUIA 1HC7A 1R4ZA 1G9SA 3UJ8A 2OYCA 1BMFD 2VAVA 1SWWA 2C2OA 2Q5CA 4J7AA 5BUSA 1FIUA 4QLAA 1LU9A 1NFQA 3V34A 1FP4A 3RKSA 2ZB2A 1D6SA 2YVQA 4WLEA 1I80A 2P3OA 4LMRA 4MVXA 4XWYA 1T9AA 3BCSA 1W59A 3JQ9C 1G6Q1 3NKLA 1NZJA 2CEKA 2VZ0A 2QYOA 2JEOA 1K97A 1P7WA 3TQHA 1KQOA 3NIFB 4U6QA 2ODAA 3NV9A 4C20A 1PQWA 4TVBA 1OA1A 3C6QA 2F1RA 2XT6A 4FHGA 3Q1LA 2O0HA 3CX6A 4JV5B 2PT6A 2R6HA 5ICMA 4Q66C 1GR0A 1GGFA 3CVVA 4K2HA 1PSDA 5ITZA 4CHTA 3OM9A 4PWYA 3UHFA 1T1JA 1NWCA 2VTDA 4PGMA 3R2JA 3HJTA 3S6JA 2HW8A 1UPBA 4I1YA 1E9RA 1Y4AE 4C4XA 1D3AA 2GDZA 3KPJA 2PIAA 1HTTA 3ABRB 4LJKA 3MT9A 4BE9A 3NIGB 1ETHA 2GBIA 3A9WA 3GDOA 3OE7D 5EZYA 3RFXA 3FUUA 4KYVA 3CEHA 3NEJA 4QDKA 3UUWA 3IUSA 5KCZA 4NYJQ 1YUNA 5K6AC 1E7WA 8LDHA 4WASA 3LOQA 1D0VA 1A5AB 1MC5A 1H1DA 1SA0A 4IDBA 1EM8A 3ZUPA 4EQ6A 2FR0A 4ZVVA 3X2SA 2NAFA 1Q3KA 1ID1A 2IU4A 1GDDA 4B75A 3BEDA 3URMA 1QHIA 1DHRA 2Z6QA 3IV7A 5F3WB 3E7PA 2RAPA 1A8QA 1JFLA 4DT1B 1G8HA 3ZOKA 2CYBA 3AUTA 1N8NA 1MFPA 3GI1A 1XXHA 3PC8A 3ONFA 1XMOB 1I5OA 2OQ2A 1XDDA 3A4LA 4NBLA 4ZV9A 1QDEA 4WOPA 3CVYA 3THXA 1N5IA 3GWGA 1NM5A 1V1MA 1VFNA 3H9CA 2IEIA 5DLEA 4A23A 3ZTTA 3LI2A 3RCBA 3UJ6A 3UXEA 4JGIA 3RASA 3BZWA 5JD5A 3DBHB 4PXYA 1K9SA 2E85A 1R16A 4B09A 4EW1A 3CZ9A 3PIIA 4M86A 2JLAA 5IF9A 5JCPA 1A1SA 2QRKA 3VNAA 3GD5A 3UQYS 2OEPA 3WMGA 5BVGA 1QHGA 4L3VA 4MVJP 3WISA 5CITA 4YCLA 1Y8RA 2CCJA 3FPBA 3DLIA 2R4TA 1SIUA 2C9YA 4GKJB 3B1WA 2PYZA 1KJYA 1NU6A 2Q1UA 2UKDA 1P2TA 4LRUA 4B6FA 5F76A 2I4OA 1EVLA 3QPVA 3TIGA 3EW9A 5EI5A 4IUYA 4MV9A 3WHLA 2JJ2D 1NAIA 4WV3A 5LQDA 2NZVG 1IB0A 1DG9A 2DULA 3QG1A 4UVEA 3V4SA 1DBSA 2Z3VA 3I5UA 5IT0A 5ISMA 3QNMA 4BNHA 1LSOA 1PJAA 2BFOA 3LP5A 4IIBA 4TS1A 5G0UA 1K63A 4BLPA 1GNQA 3I42A 3QEOA 3F5FA 4MV8A 1GN8A 4WFIA 5EQDA 4C4AA 5LU9A 4P35A 2GCOA 3QH4A 3CJQA 4TVOA 4XOUA 1J0CA 1KMNA 4OAPA 4QE3A 5HZHA 4X1KB 4UMFA 3VSAA 4JWKA 4B9EA 1QZXA 2BUCA 3AJAA 4IJWA 4Z9XA 4LS3A 3VPAA 3E9DA 4Q9LA 5BSFA 4NV1A 5FORA 3F2IA 4TLAA 1TKRA 3SIPA 4YQYA 2QP9X 1TIBA 4BKUA 1EK0A 2OZVA 5LQNA 1LW7A 2C3OA 4XEUA 3T9AA 3ZHCA 5T4HA 4RY0A 4DZTA 4OQFA 4DV1B 2BMAA 3EXAA 5JCZA 3OY7A 4TM8A 1B2LA 3QTBA 4BP9A 4DMUB 4GXRA 2V6JA 4L16A 2GM4A 3E5RA 4IIXA 4PAWA 4CIWA 1NLZA 3L0SA 3UA4A 3M2PA 5FO1A 5CDUA 2D1RA 5KSYA 3KVYA 4KVZA 5A3QA 3OKPA 1FYVA 1UWVA 4PY2A 4RD6A 5BT9A 5F1YA 4BLSA 1ZZGA 1E3MA 2BONA 4YCAA 4Q3KA 3SZUA 3FTDA 4UAUA 2CHVA 4TRRA 5KQRA 4DAEA 2BJVA 3M49A 2IEBA 2MYPA 1LLDA 3DE4X 3N0VA 4KN9S 2QVYX 3U37A 2VA9A 1U7UA 3U3RA 1E0DA 1V3VA 3BMXA 4A91A 3LCVB 1KSGA 2XE8A 1OXUA 1CRLA 4GICA 3T1YB 3U3JA 5DI3A 2QD4A 1EK6A 3IQFA 4GBJA 5JAZA 2PWZA 4DR4B 3L82B 5K05A 3SKYA 2YYZA 4M0KA 2PZJA 3N8NA 1IONA 1R0KA 3D5EA 3TTXA 1E6MA 3HVKA 1QFSA 2PRJA 3B12A 2FEMA 4EYOA 2GLTA 4TS9A 3PVZA 4YO7A 3V1TC 3ILYA 1TCBA 4ZEVA 4OQYA 2BM1A 3A7EA 1RXSA 4HAZA 5LJIA 3IJRA 5AQ1A 1E3QA 2JCYA 3SDSA 3LF1A 4LSWA 5CJJA 5JVDF 3ZDQA 5DM1A 3UMYA 3BXPA 2DHEA 5T3UA 1KO4A 3NBYC 4QGSA 3N53A 3X1ZA 2JA2A 1QXSA 2WHEA 2XITA 3U60B 3D3KA 3MCTA 4UU8A 3DAYA 3P9PA 1XA0A 4E7OA 1M10A 2R7KA 1O94D 4JVNA 2WPNA 1A5BB 1N9ZA 1A71A 1KYZA 1RRPA 4G86A 5FI1B 1NNSA 1IPFA 2C04A 2VH5R 1WUJS 3C85A 4BKOA 1QIKA 1PYGA 2VCHA 2DX7A 3AIIA 3K0CA 4PCVA 4X20A 3TVYA 2QX9A 4KQ6A 3EVDA 1GRCA 1OZGA 4K6GA 3V1YA 2IJGX 1PS9A 4QOJA 1DJOA 2UUAB 3WGJA 1WV0A 4YR7A 1JTVA 2Q5HA 2QW0X 4GOND 1ULAA 3YASA 3ZIAA 4LEIA 2O8CB 5DDIP 3LCJA 3QEKA 5ALVA 2I4RA 4TLMB 4M1EA 1Z2PX 1G5QA 3ZHVA 2Y4OA 2ZIUB 3W8FA 1YL7A 1JLSA 3E9QA 5JNSA 2PGXA 3IDAA 1ID8A 3RRFA 4XGKA 4A2QA 3K9BA 3QVWA 1KTIA 1CY8A 4OHXA 1QNLA 4EGJA 4ESVA 1O87A 2J5KA 1QG6A 2J3KA 3DEIA 5J4LA 3HLYA 3U4QA 2UYOA 2EAUA 4CN9A 2E21A 3R3ZA 4KXXA 4DJEC 1PLJA 2V7VA 2REQA 1ECPA 3LK6A 2WIKA 5DHUA 4P32A 5HFJA 4UXIA 1FFBA 2JFGA 1MRNA 3O8QB 4FFWA 5IC5A 4L9WA 3HN7A 1TFRA 3CZQA 4FS3A 1OFHA 3FH0A 4FTWA 4G0WA 3IXLA 2GARA 3AF3A 3LD9A 4V03A 3BE6A 2I3ZA 3DTVD 1V2HE 2UXCB 3CX4A 3H6KA 4RCYA 2P2NA 4JL8A 1SVSA 1C4WA 3OWXA 2C8JA 4JL5A 5IFKA 1F2TB 3BSWA 1HZZA 2XUDA 3P2MA 2B1JA 2OC4A 2WSIA 3K0AA 1PTJC 1QRUA 2HT1A 1MAVA 2GM5A 5IZCC 4KE7A 5HCIA 3TO5A 3WNDA 3KWMA 1P4JA 4QFBA 3QOFA 1XZ8A 1BX3A 4NU0A 2OGSA 1U31A 3DFFA 1U90A 3LGAA 5A4IS 1D7OA 1TMOA 1F17A 1FPMA 1PKXA 3GJXC 1MU0A 5FPYA 3DKPA 4F60A 2W2VA 1OXXK 5HOEA 4MW1A 1P61B 4RJLA 4OQMA 1Q92A 4WZBA 5F1KA 5GOTA 5HZMA 5HF9A 1G64A 2HQBA 5BV0A 2HRRA 2JIDA 3DOJA 4DCUA 4WLOA 5IXYA 1PDVA 2PSDA 1T8YA 1MAHA 2YV4A 1M66A 5H3LA 1POXA 2OP0A 3CRQA 4RPCA 4GL2A 1XMQB 4RPLA 1M2KA 1DFHA 2WEKA 1U2GA 2V54A 4DQVA 3S55A 4FR2A 4KQXA 3LCCA 1KKMA 5K3CA 4CLOA 2FZLA 1HT3A 5T4EA 4YJ2F 2HRQA 1ZVJA 4JJ7A 3ROTA 2BR4A 4PO1A 3L3BA 3VU9B 3PDUA 4ZOEA 3SZMA 4PO8A 1CZLA 2O1EA 2WJGA 1V6SA 3BZUA 1W4LA 3OZSA 121PA 4HTFB 4M98A 4H1VA 4HGRA 5B7GA 2J6HA 3PUYA 1NKSA 2OHFA 2WYUA 3LAWA 5BUZA 2CF5A 2FUG6 5AH0A 3HZOA 2EQBA 3HR7A 1V4BA 2PWAA 1X0VA 1QIEA 3PQ5A 3I1JA 2FKNA 1RMTA 5I9IA 3TB4A 1IJBA 5D3MA 4AJHA 1G20B 4HK4A 3RS7A 2CLFB 3FCYA 4JBHA 1XQ1A 5E6RB 3WYBA 3DEFA 3FDIA 4JITA 1USKA 3T3PB 1B8NA 4ZHQF 2ONCA 1M34E 2Y1WA 3CNOA 4HDSB 1FSSA 4OLBA 3RYIA 4RY9A 2DLNA 5EN4A 3JRXA 1XK6A 1Y6QA 3PS9A 5ARCA 1FZTA 4ERNA 4XOIA 2JHFA 4ZZ1A 1QGYA 2MSCB 1QP7A 4OK3A 3QFRA 3GDGA 1KBQA 4YLEA 2GNOA 4W9NC 3S0JA 1MOZA 2NZJA 4HZGA 3HCOA 2JK0A 3F7OA 1OBOA 5JCOC 4BY9E 1XSEA 3WZLA 2VYNA 5CGQB 4BLQA 1QX3A 1BDMA 4DCPA 5ILQA 2D2EA 2RKWA 1FTQA 4V24A 5GONB 3JY6A 3UC5A 4YCDA 4A27A 4PHGA 1ZAYA 1LDMA 4IKEA 3FZYA 1WWKA 4PLTA 1QIGA 1TB4A 2DT8A 2GO7A 4MMXB 1FPQA 4XUGB 4JBGA 2HCFA 4UU1A 2RGUA 2Y1EA 3BORA 4H08A 4JYBA 4LSZA 5CNIA 1ZJJA 5IC6A 2IQIA 4B2PA 3QKSB 4DA0A 4FYKA 1K27A 1D1SA 2XODA 3QK7A 2JHCA 3OZCA 2C0QA 5DK4A 3WV5A 5TR9A 5TQ0B 5KI6A 3CE9A 3STUA 4AFNA 3QUAA 2VXYA 1C8LA 2PGIA 5K6RA 2VHJA 3KZOA 4XJSA 2J0UA 1YA6A 3TRKA 2YXBA 2HM7A 3NH9A 3VR5A 1C8VB 3MJCA 4MQMA 1PS8A 3HCWA 2OBLA 3QFFA 4ZO4A 4HVTA 3MTJA 4NENA 3U39A 1M1YA 1E2MA 3RFUA 3AHJA 2QUIA 2ZJ2A 3C3DA 3KJHA 4TMFA 3FY4A 5ENVA 6CHYA 2ERYA 5KOHA 4ZRMA 3VDQA 1VL6A 2WF9A 3IH5A 5IBPA 4P31A 2VXCA 3D8BA 4XWTA 3T3EA 2IEZA 5IBRA 3UJBA 3UW1A 3HDTA 1SEPA 2FK7A 3DG9A 4MW6A 4KR3A 2G5PA 4P0QB 2O3QA 1T13A 1VLJA 1I0IA 2J4FA 1D1QA 3V42A 3KKPA 1EVZA 3JTMA 1EHIA 2QBYA 6AT1A 3L8GA 4MWDA 1K8QA 3B60A 2YC2C 3FNHA 4TTIA 1IIBA 3ISVA 1LVHA 5IASA 4TL9A 4OHKA 2XRYA 2B8TA 3LHDA 4LRWA 3V4PB 3PA6A 4BEJA 1UL1X 1OZ0A 2J7KA 1VFPA 5F2EA 5HUHA 5AM1A 1DXYA 4ZT4A 2P67A 4BC0A 5F4BA 1XDZA 4A8JB 1JEQA 3QLUA 4HUJA 4X6LA 3U40A 2HTFA 4IH4A 3IKTA 2DUUA 1V5FA 4L0CA 3W79A 4BGIA 2IEGA 1XF9A 3V80A 2H0AA 2CYCA 1R6TA 4AIRA 4QEDA 5EIOA 3VPDA 4BQNA 4C0KA 1WY7A 1E3IA 1R0BA 2P69A 1FTNA 2ZSHA 2ZYWX 4M22A 3UWMA 2IYVA 4URVR 3WYGA 1QM5A 4Q93A 4Y8VA 3KETA 1R10A 2IITA 1L3BA 1D2RA 3DE1X 4JNKA 3H65A 4TMKA 5BWCA 1KVUA 2ZITA 3TNLA 3LO8A 2XXAA 5AM4A 1XNRB 4CN8A 4TN5A 3KKKA 1JDPA 5F7OA 4NOJA 1YHNA 1EIZA 1DRWA 1PZGA 2K7ZA 3K96A 1M54A 3EQ9A 5CAEB 1UDBA 3ENKA 4R8SA 3FCAA 4BFLA 3ZVRA 3DT9A 1QS0A 3B51X 5LFAA 1ICEA 1JAHA 2O3SA 1UMCB 1ZD8A 4JXJA 5SYNA 2H2HA 2N1MA 5IJ9B 5J3JA 1WVIA 4X54A 3RSSA 2A5GA 4BO0A 4INOA 3SAJA 4HNVA 4GNKA 1AKEA 2VJLA 2B7LA 2OLKA 4IO0A 1S8OA 4BN5A 2W7TA 2N3ZA 1BJTA 2XWBF 4A03A 2FPGA 2VF7A 5HRUA 1I33A 2YMQA 2Z8YM 3KHUA 3R3VA 4FDUA 4Y2RA 5FUYA 3AUKA 5B4UA 3ZVMA 3M7IA 1XTSA 2RAVA 1QRSA 3T95A 1U5CA 1UOQA 3TEMA 3G7UA 3TAHA 3N8GA 3I9NA 2FSUA 4JT8A 4PZCA 4NKRA 1STOA 3GG2A 3HA7A 3IUYA 1F2TA 4W5HA 3U5ZB 1UJCA 4OVKA 4ND5A 2J9FB 3FJ1A 3LCMA 3VZBA 1UPAA 5JNWA 1ECLA 1K8YB 4L7QA 3BMQA 1DDOA 4CTOA 4IXWA 3P5BA 4RTSA 2FWJA 4N8EA 4LXTA 4KFTA 3J81A 3D4LA 5DT2A 4BQRA 3WWYA 1LLQA 3D3QA 2NSYA 2CEAA 1ABEA 1RMQA 3IJ5A 4MR9B 5DT9A 1XQ6A 2DBRA 1DQYA 1I14A 1P0MA 3BMCA 3ROXA 1W0KD 4ZHSA 5K6AA 1M3SA 4WTOA 4QRHA 3GLIE 1JI0A 3Q9SA 1KQ3A 1YULA 4P7FA 4WE3A 3FDXA 5K45A 3EEOA 4RIGA 4QPZA 1D2CA 3FYSA 4MUKA 5EY5B 1PN3A 2V6MA 1OLOA 4Z3KA 5B3JC 5A0TA 3VC2A 4IDAA 2NZ2A 2XKBA 4E09A 1UADA 1DU4A 1FA9A 4BC1A 4KWHA 2PLWA 5TMBA 4B5KA 4KFCA 1NF9A 1E4YA 1T1GA 2HF8A 3F3MA 5DH9A 1ZXBA 5DP1A 3KUKA 5GQSA 3LX8A 5A7GA 1ZG3A 3ASYA 3K9GA 3D5QA 3C6KA 3ZOZA 3UV6A 3DMYA 3DMGA 1FDIA 4MWZA 1SD1A 3EWIA 1CRZA 3RV4A 2FWMX 1AQIA 2FYTA 2PX8A 3PXCX 5FOTA 1NP3A 1XZGA 2G4LA 1SJ9A 2YXLA 4G85A 4UJ3A 5HG0A 1VPTA 2JGLA 1JDZA 3QF4A 4L4XA 1ZJ6A 3N75A 4AG3A 4F84A 3M0EA 2VQ3A 1SQSA 3DF9A 2RGWA 2BR3A 1GJRA 4OP3A 2GJAA 3E27A 3IOBA 3JQAD 4D8VA 4OSEA 2YRFA 1H3NA 1NJ5A 2Y6UA 3AEXA 3MT8A 3RKUA 5L3SB 1W5TA 3I2GA 3NS7A 3IJPA 4MVYA 4OP2A 3E3OA 3IVCA 2VSYA 2F4VB 4HKTA 2WUDA 3UK6A 1JSCA 2TMDA 3MT7A 3ORFA 4DPMA 3GIDA 4H7JA 4JCOA 4UAVA 2VJYA 4GMHA 3QA9A 5ALIA 5FP0A 3T7TA 1RJFA 1OMOA 1TO1E 5AK4A 4MWSA 5HF6A 5CFQA 4RTOA 1M6VA 4MUNA 1A9YA 3DBLA 5FTMA 3FSGA 4RD1A 3DOUA 2B25A 5EKUA 3BSFA 3S1AB 5C9ZA 2O19A 2JGEA 3FDZB 3OQ6A 3QF7A 4BGVA 2V7WA 1FTGA 2PBLA 1M0TA 4OHMA 3A32A 4CQMA 5HOQA 3PBKA 3BD8A 1OTYA 1LFAA 2ENWA 2ZJAA 3BUSA 3JVDA 3NOQA 3FPLA 3PR3A 3RRJA 1P81A 4IS2A 1K5DA 3QBEA 1D2HA 4M37A 5JI2E 3NWJA 2B34A 4D4IA 4DMCA 2WOOA 3SHFA 3T0FA 4ZYYA 4XJTA 3BD9A 2CUNA 4DV4B 4JD5A 4B48A 3MWDB 3A2KA 1FVFA 2WB2A 3KSAC 4D74A 2X9NA 1YZVA 3N7UA 3R4VA 5K4HA 5KVVA 1Q7EA 3BGOS 2IWHA 1V8OA 5FDFA 2ZSAA 4C6HA 1GTJ1 1E2LA 1SCKA 4Q9DA 4N82A 1QB8A 4H7DA 2RBKA 4XGNA 2O4UX 1VDMA 4HD8A 4OB6A 4BO9A 1O95A 2VQEB 1Z33A 4BMSA 4HZIA 3KDPA 1KH2A 3I0MA 2QXTA 2EWVA 2UZ1B 3GRVA 5H8WA 2W8BA 4DCNA 2M6KA 4M49A 1W9MA 4R83A 3LQ4A 4I3HA 2FN7A 4YROA 1G20E 4KJZA 1T3HA 2YDYA 3BQ9A 4FGUA 1DIBA 4JX9A 2PGLA 5AIAA 5BRJA 2HXYA 3UKOA 3BFKA 2FN9A 1EB9A 3UMGA 4KPGA 3AINA 3P9ZA 2GZAA 2PD4A 3PRKE 1MX3A 4LBZA 4JC4A 2P9FA 1ISJA 4G0ZA 3EYAA 1IQ0A 1IHOA 2AT1A 5CA0F 4H3VA 5KOHB 1B42A 2AHOA 4B3SB 1NRIA 1SCNE 1VMKA 1W94A 2PA0A 5L4SA 2X22A 3GJ8A 2Q3FA 3QRWA 4I4CA 3WDKA 3O38A 4F1KA 5IAAA 1CETA 4UOZA 2IXTA 4RA9A 2FHPA 1NW9B 4JHLA 3I2KA 4PXSA 4EJSA 4ECAA 2PFGA 5D1NA 5JE8A 2P2DA 3HR4A 5DBIA 1SKUA