3OP4A

Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. n16961 in complex with nadp+
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
247
structure length
247
Chain Sequence
b'SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
molecule tags Oxidoreductase
source organism Vibrio cholerae o1 biovar el tor
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
total genus 81
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2010-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3op4A00
2FPGA 3CXRA 4IXWA 2ZYGA 1XU9A 3HJAA 1XDWA 4EW6A 1PZGA 2DPGA 3AM3A 1UJMA 2YQ5A 4U8GA 4R1SA 2I3GA 2Y0DA 2OO5A 4J3FA 5ER6A 3C7CB 3LSYA 5T57A 2GN9A 1GADO 3E6AA 3O03A 3G0OA 1ZEJA 4UAGA 3ITKA 3T4EA 1G0NA 4QT0A 1DIRA 2W4QA 3HDYA 1B16A 1FXSA 1V35A 3GN2A 4N5MA 4PVCA 2HUNA 3A14A 4Y67A 3NAQA 5F5NA 2D2IA 2G82A 1UDAA 3ABIA 2JL1A 5A5FA 1ZSYA 3QIVA 1PGJA 3VZQA 3KVOA 4KDEA 3AM5A 1UXGA 1OZAA 3RD5A 3WOHA 4RVDA 4CMGA 3UKOA 2UUOA 4JBGA 4CODB 3H9GA 4CV2A 4XRRA 4HP8A 1RM5A 4PN3A 2Y1GA 5ILGA 4ZQHA 4R01A 2EV9A 4PZDA 4UUOA 4TKLA 5L7YA 4CMEC 1WZIA 1OOEA 2I9PA 4OQYA 3RKUA 3WJ7A 1X1TA 3OBBA 4N7RA 3WXBA 1EE9A 3QQPA 4BNJA 1BDMA 3HN7A 4M87A 1LDNA 4YEDA 3ITDA 1NX6A 2IYOA 1A71A 4FB5A 2NTJA 4J7XA 3WX0A 1T2AA 3WSWA 5G0VA 3DHNA 3WWYA 2VYNA 5BNIA 3R1IA 2CFCA 4CL8A 1GL3A 3ZH2A 1ZIDA 2EJVA 3IP1A 1DB3A 4AJPA 1YB1A 2PLAA 1Q7GA 1HRDA 3NUGA 2WTBA 9LDBA 4Y6PA 2FMUA 4RDIA 5G0TA 1I0ZA 4FCCA 4BMVA 2NU9A 4Q39A 3ZHYA 4B79A 3K8ZA 2EW2A 1GU7A 2YUTA 4KUEA 2FWMX 5U1PA 2X86A 4BB6A 3VKVA 3OMLA 1ISIA 3QRWA 3GFBA 4WNCA 3SEFA 1UP7A 4MVJP 1KBZA 2BGKA 2VZ8A 3HE3A 1P0CA 1Y8RB 3ZW9A 1R15A 5C7OO 4NG5A 3L6OO 3KO8A 2GZ3A 2I5PO 3DBHA 4JCOA 3A4VA 4DC1A 1SBYA 4R1UA 2EJWA 3WFJA 4RVSA 1P0FA 1J6UA 4PG7A 4FC7A 4OOFA 1WXDA 5DP2A 1HE2A 1HZJA 4HX5A 1HXHA 3GDOA 3DBLB 3AOGA 1PJQA 5JCXA 5JC8A 4E6PA 4JP3A 3X2FA 3D3WA 1SOWA 1IHYA 1JKFA 1TEHA 2C20A 1Z74A 3OJEA 4PFJA 4TRMA 2BMAA 5JLAA 7ADHA 2R00A 4ALJA 3ASUA 2QX7A 2HMSA 1WNTA 4QO8A 1VJ0A 1UAYA 3H3FA 3GA0A 3TWOA 3GHYA 5A9TA 1N1GA 2DAPA 1YBMA 4Q3DA 3GF4A 4XYGA 4XYLA 3WNVA 1AXGA 4EEXA 4DPKA 3DZJA 1IY8A 3AK4A 4H16A 4IDCA 1P33A 4Y9DA 3TSCA 3OJOA 3U9LA 1MUUA 3JSAA 3CMMA 4AJKA 1JTVA 4PRKA 1ORRA 4LMRA 1DLJA 3KYBA 4XD2A 4CM4A 2EP5A 5T64A 2DKNA 4BNVA 1U8XX 2X58A 5JW6A 2EERA 2QZZA 3WTCA 2QRJA 4BGVA 2Q1UA 3HZZA 3K2EA 4XDYA 5EQDA 2YYYA 4JROA 1NR7A 1P44A 1P1HA 5TF4A 4Y6SA 3HHPA 4B4UA 3STHA 3MJ4A 5IAAA 5L9AA 3ZWBA 3TOXA 1NFFA 1A5ZA 3PVZA 4BKOA 1ARZA 4WLOA 3WGZA 4D7AA 4BNYA 4JN6B 4DWVA 2FR8A 4J0FA 3KYCB 5F1KA 2I66A 3M6IA 4JIGA 1T1RA 3AM4A 3I6IA 3CE6A 2W2KA 2OOSA 5JS6A 1M66A 4R68A 1GUYA 4RO0A 3BHIA 4OXKA 4GVXA 4RVHA 1HDRA 3JQBA 1U4SA 5L95A 5DF1A 1ZMOA 2P4QA 1YDEA 1RYDA 4YAKA 2C2YA 5ICSA 3PJGA 5JDCA 4XIJA 3TOZA 1V8BA 2V6GA 4TZKA 3LC2O 3BAZA 4WLUA 3PHJA 5U4QA 3VPHA 1J5PA 1P1RA 2HSDA 3QHAA 4ZICA 1DPGA 2O3UA 5I9LA 1Y8QA 4E2XA 3F1KA 3OIDA 5TT1A 2GCGA 1O8CA 3PP8A 2NSDA 4NR0A 1LTHR 2WDZA 2V6FA 3E5RA 1X14A 5IZ4A 4ROSA 1VL8A 3V2GA 4B8ZA 2YV2A 5L45A 2A35A 3L0DA 1R0KA 2P5UA 1DAOA 2DBZA 4CR7A 2GPTA 1TB4A 1YQXA 3GNQA 4B7XA 4HBGA 1BVUA 1QYVA 3AW9A 2C5EA 1EEHA 4BO0A 1OBFO 2ZKLA 3ZNNA 1B3BA 2NVBA 1SC6A 3LLSA 4OMUA 2AW5A 3RBXA 5KIAA 3DQPA 4B7CA 4IINA 2VRBA 5T8KC 2VZ0A 1P31A 1Y5MA 4FOOA 4OOEA 3ZV5A 4BNLA 3AI1A 4OYRA 2JHFA 3RVDA 3UVEA 1V3UA 1VSUA 1DIBA 5I8ZA 4HFJA 1WPQA 2VHWA 3H5AA 1UR5A 2PKRA 3FSRA 4EITA 3S2EA 1P9LA 1QP8A 1ZXLA 2Z1NA 1WDKA 3KV3O 3MTJA 4L76A 2ZK7A 3RROA 2O3QA 1YRLA 4CUZA 2NV6A 1FDSA 4CQLB 3GN1A 1H0KA 2X1HA 3MTGA 5TRTA 4CV0A 2ZB4A 5I9NA 1YH3A 3KSDO 4R3WA 4KZPA 3QJ5A 1M6WA 2WWRA 4AFNA 1PU2A 5DCUA 3OJFA 1J49A 4PLGA 3VH1A 4CLHA 3F5SA 5G0UA 2DM6A 2Y68A 3NX4A 1N9GA 3W6UA 2Y67A 1Y7TA 2O4UX 3JQ8B 3ZN2A 3U4IA 1IULA 2C54A 1E7WA 5EPOA 1L7EA 3FBGA 1XA0A 1Q0QA 3RAJA 4XGNA 3TJRA 3HDQA 1ZNQO 4HADA 4XYMA 5JCJD 1WMBA 1I30A 2DBQA 2HRZA 5ER9A 4EJ6A 5I7SA 1N2SA 2PKQO 4WLEA 4ID9A 3JYQA 4R9SA 1D1SA 1PGNA 1ID1A 2QW8A 1P1KA 3H9QA 1U4OA 3ZGYA 4RORA 3RJ5A 1NAIA 1TI7A 1IZ9A 3P5SA 4IZHA 5KWEA 2OZPA 4RPHA 1ZFNA 1LLDA 2P2SA 1FJHA 2A94A 2X0IA 3C3XA 8LDHA 3WJAA 4D79A 3LC7O 3PDJA 3WB9A 4I9HA 4CLDA 3CMCO 2PNFA 1LLUA 3JD1A 4PLYA 4II3A 1Z82A 1NHWA 1JWBB 1HWYA 3DTYA 2EGGA 5H81A 4RVGA 4JBIA 1ISHA 4CMKA 4BUCA 1QV7A 4CV1A 2O23A 2O7SA 5JY6A 2PZLA 3ZWYA 4RF2A 5G4LA 1Y81A 1E77A 2HJSA 3H6KA 4HXYA 1SB8A 4CMIB 1N9GB 3B1JA 1JVBA 2JHGA 1GFSA 3ON5A 4W4TA 1OI7A 4IGFA 4D41A 4CMBA 1GYPA 4TKMA 1J0XO 1SB9A 1V6AA 1ISGA 2EIHA 3F4LA 2PFGA 3C1AA 3VPSA 5GZ1A 2AG8A 4BIIA 3DWFA 4OSPA 5JC1A 2HRBA 2PTGA 3CIFA 1DSSG 1H6AA 1KERA 1W4ZA 2VYND 2Y1FA 3D3EA 5H82A 2G0TA 3VPGA 4J9UE 1H94A 3H3JA 5IJZA 3WYEA 3LC1O 2YW9A 3QVTA 1EBFA 1B8UA 3ETGA 4RVFA 1W73A 4DYVA 5G0SA 4CLRA 4BGIA 2IEDA 3EDMA 3DEYX 4YJHA 4ZHSA 1ZJYA 2DPHA 3GGGA 1T2EA 2UV8A 4Q9NA 3R3SA 5DCYA 3WWZA 1CRWG 1B3RA 4L73A 1KS9A 2BFPA 4CM9A 4CM7A 2HKIA 1SZJG 1U9JA 5BSHA 3C24A 2DBRA 4IIUA 5BT9A 3G79A 5B4TA 4YR9A 1PX0A 3TQHA 1KY5A 4CMAA 3TZ6A 1VE9A 2D1YA 2VT3A 4L74A 2DBVO 2J3IA 3ZHBA 3E9NA 4Z9XA 1CQIA 3CSDA 2AE2A 1E6WA 1Z73A 4WCFA 2QYTA 2PWZA 1NASA 1MG5A 4XKJA 3AUUA 3PRJA 2C5AA 2JFGA 5JDIC 4A0SA 3C7DB 4Z9FA 4BKQA 5F1OA 4JK3A 3OA0A 5KNLA 3MOGA 4B3HA 1QLHA 3ZWVA 3SVTA 1DC3A 1I33A 3NV9A 1M76A 3ANLA 3Q3CA 4IDGA 5EQFA 1XWFA 1LXCA 3NTRA 1U7HA 3GZNB 3IQDB 2VNAA 4WKGA 2CY0A 4JX8A 1R66A 2D5CA 3GVIA 4II2A 2Q2QA 5EJ2A 2X0RA 2P4HX 3AJRA 3AY3A 1PZEA 3LLVA 3PIDA 5DDIP 1PJLA 1E7QA 4I08A 4Q3BA 2FR1A 1EVZA 2P5YA 4A27A 3PJEA 3GRPA 4I8XA 5A3VA 4ITUA 1QRRA 1X7GA 4GKVA 3WIDA 4LCJA 1BXKA 3U62A 1U3WA 4YACA 4L9RA 3VH3A 5DBFA 2WM3A 1EQUA 1HDGO 4ALNA 4GL4A 2CZCA 4BNGA 4Q3AA 2CMDA 3VPXA 1LDYA 5IN4A 5JAIA 3OQ1A 4MVJI 4J16A 1E3JA 5KKCA 1D7OA 1DC6A 4KUGA 2Z1MA 1S6YA 3JQAD 3M1AA 4ZD6A 1LDMA 3DO5A 3INTA 4HFRA 4YAIA 5LC1A 1PJ3A 3UCXA 4MDHA 3JD2A 2PH5A 1N7GA 1YL6A 4FQ8A 5DBIA 3KUXA 3A9WA 1H6DA 1DHTA 5IXYA 3M2PA 1H6BA 4U7WA 4RZIA 4A5OA 3BXXA 4CM1A 4E5YA 5KJ1A 3LT1A 3QVXA 2Y1EA 4PG5A 3QWAA 3QSGA 4OO3A 1HDCA 4Q3NA 2P9GA 2ZTMA 1AN9A 4W6ZA 1B7GO 1MFPA 5DBGA 4BO3A 4EGFA 1DFHA 1X1EA 3KHUA 1VRWA 1P1JA 3V5NA 4R54A 4TRJA 1TVEA 2B4TO 2OFPA 1OC4A 3S8MA 1XR3A 3DOJA 1ONOA 3NDJA 3E9QA 4S1VA 5DOZA 1K6JA 4NBTA 3AOEA 2XXJA 3K2BA 3BMNB 3OSUA 1HF3A 5K6AA 4PZEA 4YDRA 4EJMA 1KETA 3K5PA 2O3JA 3GVPA 3GUCA 4XJTA 1XKQA 3NTOA 3NT4A 1HSZA 2GSDA 1PL6A 4PRLA 3ZWOA 3GGPA 3ZU4A 4E2WA 2CUKA 1M6HA 1GR0A 4CM8A 1TLTA 4Z6KA 2ZIZA 1ZVMA 2Q4EA 2E82A 2DTDA 4EUEA 2VRCD 3DB2A 3MJCA 5AVOA 2GD1O 4A73A 4PLCA 4B4WA 1T2DA 2J3KA 1I3LA 5ILOA 3AWDA 1BDBA 1WLYA 4DQUA 2B37A 4R41A 4U6SA 1UH5A 1ZUD1 2DU8A 2YDYA 4RDHA 4E5PA 4RPKA 3U09A 2HK7A 4RF3A 3PQFA 4B4VA 3SBOA 1GPDG 5EL0A 3L6DA 1NNUA 3CH6A 5AXDA 1HETA 2JAHA 4ONEA 4AJ1A 1I3KA 3BYZA 4MVJG 4OXYA 1VM6A 1U5CA 2Q4BA 1M75A 5ITVA 3H7AA 2YHUA 3HN2A 1LUAA 3NYWA 1PS8A 1EUDA 4CPDA 3ZWWA 3KSZO 1NVGA 4WLVA 5L40A 3WLEA 5A9SB 3ENKA 3V2UA 3WQQA 5JFOA 3DAFA 3SXPA 1BW9B 3WGHA 1G6KA 1O0SA 2QHXA 1Y6JA 4JLWA 1AE1A 1BSVA 3JYOA 4I5FA 4OHUA 4Z0TA 4F46A 1UXIA 1DIGA 1F17A 4G81A 4N18A 1KVQA 4YA6A 5FI5A 3FI9A 2H63A 1YWGO 3KEQA 1H9BA 1HE4A 1F8FA 3OJLA 3DFZA 4MPDA 4WE3A 2FOIA 4E30A 2OORA 4ZQBA 3I23A 4M86A 5C5IA 1QKIA 2IDZA 1HYEA 1GAEO 3HFSA 2DTXA 2E49A 2GN4A 3WIEA 1XIVA 4CLOB 1T1SA 1NWHA 4DUPA 3UCEA 3BHJA 4BO9A 4TWRA 3BTVA 1WAMA 4BNNA 1F0YA 3RIHA 4NK4A 4CMJA 1D8AA 1EBUA 3GVHA 3GH3A 3PLRA 2V6MA 4JBHA 5H83A 4O1MA 1A4UA 2VZ9A 3BZUA 3RBZA 4CQMD 3D4OA 4KQWA 1ZH8A 4NI5A 3RUIA 2EGHA 1C1DA 1T24A 3ZI0A 2YV1A 4OM8A 2HK8A 2CF6A 2CF5A 5IDYA 5DNAA 1EMDA 2BI7A 3L4BC 4LVCA 1GCOA 5A5EA 1ZK0A 4QQRA 1LDEA 3I9OA 3WG9A 1R6DA 5G2OA 1P45A 4QFCA 3VH4A 2X4GA 3BMQB 1C0KA 1GZ4A 4MP8A 3ZWMA 3INGA 3P7MA 4BGUA 4LRTB 1NFRA 2QYSA 2F00A 1IPFA 1EVJA 4R1TA 3LF1A 3DZHA 3FBTA 1MLDA 5AXCA 1XELA 4XCVA 3BIOA 1VL0A 1KYQA 2HCTA 3OQ6A 1E3WB 3NT5A 3U4DA 2RHRA 1ADFA 1QYDA 4NBVA 3C1OA 1LQUA 2Q2WA 5IDWA 1T2FA 3TL3A 4J2OA 1VL6A 1WMAA 1WZEA 5IXSA 1RKXA 2B4QA 1JKIA 2AHRA 2NTNA 3ZU3A 5FF9A 1YBVA 4DVJA 1Y5RA 4E33A 3GZ4A 4Z3KA 1PQUA 1I36A 4J7UA 2Y99A 1U3VA 4MKXA 5G0WA 5CAEA 3DFUA 2QQ5A 2X23A 3D4PA 3M2TA 4INAA 4MIOA 1RM4A 4UUMA 4E13A 1E7MA 2Q2VA 2G1UA 5JO9A 2HMUA 4MVJE 3VPFA 3AUAA 3DBRB 2ZCVA 1RYEA 1UZNA 2VYVA 4DBVO 1ISFA 1E1NA 4R3NA 1ENZA 1E5QA 2G17A 5TLSA 3LYLA 1OFGA 3PDUA 3TNLA 1CIVA 3H2ZA 1PWXA 3L9XA 2FZEA 1YL5A 3DDNA 3IC5A 1ULUA 3FNHA 4B8WA 3E03A 4BNKA 1ZSNA 2CDCA 2X8LA 3DZBA 3WSVA 2HDHA 4NBRA 1HSOA 3A1NA 5DOVA 1PS9A 1Y1PA 1C0IA 5KKAA 5LCXA 4RGBA 1ZMTA 3B20A 3DR3A 4TVOA 1HEUA 4OSOA 4R5MA 2AEMA 3VTZA 1PS0A 3PIIA 2BLLA 4M1QA 4NK5A 4KP7A 1L1FA 3ZWAA 3ZW8A 5CDGA 1PZHA 4MOWA 2GN6A 3DONA 3HADA 1JQBA 2NQ8A 2W2LA 4XIYA 2QRLA 3GEDA 3PK0A 2EXXA 5I7VA 4XX0A 1GQQA 1WVGA 2AEFA 3OJ0A 1H5QA 5KOIA 1NVMB 4GWKA 1Q0LA 4YTEA 4YVFA 1LDBA 4U5QA 4OH1A 3DMTC 3ZV4A 4W7HA 3ZZNA 3DTTA 3HSKA 4P4GA 1C1DB 5TGDA 4PLPA 4RJTA 4Q3CA 2B35A 4KWIA 3K9QO 2YZ7A 4OJNA 4DYDA 3P2YA 2FN7A 1LLQA 4J43A 5B4VA 4UUPA 2AXQA 1LEHA 1C1XB 3F46A 4EUFA 4WUVA 2XPCA 2C29D 2VN8A 3BMQA 4YQZA 2I99A 3FTNA 3W8EA 4N5NA 4CM9D 1E3LA 1QSGA 4WJZA 4BO8A 2VWGA 5HTOA 4KDFA 5JMWA 1U28A 3JQBC 5B37A 5A05A 3HB4X 1YB4A 1I2CA 5THKA 4BO2A 1MA0A 5JPIA 1X15A 1BWSA 1C0PA 4B3JA 2WSBA 1IE3A 1A27A 4R51A 4KOAA 1CWUA 2WEKA 3SC6A 1I24A 1DLIA 1NBOA 3W4IA 3JYNA 1Z7EA 2V65A 4YWJA 4YYZA 3NTQA 5L7WA 4IXTA 5C37A 4U6QA 4W82A 4I5EA 4CUKA 4YJFA 2QG4A 1LLCA 2Y0EA 4IQ0A 2H9IA 3IIEA 3N7UA 4YJGA 2O2SA 2UDPA 5CEJA 2VYVD 2WD7B 3RKRA 2GR9A 3UFXA 3ICCA 1QYCA 3UGKA 2YV3A 3UUWA 4OGWA 4Y6RA 1JA9A 5L53A 1T2CA 1TA4A 5GMOA 1GUFA 4XB1A 3C8MA 4J7CA 4XWYA 1ADBA 4GGPA 2GNAA 4P4LA 5TIIA 1GD1O 5EESA 2I67A 3WGIA 3QVOA 4UULA 5BR7A 3GEMA 4YT8A 3LVFO 2GRAA 5GZ3A 2BHLA 5JYDA 1LNQA 2Y1OA 2WE7A 3GT0A 3ADPA 2BGLA 1VSVA 2IZ0A 1SPXA 4W9NA 1DBVO 2R2GA 4CR6A 1BMDA 3I6QA 3F4BA 4GBJA 4L0QA 4RQTA 2UUPA 4A26A 1X7DA 1FDTA 4W99A 3ZWCA 1R4MB 3JQGB 3ANMA 3RQSA 1I8TA 3BMOB 3VAZA 3MJVA 3ZV6A 1YOVB 3ORFA 3W1VA 1DRWA 3AU9A 3FPLA 4TRRA 1ZEMA 3FWZA 2VTEA 3PWSA 1O94A 1I3MA 3H2SA 3UOGA 1X7HA 3WICA 1ONNA 3HFGA 3OQBA 1PIWA 3WGGA 2ZTLA 4PG4A 2VTDA 1N92A 4FFNA 4DPLA 4NQZA 3GGOA 2FZWA 4IMRA 3A06A 2IZZA 4HWKA 2G5CA 1MGOA 5CDYA 1EFKA 3INRA 4G65A 4JJIA 1JW9B 3L4BA 2P9CA 1KEVA 1I2ZA 2O4CA 4F6LA 3M1LA 4IUYA 3AY7A 4IS3A 5K6AC 4TZTA 3WLFA 3JQ9A 1MV8A 4KTTE 2POQX 3ZNPA 4CQMB 1KY4A 3E8XA 3G49A 3P19A 3E9MA 4PGFA 5BSGA 1LU9A 2OBYA 2DUUA 3L6EA 3G3EA 2XOXA 3GRKA 3EW7A 2NACA 2FHSA 3RWBA 4GH5A 3IUPA 4BVAA 4J0EA 5A06A 1CERA 2TMGA 4ND2A 1NR1A 3RFXA 2P91A 2W2LD 1NM5A 3GVXA 1EDZA 4LN1A 4NFSA 4CMCA 1DJNA 2BRUA 4TROA 4GX2A 3PQEA 4BV8A 2PKQP 1DO8A 4M55A 2Y05A 4EBFA 3ENNA 5KVSA 2B83A 1JDJA 5HRUA 5COBA 4A10A 1TT5B 2EKLA 3K73O 1E6UA 2OHXA 1AHHA 1U2GA 4NFHA 1I2BA 3QY9A 1HKUA 4DRYA 1GEEA 3UF0A 4AG3A 5B4UA 3MEQA 3NGXA 4YPOA 6LDHA 1O9BA 5IZCA 4OIMA 3L77A 4BMNA 1E92A 1V9LA 3F47A 1T4DA 3GVCA 3K92A 4QXMA 3PWKA 4CMHA 3GK3A 1KEPA 2BELA 2W98A 1ISMA 3QVSA 1F8GA 1ZZEA 3BMNA 3Q11A 1NYTA 2J8ZA 2Q3EA 4LVUA 4B7UA 5CDUA 4J6FA 1PJ2A 1TXGA 2O3SA 2JCXA 3JQEA 3ZWNA 1BXGB 3SJ7A 1MC4A 2IXBA 3QV1A 4X54A 3GDGA 4RL6A 3ULKA 4UVHA 3S2GA 4HUJA 2X5KO 2J3JA 4AJIA 3UHAA 1DFGA 4AJHA 5KJEA 3KB6A 4JGBA 3K96A 1XLTA 4O6VA 3RUAA 4DLLA 1ISJA 2OGUA 3VOSA 5CPFA 2ET6A 2X0JA 3RC1A 2NLOA 2H6EA 2WYUA 4J91A 3ANNA 1MC5A 3WGTA 2ZTUA 2X7HA 3C1TA 3W6ZA 4EDFA 4BNXA 4IJVA 1NTOA 3ONEA 3UICA 4IQ8A 2YFQA 4Z0HO 1E5LA 3ETDA 5JAMA 1V3TA 3IMFA 3PYMA 1PQPA 4PCVA 5ITWA 2NNLD 4NNJA 4HKTA 1K6IA 4KMSA 4MINA 4LGVA 1B8VA 4LCEA 1SNYA 1TT7A 5EINA 2AEJA 3SLKA 5C3MA 4MIYA 2NTVA 1B15A 2V6BA 1DHRA 4YRAA 2D3TA 1V3VA 2C7VA 5EIOA 3QA9A 3EAGA 1CF2O 4XEHA 1Y9EA 3GG9A 1K0UA 3RC7A 2YDXA 1JAXA 3ROQA 4MVJM 4K6FA 3Q2KA 2VUTA 3FD8A 2EG9A 1X0XA 4PLFA 2RHCA 4JXKA 1XU7A 4ZQEA 2Z5LA 2IZ1A 4J49A 2FRDA 5K0ZA 4CQMA 3TZCA 1AXEA 3DZGA 4J1SA 5I9MA 1U5AA 4JJFA 4BNIA 4RLSA 3IDSA 4XQGA 1YXMA 2Q1WA 1E3WA 4XQ9A 4A03A 4F45A 2Y1DA 4IIVA 3DBVO 1EZ4A 3PTZA 1NFQA 2VCYA 3EGOA 4QX6A 1GV1A 3DAGA 3RFVA 3L07A 1XHLA 4U0KA 1I5RA 1C3VA 4W7IA 4AJNA 5JBIA 3WGYA 4GX1A 3ZWPA 3GNTA 4R5HA 5C7IO 3ZHXA 4H15A 4MVJF 4RCVA 1ZXBA 2GDZA 3EYWA 4WEOA 1MXHA 3G17A 4S3MA 4CUJA 2EWMA 2BH9A 4GGOA 2EEZA 4TSKA 1ADGA 3I4FA 4LRSB 5T5QA 3HWRA 4CM6A 1BVRA 4RZHA 2ZJ1A 1EUCA 4E31A 2VHVA 1YS4A 1UP4A 4M8SA 4ZQGA 1SAYA 1U2DA 2H1SA 4BNZA 4LK3A 4C7KA 1PJTA 1AGNA 1E3SA 5T67A 1PJBA 5F5LA 1O6ZA 2VNSA 3U3XA 1K89A 5TC4A 3K6JA 4R4JA 4WOJA 3U0BA 3MJEA 4NPCA 1PR3A 4IQGA 3EK2A 2AE1A 5I7FA 2I76A 1DXYA 4YT4A 1NWCA 2HO5A 3PPIA 4CJXA 4AJ2A 2DLDA 4UEJA 5DULA 2DFVA 4D44A 4ZA2A 3DHEA 4NBWA 1DC5A 1U3UA 1PEDA 1LSOA 1PGQA 3W4JA 4G2NA 1OAAA 5BSEA 1Z6ZA 1KOLA 1D3AA 1Q0HA 4YT5A 2NQTA 2NU7A 1LC3A 1NPTO 4PVDA 5FWNA 1A9YA 2PGLA 3NT2A 4D46A 4CV3A 1CEQA 4I9NA 3I83A 1GYRA 3DZKA 3ZDFA 2PZKA 3SJUA 1VKOA 5ES3A 3PJDA 3IL2A 3KXDA 2JJYA 3MJSA 4WASA 1H2BA 2CNBA 3QWIA 4XRGA 4J1TA 1PZFA 2BFMA 3N58A 1B2LA 5T8KA 1HT0A 2Q1SA 2HK9A 3PXXA 4Z9YA 1E3EA 2DFDA 5KVQA 3KM0A 8ADHA 3HQ4O 4BMSA 2NU8A 4BOYA 3NRCA 4CM5A 3FNEA 3WMWA 2RCYA 1HTBA 3OEWA 4UEOA 3PGXA 3AFNA 1R4MA 3JQGA 1CETA 5COQA 4OKIA 1FDWA 1A9ZA 1KC1A 3FF4A 3GLQA 3EVTA 1PTJA 1IL0A 3JQ8A 5A03A 2OMEA 1GCUA 4GMFA 4QFDA 4WCFC 1LQTA 1SEPA 4ZQFA 4ZU3A 5GY7A 3ZNOA 4BNUA 3IP3A 4GSKA 4H3VA 5JMPA 3V1UA 2SCUA 2JCVA 1GUZA 5G4KB 5EN4A 3G1UA 2X5JO 5BNFA 2PR2A 5I8WA 4LMPA 5JXWA 2ZATA 4OAQA 4B3IA 4RLHA 3I5MA 4BHTA 1T25A 2ILTA 4ZN6A 4K6CA 1KEUA 4YB8A 4BS9A 4D3DA 4IDBA 3JQAA 2BKAA 1CQJA 1Y9AA 2NM0A 1ZK4A 5EMHA 4TRNA 2RAFA 1JVSA 2PGJA 4A2CA 4M89A 4DGSA 5IDXA 3IUSA 4HNGA 4Q3EA 4N5LA 2YJZA 4YAGA 1R37A 3VVCA 2B5VA 2EF1A 1QLJA 3RBVA 4EZBA 4JJGA 4K26A 4P8RA 4PIVA 3VDRA 3WGOA 3GUYA 3PHHA 1YJ8A 5CHEA 1FDVA 4IBOA 2PD4A 2VWHA 1HE3A 1HDOA 4BV9A 1NP3A 5TQVA 4CLEA 1VPDA 1YE3A 1C0LA 3JV7A 5JYEA 5A9RA 5CDTA 1R4NB 5KVVA 2W2KB 4L75A 3RC2A 4IDFA 3WFIA 3NKLA 4DPMA 2O2YA 2YHIA 3I9JA 5A04A 5CEEA 3FR7A 4Y98A 3C7AA 2VWPA 3O38A 4XYEA 3ZHZA 3E1KA 3PFWO 2PD6A 4RV9A 1A4IA 3TDKA 2Q99A 1P74A 4FSHA 5F21A 1ADCA 4BO5A 2DTEA 2O7QA 4LISA 3FNFA 4ALLA 5IZCC 5CPBA 3T4XA 3KYDA 4FFOA 5KJFA 3DOCA 1PWZA 3OH8A 4FS3A 4IJUA 3UH1A 3GG2A 3I4CA 1YBAA 3S2FA 3IOYA 1XQ6A 1FDUA 1S7CA 4NZ9A 4MP6A 2VRCA 5HA5A 1B14A 3RU7A 2G76A 1EK6A 1ZK2A 2CDBA 5FI3A 3LK7A 4BKUA 3OFSA 4YRDA 1LDGA 4L4SA 5JE8A 3SC4A 3GDFA 4FFPA 3A28A 2VOEA 3KEOA 5IDQA 4BL5A 1B0AA 2ZTVA 3PQDA 3EC7A 4UVEA 1BG6A 4XDZA 1NQOA 3N74A 4FC6A 2CVQA 4N54A 2GF2A 3FTPA 1M2WA 5MDHA 1VC2A 1PL8A 2IRWA 4IDAA 2B36A 3AUTA 4IDEA 2YY7A 4RQUA 5A02A 3NDRA 3RU9A 4MKZA 4BQRA 4F3YA 1DEHA 3GAFA 3JQCA 4E5MA 3DMYA 2X6TA 4PG6A 2VHXA 2D8AA 1LI4A 4E5KA 1E7YA 2X9NA 3IAHA 3U49A 1DIAA 1WP4A 3FN4A 3PZBA 4EI2A 5JSFA 4EEZA 2EP7A 4K1LA 4OKNA 4WCDA 4E3ZA 3AOEC 5BNTA 4B4OA 3GZNA 3P2OA 4TQGA 1LRKA 3GQVA 4CL3A 4ND5A 4NIMA 1JLLA 1Q2XA 1A7AA 3MJTA 5A9SA 6ADHA 3EZYA 3KSUA 3TZHA 5MGBA 2PK3A 3VC7A 1BGVA 3V1TC 4LSMA 1NHGA 1EE2A 5A1TA 1I01A 2VWQA 4FOSA 5FYDA 2NUAA 5HS4A 3OICA 4TVBA 3AI2A 4AJOA 2NVUA 2FY8A 1R16A 2FP4A 2RH8A 5I7EA 3RUDA 3OHSX 3K30A 3VDQA 1ZCJA 3AY6A 3ROMA 1F06A 4CLXA 5JCJA 1RWBA 1WDMA 3V2HA 1FK8A 2A9FA 3OIFA 5JO0A 3H4VA 1PR9A 3BTSA 3OP4A 2HU2A 1VJ1A 3OEYA 1PJSA 5LDGA 3ZCXA 5FEUA 2WD8A 1W0CA 3GPIA 1IB6A 3DHYA 4NJMB 3RSHA 4O0LA 4GI2A 2YQ4A 4XB2A 4U0JA 4DL9A 1UDCA 2ZB8A 4GSLA 5AXAA 5TNXA 1H6CA 3F9IA 4FFMA 4DIFA 2PZMA 4J4TA 3AUSA 3O26A 1NQAO 2VQ3A 1GZ6A 1H93A 3ROKA 5KVCA 1LBEA 4YJGB 4XA8A 4BNHA 4FJ2A 3H9JA 3OIGA 5AXBA 1T4BA 1U7TA 2UYYA 4L4RA 2GZ2A 5L51A 5JDCC 3GC6A 3WYCA 3OECA 1E1KA 4YJDA 3IKTA 4PG8A 3D64A 1Z45A 3JQFA 3QE3A 1LA2A 3ETEA 4URFA 1Y8RA 4AJEA 3CINA 1X13A 3W8DA 1DAPA 2R6JA 3WYBA 9LDTA 3F6YA 3BHMA 4A7PA 3EUWA 3I3OA 4XYBA 4FN4A 4MVJD 4FW8A 1MFZA 3UAGA 3Q9UA 3F1LA 4D42A 3VHRA 3CPSA 1JWAB 4L8VA 1O89A 2X22A 1ONPA 4GMGA 2X0NA 4QO7A 2QZ9A 3EZLA 4PLWA 1NVTA 2CSUA 4K9DA 1RM0A 1UAGA 2Z95A 1EVIA 5AYVA 4QTZA 4DLBA 3TN7A 4DIOA 1AUPA 3UN1A 1UXHA 3B1FA 1Z7BA 1VLLA 1P77A 3E48A 5DCWA 5JNLA 3EY4A 5BSFA 3LQFA 1HE5A 3OF2A 4FPXA 1JU9A 1PSDA 3H9EO 2RH4A 3DZFA 3KTDA 1SCUA 4LSWA 2ZQYA 1Y8QB 3EVNA 4ILKA 1PGOA 2BGMA 4GX0A 4E2ZA 5F3RA 4P38A 2OP0A 1CDOA 3L4SO 3COSA 3JCZA 2D0IA 3DMTA 3GFGA 1YQGA 2X9VA 1Q1NA 1LC0A 1ZK1A 2JAPA 4NDNE 3JQFC 1B8PA 3JQDA 4HFNA 2Y93A 2GASA 1KVUA 1JAYA 1HLDA 1K6XA 7MDHA 5HBRA 3R3JA 5J23A 4MJLA 3RI3A 4I9UA 1I3NA 4WOKA 3KETA 4CM3A 4FBGA 4XJSA 4GLLA 5HM8A 3RUFA 3WQRA 2BD0A 2WJPA 1UXJA 4WECA 1LJ8A 4YJFB 4D3SA 2PZJA 4P4NA 1GZ3A 3Q2IA 1QMGA 1QV6A 5G4KA 2O48X 3H5NA 4R16A 4DQXA 3BMCA 1EK5A 1XYGA 4ESOA 3IKVA 4FJ1A 2O3RA 3E82A 3VVBA 1E7SA 1KIFA 2J5QA 4NU6A 5TT0A 4GPD1 4YJHB 1WWKA 3ZNQA 1PGPA 1YQDA 1C1XA 3BTUA 4WLNA 1YO6A 1BHSA 2AQIA 3LF2A 3FR8A 4R69A 4MVJH 1KVSA 1MP0A 2IODA 3AFMA 4DREA 1YL7A 3ICPA 2NVWA 1LSJA 1H2HA 2ZB7A 5JAZA 2EKPA 2AA3A 1N7HA 3D5QA 2VUSA 3QWHA 1PJCA 4FR5A 5T6BA 4FDAA 1RM3A 4BKRA 4WK6A 5KJCA 1G0OA 3TZKA 3PJFA 5L4NA 3WBFA 5F1PA 3NGLA 3WMXA 2NVUB 3DBHB 4XGIA 4DBZA 4MO2A 3PHGA 3E18A 3FWNA 1LRLA 2IXAA 3GAZA 1D1TA 1DDOA 2R00C 2RBEA 1E6EA 4D3FA 3FCOA 5DT9A 1M67A 3RUEA 1GEGA 3HG7A 3Q0EA 4E4YA 2HMWA 3TPCA 4NJOA 4YQYA 2A4KA 2VHZA 3DAPA 4FIZA 4O59O 2B5WA 5TJHA 4EYEA 3ZV3A 1U1IA 4BO6A 4R1NA 3OA2A 5IF3A 1P1FA 4IPTA 1V0JA 2OP1A 4D0RA 1HDYA 3I1JA 4YT2A 4ND4A 1P3DA 3VH2A 3RUCA 2D59A 3PYLA 4J4HA 4M54A 4Z0PA 4ZVVA 5K9ZA 1SO8A 2WMDA 2FSVA 4WLFA 3VZRA 3DOOA 1H9AA 2NU6A 1ZSVA 2PD3A 1GQYA 4DMMA 4MKRA 1YONA 2DUWA 4TMFA 1LSSA 3I52A 4OXNA 3LT2A 2JKVA 3Q1LA 1UP6A 2BFAA 2UAGA 4ZGWA 4RVUA 1YJQA 2JD0A 1NPYA 4Y8VA 1O5IA 4BNTA 4XQEA 4YCAA 1A72A 3C85A 3ROPA 2D4AA 4J4BA 1NAHA 4NU5A 4ZRNA 1E3IA 3UW3A 2EW8A 2E6UX 2DQ4A 4CLOA 4AJ4A 1R0SA 2QRKA 2QIOA 3BA1A 4RF5A 5JAQA 2IE0A 4EJ0A 3PHLA 2WE8A 5TSDA 4YRBA 1P1IA 2E4AA 3FHLA 2C2XA 3BTOA 3D3WB 1CYDA 2Q50A 1UUFA 1GTMA 4ND1A 4XQCA 5TX7A 2JCYA 4WCFB 3Q9NA 3QVWA 4ALKA 1SEVA 4I1IA 3DBLA 3TFOA 3NEPX 2Y1CA 3F5QA 2VT2A 2DC1A 3O8QB 4J1QA 1HZZA 3VTFA 4HV4A 5COAA 5LDHA 4YXFA 2PH3A 2AG5A 5DP1A 2UVDA 2Q1TA 2XAAA 1YDWA 3H5RA 5B12A 1YVEI 2C82A 2Q45A 2A92A 2CVZA 1W8DA 3LT4A 3AI3A 4YAJA 3VKUA 2X9GA 1GYQA 1QR6A 4BKPA 2FR0A 4BO7A 4BO4A 3DBRA 3RFTA 4CMEA 1CJCA 5KCZA 4IJKA 2GUGA 1WW8A 3LZ6A 3PGJA 4KWHA 4IGEA 2PGDA 4Z3DA 4AL4A 3Q6IA 4IZIA 1EFLA 3HB5X 5A4DA 1KVRA 3VZPA 4NBUA 1YB5A 3I9LA 3VZSA 5L4SA 1OMOA 1VI2A 4NFYA 4P22A 4DIBA 4R9RA 3JD3A 3NDIA 4GX5A 1YKFA 5ENDA 1ZJZA 1N8KA 1UDBA 3GNSA 3CZRA 1XQ1A 3PI7A 4HNHA 3BMOA 3G1TA 5TS3A 1G1AA 1ZW1A 1R12A 3D5TA 3GOHA 1R4NA 2I65A 5DN9A 4J2HA 3LU1A 4GWGA 4CMIA 2BF7A 1JKJA 2YFHA 1DRUA 1JN0A 2WYWA 5FFFA 1XGKA 2GGSA 3U4HA 3FNGA 3JD4A 3ZWXA 3S55A 3FRJA 4PLZA 2ZCUA 4L4XA 5IFLA 4FFRA 2C07A 4J1NA 2GZ1A 3ONDA 2WYVA 3ASVA 1RJWA 3IJRA 3HDJA 1DOHA 4BGEA 4F6CA 4G5HA 3RC9A 4CR8A 1LSUA 4O5OA 2NADA 3PHIA 3T7EA 1LRJA 4WNIA 4FGSA 4OL9A 4DLAA 1MB4A 2AQ8A 2P68A 4O63O 3LDHA 4DC0A 4ZRMA 1IHXA 2Y66A 1DIHA 4NH4A 2GO1A 5THQA 1F12A 4UUNA 1OC2A 3MZ0A 2GERA 2FSSA 3SX2A 1W6UA 1QG6A 1U3TA 3V1YA 1R0LA 2W90A 3ADOA 4BNWA 4IJWA 3WR5A 3JQ7B 3FPCA 1EVYA 1DRVA 2J5RA 1FF9A 1ZO8A 2JD1A 4QECA 2ZB3A 3S2IA 1Q7CA 3DL2A 1U8FO 4XR4A 1BXZA 2E37A 3OETA 4ZJUA 4K28A 5AOVA 1RPNA 3GMSA 2GLXA 4PZCA 2O3TA 2NWQA 1IYZA 1VJTA 4GKBA 5TJ9A 2Q49A 3MWEB 4E0BA 3JYPA 3I9KA 1E0DA 1E7RA 4WGGA 1EUZA 4KUHA 3UXYA 2PA3A 3CZMA 3PFFA 4UVIA 1XCBA 3CTMA 3KRTA 4BO1A 5CG2A 1NQTA 3F3SA 1J4AA 4QUKA 1C14A 4YAEA 1D4FA 3PZRA 4I5DA 3PWZA 2HLPA 1ULSA 1GPJA 3H65A 3WQSB 2LDXA 1NXQA 1N5DA 1FMCA 4C7JA 3AU8A 2HMTA 3MCVA 3WS7A 4FFLA 4H7PA 4MVJA 3W4KA 2J3HA 3CEAA 2CDAA 3TRIA 2WD7A 1MXFA 4KTVE 3RJ9A 4D45A 1Z75A 2ZYDA 5GZ6A 3O4RA 3PLNA 5BQFA 4CQLA 2P9EA 3KBOA 1PJ4A 5ADHA 2DVMA 3KLPX 3WGQA 2IYPA 4JNKA 1HLPA 1EDOA 1GQ2A 4DXHA 3GR6A 4CM8B 4QSMA 5JDIA 2HQ1A 1XSEA 2C7GA 3TZQA 2Y0CA 3GEGA 2FPPA 1E1MA 4PLHA 4EUHA 1K5HA 3TFQA 1K3TA 1ENYA 3QWBA 5IN5A 4ALIA 3TF5A 1ML3A 1IZ0A 4RPJA 4JQCA 2D5AA 5KTKA 3SLGA 5CFZA 2EHDA 4KQXA 3WDSA 2B69A 4D43A 3QLJA 4C4OA 3L9WA 1I32A 1ZKMA 4UVGA 2PV7A 2DT5A 3HNPA 3E5MA 3IJPA 2GYYA 1F14A 3ST7A 4E32A 5HS6A 4UREA 4CLRB 1HYHA 1PL7A 4W9NC 3O9ZA 3R0IA 3JTMA 1VKNA 3B1KA 1UXKA 3GY0A 1QXSA 1UZMA 3HDHA 4IMPA 1EQ2A 3CUKA 2J6IA 4HFMA 2B4RO 4DTIA 3B6ZA 3GPDG 2BFOA 4WPGA 1NQ5A 3IS3A 3HUDA 4CM4B 1HDZA 2JFHA 2OL4A 3B70A 2H5LA 3JD0A 3GHHA 4QEDA 2Q46A 3DZIA 4M49A 3MOIA 2C59A 4ALMA 4DMLA 2I3AA 4HY3A 4IDDA 1DJQA 5L7TA 1WDLA 4RF4A 3ZU2A 1SOVA 2TMDA 4BQPA 4IS2A 4NJMA 1ENPA 2X5OA 4J9VA 3V8BA 2OUIA 3U5TA 1XG5A 3KYCA 3R6DA 3ZU5A 1Q7BA 1KVTA 3I9MA 1GV0A 3CKYA 3PYXA 4E5NA 2EKQA 3NJ8A 1TT5A 2JD2A 3O8QA 1PQWA 3TL2A 4AVYA 4BNMA 4FJ0A 4RPGA 4RPLA 4AJLA 4UVDA 1LX6A 5HWSA 4E21A 5AQ1A 1UZLA 3D0OA 3WNQA 1MX3A 3UCFA 2YHIB 2GN8A 1HL3A 3H8VA 4XGKA 3MWDB 1BTOA 5ENVA 2RIRA 4AJJA 2E48A 3KYDB 4WEQA 1HDXA 4BNFA 1MG0A 2OBNA 3ONFA 5B1YA 1IUKA 3NJ4A 2PY6A 3S1LA 3WTBA 1BXGA 1N1EA 1E1LA 2W8ZA 5C7LO 4GAEA 5CDSA 4OQZA 2V7PA 1IPEA 5DZSA 3DC2A 4DA9A 2B0JA 3EHEA 3EMKA 4PLVA 2VHYA 4GQAA 4IY1A 4UEKA 2VOJA 4MP3A 5CG1A 2LDBA 5KJ6A 5CEFA 4PLTA 4J90A 1ZBQA 3RASA 1IOLA 4XR9A 3KZVA 1DFIA 1ENOA 4NMHA 2XF8A 1KEWA 3H9UA 2I6TA 3QW2A 1L7DA 3GMDA 2XXBA 5L4LA 1X0VA 3WBBA 1AHIA 3LT0A 4XZ3A 5ICMA 1YGYA 3BMCB 4LW8A 4D0SA 1GDHA 3D7LA 1T26A 3JYLA 5U9CA 1HYGA 1QYXA 3K31A 3PEFA 2O50A 4FGWA 3QWFA 5IG2A 3U4CA 3T7CA 4YBZA 4GLOA 4FD3A 4GVLA 5L3ZA 1QORA 3W8FA 1XEAA 1YOVA 1ZK3A 3D4NA 2J5KA 2BI8A 2AQHA 4I5GA 3DXFA 3D1LA 3JQAB 2CD9A 5CP8A 3KLMX 5JY1A 2IEBA 3I9NA 5A3JA 1DC4A 4BB5A 4E2YA 2CVOA 2HMVA 2FPIA 2HAEA 3JQ6A 5EERA 4MIEA 1NPDA 1KC3A 4IM7A 3OM9A 1B26A 1A7KA 1BW9A 1QYWA 1O95A 2JFFA 2C0CA 2AMFA 2AQKA 2ZQZA 2ZJ0A 2ZYAA 2VUUA 3RCBA 3JQ9C 2OXIA 3JQ7A 4NHEA 3RUHA 4AICA 4DQVA 1K2WA 3KOUA 3X2EA 2HJRA 1BRMA 4JP2A 1GY8A 4E12A 1I10A 4ND3A 3QP9A 1SMKA 2F1KA
chains in the Genus database with same CATH superfamily
2VYQA 1PEAA 1MZVA 2FPGA 3IA7A 3NGMA 1XU9A 1YJBA 1S4QA 2PFKA 3EA5A 3HJAA 1JBEA 3QF4B 1KIMA 3AM3A 5DTEA 5GOTA 4EW6A 4U8GA 1M34B 1GKKA 3CC8A 1VHQA 5B58T 5DYWA 4LPKA 3W6NA 3FWYA 2OO5A 1Z6TA 3P8ZA 5ER6A 4GE0A 3LSYA 5T57A 1P4RA 2GM9A 3E6AA 4IV8A 3KZMA 5BYJA 3RSFA 3TX6A 4UAGA 4BUZA 4JQYA 1JQEA 5GIOE 2ZIVB 3CEHA 1W48A 3ITKA 4IXDA 1G0NA 1PSZA 1UPUA 4QT0A 3T4EA 4DARA 4F21A 5C2JB 3MRXA 3FVRA 5LNK1 1J70A 1LPSA 1FXSA 3FG9A 4AZ0B 3A14A 1H0SA 5DHQA 4NV1A 3HB1A 3NAQA 1M0SA 5F5NA 4D9EA 5LNK6 1ZL2A 5AT1A 2XTMA 2JL1A 4AY3A 1O5OA 4YPVA 3C15C 4PSAA 3HRHA 3VZQA 3QV2A 5BYKA 4X84A 4KDEA 3AM5A 4G8JA 1OZAA 3HRIA 1KI3A 3HL4A 4U9HS 1OU0A 3WOHA 1YJCA 2C8VA 2HF9A 2HPZA 3UK0A 2Q7XA 4DLTA 2G9QA 4Z2AA 3GLIE 1K6EA 4FFSA 1RM5A 4HP8A 5E6RB 3FJ1A 3CIOA 3KB1A 1UPFA 3T1NA 1FNNA 2AFHE 1KFEB 1POWA 3CKLA 4MUMA 5LXTF 1YULA 4RVCA 4PZDA 3VPDA 1IK6A 4TKLA 4HX2A 4X95A 2H5EA 3BA6A 3WJ2A 1QTIA 4GRAA 2Z5GA 2FPOA 1YRYE 4RSGA 3WXBA 1FVOA 3JVEA 3TCXB 4DXDA 3B6KA 3DKIA 1TTQB 1J0AA 1BDMA 3HN7A 2WY2D 1LDNA 3P0JA 4YEDA 5JNSA 1NX6A 5EHIA 3M1IA 1ULZA 2R60A 2CV0A 3NHJA 1TD1A 4JLAA 4FB5A 4IV5A 4MWSA 3ZOKA 2NTJA 1N2EA 5LXTA 3CT6A 4NQRA 3THYA 1G59A 4JUFA 3WWYA 1LK7A 2PAAA 3K0AB 3R1IA 4P7KA 4FHCA 1YFKA 5EE1A 3ER6A 4Q37A 1XWWA 4KJZA 4ON9A 2BP7B 5IAJA 4BJ5A 1U7UA 2CLOB 5IJ0A 3IP1A 4MW4A 2WUEA 2OD9A 3DTVD 3COJA 5BXQC 2XMDA 3H5TA 3G0HA 1HRDA 1K9SA 1VB3A 4KQJA 4BYGA 5IW8A 4G01B 4Y6PA 2FMUA 4AU1A 4CQMB 3TOCA 1CJKC 4CXMA 4OHPA 2GBCA 2DSTA 2QTVB 1J22A 1SC9A 1G20B 3K3PA 5EMMA 4HUQA 5FUXA 1Q6ZA 5E6SA 2YUTA 1P1BA 2A9KA 2FWMX 2J0UA 3PFHA 1ZVJA 2F48A 2ZWAA 4JFAA 3ZHQA 3SCZA 1ISIA 4JY7A 3SBXA 2JBAA 1ODTC 1DEOA 1VSBA 1X7XB 2BFNA 4C4PA 2DLCX 1VMDA 1UP7A 3HJTA 3JAWB 1KBZA 3WGLA 2X8JA 2VZ8A 2QSZA 3I42A 3IFSA 5EWJA 1CY6A 1WO8A 1PHRA 2J9FA 5FJJA 5BVGA 1KORA 2H4FA 4I4LA 3LA8A 1R15A 3HCPA 5C7OO 1CUWA 1E99A 2P0YA 3LW7A 5DX1A 2WQ7A 3A4VA 1XAHA 5HIJA 2UZ1A 3AONB 2G67A 3UOAB 4EY3A 4R1UA 1M0TA 4KDRA 4RVSA 3MJHA 2CJPA 4R05A 2PKXA 4X65B 1J6UA 4IVRA 4H6XA 4RH0A 1TL7C 3SR3A 1WXDA 3GZTB 2E89A 4OYLA 5G1OA 1Z7WA 4QICA 2DETA 4HX5A 4OPMA 4OHKA 2PMBA 5EAIA 3S27A 2ZIXB 4LHSA 1DE0A 4GR9A 4ZO9A 4ZAVA 1P2TA 4RKYA 3OFJA 2O2ZA 1VE3A 5JC8A 5IBRA 4EENA 5LR6A 2BM9A 1BWPA 1FX1A 3F3MA 1YKSA 4UHCA 3I0NA 3AERB 5CCDA 3D3WA 4Z54A 3PXAA 1NQWA 1YQUA 1P81A 2AK3A 4PFJA 1EVKA 2A1UB 3OJEA 3A2KA 2MSKA 4UDOA 3B5IA 3ZVMA 4MGIR 5JQGB 3Q0IA 4PU0A 4URYR 7ADHA 4ALJA 4EPWA 4G8BA 5FTWA 5IKOA 4EH1A 1H85A 3SJBA 4HDQB 4RSMA 1JG7A 4QO8A 3VNQA 2QN2A 1Y34E 1Y6GA 3HGQA 1ZH0A 1IPHA 3CRNA 1NVUQ 2RJOA 2DAPA 3ROXA 2X13A 1FUUA 4KGVA 2AZDA 2CEKA 4DPKA 2ZREA 1UJCA 2X7XA 3DZJA 3G2IA 3E9ZA 5E4TA 3LUHA 1P33A 2B8JA 4Y0NA 3SIPA 2AG1A 3STVA 2IYLD 3ND6A 5AVWA 3OE5A 4X97A 4UNQA 3U9LA 1L5OA 1Z9BA 4I55F 3TXYA 1Y4ZA 2VBFA 4H7FA 1KI6B 5TMDA 1JTVA 3WWDA 1SUEA 2B3TA 3PUHA 5IAKA 3OZSA 4EYKA 3SF8A 4O2AA 4AAYA 1J23A 1D2RA 3DDUA 2OXTA 2EU8A 4UHJA 1IJFA 1YA6A 4A92A 3VAYA 2SECE 4K81B 1QCZA 5CA1B 2V3CC 1UEIA 1GZVA 2JLAA 4D0RA 4BNVA 1OAOC 3NHRA 3BGDA 3FLBA 3PA8A 2WYIA 1QV9A 3WTCA 2O7VA 3H13A 1YI0A 2XE8A 1FLVA 5AK0A 4PICA 4P34A 4BGEA 2HZ7A 1NR7A 1MQAA 1P2BA 4KN5A 5TF4A 2H2HA 5JECA 1OH5A 1TVMA 5CAEB 1EM8A 2HO4A 3HWX1 3MJ4A 5IAAA 5L9AA 4JJ6A 3ZWBA 2E6KA 3DTVB 1APBA 2FPXA 2IYQA 4EI8A 5C51B 2M1XA 5CX1B 2Q5JA 4Q7MB 1DEAA 3N0RA 1C7EA 1QNFA 4DWVA 1K7SN 3KYCB 1NI3A 1K06A 1C0EA 1Q17A 3CNNA 4JIGA 4QFMA 3AM4A 3I6IA 1FBTA 4U2DA 4D81A 4O8ZA 2W2KA 1T5OA 4F3CA 1I9CA 5BOSA 2ZRFA 4P9NA 3VOAA 2BGJA 1MRZA 2AXNA 3QM1A 1P6UA 1HDRA 1N3IA 3JQBA 1U4SA 5BPFA 1OBCA 5DF1A 1BYIA 1Y9JA 1LQ2A 1HDIA 1AZTA 1TJ3A 1RYDA 1B93A 2OENG 2R8BA 2F3QA 3QPCA 4JJZA 4RH3A 3PJGA 5EJAA 5JDCA 1NJSA 3TOZA 4TZKA 2OE2A 1X7ZB 5U4QA 1REQA 4MHOA 1FU4A 2AOWA 4WGFA 2HSDA 2VUHB 1Z0JA 4WUTA 3UJ8A 3Q3VA 3G2HA 5I9LA 1X38A 3F1KA 5TT1A 2GCGA 4IWXA 4V3BA 4KLRA 2VPXA 4IKPA 1RWWA 2WDZA 4RESA 1JPVA 3IUNA 4WY2A 3TZBA 5BURA 2G8NA 3A6JA 3V2GA 4V0SA 1YB2A 2X77A 2ZRBA 3C39A 3PCXA 3LC0A 1DELA 3IP9A 2YV2A 3OPNA 1VMIA 5BYAA 5L45A 3GT7A 2O2DA 3ELUA 4IICA 4Y9SA 3SBDA 4RTKA 1OFTA 3U4MA 3BDAA 1RJ9A 3QE2A 4OREX 3KZCA 2RHLA 4I6EA 1Q84A 4U02A 3GNQA 2H17A 4PYLA 1P5FA 5FWXA 1MIOA 1QYVA 1X8LA 2BUBA 1FLNA 4KZKA 1PYOA 2ZKLA 2F1HA 4OBXA 4OQEA 3K32A 4PC7A 4ZEOA 1V7ZA 1SC6A 3C41J 1NJFA 2IBMA 3DM5A 1E4VA 4LY6A 3HV2A 3RBXA 4NYIR 3IYLW 3TMYA 4DLXA 4ESHA 4IINA 3E70C 2VRBA 1L4FA 3Q88A 3W5SA 1ZVVA 3WOVA 3G8DA 1T3TA 3JASB 5ALFA 1TDJA 2JHFA 4YLGA 1ZWLA 5A6SB 2YFKA 1DIBA 2JFWA 1MJGA 2IYVA 4L5IA 4L5AA 1DG9A 1XZIA 2J4DA 3VU3A 2EWWA 3S2ZA 1KFJB 3FSRA 3V33A 2VDMB 2YJTD 3CZ9A 1PW5A 3S2EA 1W1WA 4HL6A 2Z1NA 1Y63A 2W2OA 1G8GA 3HO6A 1A88A 3G5AA 3MYYA 2O3QA 5DSXA 3HXLA 3WK4A 3TF5A 3I45A 4FINA 4X7RA 1KU6A 3U7IA 4JCCA 2X1HA 2RK6A 4JKOA 1LCIA 4CV0A 4DCVA 3Q3IA 2ZUCA 4ZTBA 5IAOA 4KZPA 3HXPA 1SVUA 4L4UA 3QJ5A 3CVJA 3N6XA 2PKEA 1MIHA 5CFPA 1AGXA 1PU2A 1W93A 3HRKA 5DCUA 1G8JA 1CEYA 1L5WA 1IVYA 1E9DA 1FY2A 3TUJC 2H7CA 2B1JA 1ZU4A 3U3KA 1N9GA 4P3YA 1ZJ6A 2DP4E 3DF7A 2B30A 2R1TA 3FVTA 3IOMA 3RRJA 3DO8A 5ECGC 2O4UX 2I33A 3GBSA 1ST2A 1Y6RA 3CF0A 1IHPA 4J94A 3ZN2A 2C54A 2OV3A 5EPOA 3DAHA 5DW0A 4Z7OB 1Z2NX 1UBEA 1L7EA 5LZ2A 3B5EA 2V9PA 3FBGA 5A4KA 3NVDA 1SPBS 4QU0A 1Q0QA 2BMEA 1EWKA 2GTPA 3KXLA 4LJ8A 4XGNA 3TJRA 4XYMA 5JCJD 2NPOA 2WUGA 1FFHA 1KAGA 2DBQA 4OHXA 4EJ6A 3LXRA 5ELMA 3WK5A 1OT5A 3QVVA 3QZUA 1JHMA 1MDBA 1KZ7B 3ANYB 3GCDA 4HGPA 4EA8A 1J2UA 1D1SA 3NEYA 4YIKA 3BVPA 1ISSA 1XROA 5EMNA 5I4KA 2QW8A 4OHOA 3L06A 3K0SA 1UFOA 2VRWA 2ZG6A 1Z0SA 4H4DA 5LZ5A 4B75A 2BR3A 3F67A 4C0XA 4IIJA 3RK0A 1ZIPA 1SVSA 3CNQS 1F4PA 2V45A 1U0FA 5A0FA 3S5UA 2OZPA 5CM8B 5B3LA 5KWEA 2P2SA 5LJIA 5EE0A 4KGDA 2IIBA 3C3XA 5LP6A 2O8EA 4JS0A 3MPUA 3A1VA 1J9ZA 4FSDA 1CJBA 3K5IA 4CLDA 3CMCO 4FE3A 4PLYA 1OGJA 2K87A 4II3A 3OJWA 3AUXA 4MWZA 1JWBB 1G3MA 3EY9A 1I6WA 3VR6A 3CW2A 4FNOA 5AESA 1KR5A 5JCZA 1TEVA 4ZMBA 1LPOA 1ZZGA 2V9CA 2BSXA 3OLYA 2RGBA 1JU3A 2QLLA 2XVYA 3NWBA 3VKHA 1NYLA 2QM0A 1Y81A 1E77A 3H6KA 3TBKA 1M5RA 1SB8A 2GVZC 4CMIB 5HOEA 3K09C 1N9GB 1W87A 2YV4A 4RS4A 4CT5A 1GFSA 3ON5A 1L7BA 2VRNA 1FFBA 2QX8A 1P4AA 5KWSA 4D99A 2KHZA 3CNOA 3OBIA 3OPMA 2FF7A 2ZBGA 4JU9A 2KI5A 4F38A 2A9VA 5KYYA 4F4IA 1RBYA 2L0XA 2C7PA 1YE5A 1E98A 5EJGA 3SZOA 4F3NA 3EOAI 1V71A 5AJXA 3VPSA 2XUFA 5GZ1A 2XRYA 1BA3A 3W0LB 5JC1A 2O8DB 2XEDA 2UUCB 1Z6QA 2RH9B 1VHDA 3WLLA 5WRFA 1NW7A 1Q50A 4GOND 3JALA 3LY5A 2G0TA 4DAOA 4J9UE 4A91A 4B0PA 4LQCA 5HGXA 4JZYA 5ECYA 1ZUNB 4FHEA 2XCRB 1AK2A 1M1UA 3QE9Y 2V6IA 3EDMA 4HH3C 2C3PA 2O1EA 2WT9A 4ZHSA 1ZJYA 4ESVA 3K1JA 2QF7A 3A6ZA 1ZQ1A 4BRZA 2QNBA 3GGGA 2ZAOA 2PRSA 1SWWA 1CRWG 3ZXXA 2Q8QA 2BFPA 2XW6A 4OB8A 4DT1B 2QM3A 4DG9A 1SZJG 1RXWA 2YHSA 2NZUG 1ODKA 3OUTA 4IIUA 1UC9A 5BT9A 5B4TA 2ZJ2A 2HF2A 1FOEB 1OFHA 3MT0A 3T5GA 4YR9A 5I9TA 2GS9A 3EZ6A 4QJBA 1PR4A 4NLLA 2PT6A 1TCAA 2D1YA 1JHUA 1J2EA 3ZHBA 1PK8A 2AYXA 4Y2VA 4XEUA 3IIMA 4PAGA 2LW7A 1KJWA 2Y2UA 1K88A 3EGVA 1ISRA 3A4TA 3DEIA 3HLKA 2PWZA 4KVZA 4WCFA 5H16A 4LZOA 1MG5A 2ZR9A 3PRJA 4QGGA 1P7WA 3C7DB 4TSFD 1WE2A 5F1OA 3UFBA 4BKQA 3AJAA 3M5PA 3ZS8A 4YV7A 5KNLA 1U7PA 3MOGA 1X92A 4O4LF 5F1YA 1GPYA 2GEVA 3DPIA 3F5FA 4X8MA 5TPWA 4F04A 5J2UA 2WIBA 2A30A 1I33A 3U13A 1M76A 1MOPA 2GPWA 3ANLA 1CZHA 3B7GA 3CRZA 3LY7A 4M53A 5FQNA 3GLIA 2DXIA 1FXWA 2GBGA 3IESA 4O08A 3IQDB 2B92A 2C83A 1MEJA 3QQ5A 5EKSA 2OO3A 5GONB 4ZEVA 2XTZA 2D5CA 2XDWA 4II2A 1I4LD 2GPAA 4Q02A 5D87A 3ZCQA 4JC8A 2FXVA 1ZC3A 1EFDN 3EB9A 5I7OA 3WRXC 1Q1BA 4YROA 4MR8A 1ESMA 3ZE9A 4C2UA 1E7QA 2P5YA 3TGLA 3OOYA 1F0KA 2PUWA 2WHRA 2WP8J 5CB6A 2GZMA 1X7GA 2GJ8A 1BXKA 4M0FA 1MABB 4LRYA 3UAWA 3WGVA 3DAYA 3GLGB 4FMBB 1UKVY 2C03A 4YACA 3N3BC 2WM3A 1JFFA 1Y37A 4M7WA 4BNGA 2H4YA 2ZIUB 3VPXA 4J3NA 4G1EB 1LDYA 1EJ6A 5IN4A 5JAIA 2GESA 5FPSA 4C6SA 1BGXT 5C4GB 1E5XA 1BKYA 1LI5A 4QNMA 4KYVA 3I62A 1S6YA 2P5TB 3SZMA 3M1AA 3DO5A 4FS8A 4BMZA 4MDFA 4IF4A 3F73A 2R3SA 1ZOSA 2W37A 2W00A 3JD2A 2PH5A 4FI3F 1YL6A 2G77B 4TXHA 3LSTA 5DBIA 1YMVA 2EBFX 3ONVA 3PSAA 4JZKA 4YLEA 3KUXA 2RB4A 4LXQA 4RHYA 5JRDS 2VA8A 5BO5A 5J5CA 1G17A 1H6BA 1U2RA 3BXXA 5C52B 2FPPB 4W5OA 1YS7A 1VLZA 4K05A 4QREA 5FL7A 5EQTA 5BR4A 2QT0A 2VF8A 2M32A 2Y1EA 4GUAA 4PG5A 3RYTC 4PO8A 5KB3A 5FPTA 2F1JA 5YASA 1EHYA 4OO3A 4HYYA 5IKPA 3E22A 2W58A 3INYA 1N75A 3QTLA 4F2PA 1P91A 3EMDA 4W6ZA 3IQEA 2WG0A 4DJJA 4CL2A 2F3SA 3V9PA 1U04A 2IH2A 1JIVA 1VRWA 4F5YA 3ER8A 1H4TA 4TT3D 3KLOA 2Y6VA 1AHNA 1XXHE 3G68A 1XR3A 3DOJA 1ONOA 3P9QA 4FFBB 4WZBE 4ZAZA 1K6JA 1N0WA 1WHTB 5JD3A 2DJIA 1T3LA 4NCKA 4TUYB 1UEJA 1QO9A 1HF3A 3OZVA 5ALWA 5K6AA 2PGXA 1GNVA 2JGFA 3H0CA 4LOJA 5F9MA 1DBIA 2GI4A 1X7WB 4MA5A 3D02A 3THSA 4NWIA 1XCPA 3KR1A 1V8DA 4HD8A 2EJUA 1TFUA 1Y4SA 3QEOA 1A2BA 1DQNA 1L4KA 2HB6A 2WLSA 1PL6A 4HTAA 1IDOA 4UCXA 2JATA 3R7FA 3VUEA 3ZWOA 3GGPA 2Z98A 1I4DD 4L7VA 4R1OA 1EPUA 4E2WA 1M6HA 2K7FA 1TLTA 1RLTA 2Z3WA 4Z6KA 2E82A 2PUJA 2DTDA 4O2BB 5DYIA 4B6SA 1CF4A 3Q6MA 3DB2A 3U7EB 3AW8A 2NV2B 5ESWA 3A27A 2CLDX 4UFNA 1T2DA 1J56A 1OLOA 1RRPA 2P9TA 1IN8A 1L5SA 1WLYA 4BNDA 1EAMA 3IHTA 1ZD5A 2F9MA 2Q3BA 1ZUD1 5LPNA 3U09A 3D0KA 2AZ4A 3IBGA 4B4VA 1J2YA 3NC1C 1UBRS 5EL0A 4YR7A 4FMDF 5AXDA 2JA2A 1JEAA 4K40A 1TM5E 2C94A 4YDQA 4RTSA 4ONEA 3E7DA 2BFBA 1EFPA 1JIUA 4MGKR 3SICE 5EIBC 2BDEA 4W5NA 4RE6A 4RIIA 2Q4BA 2W71A 1M75A 2K7ZA 3DM9B 1CR6A 5ITVA 3UBMA 2A7XA 1LUAA 3NYWA 5DNDA 5IM5A 1EUDA 5NLLA 3ZDEA 4CN8A 2VKQA 2LR0A 2ORYA 3BRWD 4O4JA 5HFAA 3ZWWA 2DPXA 4RCYA 2HIHA 4KAFA 3IX7A 4NZPA 3EGEA 3QUQA 1NVGA 1M1YE 3OHPA 4WLVA 4XWTA 5G1PA 5DTQA 5JQWA 3WLEA 3PRKE 5A9SB 5JS7A 4KLZA 1U7DA 3WQQA 3DWIA 2IS1A 2RI1A 4FZVA 5JLJA 2NU7B 1N2HA 5AM2A 4WZZA 3KQHA 3WGHA 4HTFB 2IXEA 3AL0C 4UHHA 1NMSA 1Y6JA 4JLWA 1USVA 2I3DA 2DRIA 1THMA 1V4BA 1Z4QA 4TQUS 4EB0A 3EXG1 1E2MA 2RCNA 1C9DB 1FXWF 4F46A 4A2PA 3R8XA 2QEQA 3C8DA 5MFPA 3AF6A 1XZCA 4YHBA 2KLHA 1NW8A 1FYWA 4F60A 1LWNA 4NOLA 2H7YA 3KEQA 1F8FA 3OJLA 4DNQA 3FRHA 5JNTA 4ZODA 4HMQA 3CLVA 5FWAA 4G63A 4M86A 4OQNA 2QZ4A 2OHIA 3H18A 4M46A 4MYDA 4TLDA 3NAZA 3W5JA 4CCWA 2FZGA 2IDZA 1QJCA 3UENA 2E49A 4ZV9A 3D1VA 5BN4B 1YUNA 3L6UA 1KPHA 3ENZA 1J8MF 2HJHA 4G0UA 5KTTA 2P5SA 4OBWA 5DK4A 3IEXA 4RZXA 1QIDA 2GCOA 3P4XA 1WAMA 3QFCA 3R9WA 4RK4A 3AJ8A 1WIWA 3SFZA 3WV4A 1KTIA 1KAMA 1D8AA 1EBUA 3FPKA 4QPPA 3ELBA 4JNCA 2O7NA 4MTLA 5BQ5A 4QARA 3TEMA 1SWVA 4PHTA 3X1KA 1U0NA 5H83A 4O1MA 1PAUA 3BZUA 4JLSA 4UU0A 3FNRA 2PJRA 5F2NA 1C1DA 2WM9B 4LOKA 3P9KA 1NSYA 4EYQA 2HK8A 4ZV4A 5L3SB 3IAM1 1IXKA 3FETA 4EG7A 2BI7A 5ALXA 4ENQA 2MSNA 4M0UA 3OY2A 3ZR4B 1KYVA 3TDMA 2WHPB 3I9OA 1G5HA 1R6DA 4LGMA 1JIXA 1P45A 1P72A 4KXVA 3OFKA 4OI4A 3I04M 4XR9A 1FNCA 5CW2A 4LBYA 3T9CA 2G9VA 1NJ8A 1E9VA 4K7JA 2PRIA 4B46A 5MGNA 3INGA 4Z4EA 3P7MA 1SHZA 4RFSA 4D92A 4BLWA 2EZUA 3C70A 2QYSA 3V8RA 4BN5A 1GRQA 4R1TA 5J9FA 3DZHA 2GCNA 1L6IA 3E9YA 3PNSA 4ZOEA 3RVSA 1BCSB 1O4VA 1R8YA 5BY2A 3ASZA 1AB6A 3NT5A 2AOUA 4QYXA 4QXAA 4EW3A 1P39A 5TDHA 4DR1B 3U4DA 1ADFA 1DX9A 2EYUA 3OQVA 3KS9A 2ZXFA 5A3QA 1CY0A 1YE8A 3BRCA 2BYTA 121PA 4B84A 3QLVC 4J2OA 2PGNA 3QENA 4QEKA 2OHGA 1FW6A 4DNPA 5AK6A 1N4DA 1JHZA 1OFIA 2VT7A 1ECCA 2ZIXA 5FF9A 1LZLA 4TWIA 2EX0A 4WK2B 5LB2A 4REQA 1OVGA 3GO4A 3TJMA 2C57A 3G9QA 1YCDA 3KKKA 1OY1A 2NAPA 4EPRA 2Q62A 4EECA 2JFPA 3BIFA 3FDIA 4INAA 4MIOA 2OCKA 1RM4A 5DLQC 5TY0A 4FBMA 4MQMA 3RANA 2WAOA 2PJDA 1QHXA 3IV9A 4IW3B 5L3QA 2QTBA 4OA8A 5E95A 4DANA 4FLMA 3JRXA 2CLSA 3DBRB 5EJ6A 2VPWA 3HH8A 3RS9A 4WXYB 1NLUA 5LIPA 1EM6A 1LS6A 4OQFA 4RD2A 1J8YF 4RIFA 1ENZA 4RH1A 4Z7NB 1F1JA 2XA1A 4QUJA 3FTEA 3EXAA 3PDUA 1TYDE 1ORTA 4BPRA 5J2UF 3B8HA 3H2ZA 1NDHA 2CMFA 2AYYA 3QMMA 2J32A 4D9KA 5IUJC 4BX3A 1LBHA 1GAQA 1YL5A 1CULC 3DDNA 4L7QA 2Q41A 4OGGA 3TE6A 1XDUA 3E03A 3C3CA 1ZSNA 3AR4A 1EH5A 1OIXA 3G88A 2AFIE 3A4YA 5IUKC 3SDSA 4I55A 1E8MA 1Y1PA 3VR6D 1PP4A 1C3LA 2IYZA 3EIFA 5LMZA 4RGBA 3KQSA 4URUR 4J0IA 3B20A 3V6LA 5IWCA 2QTNA 4QNRA 3PUJA 3GP5A 4TVOA 4X6LA 4DZRA 2FP4B 5F2KA 3VTZA 1N6KA 2ZTHA 3ZW8A 2XDYA 2Y4NA 1PZHA 2JGMA 5CK4A 5ADUS 1OROA 2TMKA 1JT9A 3HADA 4KSYA 2LD4A 2XUQA 5GVRA 4MCAA 3PK0A 2QRQA 4AZTA 5I7VA 2C58A 3GFTA 1SUDA 1XLTC 4N0PA 4NC9A 4V03A 2XEXA 1JP7A 2OXFA 3W5HA 4ZI3A 1R0ZA 1Q0LA 4MA0A 1ZICA 3IH5A 2P4SA 5LP1A 2O59A 4U5QA 4ZCLA 1GR1A 5FI1B 4E11A 1X39A 2ZR8A 1JLRA 5AW8A 4WXEA 4PTYA 3ZZNA 1AKYA 2WK1A 3R3VA 4GW3A 3DTTA 3ECAA 3B6JA 4RD6A 4O4IB 1LW6E 1CLUA 4G85A 2P78A 4FYVA 1Z2AA 2AD5A 4MARA 4Q9AA 2ONJA 4RHUA 1QDUA 5F2OA 3P2YA 5LBTA 1CUDA 4BVLA 1B1CA 5EXDA 1OWLA 1XE3A 3FMFA 4ZVSA 2DYKA 3HJUA 1DKOA 1MB0A 1SUWA 3F46A 1VGRA 4NEGA 3W79A 1RWQA 3DD1A 3MTIA 1DG3A 3O0TA 1C9NA 4ZKEA 4FMPA 2O5CA 1OLSA 1JG3A 4MNTA 2Z2IA 2VP4A 4WOPA 4C0BA 3U56A 3BMQA 4CM7A 2FOLA 2QVGA 4N5NA 3AG6A 4HDKA 1I4WA 1E3LA 3CBGA 5LQNA 1QSGA 4WJZA 5HTOA 1QAOA 3AEZA 3D4BA 5BV7A 2PWPA 4KDFA 3VU8A 3HYNA 5ES4B 1TQ8A 5A05A 5PGMA 3ZVKA 1JLKA 1SURA 2FW6A 3FA2A 4BATA 4MRAA 2QK4A 2OXRA 4JJ4A 4WCVA 1C0PA 1JTFA 3V7WA 2WSBA 1NN5A 3SIWA 3ZX4A 5CVDA 5F64A 4LBVA 4BFWA 1CWUA 1NVEA 1V48A 2LWIA 3SC6A 1I24A 1N6HA 1D4OA 2Z2ZA 5HIAA 4RELA 1F4LA 1NBOA 4G0WA 1TJ5A 1Q16A 2I34A 4YYZA 1WCYA 4P4SB 2GBLA 2YWCA 1I7QB 2C5FA 4Q1VA 5L7WA 3HXMA 4FDLA 3AVTA 3G23A 2I4IA 2NUTB 2OORC 3B7PA 3MPOA 4V2IA 3K1TA 5FUYA 3U44B 3O8NA 1RPZA 5EXPA 1N2GA 4LJ6A 1DT3A 4EHHA 2ZR0A 1K98A 1SRRA 4YMIA 5AW3A 7REQA 4LGYA 2UDPA 4HTFA 1UJ6A 5A1JA 1KY2A 1MCZA 1ZRHA 1XLWA 1C8KA 1YS9A 3O73A 3UPUA 3UGKA 4HNVA 2YV3A 2BN4A 2BGRA 3EARA 4OGWA 2WSLA 4Y6RA 2XUHA 3RVPA 3UAOA 4B9AA 5E7MA 5I3ZA 2UXBB 4XB1A 2QAGA 1UBFA 2IW3A 2R25B 4XWYA 2J3QA 2ZYTX 5DBOA 1YRQA 4JUCA 1L1QA 1N0UA 3AF5A 3X1MA 1IN5A 5TIIA 2F6RA 2FX2A 1AKQA 1QOPB 1T1IA 3ZD9A 2BBTA 1YCHA 5BR7A 4OCZA 3QITA 3DUFB 3AR5A 4YT8A 2GRAA 4ND7A 5ALTA 1X2BA 2BHLA 4QLOA 1EE1A 2JJ8A 5K3BA 3LQKA 1O0CA 2WE7A 4JUBA 3QFTA 2HF7A 1ECFA 4RY2A 5BRAA 5K03A 4DB4A 1SPXA 4UBLA 1DBVO 4ABTA 3P9SA 2FN4A 4EP1A 1VCIA 1QVAA 2ERYA 1X7DA 3OFND 5LUBA 5T6MA 3SQOA 3JQGB 1SOMA 1ODIA 2OY0A 3RJTA 3GELA 3BMOB 3W77A 4DDHA 4S0ZA 1T2NA 3UGJA 2QBYA 1DUVG 1ILEA 3WLHA 3GROA 1CB7A 1EU1A 1WCXA 3FPLA 4YAOA 5U4XA 2ZJBA 4YJ3B 2C5SA 5KMGB 3BICA 3T94A 1SU8A 1ONNA 1FFEA 3VSAA 4R31A 2E4ZA 4UTVA 3BEOA 3AF1A 1SD1A 2ZTLA 4Z4CA 3EGXB 2VTDA 1V11B 1EKXA 4NQZA 1QGYA 1C3JA 3CUEF 3A06A 2PSHA 3F5DA 3SFVA 1MGOA 3H0KA 1II8A 5EXSA 2QIPA 5BRNA 6ABPA 4N7BA 2XCUA 2Q6IA 4GNKA 3ESRA 1KU0A 4ZARA 3L4BA 4WZBA 4KQHA 2PH1A 3EWNA 2JGDA 3M1LA 3AY7A 3QJGA 4C88A 4KRFA 1MV8A 5C80A 2WVJA 1J0CA 3PTLA 4EJSA 1KY4A 2OESA 1NBWB 1XQWA 1UK7A 3CEPB 3G49A 3P19A 1H3EA 1ONSA 2ACVA 1W9HA 3B6MA 2GFHA 1LB1B 3E9MA 3MBIA 4CIVA 1E20A 4PGFA 4U2BA 5BSGA 1IY2A 1LU9A 2YXEA 3NLLA 4II7A 2A5YB 1MX5A 1MX9A 1WR8A 4TV8B 3ITEA 4BECA 1VZ3A 1B74A 2LUOA 4MI6A 3TX2A 5HCUA 4BJ1A 2MYPA 5LDDC 4GH5A 1D4ZA 3IUPA 3RIXA 3LNCA 2QL5A 3FPAA 4HH4A 4JXJA 4NZMA 5IANA 3BD8A 3ICVA 1NR1A 3RFXA 1M2KA 3O8OB 3IVCA 3IP6A 4RE5A 3JARB 1KDPA 1W94A 1EDZA 5BSRA 4EOGA 1UBTS 2SBTA 1U6JA 4TROA 4Q4AB 3GEBA 3PQEA 5IYZB 1EP3B 1TKBA 3EG9A 1IFXA 3OTGA 1QQAA 4JBXA 1MTZA 1YIOA 3ENNA 5HMMA 4Y7CA 4MK4A 5ANRB 4KQ1A 3EGWA 4KN8A 5COBA 1SHKA 1U9IA 2EKLA 3K73O 4LXUA 4NCHA 2OHXA 3H2JA 4IVPA 2XRZA 1U2GA 2XZLA 4HGNA 3I92A 3QY9A 4DRYA 2J08A 4RUKA 2G4CA 4ZTZB 1M1NA 1UFVA 4MTCA 2C04A 3MEQA 3OZTA 4WXHA 1RR6A 2FTKE 3AIKA 3Q40A 4DDUA 1YB6A 5HKKD 3SYNA 3A6KA 4BMNA 1QGAA 2HLDD 1JQAA 2HU8A 2IZ7A 4QQKA 5F23A 1YC2A 221PA 4NF2A 3PWKA 3GK3A 3BRWA 1CUZA 2OHHA 1X9HA 1ZM7A 4RQAA 2J8ZA 2Q3EA 4CLHA 4FX5A 3O4VA 1YU6A 4J6FA 1TXGA 2O3SA 5KNCA 3LLMA 3M4NA 5A7GA 3ZWNA 3WKDA 5LLSA 2JVKA 4X5OA 1NY5A 3TGWA 2DR3A 1JX6A 4X54A 5BMVF 1CFJA 5AW1A 4RL6A 1P4GA 4EWLA 3QVJA 1QZTA 2JKYA 4UNIA 3TLKA 2PZGA 3AEKA 1SR8A 3KB6A 3K96A 1IMJA 3BXOA 4EF6A 3NV7A 4DLLA 5FTJA 3WL6A 5BN5B 2DPYA 1OLUA 2X0JA 3LKDA 4RPCA 3IBYA 4XFJA 4ARIA 3NBUA 4RHEA 3ANNA 1SBNE 5AVYA 3WGTA 3W6ZA 3MHPA 4EDFA 2QI9C 5AFSA 5D3MB 2BGUA 5K51A 1DRKA 4HDSA 1VCNA 5TQ2A 1MENA 4JVMA 3UICA 5DLEA 5JAMA 4MAAA 4RMIA 4EY6A 3IMFA 5K8TA 3H9BA 1CEEA 5CBPB 1YQQA 3L93A 5F7JA 3S29A 4HKTA 6GPBA 3F9RA 1E1RD 3MILA 3RK1A 1SNYA 3OURA 5C3MA 2XWSA 1OX4A 3B9BA 5HQJA 5EIOA 4B5LA 1N77A 3QA9A 5TARA 2LKDA 4UM9D 5BQPA 5GJBA 2K6GA 3PUZA 3ZHVA 4YY3B 1N6OA 4K0RA 4WDRA 1O97D 4XIIA 2IHJA 1A5AB 3NAMA 4HGYA 4NTZA 3U3RA 4DKJA 2JIBA 3AC0A 3VR6H 2VUTA 1KOGA 3HJHA 3S68A 1E6MA 4FNAA 3TJZA 1YR8A 4GE3A 4US0R 2GPBA 4DQLA 4YUAA 3PNPA 4JXKA 5BRJA 1XU7A 2XGMA 1U7WA 4ZQEA 4G4IA 2C00A 1WEHA 3B82A 3TZCA 1X80B 2AMYA 5B7GA 2ZZNA 3ZBTA 1GARA 3BDVA 1U5AA 3FUXA 4JJFA 3UHFA 4RLSA 4XQGA 5K0BA 5CITA 4I81A 3V6MA 721PA 2YY6A 3KTAB 3DBVO 5JOQA 4IWNA 1E2UA 3HKDB 4MQEB 3KVRA 2YN0A 1XHLA 2H8KA 3NI2A 3NIWA 2YJGA 4Q3LA 1T8PA 3SZ3A 3ZWPA 4WDQA 3X1YA 5ISMA 2RGUA 4DUZB 5CHYA 2I4MA 4MVJF 4DUYB 1EDEA 4ZOLA 1YJAA 4DV4B 3QMVA 1ZXBA 1EK1A 2FZCA 3B89A 3QKUA 4GZMA 1HQYE 1RU3A 1QE0A 3ZLJA 2FX3A 5ESDA 3WBKA 4RLQA 4GGOA 5SY6A 1QAQA 2EOAA 2FE1A 1A8UA 1TC2A 2EEZA 3BJRA 4TSKA 3DMPA 1MNQA 2FVXA 3IDFA 4MW6A 1VTKA 4BDTA 5HQ3A 2WMYA 4LRSB 2AUNA 1TVKA 4NEQA 3PQ4A 2FEWB 4E31A 3E35A 3RF6A 2ZBEA 2WZDA 1K75A 2RHTA 3QELB 1W5FA 1U2DA 2BTOA 2GFIA 3E2IA 4M6WA 3VPAA 2H1SA 4QBHA 4D9HA 4BTEA 2HBQA 1NP7A 1PJBA 1BFDA 3QTBA 3K9HA 2WZQA 2Y0BA 3AB8A 4Y7DA 3MTAA 2KJQA 4WOJA 4C21A 1P61B 2GM3A 1ZRSA 2JNWA 4I66A 2PRKA 1YQ9A 4YP9A 2HSJA 2QT9A 3AJ9A 2D62A 1EUQA 5EHZA 4MUEA 3DE7X 1TUEA 3ZGVA 1H5NA 2BMJA 3HBNA 1QHHA 4FLEA 3KR0A 3OCWA 4NYJQ 2ZRDA 2FJPA 3KVYA 4NYMQ 4AJ2A 5BSWA 1DWUA 1NBIA 2VP6A 5JJLA 5DULA 5JWHA 4MHSA 4BTLA 1CVLA 3ZHSA 2XYHA 4PZAA 1DC5A 2ZAMA 1R0RE 3F7OA 1PEDA 4AUKA 4J2TA 5C8ZA 1JALA 1M7BA 3W4JA 2FSHA 4BFYA 2PBFA 2NNWB 4UAJA 1D3AA 1V4NA 4S05A 4RIEA 5BVHA 1EFRD 3DW1X 4HX9A 5FWNA 3EG5A 4QYMA 2A9OA 4MWDA 2GJ9A 3PDIA 4WK0B 4TPKA 5KOYA 3O8RA 1SD5A 3R7SA 4HNQA 4CV3A 1CDDA 1N78A 1GYRA 3DZKA 1F5NA 5I51A 2BL4A 1UKCA 1VKOA 1YFZA 2OSBA 3EVBA 5ES3A 3KYJB 5B1HA 3AP2A 5KEIA 2WZBA 3FKJA 3KXDA 1U94A 2GBFA 1MGPA 1GQSA 1RT9A 2GWRA 3GEHA 3QWIA 4WASA 4DJFC 3IB3A 1PK9A 1LJUA 1PZFA 2REBA 3AEUA 3PF9A 3RSQA 3HBAA 1FYEA 3KHSA 5FFMA 4BQQA 1RZVA 4GSYA 2HK9A 4JLUA 5ICMA 1DJLA 2F9LA 1FMTA 1YRBA 1L9KA 3HQ4O 3JWIA 3P1JA 1ECGA 5DIZA 3CNBA 4OAOA 4UUAA 4CM5A 3FNEA 4UEOA 1ND5A 3AKEA 3H04A 3OZ7A 3PGXA 6CHYA 2PR7A 4FOPA 3FTCA 1I2AA 1LBIA 1Q11A 5BW8A 1FDWA 5ETJA 1KC1A 3B53X 5JATA 1U98A 2RJNA 1PTJA 4M7PA 2GD0A 2Q1YA 5ICCA 2OMEA 1Y1TA 4BNUA 3GT3A 3OX3A 2BHSA 2VKTA 3IILA 3N07A 4INZA 1GL7A 1YQWA 2QD4A 1DP4A 3U4AA 1O77A 3R7LA 3S1AA 4Q7JB 4EABA 2IUEA 3NC0C 5EN4A 2X5JO 4OHFA 3FZEA 3IKJA 5I8WA 4LMPA 3QOWA 3H1AA 3DR5A 2V98A 3E22B 5KYNA 2QRGA 3DKVA 4OAQA 2UVPA 3I5MA 5EUBA 2JBHA 2N47A 3DFKA 5F78A 2VF5X 2GKOA 1HQCA 4GDMA 1CQXA 5DKFA 4LYGA 4TS1A 3S1SA 3L7NA 1VA5A 1US8B 3JQAA 2BKAA 4ITRC 4H9GA 1CQJA 1VYUA 2NM0A 4X6YA 3K53A 3ABOB 4CG2A 5FADA 1SKYB 2Q3CA 3OP1A 4NCXA 3RIMA 3VUFA 4IH1A 2PGJA 1PG0A 1BE1A 5CLGA 4AO8A 1COWD 4N5LA 1JDNA 5IJ9A 5J1SB 3HKBB 2YN4A 2P0EA 4FOTA 3VVCA 4HQKA 1JFTA 1QLJA 2PANA 3FOBA 2V0NA 4MEAA 2J0QA 4JJGA 5JXGA 1EA7A 3DLIA 4P8RA 3VSEA 1AMUA 1YDGA 2ZAIA 3MS2A 4OHVA 4G86A 1Z47A 5CD1A 5HZGA 1JA1A 4PGMA 3QTTA 1C4OA 1SM4A 5CHEA 2X6QA 3CJQA 3AH8A 2C3OA 2VWHA 4Q47A 4L08A 4TN5A 3OEHD 4CLEA 3U4QB 2G80A 1ZGHA 2QD3A 1C0LA 5I01A 2CNOA 1OXUA 3GCZA 5JYEA 2V3WA 2QTCA 2Q8PA 2W6CX 2Y1KA 1JB1A 3IE2A 4F6RA 3D2CA 1SXJE 3NKLA 3U9SA 2DUJA 4DPMA 2IYNA 2UKDA 4C76A 1Y3FE 1SIWA 1KNQA 3RYCB 3OIVA 2QTRA 1DMRA 2HSGA 3O38A 2FEAA 3RQIA 3WZLA 2B8EA 1BHJA 4EELA 3SLRA 1U31A 4GUDA 3GJ8A 3ZU6A 3AHGA 1A4IA 3EFOA 4RV9A 3TDKA 3ONWA 5F21A 4IMJB 1CUHA 1KPGA 2BKLA 4M36A 5B3JC 2O7QA 1J39A 3LECA 2O6LA