3OP4A

Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. n16961 in complex with nadp+
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
247
structure length
247
Chain Sequence
b'SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Oxidoreductase
total genus 81
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2010-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3op4A00
2WYWA 3QW2A 1UH5A 3JQBC 5BSFA 3EW7A 1VRWA 1M67A 4MDHA 3WGTA 2FR8A 5A05A 4DPMA 1CDOA 4JNKA 3KO8A 3DZGA 5F5NA 1EE9A 1DPGA 1KVUA 3AK4A 1EBUA 4BKPA 1U3UA 4R9SA 4AJLA 4DPLA 4BGUA 5A1TA 3SC6A 3BMOA 2EJWA 3DHYA 4LN1A 2DU8A 4UEJA 4TRRA 5ER9A 1OI7A 2DVMA 4JBHA 2D3TA 1JWAB 3QRWA 1ML3A 3GN1A 4XA8A 4G81A 4BS9A 3E6AA 3I9NA 1PEDA 4YAJA 4YAIA 3EZYA 1N8KA 4AJJA 3PYMA 2FMUA 4R16A 2HUNA 1GPDG 2NVUA 3MZ0A 4N18A 4TZTA 4DMLA 4NU5A 2YQ4A 1X7GA 3TSCA 4IINA 2Q4BA 1V3VA 1HZZA 3B1FA 5BSEA 1WPQA 3ZWYA 4QO7A 1U8FO 4WJZA 3ANNA 3WB9A 4OJNA 1NFRA 4NFHA 4DBZA 2DQ4A 3M1AA 2R6JA 4PZEA 4Q3DA 4YRDA 4D43A 2PGLA 4P22A 1X0VA 3NDIA 1T1SA 2W4QA 4BNZA 1B7GO 1A27A 2OGUA 3KSDO 4QSMA 4FGWA 1N2SA 1MC5A 2PGJA 1ZNQO 3CMMA 3DBHA 1GAEO 4LSWA 1A71A 1PGOA 2JJYA 1UZMA 5HTOA 4OAQA 4FC6A 1A7AA 3KRTA 5FEUA 1ZKMA 1SEPA 2E82A 3H9GA 4MVJD 1NQTA 1ENYA 4HV4A 2YFHA 3TPCA 3LT0A 3AI2A 2O3UA 2Q49A 3D3WA 4CR6A 4PLVA 4B7CA 4E5KA 1NWCA 2AA3A 4WCFA 1BTOA 1O94A 1Z73A 1CRWG 3M2PA 3IKTA 1XU9A 1GADO 3GC6A 4L8VA 4MINA 4B7UA 2EV9A 3L07A 3QWIA 3PQDA 4DIFA 1VJTA 1YXMA 1E7RA 1FK8A 3ONFA 4YT5A 3HNPA 4DRYA 2Y05A 3WTCA 2VT2A 3QLJA 1Y7TA 3FN4A 1NWHA 2HO5A 3CZRA 4TROA 4CLRB 1TEHA 3WGIA 3HZZA 3GUCA 3JQ8B 2ZQZA 1NAHA 4ZQEA 4CPDA 3MTJA 4MKXA 5KJEA 1X1TA 3ZWVA 4EITA 3K73O 5JO0A 3AY3A 2UAGA 3ONDA 5JC8A 4L76A 3ASVA 4YA6A 3TOZA 5DOZA 1ULSA 3GDFA 8ADHA 2D2IA 1P44A 2YFQA 4P8RA 3G3EA 3W6UA 3HDYA 4NK5A 1GD1O 3JQFA 5JDIA 5K9ZA 1KY5A 5HRUA 1Y6JA 2Y0CA 3OP4A 1LBEA 2I76A 3RKUA 4JJGA 1V3TA 1YB1A 4PN3A 1IHXA 2Y1CA 2D1YA 3PLNA 3RD5A 1EK5A 2O7SA 4Y6PA 2YUTA 4I08A 3VDRA 1V0JA 5AXAA 4CM4A 1GQ2A 1U1IA 4MO2A 4ND5A 1BXZA 4XB1A 5AXDA 4YRAA 3HFGA 2Z95A 3PQEA 4FJ0A 4YBZA 2CDAA 4DTIA 5JDCA 4NPCA 4AJEA 4LVUA 2C5AA 2P9CA 2OXIA 1A5ZA 1Q0QA 2YJZA 1GZ3A 3WG9A 4DC0A 2I3GA 4GWKA 1LRJA 3SLGA 4CQMA 4ZQFA 3OIGA 4NFSA 5G0UA 5CG1A 1N1EA 4Z9YA 1PZHA 3I52A 4ID9A 1KEPA 5G0SA 2WJPA 4C7JA 1PQWA 4XGKA 1LLUA 1N92A 3M6IA 4M89A 3NX4A 3BHMA 3Q2IA 4U7WA 1F8FA 1YBMA 1U4SA 1NX6A 3CINA 3GA0A 1YOVA 4RPHA 4IMPA 1B3RA 4DLAA 3M1LA 3O8QB 2WWRA 4CL3A 4FW8A 4KMSA 1ISMA 3WLFA 3WOHA 1P1JA 4R5MA 5A9TA 1YH3A 5F5LA 4PLYA 4MVJI 1PTJA 3FSRA 3S2EA 4IXTA 3U09A 4D41A 4MVJH 1I3MA 2EF1A 2Y67A 1D1SA 5HS4A 2NNLD 5DDIP 3MEQA 2PFGA 1DAPA 4B3HA 1GV1A 2PZJA 3CKYA 3I4CA 3QA9A 3ZHBA 4TKMA 3U4HA 2UUOA 3PGJA 2CFCA 3TFOA 3WWYA 4BNGA 1ZK1A 1DO8A 1NXQA 4D46A 5TLSA 1Z6ZA 2FSSA 4U8GA 3OA2A 4R1NA 1UDCA 1W6UA 4L4SA 1HE5A 3FBTA 4E2YA 4IM7A 1NVMB 5CG2A 3E8XA 2PLAA 4XIYA 4AJKA 2VRBA 3BTOA 3JQBA 2E6UX 1H6BA 2HSDA 3ZW9A 1YDWA 1U8XX 2PKQO 3DTYA 1IYZA 1M6HA 4CM1A 3CZMA 1DFHA 5EIOA 2QRJA 1OFGA 2G5CA 5AQ1A 4AJIA 3L6DA 3VZPA 3WMXA 3D3EA 4OYRA 3A14A 4YJFB 3VH3A 3JYOA 1QP8A 4XEHA 3ZV4A 1ZEMA 2JAHA 3ZWMA 1TT5A 2I5PO 1Q7BA 3S2FA 4A10A 3NTQA 4BO6A 4WPGA 3SEFA 1WNTA 4E6PA 1LJ8A 5DT9A 4CMCA 4R4JA 3BMQA 4CM9D 4QEDA 3W8FA 3SXPA 1PJ3A 1YB5A 3JQGA 2ZK7A 4IMRA 4E32A 1EUZA 3L4BC 3IQDB 3PFWO 2OBYA 3AY7A 4LK3A 3VVCA 3VZQA 3U0BA 3I83A 4WECA 1BXGB 2YW9A 3KSUA 4B4OA 1P0CA 1MFZA 3X2FA 5TSDA 4D79A 3VOSA 2XF8A 1GEEA 3OJ0A 4YJGA 3PYXA 3ZNQA 1MGOA 1NVTA 2PZLA 3KYCB 3ROPA 2O50A 5EJ2A 3T7CA 1YWGO 3AWDA 2DUWA 2ZB8A 1GPJA 4D3FA 3HB4X 1DDOA 3R3JA 4B4WA 2ZATA 5B12A 3OH8A 3UH1A 3BMCA 3U3XA 3FI9A 4XD2A 1BGVA 4J43A 5BNTA 4M87A 1LSSA 4TRNA 4BO7A 3AFNA 1LDYA 3RU9A 1KEVA 4Y67A 1GUFA 1DOHA 3WGGA 4CM6A 4LRTB 1HDYA 2GZ2A 4KOAA 4JX8A 1GYPA 1DC4A 4GQAA 4BHTA 1JA9A 2QIOA 3GZ4A 1NHGA 3E18A 1GZ4A 4OXKA 4PG8A 5CPFA 3QWAA 1I3LA 1LA2A 2Q45A 5KJ6A 4GGOA 5DBGA 3WBBA 5DOVA 3RUFA 1N9GB 3C1AA 5EL0A 1O95A 1SB9A 2GN8A 4FFMA 5TJHA 5CDGA 1P1IA 2Y93A 3LQFA 3KYBA 1FMCA 4I9HA 4MVJG 3ZH2A 1R4MA 5H83A 2G82A 1ZO8A 3UUWA 3QSGA 4CLXA 3NDRA 3ADOA 3FBGA 4OSPA 2NUAA 3NUGA 1AXEA 2GD1O 2V6GA 3DEYX 1U3VA 2HU2A 5DF1A 3V2HA 1XKQA 3NJ8A 2V65A 5T5QA 3HADA 2POQX 2X0IA 4XCVA 4A26A 3WYCA 4AICA 3GVIA 4WK6A 1WZIA 2RHCA 3I23A 4W6ZA 3RBVA 1LLCA 4GKVA 4Y98A 2R2GA 4GI2A 2H6EA 2CUKA 1B8UA 4DQXA 1H93A 1NFQA 1KS9A 1P31A 4XYMA 1R0SA 3K8ZA 4BKOA 2AQ8A 3QHAA 4LVCA 4HADA 4NBTA 5JC1A 2C59A 2AMFA 2EW8A 3VH2A 4S3MA 5IF3A 3D4OA 4EEXA 1BDBA 2HAEA 2YHUA 5H82A 4R3WA 1VSVA 4QX6A 5KVVA 1HE4A 3DAPA 3GG9A 5TQVA 1DIRA 1WVGA 3IJRA 3LK7A 3PJGA 4JXKA 4KUHA 3C1OA 1X0XA 4M86A 1D7OA 3WMWA 4TWRA 3U4DA 5GZ3A 4BMSA 1K2WA 3GG2A 1HF3A 2YZ7A 1ENZA 5T64A 1Y8RB 1B26A 1YE3A 4LGVA 3RUHA 3U4CA 2IYPA 2JL1A 2P9GA 1ONNA 4E5NA 4WLOA 3OJEA 3RUEA 1ZEJA 1SCUA 2P9EA 2PWZA 4IJWA 3RI3A 1HDGO 1YONA 4Q3EA 3ROQA 5JCJD 4DIOA 1SNYA 1CJCA 1I2CA 5CDSA 1B0AA 1RYDA 2Y1EA 1PGJA 1MG0A 3BXXA 3D5TA 3IUPA 3OECA 3GMSA 3UCFA 1IL0A 3JD2A 1PIWA 4ND4A 1P74A 4DUPA 4WNIA 1C3VA 1E6WA 4MVJF 3JYQA 2YHIB 1OZAA 3MJTA 3PPIA 3U5TA 4CR7A 4YEDA 4CM8B 3GZNA 4GGPA 2QZ9A 4U6SA 4KQWA 3EAGA 1XHLA 4D45A 1GQYA 4JJFA 2G1UA 4XYBA 2J8ZA 3EMKA 1V8BA 3ZHYA 1HYGA 2O3SA 3F6YA 3AUAA 2VWHA 1LI4A 2IZ0A 1PS0A 5A9RA 4OKNA 2X0NA 4RVFA 4J90A 4A5OA 2EKPA 5CDYA 4MVJA 4Q3NA 3KVOA 1PQPA 4ESOA 1QKIA 4HFNA 1BVUA 2ET6A 1LDBA 2BI7A 5IZCA 3F4LA 1SC6A 2AE1A 2VRCD 2W2KB 3JD0A 5CEJA 2WM3A 3R1IA 1LX6A 3UFXA 3DZJA 3Q0EA 5A3VA 4NMHA 3LF2A 1LSJA 1MC4A 4YCAA 3PZBA 2PKQP 4OH1A 3OIFA 4ZD6A 1E5LA 2JCXA 4CMHA 1PZFA 1D1TA 4B4UA 3UOGA 2C7VA 2TMDA 3BHJA 4EI2A 3A9WA 3RKRA 3DZIA 1M2WA 1PR9A 4YJDA 4RCVA 1L7EA 2DBQA 1JW9B 4BQRA 3WGYA 3OJLA 3AW9A 2BRUA 2VZ0A 4YT2A 4YQYA 1C1XA 4Z9FA 3C1TA 3JQ7A 4JBIA 5KJ1A 4RLHA 3DZHA 2YV3A 1SOWA 2Z1MA 3E9NA 3PHGA 3N7UA 5A5EA 5I8ZA 1F12A 2XXBA 5L95A 1G6KA 1ZMTA 4DYDA 5ILOA 3L4BA 5I9MA 2OL4A 4U6QA 5CDUA 1LC0A 1UXIA 1A4IA 1YQDA 2C2XA 5G4KA 5FWNA 5BQFA 3VPGA 2QRKA 4A0SA 1R16A 3PIIA 4IDFA 1I8TA 1LSOA 4RJTA 4F46A 3COSA 4ZGWA 3A28A 3DOCA 4H16A 3WNVA 4BB6A 3R6DA 1OC4A 4RF3A 1WLYA 1U7HA 2BFMA 4BV8A 3NT5A 5AXBA 1UXKA 1XQ1A 3CH6A 5KIAA 2FSVA 5JDIC 2IRWA 2HMUA 2ZTMA 4BO2A 1XR3A 1HETA 5L53A 5T67A 4F6CA 3ADPA 4WNCA 4RPKA 3WBFA 2HJSA 2PD4A 3D1LA 1RWBA 1H6AA 1U9JA 2OUIA 5T57A 4YTEA 3TQHA 1M66A 2Y1GA 3DZFA 3WDSA 5CEEA 1YS4A 4HKTA 3KETA 1ISIA 4Q39A 1EEHA 1GL3A 1EZ4A 4NNJA 1DJQA 3DTTA 1YO6A 5EPOA 2NM0A 1NM5A 3RUIA 4R41A 1ENOA 1Z7BA 2HK7A 4BUCA 4DA9A 3I6IA 1PS9A 2HKIA 1N1GA 2EGHA 4J4TA 4D7AA 3DB2A 3VZRA 3Q3CA 3VTFA 1H2HA 2HQ1A 3L9XA 4BO1A 3H3JA 2C0CA 5L9AA 1B2LA 2WD7A 3F47A 4UEOA 3PHJA 2BELA 3FCOA 2PZKA 4W82A 3VPSA 3WSVA 1MFPA 2H5LA 2VCYA 3GEMA 4CMBA 3S1LA 4UUOA 3ABIA 4FJ2A 4RO0A 4ALNA 1RM0A 2V6BA 1PJ4A 4J7XA 4BNTA 3WWZA 3WFIA 2ZB3A 4BO9A 3RWBA 1XU7A 3OJOA 3PGXA 4WEQA 4MJLA 1IULA 3V2GA 5L4NA 3NRCA 2W90A 4BNIA 3DBRB 1Y1PA 4M55A 4CUZA 4IPTA 1VJ0A 4NH4A 1QMGA 2QZZA 4BNYA 1R12A 5AOVA 1HT0A 1K5HA 1LDNA 1NR1A 3F46A 3RCBA 1HDOA 1R4NB 2JD1A 3WYEA 2X9VA 3VDQA 2OP0A 3KLMX 1LEHA 4ALMA 5L3ZA 1QXSA 1R6DA 2JD2A 1IPFA 3AM5A 3Q1LA 5L4LA 2B5WA 2EJVA 1BSVA 3L6EA 1OAAA 3JQAA 1B8VA 1XSEA 1WWKA 1TI7A 1KEWA 4ND3A 2IODA 5GZ1A 4AJ2A 4NIMA 2BFAA 3WX0A 4OSOA 4XKJA 5ITWA 3GR6A 4CM9A 2BGMA 1RJWA 1ONOA 5LDHA 2PV7A 3IOYA 2HK8A 4J1QA 1E1LA 2Y68A 1Q7GA 3MWDB 4IQGA 4KUGA 1F06A 3HE3A 3F5QA 1PGPA 5B4VA 2C2YA 2PNFA 1U5AA 5DBFA 5GY7A 4RGBA 3G1TA 3GLQA 2YQ5A 3G17A 5EQFA 4FQ8A 5TS3A 3STHA 4Q3CA 4L74A 1T26A 4RLSA 1I33A 2I9PA 3UCEA 5F21A 2B37A 5L51A 2OORA 3A1NA 1LLDA 1HYHA 4YT8A 3H2ZA 4CLDA 4CQLA 4WKGA 3TZQA 1I36A 2FPGA 3G49A 4FDAA 4U5QA 1G0OA 2BFOA 3IP3A 3OHSX 1SZJG 4MKRA 2PA3A 2A92A 3ULKA 4PLTA 4PVDA 2EGGA 1IB6A 1Y9EA 3L4SO 3T4EA 4TKLA 5GMOA 1VL8A 4LW8A 4OIMA 2AW5A 4OXYA 5JYEA 3RC7A 4CMAA 4CM5A 1O6ZA 3K92A 5DBIA 1ZK2A 3DZKA 3WQSB 4RVGA 1HSZA 1QRRA 2AEMA 3WGOA 3NV9A 2ZJ0A 5CPBA 1UZNA 4Y6RA 4ND1A 4B7XA 1JTVA 4ZJUA 1GQQA 2BF7A 1I2BA 2PY6A 4FBGA 4LCEA 1B3BA 3DMYA 2GN6A 4UULA 2X6TA 4DLBA 3DAFA 3GVPA 4L4RA 4DYVA 4L4XA 1RPNA 3UKOA 5IDXA 2Q2QA 4E21A 5IXYA 3GY0A 4CLOB 3RIHA 3SJUA 1JKJA 4R69A 3ETDA 1KVSA 2FOIA 1JLLA 1HWYA 4A2CA 2GZ1A 2W98A 2YV1A 3OQ6A 1SB8A 3H5NA 3I9JA 4NJMB 5H81A 4H7PA 4AJ1A 2H1SA 1CIVA 3IKVA 4KTTE 2J5RA 4E31A 5I7EA 3U49A 4KZPA 4MIYA 1UDBA 4K28A 4FGSA 5EESA 1PL7A 4UAGA 4GVXA 1TA4A 2WD8A 2RCYA 3HG7A 4E2XA 4ZQBA 2FZWA 2F00A 5JS6A 1ARZA 3C3XA 3GAZA 4RVUA 1D8AA 3FR8A 4TVOA 1LQUA 2RAFA 2GGSA 2O7QA 3LT2A 3GEDA 5A02A 2VYVD 4IJUA 3S8MA 2FPIA 3T7EA 2NTNA 2C5EA 4HWKA 4UUPA 1BRMA 3D7LA 3R3SA 4I5EA 4RVSA 3MOIA 4L75A 2CZCA 4E2ZA 7ADHA 1E3SA 3WGQA 3GPDG 3ANMA 4Q3BA 3H6KA 3UAGA 2Q4EA 4BB5A 3AU9A 5ER6A 3WFJA 3DOOA 4ND2A 2H63A 4PLZA 3GOHA 4GMFA 4H3VA 5U9CA 1B15A 2Q2WA 3DFZA 4PRLA 3MTGA 3PHIA 5MDHA 4E12A 2I66A 5GZ6A 1I5RA 3V8BA 4BO3A 1CEQA 1WDKA 2DBVO 4JP2A 2EXXA 4DIBA 3QWHA 1LTHR 1M6WA 2UYYA 2V6MA 4PVCA 5A4DA 1M76A 1AN9A 3NAQA 1LDGA 1NQAO 3GNSA 3F1KA 5AXCA 4J3FA 4ZRNA 3P2OA 5JCJA 1KERA 1VKOA 2X5KO 2J3JA 2XPCA 3IC5A 4BOYA 3GGOA 1O89A 3IAHA 4KTVE 5BNIA 2UUPA 2CF6A 2NU9A 1DAOA 4BNJA 1C14A 4XYLA 1GU7A 3AUTA 3E03A 3JYNA 3FRJA 4ZQHA 3LC7O 1HEUA 4IY1A 2Y66A 1Z82A 2VUTA 4XGNA 4CLEA 3A06A 2IZZA 3OETA 2NTJA 4J91A 1I01A 3G0OA 4RZIA 1BXGA 1G0NA 1HE2A 4IGFA 4CV1A 1PZGA 4YYZA 4RORA 1R0KA 2IYOA 3RJ9A 2GASA 4Z0TA 5ICSA 3E5RA 3W4JA 5I7FA 1ZSNA 3LLVA 3DBHB 3K2EA 3G1UA 3SC4A 4ALJA 3VZSA 1KEUA 2HJRA 5KOIA 2PKRA 3H4VA 1DFIA 3AI3A 2O48X 5U1PA 1GTMA 3QE3A 3AOEA 3ZZNA 3X2EA 1WXDA 1CF2O 3C7AA 3I3OA 2OBNA 4DBVO 4DWVA 5JW6A 4BNVA 1SEVA 2NU7A 5IAAA 2D59A 1O8CA 2WE7A 4FN4A 1WZEA 1I2ZA 1GUYA 3HDJA 4WCFB 2EKQA 3NTOA 4EUFA 1QR6A 1NTOA 2O3TA 5G0TA 2YV2A 2ZYAA 1M75A 3D5QA 3PHLA 5AVOA 3VTZA 3QJ5A 4I1IA 4BNFA 3WR5A 1V9LA 1H2BA 4FJ1A 2CVOA 4DMMA 3EVNA 1YBAA 3TZKA 1T2CA 5IZCC 2HMTA 4HXYA 5C7IO 3F9IA 4R1UA 3TWOA 4BO5A 4WLNA 4GAEA 3LC2O 2FPPA 3F5SA 4WLEA 2HLPA 2IDZA 5I9NA 4RQUA 4HFRA 2Q46A 1N9GA 4DXHA 3ZV6A 2NV6A 4EDFA 3PDJA 2GYYA 1L1FA 6ADHA 1EVJA 2B4QA 3GT0A 2EKLA 3RFVA 5T6BA 1YL7A 1YGYA 4P4LA 1KIFA 2O3QA 1BVRA 1EDOA 2GF2A 2QQ5A 4Z0HO 4Y9DA 5HA5A 4HBGA 5IZ4A 1JKFA 3TJRA 1HXHA 1DB3A 4K26A 5IXSA 1ZSYA 1E1MA 3PHHA 2ZIZA 4OKIA 4A73A 1C0KA 1PJCA 3C8MA 3NTRA 4FFRA 1E77A 1LNQA 2D5AA 3KTDA 2C54A 3ZWOA 2BD0A 2Y99A 3OQ1A 4R3NA 1SOVA 4WCDA 1UR5A 3ZGYA 1BW9A 2E4AA 2FRDA 1IOLA 1CQJA 3DAGA 2TMGA 2FN7A 3QWFA 4PLFA 2FWMX 3DO5A 1NPDA 2HK9A 1EBFA 2VZ9A 3EY4A 3I9MA 5LCXA 4YT4A 1C0IA 1XELA 3EVTA 3KOUA 2WE8A 3S2GA 2YYYA 2AEJA 1Q0HA 1N7GA 3OIDA 3W1VA 4EUHA 3CUKA 4FOSA 2C20A 1A72A 1PJQA 3GFBA 3I9LA 1EK6A 2FR1A 1F17A 3V2UA 3BYZA 2OFPA 2ZJ1A 4JP3A 4U0JA 1ZK4A 2O3JA 4PG4A 2NVBA 5FYDA 4O5OA 2X58A 4OO3A 1Y8RA 1IUKA 4FS3A 3HHPA 2DPHA 4M8SA 3F1LA 4W4TA 3RROA 3N58A 1P77A 4J1TA 3AUSA 1PJBA 2YY7A 1FDTA 3W8DA 1U3WA 3TFQA 3HSKA 4DL9A 2IE0A 1LSUA 1YOVB 2X9GA 2NQ8A 3GVXA 3QVSA 1ISJA 2DBRA 3PRJA 1EUDA 2JCYA 2Z1NA 3L9WA 1PJTA 2Q1UA 5L45A 1QV7A 1P33A 3ZWWA 1T1RA 3EUWA 4Q3AA 4YAKA 1EFKA 4XQEA 3ENNA 2RIRA 2BGKA 4PCVA 1C0LA 3FWZA 1EVZA 4EGFA 1U5CA 3RUDA 2X4GA 3PEFA 1I3KA 1Z45A 2YHIA 3FD8A 1E7YA 2Q1WA 1ZH8A 4FC7A 4CM8A 1HDXA 3PFFA 2P4HX 3LT1A 1YJ8A 3VKVA 1DRWA 4BGEA 1IE3A 1AGNA 4GX2A 3MJSA 4PZDA 4B4VA 1T4DA 1ADFA 2BKAA 8LDHA 3D64A 2XXJA 1DHTA 2GZ3A 3OA0A 1BDMA 2IZ1A 1PJSA 4XDYA 3ZU4A 4FIZA 5DP2A 1U2DA 3SJ7A 1T2FA 5IDYA 1MX3A 3HJAA 5LC1A 5COQA 3DONA 5HBRA 3RJ5A 4B3IA 2A9FA 2NACA 1N7HA 1ZK3A 3EGOA 3KUXA 1A7KA 3JQ9C 4UVGA 1MXHA 3LZ6A 4IDCA 3RBZA 2E37A 2P5UA 3OM9A 1VC2A 3TRIA 4BKQA 4J7UA 4KWHA 3NYWA 1PZEA 3I1JA 1Y8QA 4XGIA 2VWQA 3BMQB 4WLFA 4A27A 1ISGA 1HDRA 1HRDA 1NPTO 4GMGA 3ENKA 3GQVA 3RC9A 2CY0A 4CMIA 3TZ6A 2I99A 4RZHA 4BVAA 3WQQA 2GN4A 2D5CA 1JWBB 3P7MA 3OEWA 3ZDFA 3KZVA 4GL4A 1UUFA 1E3IA 1O0SA 4A03A 5TT0A 3PP8A 2P2SA 1H94A 4XR9A 4TMFA 4AJ4A 5F1KA 3RUCA 2BH9A 4E5PA 4YACA 2NU6A 1ISHA 3B1KA 1LRLA 4XQCA 4YJGB 3L0DA 5DZSA 3P2YA 1PWZA 4HNGA 1D3AA 3N74A 3T4XA 4LMPA 1X13A 1KBZA 5FF9A 3ZV3A 3KV3O 2RBEA 2UV8A 4UVIA 3BMNA 4Z6KA 1Y5MA 3UN1A 3BMCB 5JY6A 5DNAA 3DDNA 1DXYA 3QVOA 3AUUA 4UREA 3TN7A 4IZIA 3H5AA 3Q6IA 2GDZA 3FR7A 3GFGA 1N5DA 1VPDA 1R15A 2IXBA 4IDDA 3I9KA 3UXYA 4WOKA 1ISFA 2FHSA 2V6FA 4FCCA 4I5GA 5KKCA 3HDQA 2NU8A 4JLWA 2O4UX 2CMDA 1BWSA 2Z5LA 1TLTA 5A04A 1H0KA 2DLDA 5EMHA 3HB5X 4W9NA 3RFXA 2ZKLA 3RBXA 1QYXA 1BHSA 4K1LA 4XQGA 3V1TC 3EHEA 3LYLA 2C7GA 4WE3A 3WIDA 4YRBA 1F14A 3K31A 4BNMA 3GVHA 3DBLA 2CSUA 1MUUA 4OL9A 3V1YA 4BGVA 3JD3A 3EK2A 1R4MB 4Q9NA 1HZJA 4ZA2A 1ZXBA 1V3UA 5TT1A 4XB2A 3ROMA 1GR0A 5JMWA 4ONEA 1ADCA 4E13A 3I6QA 2NVWA 2X22A 2O2YA 1XLTA 1P9LA 2J3HA 4DLLA 1YQGA 4IDAA 4AJOA 1V6AA 1K6XA 1CETA 3D0OA 1PU2A 3RQSA 3SBOA 4DGSA 5U4QA 3H2SA 4XX0A 3FPCA 3ZW8A 3WYBA 4JQCA 3DMTA 4AJHA 3AU8A 1DEHA 1Z74A 2WMDA 4P4GA 3ZCXA 1UXHA 1BXKA 1MLDA 3KYDB 2LDBA 2V7PA 5CFZA 4B8WA 2NWQA 3QP9A 4RQTA 2P68A 3CXRA 2VYVA 1GUZA 1EMDA 5JCXA 4RDHA 3FNFA 3MJ4A 3JV7A 2BGLA 4R1SA 2VNAA 3VVBA 5G0WA 3W6ZA 3K6JA 4ZVVA 4TRMA 4TVBA 5BNFA 1LU9A 5B37A 4UVDA 3PVZA 2WEKA 1GDHA 3JSAA 1OC2A 1ONPA 1QYDA 1I32A 3ETGA 3HDHA 3OSUA 3AJRA 5L40A 1R4NA 2BHLA 3CPSA 3GGPA 1XQ6A 5KJCA 4MKZA 2VTEA 3ASUA 2C29D 4M54A 3HN2A 3UF0A 4ZRMA 1Q7CA 2CDCA 3NJ4A 5A03A 5A9SB 1BG6A 4O6VA 2AQKA 4PIVA 5A3JA 1J4AA 1YVEI 2GR9A 3INGA 5TNXA 3UHAA 4M49A 4M1QA 1X7HA 3DOJA 5ILGA 4CR8A 2VUUA 5KKAA 1HE3A 4CMEC 4QTZA 4KP7A 4J4BA 1TB4A 1NYTA 4NQZA 5I7SA 2CVZA 3UCXA 4O63O 2R00C 4YXFA 2P91A 1FJHA 4R54A 3HFSA 1Z7EA 3BTUA 1I30A 4J4HA 4XYGA 4MPDA 3H3FA 4RPGA 2E49A 2X9NA 1K3TA 4G5HA 1X15A 1DBVO 1FXSA 4K6FA 2AQHA 1C1DB 3PZRA 3GZNB 2CF5A 1PS8A 2NLOA 3ZHZA 1G1AA 1PQUA 2DM6A 4B79A 3LSYA 2B0JA 1DIAA 4CUJA 3D4NA 5J23A 4JIGA 5KVSA 4L73A 2O4CA 4BNXA 2HCTA 3WS7A 5CDTA 5EN4A 1XIVA 1LRKA 2A94A 3E5MA 3Q11A 3DHEA 1QYWA 2AQIA 2FZEA 2VN8A 1QYCA 1J49A 4FFNA 2ZYDA 3OQBA 1MP0A 1K6IA 3H9QA 4DVJA 1EVYA 1J5PA 4UVEA 2ZTLA 3AOEC 4CJXA 1VLLA 2AG5A 4PGFA 1ID1A 1P1FA 1FF9A 1YKFA 1YRLA 1YL5A 4BO8A 3JQ9A 4PG6A 3ONEA 1GZ6A 4J16A 3SLKA 1I3NA 3GGGA 3QVWA 2AE2A 2JHGA 3WICA 4N5NA 4GSKA 4RVDA 3O26A 2O3RA 1MG5A 4F3YA 2J3IA 4BL5A 3NT4A 1ORRA 4MP3A 5TJ9A 4E33A 3B20A 4E30A 3IMFA 1B16A 4OQZA 1C1XB 3KM0A 1KOLA 1H6CA 1PL6A 3JQ7B 1E7SA 4FFOA 3FF4A 5TF4A 4NJMA 5IDQA 4MVJP 4IGEA 4RV9A 1LC3A 5CEFA 1A9YA 3BHIA 4JK3A 4MP6A 4YJHB 5IDWA 3JQ6A 5DCUA 1DC3A 3AOGA 4XIJA 5ADHA 5G4KB 1NNUA 1FDSA 2BLLA 4AJNA 4R01A 3KBOA 1W73A 3NEPX 3K30A 4FR5A 3CEAA 3C7CB 3E9QA 4CLRA 2ZYGA 4YAEA 1OBFO 3JQ8A 1LLQA 3PLRA 4NJOA 5DP1A 3ZWPA 3H5RA 4MVJM 4XDZA 2GN9A 4HP8A 1NPYA 4XJSA 2WSBA 3ZU2A 1IZ0A 3WSWA 2VHYA 4WUVA 4BGIA 2W2LD 1GY8A 2RHRA 4S1VA 1P3DA 3ZWCA 1PX0A 2PR2A 2ZB7A 1KYQA 1VL0A 2WYVA 3BIOA 1FDUA 2B5VA 2DAPA 3GK3A 4J1NA 1CQIA 3H8VA 4QT0A 4YAGA 3H9UA 1T2EA 3ZU3A 3KXDA 5JY1A 4EYEA 4PLGA 3VAZA 1Q1NA 1KVQA 4LRSB 3HUDA 1F0YA 3E9MA 4YDRA 1RM3A 4E2WA 1Q0LA 4LCJA 4Z3DA 3EDMA 1WDMA 2QW8A 2B36A 3FTPA 1WAMA 4Z3KA 1JVBA 1GV0A 3A4VA 3Q9UA 1ZK0A 3UGKA 2AXQA 3VPHA 1DLJA 4NBWA 1S7CA 4GVLA 4MVJE 4NBUA 2WD7B 4CMKA 1W0CA 1VKNA 4XQ9A 1B14A 3FWNA 3JQEA 4MIOA 4J2HA 1SMKA 1L7DA 2I6TA 2DC1A 3K96A 3PK0A 4TRJA 5G0VA 1YQXA 2SCUA 5CAEA 4CV3A 2O2SA 5IN4A 3ITKA 2ZTUA 5DULA 4RDIA 1KC1A 3LVFO 2HDHA 4AVYA 4N5MA 3RU7A 1IZ9A 3TOXA 2XAAA 1F8GA 1WW8A 3O8QA 3GNTA 3QY9A 3W4IA 1ADBA 2VNSA 2X7HA 4GX1A 4NDNE 4Z0PA 4JJIA 1H6DA 4J7CA 3VH1A 1QYVA 3DR3A 2PK3A 4QFDA 4KWIA 1E3WB 3ON5A 1E1KA 4J0FA 3WGZA 4ALLA 2JFGA 4KUEA 2YDYA 1E1NA 1GYQA 2AG8A 4DPKA 3C24A 3RC2A 3ORFA 2VWPA 1GFSA 2X1HA 1PJ2A 3NGLA 4J6FA 4CV2A 5BT9A 1DIGA 5I9LA 1PSDA 4FOOA 1E92A 4FFLA 3GUYA 3JQAB 1PR3A 4IZHA 4Y6SA 2Q3EA 5G2OA 1HDZA 4IDGA 3VHRA 3GH3A 5L7YA 4D0RA 5CHEA 4F45A 1DHRA 3WNQA 9LDTA 4IJKA 4D42A 1ZJYA 4PZCA 1U7TA 1CERA 1JDJA 3O03A 3GHYA 4L0QA 3AY6A 3DHNA 3BMOB 3FPLA 3PJFA 4J9VA 3SX2A 5B4TA 4W7IA 5F1OA 4CMEA 5MGBA 4ITUA 4CODB 3I9OA 1ZSVA 2R00A 3ICCA 1X1EA 2A35A 4BNLA 1WP4A 5TC4A 1JVSA 1RYEA 2NVUB 1RM5A 3U62A 4YJFA 4R5HA 4BV9A 4GLOA 5L7TA 2G17A 4R1TA 5C37A 4RPLA 5JAZA 4XJTA 3OEYA 4CQLB 4QO8A 2OP1A 4K9DA 2ZB4A 5JSFA 2PH5A 4I5DA 5K0ZA 1T25A 3K2BA 4FD3A 5K6AC 1HLPA 5THQA 4IDEA 1QLHA 5JNLA 4XR4A 2H9IA 4XRRA 4AL4A 3WJAA 2JKVA 1FDVA 2GERA 1OOEA 5A06A 4GLLA 1SO8A 1P1KA 4PG5A 2VHXA 4OOEA 3WGHA 5C7OO 2EHDA 1E0DA 5COBA 3HQ4O 3I4FA 5G4LA 2VTDA 2P4QA 3JQDA 3KYCA 1NBOA 1T24A 1O9BA 3FHLA 1ZZEA 3MJVA 3G79A 3LU1A 1XG5A 4EZBA 3VPFA 5C3MA 3P19A 2CDBA 4URFA 4EJ6A 4TSKA 1J6UA 5IG2A 1PJLA 1HL3A 4O1MA 3D3WB 2XOXA 2ZCUA 3DFUA 3ST7A 3ZWAA 2C07A 5JAQA 4BO0A 1P45A 2VRCA 4PLPA 4AFNA 1NFFA 2W8ZA 2X5JO 4II3A 4W9NC 2DTXA 1E7WA 1LDMA 2DUUA 2QYSA 2VHZA 1LQTA 2Y0EA 1AUPA 1VE9A 1XEAA 2CVQA 2E48A 2PD3A 1GCOA 4DC1A 5COAA 4DQVA 3H9JA 5F3RA 5EINA 3RAJA 3KLPX 1PWXA 4BNUA 1GYRA 1TVEA 2EERA 1HLDA 2NTVA 4CV0A 2RH8A 3Q9NA 1SPXA 2GCGA 4X54A 4B3JA 4D3SA 3AFMA 3W4KA 2UDPA 2QYTA 4HFJA 4ILKA 4EJ0A 2Y0DA 4IS2A 4J2OA 3LT4A 3F4BA 2GO1A 1EQ2A 2CD9A 3BTVA 4LSMA 3KHUA 3DMTC 3TZCA 3WIEA 3QIVA 1BMDA 2X0RA 1R0LA 3AM4A 3WQRA 3MJCA 3SVTA 4ZQGA 1ZVMA 4EEZA 1TXGA 3B1JA 2VOEA 2VYND 3CIFA 3ITDA 4QQRA 5C7LO 4GX5A 1KY4A 2EP7A 3BAZA 2OMEA 4GKBA 2P5YA 4A7PA 2PGDA 3BA1A 4CM4B 3PQFA 2QHXA 3JQAD 1H9AA 4KDFA 4R68A 2VQ3A 3ZI0A 2FP4A 1NQ5A 1YL6A 1IY8A 1MB4A 2ZCVA 2EP5A 3PJDA 3DBVO 2DFVA 2Q1SA 4NZ9A 4ZN6A 2VZ8A 1DFGA 5JYDA 2NSDA 4CQMB 4GSLA 1UP6A 4UUNA 4IJVA 3R0IA 4N7RA 4P4NA 2GSDA 2Y1OA 5EERA 2JD0A 1JAXA 3GEGA 4MOWA 1EE2A 1LUAA 3GVCA 4UUMA 3GHHA 1J0XO 4E5YA 1E3EA 4XWYA 5KCZA 1U4OA 5ENDA 4JROA 4KQXA 3D4PA 4ROSA 3E82A 4IBOA 3MJEA 4NHEA 3V5NA 3GRKA 5JAMA 2DKNA 3EZLA 3FNGA 3GRPA 3RASA 2GLXA 1HSOA 4RPJA 1Y5RA 5DN9A 1T2AA 4BMVA 2UVDA 2EIHA 1JN0A 3L6OO 4E3ZA 4EW6A 1EVIA 4CM3A 5KVCA 1AHHA 3NT2A 3ZNOA 5KWEA 1SAYA 2QX7A 1WDLA 3E1KA 4IIUA 3QVXA 3U4IA 3EYWA 1LXCA 4FFPA 5I7VA 2VT3A 3ETEA 2VUSA 4UEKA 4PLCA 1FDWA 2JAPA 3ZNPA 1AHIA 2D8AA 5FI3A 4OQYA 4OMUA 3GAFA 3GMDA 4TQGA 4IXWA 3K9QO 4WOJA 4PG7A 1GEGA 1D4FA 3INTA 1B8PA 2B83A 5ITVA 1R37A 1DRUA 3Q2KA 4IDBA 2DT5A 1HTBA 2VOJA 3H9EO 1CYDA 3RSHA 3AI1A 1UXGA 5T8KC 2PZMA 4BNWA 5L7WA 2J5QA 3O9ZA 2PD6A 4D0SA 2DTEA 2AHRA 4BO4A 4GPD1 1DC6A 1QLJA 1KVTA 2EEZA 3HN7A 3ICPA 4RF2A 2JFFA 5DCYA 1IHYA 4BNHA 3MOGA 1UP7A 2W2KA 3MCVA 1XYGA 2B4RO 4L9RA 3DL2A 4INAA 3IDSA 1DJNA 3PDUA 3W8EA 5ENVA 4OOFA 4JBGA 4QUKA 3B6ZA 4HY3A 2Q2VA 1ZMOA 3NDJA 2BMAA 4D44A 2DFDA 4Y8VA 2EW2A 1JAYA 3UVEA 3E48A 4WASA 1QSGA 1TT5B 4JCOA 1UAGA 4XZ3A 4YQZA 3VPXA 2B69A 2OZPA 4CLHA 3ZN2A 1DIHA 3OF2A 2FY8A 4CMJA 3JTMA 3OICA 3L77A 3ZU5A 5KJFA 4EUEA 1X7DA 1MXFA 2G0TA 1KETA 2X23A 9LDBA 1ZFNA 3ANLA 2GNAA 3IS3A 3KYDA 3JQGB 4BNNA 1ZBQA 3EC7A 2OOSA 1HKUA 3JCZA 1H5QA 1RKXA 3VH4A 1BW9B 1H9BA 1PL8A 4DQUA 3WXBA 1X14A 1UZLA 1U3TA 4C4OA 2BI8A 4HNHA 3LDHA 4NFYA 5K6AA 2QRLA 2W2LA 3TL3A 4E0BA 5JLAA 4G65A 2YDXA 3CE6A 3CSDA 4ZICA 1NAIA 1DSSG 4G2NA 4RVHA 3DXFA 4W99A 1NP3A 3RVDA 2QG4A 1Q2XA 3QVTA 3I5MA 2X0JA 4QECA 1O5IA 4O59O 3GNQA 4IQ0A 4QFCA 3WJ7A 4EJMA 2OHXA 3OBBA 1VSUA 5A9SA 1ZCJA 3CTMA 5B1YA 2CNBA 1E7QA 2O23A 4RL6A 4XYEA 4JN6B 5JAIA 5KTKA 1HDCA 5CP8A 1EUCA 3ZWXA 1PGNA 2PTGA 1E5QA 2HMSA 2D0IA 5FI5A 3TL2A 3FTNA 1AE1A 5I8WA 1UAYA 5BR7A 2X8LA 1Y81A 1ZIDA 3LC1O 4GWGA 1XCBA 4CL8A 2J5KA 3QV1A 2WYUA 4CQMD 5B4UA 5BSHA 1RM4A 3QQPA 4R51A 4NR0A 1MV8A 1UXJA 4EBFA 1ENPA 4F6LA 4BNKA 2BFPA 2VWGA 1W4ZA 4GH5A 1SBYA 4AG3A 1PGQA 1E3JA 1W8DA 4IUYA 3JD4A 3TNLA 5JFOA 2I3AA 3PWKA 1C1DA 4RF5A 5A5FA 3VC7A 5HS6A 3GN2A 2F1KA 3DQPA 4PRKA 1WMAA 4IIVA 4QXMA 1U28A 4JGBA 4E4YA 1K6JA 4PLWA 2X86A 2Q99A 2HMWA 2GRAA 2IEDA 2VHWA 2EG9A 3VKUA 1NASA 3IL2A 1E7MA 1ULUA 2IEBA 3JD1A 4W7HA 4MIEA 3B70A 2Q1TA 4WGGA 6LDHA 2ILTA 5ICMA 4BMNA 2B35A 4I5FA 3RFTA 5FFFA 1QV6A 5BSGA 3UW3A 1VJ1A 4N54A 1E6UA 4OM8A 1XA0A 1XWFA 1E3LA 2GPTA 1YJQA 4NK4A 4I9NA 5HM8A 3JQCA 3P5SA 1ADGA 3PJEA 3HWRA 4R9RA 4OGWA 4PFJA 4CMGA 1YDEA 3JYPA 4ZU3A 3IIEA 3LLSA 4KDEA 1XGKA 3DBRA 3GPIA 2JCVA 4WLVA 4GX0A 3C85A 1ZJZA 4XRGA 1KVRA 3IJPA 1Y8QB 1UP4A 4IQ8A 2HRBA 3GF4A 3IP1A 4WCFC 1QORA 3OMLA 4CMIB 1IPEA 4MP8A 5IN5A 5LDGA 5C5IA 1C0PA 1P1RA 5TX7A 1NQOA 1OMOA 1UJMA 2RH4A 5TRTA 2D4AA 5JXWA 4II2A 5TIIA 2G76A 4HUJA 4D3DA 4FSHA 3DZBA 1NR7A 3NKLA 4YJHA 3GDGA 4J49A 3PXXA 4P38A 1V35A 3U9LA 5DCWA 5KNLA 5IJZA 4J9UE 2A4KA 2Q50A 4RF4A 1TT7A 3FNHA 3RUAA 3PYLA 1VM6A 3WLEA 4TZKA 3O4RA 4GBJA 1EFLA 2OO5A 3BMNB 3TF5A 1JKIA 3M2TA 2EWMA 2LDXA 3OJFA 4ALKA 4NU6A 3PTZA 2VHVA 3H7AA 1LDEA 4BKRA 4YR9A 1DLIA 3JQFC 4BQPA 3S2IA 3NGXA 1P1HA 1JQBA 1CWUA 4O0LA 3O38A 3PIDA 4J0EA 3ZHXA 5JMPA 5HWSA 1P0FA 4C7KA 2IXAA 1YBVA 2NQTA 4PLHA 1KC3A 1DIBA 5L4SA 4Z9XA 5JE8A 2J3KA 3DC2A 3TDKA 3MWEB 2HMVA 3KEOA 5JPIA 4LISA 4OHUA 1ZXLA 5JBIA 1A9ZA 3S55A 1Z75A 2FR0A 1U2GA 2WTBA 1I24A 4K6CA 5JDCC 1UDAA 2DTDA 3DWFA 2JFHA 4BKUA 3H65A 2DBZA 4HFMA 2WDZA 1A4UA 1MA0A 3DBLB 1I0ZA 3JYLA 2HRZA 4UVHA 4ALIA 3K5PA 4FPXA 5T8KA 1XDWA 4YB8A 1DC5A 4I8XA 2ZTVA 4NBRA 4DREA 2DPGA 2I67A 3UICA 1GCUA 3AM3A 3BTSA 3ROKA 4ZHSA 1YB4A 1I10A 2JHFA 2X5OA 3GDOA 2B4TO 1JU9A 1S6YA 1K0UA 4AJPA 7MDHA 4I9UA 4E5MA 2ZQYA 4YWJA 4NI5A 4WLUA 3CMCO 2C82A 2J6IA 4YPOA 2I65A 3V1UA 3PI7A 3ZNNA 1EDZA 4OXNA 4CLOA 3TZHA 2GUGA 5AYVA 2NADA 1NVGA 3FNEA 3RC1A 4BIIA 5THKA 4B8ZA 3QWBA 5EQDA 1EQUA 1E6EA 1T4BA 1ZUD1 3WTBA 3ZV5A 3LF1A 1Y9AA 4CUKA 2AEFA 4WEOA 3IUSA 1WMBA 1VI2A 5F1PA 3C7DB 5ES3A 5IFLA 3KSZO 2Y1FA 4IS3A 3ZWBA 4U0KA 1E3WA 2Y1DA 3BZUA 1T2DA 3INRA 3KB6A 4CM7A 3F3SA 1R66A 3KEQA 1VL6A 5JO9A 2VYNA 1QG6A 4NBVA 5TGDA 3PWSA 5KVQA 4H15A 1DRVA 1K89A 4YVFA 1ZW1A 3PWZA 1HYEA 4FB5A 2PH3A 4J1SA 4N5LA 1NHWA 1AXGA 3OFSA 4HX5A 4LMRA 3ZWNA 4NG5A
chains in the Genus database with same CATH superfamily
4ZI5A 1P3JA 2RG1A 2R8EA 1PFKA 1T15A 1XNGA 3EW7A 2HBYA 3K1YA 3AUFA 4CIBA 1W36C 2KMLA 3DHWC 1CDOA 4JNKA 1VJDA 1CY8A 3KO8A 2D2VA 3MN1A 4GYWA 5I7HA 5CYPA 5GJCA 1GGEA 3KNZA 1ODSA 2VF4X 4TYWA 5FULA 3O73A 1KDVA 2FCAA 2MSKA 4AJLA 4P7KA 4ARBA 2EZ4A 3BMOA 3DHYA 4LN1A 3KWJA 4YPFA 3S28A 2ZSJA 5C18A 4TRRA 2EWWA 1AKWA 1H2XA 2BBSA 2GBGA 3DCNA 5FBRB 5B7NA 2CEAA 2JIBA 3I3SR 4FBMA 3EZXA 4HB2A 4XA8A 4F06A 2IV2X 3PNBA 4YAJA 2Z3ZA 1ONSA 4YAIA 4AJJA 2B4KA 3O4IA 1FBNA 1Y89A 4P3XA 2FMUA 3PT9A 3KCQA 1GPDG 2VP6A 3BZWA 2D7CA 4TZTA 4ZAVA 4NU5A 4DMLA 5KTYA 4LZJA 4IINA 4EHJA 2QBYA 3BORA 5DBOA 3ZE9A 1CUDA 2HQSA 3B1FA 1WPQA 5BSEA 2HIHA 2VXOA 2E87A 5KYGA 1ORVA 2RKOA 4QO7A 5EKUA 4WJZA 3IA7A 2HREA 3ANNA 3H3XA 1MOPA 5FBLB 5FFNA 3NALA 3WB9A 5CIWA 3OQOA 1OAOA 1NFRA 3UXMA 1JFRA 1OXTA 1SUEA 1T91A 1JEDA 4MI3A 1D4ZA 3E8MA 3S7TA 3S8YA 4Y9RA 3R5KA 3BM5A 5JZVA 3WZLA 1L1RA 3GELA 1GTVA 1DWPA 2J0SA 2W4QA 2ZT8A 3V4ZA 2E1PA 2OGUA 1GARA 3CLSC 4G24A 4QSMA 2DR3A 1N2GA 4Z86A 4O4LF 5KYUA 4DA0A 1IEQA 3ZK7A 4AKEA 1M34A 1L4GA 3SGLA 4JJZA 4W5WA 3V3TA 2I80A 1G8AA 4OYLA 4WOPA 1AQ6A 5EXTA 1ZHHA 3DNPA 4IRMA 1QQAA 1Y8AA 1U8TA 1A71A 3CPEA 4K03A 1SBNE 4JQYA 3RHSA 4EY4A 1E1QA 4FC6A 5K3FB 4YJ2B 4P32A 3DPSA 3FH0A 4JKOA 1V8FA 4N5HX 3T9DA 4JYBA 5FEUA 1OFVA 3DG9A 3H9GA 5CLGA 1NQTA 3NAMA 4D4MA 4OLAA 1C0EA 4KRGA 4TYNA 3LT0A 2PUJA 2O0JA 1HY3A 3GFPA 2FG7C 4CR6A 5JJCA 4E5KA 2QTVB 4O4LA 1XKTA 2AA3A 3EG5A 4M0FA 4RPIA 2MYTA 3ESQA 1I6KA 5BUCA 1CRWG 1K66A 4N7MA 3M2PA 2Q62A 1XU9A 2EX4A 4L8VA 4B7UA 1DDGA 4IEFB 4DIFA 3OCWA 3PXCX 1QFJA 4ZODA 1FLVA 2OTCA 3O2NA 2OO3A 3WTCA 1E0KA 2DX7A 1QHHB 5K3AA 4B6QA 2XNDD 1YZVA 3QLJA 3P9PA 4EA9A 4TROA 3LI2A 3VKWA 5SY6A 4N6OA 2WB2A 2UUBB 5KTSA 4GI7A 2WTEA 1NAHA 2VPYA 4MR8B 2XOEA 4QJ3A 3HFJA 4KXMA 1FZQA 4J94A 4LI0A 3UC9A 2Z8XA 3N6VA 5FOUA 3ASVA 3DUFB 3EFOB 3TOZA 4UM8B 3DEAA 3GDFA 2PMWB 3OCXA 1GVHA 2YFQA 4TXMA 4UU8A 1VPWA 2BEKA 1M6VA 4DIUA 2BAGA 1M8JA 3GCGA 4PGHA 4AMUA 5JDIA 1PV4A 3BWVA 4QA9A 4IUBS 2P2DA 3RT9A 1RRMA 1TCUA 3KQVA 5H5JA 2EL9A 2OCAA 2Y0CA 3I34X 4GUDA 2ZOSA 4MGEA 4X8OA 3ODPA 4QGHA 3RKUA 3I2YX 1N2CB 4ZRDA 1V3TA 2Y1CA 4KE8A 1NXWA 4INOA 3PLNA 2R1TB 4B09A 3K6SA 3A3PA 5IJ0B 4YGYA 4HQ0A 4UMDA 4Y6PA 4PIPA 2G4CA 2YUTA 4QBHA 4CM4A 1GQ2A 4ND5A 3ZE1B 2K2WA 5FI1B 3ZQ6A 2WP8J 1Z0JA 2HT6A 3KS9A 4N5DA 3K20A 1MVOA 3TW8A 4RTRA 3V4FA 3IT3A 3OBIA 4LNUB 5TR9A 4JLDA 4X3PA 2C5AA 3KQPA 5FQOA 1YZUA 2P9CA 3URMA 6AT1A 4B0PA 2YNMD 5J58A 1E2HA 1A5ZA 5F52A 3FW1A 3ZVLA 1Q0QA 4DC0A 1GZ3A 4Y2VA 4LYHA 1SBHA 4LXGA 5HFJA 2I3GA 4GM0A 4QKQA 1FP2A 2G1PA 2XGSA 4ZQFA 1VECA 2D62A 1N1EA 4Q01A 4GECA 4HSGA 4LZOA 4FWTA 2NMVA 1CYEA 2XCQA 2YWJA 4MXDA 3B5JA 3ZIUA 2H4WA 3ZJYA 4C7JA 3G02A 3DKRA 2WWVD 4D9EA 1LLUA 1N92A 3B36A 3MJHA 1JBQA 3F2IA 3VR5A 4Z7QB 3QTTA 1JLLB 1R8SA 4U7WA 4D5EA 5EKSA 1KXZA 4WESB 1DBIA 2COEA 4COKA 4J2TA 4DLAA 3KKZA 1B3RA 1Z07A 1N4AA 4ZAGA 1N2IA 1IUNA 4LOIA 3UBMA 2PGNA 3CNQS 4DR2B 4KVFA 4AKTA 2QTBA 2NO5A 2C2WA 1Z39A 2HH9A 4G8CA 4PGGA 1ISMA 3WLFA 2IUYA 2OWEA 1OYYA 1P1JA 4N5IX 4R5MA 4EG3A 4GLFA 1O6BA 2ATCA 4HPXB 5DGTA 2O8DA 3MMSA 2ZSAA 1IY2A 5GINE 2G9VA 4MVJH 5E6UB 2IFTA 5EI5A 1D1SA 4J8PA 2PFGA 3GEHA 4RBNA 1M6NA 5DTMA 1C4OA 2QM3A 2JHPA 3DVRX 3SF0A 1EHIA 1NONA 3UAYA 1E2NA 3H8SA 1YA6A 1SVNA 2X2FA 4ZYXA 1LWNA 1QHEA 1JDBB 3CB4A 2XNCA 3DEZA 3R0JA 1Y3AA 1ZK1A 1OHHD 3AONB 4Q37A 1BDJA 3P5BA 5EIEA 2EKZA 5EJ7A 1WO8A 5TLSA 3OA2A 4R1NA 4L4SA 5AW7A 4NG4A 3I9V1 4E2YA 4WJKB 1X1SA 4MO9A 1G42A 1LVGA 2VDLB 2JCGA 1ZR2A 2PS1A 5I9SA 2GYVA 3QU5A 3GLRA 3W7AA 3W9BA 2J0UB 1Z34A 1P0QA 2PLAA 2XYVA 4XIYA 5ELLA 4AJKA 5CD9A 1B74A 3NIFB 5ELXA 1W46A 1H6BA 5BW6B 2RGEA 3WIVA 1U7ZA 1YDWA 2PKQO 2ZUWA 5G02A 4V3BA 2JIZA 5KWIA 4KFSA 3S68A 1M6HA 2PGOA 2GEBA 3COWA 1DFHA 4RETA 2H51A 5EIOA 3QI7A 5B30A 2G5CA 4B31A 2KX7A 5CB6A 3P2MA 1QIJA 1AKRA 5D7BA 1NLFA 1B8OA 3S5JA 1N3BA 3FG9A 2JI7A 3MIZA 2AN9A 3VZPA 4FYXA 3ZZUA 4EMTA 3K5HA 3GJRA 3A14A 4NE9A 4F3TA 1OLUB 1C3XA 3ZWMA 2QT1A 3ILSA 3SX4A 5ECDA 1YDGA 5KMGA 1Q7BA 4IIHA 4A10A 3NTQA 4X1IA 1W5EA 4PYQA 5A3SA 1GKUB 1N2CE 3HUUA 4WVLA 1M6YA 4HWRA 5DT9A 4FN5A 4QULA 4BU1A 3ZDXB 2DEUA 4CM9D 4GUAA 2VDWA 4MPJA 3LWBA 5FOSA 2NU9B 3TR5A 4DLRA 3OHPA 3SXPA 1WY5A 1YB5A 4EI8A 3KTAB 3OPNA 4E32A 3IMCA 3A1EA 5JS1A 3L4BC 5CFLA 3NIDB 3IQDB 2O1WA 1KSHA 4YFVA 3I92A 1UJBA 3UAZA 4LK3A 3ZCRA 2EQBA 3KOZA 4Y2TA 3LOUA 3I83A 3NHLA 2YW9A 1PR1A 2CXNA 3IERA 2JJ1D 1FRVA 1D2RA 2OO5C 1E0SA 1DTSA 1EBBA 2H65A 1GEEA 1FFBA 2E4WA 4CF7A 5M34A 2JZNA 4E03A 5FX2A 1Z4IA 3M4XA 1VIVA 1MGOA 3O4VA 3O5AA 4P86A 2V1UA 5HJ7A 3DCJA 3HY3A 4MLDA 3SC3A 4ECAA 2DUWA 2VQSA 4GP9A 4D3FA 1OFUA 3AVVA 1G6HA 1MB9A 2WSLA 3NWEA 1EK2A 2J3LA 2ZATA 1X86B 4Q24A 3RYIB 1YVUA 3SYLA 1H2WA 2ETVA 5LBUA 1CRPA 5B3KA 3MG9A 3FI9A 1BGVA 4G9EA 3BD7A 4J43A 3EVCA 1OWNA 5IVIA 4F3CA 1ZD3A 3KEFA 3C6ZA 3PQCA 1U0TA 5DLYA 1CD5A 3VJMA 2Y1KA 4JJEA 3RU9A 2WW8A 1CB7A 2R5NA 1GUFA 1DOHA 2ZIUB 4Y2RA 4LRTB 1KGSA 1ZQ1A 5AUNB 5AVZA 1CQWA 1GYPA 4MYTA 5K09A 3MYYA 4GQAA 1QPGA 2QIOA 2NYVA 2A1UB 3SHWA 1GZ4A 4Y2YA 3KKEA 1KH3A 1LS6A 1SHJA 5CPFA 3L7OA 4CKEB 1E5DA 4DSOA 4F4FA 3EIHA 1UKBA 4LJ7A 4MYCA 1G63A 1J1IA 3WBBA 1AURA 1FFXA 4P5DA 5CUQA 3FYUC 3LLMA 1YZLA 2GLTA 4UQOA 5DYYA 3UKDA 2JJMA 2I2AA 5JD5A 1YJCA 3C1AA 4H7FA 1VBFA 2JAQA 4KSYA 3LQFA 3LBNA 1NVVR 2HWXA 4MKIA 1UFVA 3UK7A 2AYXA 1Z6GA 4Q0MA 4F6RB 4EJ2A 3RF7A 2JATA 5JMOA 1B0UA 3BRSA 2NUAA 2L69A 1GPBA 3N2ZB 4YRQA 4I4TB 3AZPA 2O8CB 4MRRA 1IXYA 3R6GA 1L5ZA 1UCFA 3KYJB 1BQEA 4TTIA 3TXXA 2YXLA 3L0BA 1ZD2P 3QZUA 4PZ0A 3NIGB 5DTEA 4I1OA 3WYCA 3T1TA 2GTIA 2ZYIA 4Q15A 4WK6A 3O1HB 2RHCA 4XCQA 5ERGB 3RBVA 1OWLA 5TPZD 2XMCA 5LL6P 2Q3HA 2R2GA 3EIFA 3PEEA 4RYLA 3H2GA 2QE6A 3I30X 5HPYB 2H3HA 1W5BA 3FF1A 5EWLA 2NXWA 3GCWA 3X1DA 2BEJA 3DNMA 1KS9A 4G9BA 2VQDA 5KYXA 4W5OA 1F2VA 3UG7A 3RSZA 2G9UA 1USWA 1NN1A 1JILA 1NVEA 1CQJB 1KA9H 3K9BA 4NBTA 4PVDA 2AMFA 3TLGA 3WRXA 5JC1A 4Q1FA 2YOFA 3I9FA 1SD5A 1BDBA 1N2BA 2HAEA 4TKUA 4G63A 4U2EA 1CJSA 1CY1A 2EX1A 4BEBA 3HBLA 4U63A 5BUQA 5CLQA 2AFVA 3ET4A 4YPVA 1XA3A 1CSEE 3I72A 5EE1A 1WVGA 3U3OA 1S9DA 4BB0A 2YVLA 1Q0ZA 3C1OA 3S2YA 1X0XA 2V7GA 4TWRA 3QELB 2FMKA 3RAEC 2CCGA 2Z8YA 4MUIA 5CIYA 1K2WA 2PGIA 2QTAA 4ZREA 5L3SB 3NHAA 2FR8C 1ENZA 1ODCA 4HH4A 3G68A 5AHOA 3HKCB 1Y8RB 5K0LA 4DMRA 3EZ2A 1B26A 4LGVA 3RYFB 3RUHA 3U4CA 3BXHA 2ZWAA 3KR0A 1ONNA 4RX1A 1XZ8A 3ZS8A 3CG4A 3OJEA 4QXAA 1HNNA 3P2KA 1BVYF 1E4YA 1EUDB 2PWZA 4IJWA 5CH8A 2YY6A 1RC8A 1HDGO 1YHYA 4WZBB 4QM6A 2VS1A 4BZXA 4DIOA 4UNSA 3KHSA 1F4LA 2Q0HA 3WK6A 1WCIA 4P0QB 1I2CA 1A96A 5CDSA 2ZRMA 4MW0A 1K88A 1EUQA 1MG0A 1Q83A 5TMEA 2FQQA 1GR1A 1VHTA 1NVDA 3OQNA 3NHRA 4US0R 3WGVA 1FYVA 3UHPA 3QKUA 1FX0B 2ZEJA 1JNXX 1TVKB 4LECA 5BNWA 1W85B 1E6WA 3FPHA 3EG9B 3FPSA 2YHIB 3QE4A 4I50F 1X2EA 3IVGA 4OXXA 5AKLA 2H4YA 3T9EA 3RIXA 4CR7A 5TQ2A 1U0OC 4CM8B 3GZNA 3ZQKA 2QZ9A 3NWOA 3VO1A 1OJ7A 3AR9A 4KQWA 4ZOLF 4DDVA 3FJOA 1FLDA 5DM70 1TC1A 1UPBA 3VKHA 3SZGA 3OQIA 2BTQA 4X1OA 10MHA 3MGKA 1EJ0A 3B1VA 1GQYA 2GLUA 1ONBA 2WBLC 1T0JB 3CJTA 3I6MA 4D74A 3S40A 4RD6A 5H02A 1ZUHA 3A9UA 4OJQA 1G8GA 1V8BA 5LXTA 3QPBA 2QQ0A 1J9GA 4OFZA 2JGKA 1OE0A 2X0NA 3G8BA 2WILA 3FOCA 3C3AA 1C29B 1PR5A 2VYFA 4JOSA 1J00A 3WRYA 1M5UA 2N75A 3DEKA 4I50A 2MT9A 4HFNA 1BVUA 2A1IA 4UHFA 1NLUA 3HBJA 3I61A 5HCUA 5C8ZA 3R1IA 2IC5A 2QG9A 1BA3A 4QOSA 3VM6A 1LX6A 3UFXA 1RZUA 2GM9A 3DZJA 3W06A 2RARA 4FYIA 4OXIA 4NMHA 4QATA 1L8AA 3WWPA 4YCAA 1LSJA 4OLBA 2A6PA 1R4AA 3P4YA 3OIFA 1KMCA 1JFLA 2JFYA 4WZAB 4LE0A 4G26A 4AO8A 1E2KA 1VL2A 3A0UA 1JYSA 3S6JA 4B4UA 1TYCA 3UOGA 4WNAB 3W5JA 2D1QA 3PFGA 2VP9A 1RWOA 3TRKA 1KJIA 3UWSA 4IOJA 2XNDA 4NMMA 3NM5A 3UYLA 2V6JA 1KP3A 4RCVA 5DHFA 3JPYA 4B73A 1PWEA 1VIMA 2I3ZA 3NC4A 2V4MA 3HJTA 2R87A 3WGYA 3A6LA 4OHXA 4BZPA 2XMDA 1TL7C 2BRUA 3W3AH 3OTGA 2YN0A 2D74A 3CX7A 4YQYA 1J20A 3FGNA 4W5TA 3C5HA 3C1TA 1T34A 1WQ4A 2GBCA 1ZRMA 4KW7A 3T1QA 3UJ6A 1NVUQ 3TKLA 1SBIA 2B7CA 2YV3A 5HIAA 1N6PA 5DM0A 4Q4HB 3TQQA 5A5EA 2NUTB 2XXBA 3AF6A 1ZMTA 2NU6B 4MVYA 3C4VA 2CNOA 4ND8B 5FUWA 1FFHA 3TINA 2PHZA 1D09A 3IDZA 3ANSA 3GLFA 4KJZA 3ND8A 3LOQA 4E09A 3VPGA 4EGJA 3E70C 2Q5FA 4RWEA 3AG6A 3WK4A 4RJTA 1D0VA 3GZTB 2AZTA 1DBPA 3VZDA 3U4QA 1BJRE 1OV4A 1AHPA 3GDHA 3KAPA 4EG1A 3DOCA 2VAWA 3HY6A 1WLYA 3BKXA 1A7UA 1A7JA 1B6GA 1M33A 2IZOA 3ANYB 2BFMA 3G5MA 2GO7A 1S5PA 1XQ1A 3F97A 2JANA 2XH8A 3CH6A 3JS5A 4F21A 5CITA 4B33A 4B3DA 1AQNA 1XK7A 4XD7D 1HETA 4D99A 2HA6A 2I7VA 2TMYA 3FCEA 4WFIA 1P61B 3DOEA 4RPKA 2YNMA 2VHQA 3VYTB 3QNUA 1XK6A 1U9JA 5D51S 4UBNA 4C4ZA 5T57A 2ZWVA 3IV6A 1IIRA 1KKMA 1U0EA 2AFIB 2VJMA 4TM8A 2PAFA 4V0MA 4YTEA 3NNDA 2YOGA 4MWCA 4X8LA 5EKDA 4CHTA 4HKTA 4IIDA 4KV7A 4LZPA 2ZWOA 4IDNA 3W8NA 4EPVA 3M9LA 1GL3A 1P0MA 2BZ0A 2J46A 3SKYA 3D31A 2I54A 2XMRA 5EPOA 5F9FA 2NM0A 1HE1C 3SFTA 4DDKA 1XJWA 1NY5A 2P3QA 2WFAA 2N1BA 1CVRA 2Q8QA 1SJ9A 2Z2ZA 2BFCB 1MIHA 1TM2A 2OK8A 3D6MA 2F1OA 1E6CA 5DWDA 3W2IA 3VZRA 3Q3CA 6ABPA 1SQSA 3M89A 1PNVA 2DFNA 2VDKB 3T15A 1M1NB 4XDGA 3RS7A 4BO1A 5K3OA 1F1BA 1T5IA 1VDMA 3HCRA 4BWVA 5L9AA 2BR3A 1HT3A 1EJ6A 2MIIA 3IEVA 1JSZA 2XLCA 4OLJA 3HNOA 4MVXA 5HNKA 1EGHA 2ZAOA 4W82A 3VPSA 3L5OA 3DXXA 3ZEIA 2O2IA 1G5QA 5ALPA 4IDOA 5A7GA 1Y37A 5C80A 1JSXA 1JEQB 3WK5A 2YZKA 4TS3A 5JLJA 4EZIA 2G0NA 4ZVSA 2IY9A 1RM0A 2V6BA 1CEYA 3UA3A 1PJ4A 1SUAA 2AMVA 4WZAE 1XTJA 3DF9A 5C8YB 3GLGA 2WR8A 3WFIA 2X0EA 1BEEA 3H2BA 1CNEA 4G1UC 4OPMA 2FMXA 1LKZA 4LDRA 3RLFA 4PQYA 1OHHA 3QUCA 5K3SA 3V2GA 4BNIA 4DVGA 3D8UA 5I7UA 1Y1PA 1CRZA 1FFWA 1ABEA 3RTAA 3SS7X 3THYA 1MDFA 1VCNA 4K46A 4IPTA 1QAMA 1XZIA 1EJ2A 1R12A 2AOTA 3B1WA 3G9QA 3NQ41 3VR4H 4EQ6A 3WMEA 3AHCA 2BHTA 2JD1A 3OZBA 1EFRD 1SHKA 1NI3A 2OSBA 2ZU6A 5IF9A 4KCGA 2CL7X 4O2BF 4YCSA 3HB9A 4HMQA 3E22A 5L3ZA 4HNUA 1IVSA 2JD2A 3SKXA 4RK1A 2FN9A 5FTLA 2ODTX 2EJVA 2PUFA 3L6EA 1PN3A 2P0AA 4ZO7A 1XEXA 1B8VA 2ENWA 3FTFA 2FOXA 1F3OA 2BGNA 4U7PB 1XSEA 1UEIA 4K8OA 4ZYLA 1NVFA 2QGZA 5HRCA 3RYTC 3L7IA 2PUAA 7GPBA 2GSWA 3CZAA 4XH9B 1UFRA 4CM9A 3BF7A 2C4WA 5AI6A 5ITWA 2ZRGA 5T6MA 2JEZA 4IQ4A 4LVNA 4F2GA 1TCAA 4K9OA 3W79A 2PV7A 2HK8A 5C1BA 2OLJA 3HE3A 4V2UA 2OSVA 3HH8A 2AN3A 1RMTA 3H5TA 1QK3A 1V1JA 3AYZB 1WRBA 3LFHA 5DBFA 2DY0A 1E9DA 1RS0A 5F77A 4OP1A 4FQ8A 1I3CA 5AW2A 1O4VA 5BMVB 2VH1A 2VJQA 2JJ1A 1T9AA 4RLSA 1I33A 2Z2KA 3JZMA 4NCIA 3K9NA 3UK2A 1HYHA 2YJ6A 1MTOA 2C7RA 3MRXA 5M3BA 2YVAA 4YCJA 4WKGA 1ECJA 2ORED 1SUSA 1VJRA 2FPGA 2AFHE 2QQEA 1PUIA 4FDAA 5E3IA 4BLOA 4D26A 1XRMA 4MKRA 1SZJG 4ZT7A 3ULKA 4QTYA 1J0BA 2EGGA 1YMVA 4M9QA 1Y9EA 2BN4A 1PFUA 4FEYA 4C3ZA 4DFDA 2VXCA 3ETJA 2DLCX 1XMQB 1REQB 2G40A 4Z9BA 4HRXA 2ZRDA 5BW8A 5JYEA 1L7XA 1O6ZA 2EBWA 3E1SA 2F6RA 3DZKA 5DBIA 1L5NA 4YJ3B 4CM7A 3LUPA 1ZLYA 2QX4A 3B3GA 3L41A 2Q1YA 3NV9A 5J4YA 3AR8A 5I7WA 5CPBA 3E27A 3GYGA 1JT9A 5CNMA 5DLPA 1GLVA 4ZJUA 4A0HA 4BAZA 1IRXA 2ZITA 3OLWA 3WBJA 2XE8A 2O52A 1Z0UA 2F62A 1OJLA 1NOKA 1MV5A 1QB8A 2H5IA 3ONVA 1JR6A 1NG1A 2I6SA 3GVPA 3HNRA 4L4RA 2C2OA 4DYVA 4DLYA 3QPDA 2OHOA 5JAOA 5LZ9A 3C15C 1Q7RA 1RXYA 1ZGGA 3GY0A 3WBKA 1J22A 2W8BB 3RIHA 1JKJA 4D8WA 3D02A 3HB1A 3QVJA 1JXAA 1HWYA 3G13A 3GAAA 4LWOA 4B85A 2W98A 2YV1A 3OQ6A 4MR7B 1SB8A 1ZN9A 3I9JA 4KGZA 4S2EA 4UZSA 5CVDA 5E2AA 4AJ1A 3WHPA 1ZH4A 5EJGA 2GX6A 3CUSA 4TQAA 3TTVA 3V97A 5A5DA 5I7EA 2PUCA 2Z6QA 2Q3JA 5KPDA 4LBYA 5JI3E 1O6GA 1KQOA 1TW2A 3K2IA 4MIYA 5E1BA 1ZNXA 3AJEA 3L0YA 1ZINA 1XQVA 4GVXA 4UAGA 4ZIRB 1VKJA 1YI8A 3LY9A 3ESAA 3Q40A 4C4PA 1IN6A 2HFJA 3HG7A 4E2XA 1XWWA 1NT2A 3H1TA 5C5CA 3GAZA 2P1ZA 3MW8A 3LQYA 3PQ2A 5TPZA 4HVLA 3FPJA 2GK6A 3UHOA 4FI3C 3NFYA 2QLTA 2X0DA 1ZRNA 5JD4A 2ANCA 2FPWA 3PVSA 2XNSA 1LQUA 1NVBA 1NJGA 2A5DA 1FYEA 1QIEA 1Y1SA 2GGSA 2RAFA 2LD4A 2YC4C 3EASA 2WZBA 4NOKA 3GEDA 4DXAA 4FYWA 2EJBA 1R0BA 4UTZA 5D6OA 2A14A 1KEZA 3WLQA 1I6LA 2AKYA 4IJUA 3I5AA 3KJXA 1U0LA 2ZVDA 3G9UA 5AW6A 2YHSA 4BEWA 1CR1A 3A4YA 2XNHA 3DMFA 2WMYA 5EHGA 2JLUA 1IEWA 4NYMQ 4I5EA 1CUUA 2CZCA 5H70A 2R4TA 2ZANA 5FR2A 4Z4EA 3ANMA 1JHPA 3H6KA 2PJUA 4UU1A 2EDCA 2QX6A 2DRIA 2H1CA 1SG9A 5ER6A 4CFSA 4EYSA 1Y6FA 1HFKA 1E2IA 5AOCA 2BZ1A 3GOHA 3NEJA 3SDZA 4FFBB 4R2XA 4IVNA 1LFDB 3NWJA 3QEKA 1B15A 2QUKA 1L7QA 1ACLA 3DFZA 3MTGA 5IC6A 3PHIA 2L2QA 4ARUA 4KIUA 2VZLA 3ZCPA 2HA5A 1E2GA 5GZ6A 4BX2A 5ENZA 4V1CB 4C30A 4H7KA 4BO3A 2O19A 2NW6A 3WE7A 4A8PA 1G21E 1MQ9A 1VYVA 1YR7A 1M2OB 2DBVO 2ZUCA 3AF4A 3FYCA 3G5TA 3CEJA 2HA7A 3I4LA 5CLHA 3N2NA 5DLDA 3BXPA 3ZE6A 3TIGA 3NKVA 2V6MA 1N75A 1JIKA 4TN5A 1M76A 3B7WA 2DGDA 1AN9A 3AIMA 4WZZA 4DJTA 5AXCA 2HLHA 1NU6A 1JALA 4P31A 1VKOA 2J3JA 5B3AA 3IC5A 3GGOA 1JHDA 4PBRA 5KSZA 2V3WA 3NBAA 1KZHA 1T8YA 4DT1B 1XWIA 3AUTA 3ITNA 3IULA 3KUKA 3RBAA 4HN4B 4FMDF 3OD5A 4UHEA 1RI1A 1KEEA 2HA3A 2JIMA 4HGRA 4ZVPA 3A06A 3OETA 4ZV7A 3IPXA 4D9JA 2OENG 1TPZA 5KU1A 4J0DA 4X1KA 1BXGA 1RQ7A 3LCJA 4GPEA 4YYZA 1PZGA 2QQGA 4JL8A 1OR8A 2NZWA 4R1QA 1B42A 3NRJA 2FDCA 4Z0TA 3W4JA 4M8KA 1ZA2A 3LLVA 3DE2X 4GYYA 1SKBA 3K2EA 2IXDA 2G71A 3V9AA 4N0DA 1KEUA 2OHJA 1UKVY 5KOIA 2ZR8A 2GBLC 3AI3A 1OCEA 3PQ5A 2VTBB 4L95C 1N78A 1P29A 3RLIA 1FB5A 3C98A 3JPWA 1MIOA 4ARZA 1YI0A 2IF0A 1CF2O 1MU0A 2MSEB 1GHTA 2Z5FA 3D43A 4IDPA 4M1WA 5I9TA 4K9RA 4QTXA 2WY2D 3QVGA 4QM7A 1LFAA 1VGRA 1O8CA 2QENA 3G2PA 5FWYB 4YWHA 1WZEA 4CIDA 4UDXX 3UC5A 1I2ZA 4GVPA 3ER6A 3UMRA 2FK8A 1FTGA 4WCFB 3U80A 3NTOA 3JWPA 2EFYA 4EUFA 4ZDWA 2O3TA 4N48A 2WJVA 1UK6A 2YV2A 3ZCXA 4TUYA 4JGIA 1VCIA 4JA2A 3MD0A 1XQ9A 4A1FA 3E7XA 5JEDA 1F7UA 4DMMA 3T41A 1PFYA 4JB2A 5TPWB 3A6EA 2Q5EA 4BVFA 2J4DA 1D2GA 1NP6A 4FONA 4UUQA 4R1UA 1R6UA 1US8B 5AVJA 1HR0B 3OQJA 4ZAFA 5HKLA 2QMZA 3VOAA 3TWOA 4BO5A 1ZLXA 1XRNA 4GAEA 3LC2O 1OBHA 1HE8B 1FU4A 3BE6A 4H7EA 3THXA 1NUPA 1UOPA 2PYDA 3DM9B 4HFRA 2DXIA 1QOQB 4DXHA 3IAS6 4NEGA 3IIJA 3P9QA 3HV0A 4KQGA 3SG0A 1JLRA 3AL2A 2NV6A 3O4GA 1A2KC 1TAUA 1EVJA 4JR0A 4JVMA 3EGVA 4O2AA 1PE0A 4L2IB 2O7VA 3C8ZA 4IVQA 2VPPA 3WYGA 2C9YA 1FP4B 1KIFA 3PBKA 1KPHA 5BW4A 3GGCA 3B12A 5TMPA 2P2LA 3IB6A 3GCDA 5EJAA 4JDPA 5GOZA 2JBAA 1JKFA 2IXEA 4DABA 5BSWA 4TTSA 1DB3A 4K9PA 3QLUC 4TYMA 2HF8A 3BC1A 3PWTA 3FCXA 5ALZA 4OKIA 2ZIZA 5WRFA 2WVJA 2O2HA 3NBZC 2IP2A 2XB8A 3CBQA 2Q4OA 3K4PA 4GO1A 4HNAB 3D6TB 4ZO6A 2JIQA 5EJMA 5GJWC 1LNQA 4EMUA 1EFVA 1W6RA 2C54A 3A6KA 1E6KA 4UHCA 4YQEA 3OQ1A 4R3NA 4RZ3A 3WB2A 3ZWOA 1UR5A 8GPBA 5KHOC 2ST1A 2E4AA 4PSCA 3I64A 4MR9B 1Q3KA 2R7AA 1IOLA 3DP7A 3N87A 4MYHA 3DAGA 3QWFA 1FNCA 2FN7A 1QYIA 3HZHA 2E6KA 4QU5A 3DO5A 1NPDA 1B41A 1PHRA 1WUYA 1ZRSA 2CXTA 2Q0XA 2V74B 4XD7A 1KMIY 1T3TA 4IHKA 3UO8B 1CKEA 2H52A 1G8HA 2JLRA 4BLQA 4RTPA 1C0IA 3K53A 3S2GA 5UKDA 1G3QA 1Q0HA 3GI1A 5JHHB 4OQLA 2QMUA 2I4OA 3KSBC 4C7MA 1A72A 5TB5A 1PNQA 2DWQA 2G88A 1F17A 4MLZA 4Y9UA 3V2UA 2MWMA 2OFPA 1RC0A 3J7AC 4B3MB 5FYDA 4CNQA 2C3PA 1XTTA 1IUKA 1KWKA 1NJ6A 1Z2CA 1Q44A 3ESCA 1TLFA 4NAHA 4B17A 1UWLA 4J1TA 2B9VA 4CU2A 5KC8A 2P9QA 1KZGB 1N6RA 3AUSA 1PJBA 3PI6A 3VR1A 1H2RS 5MHTA 4B6RA 4WFKA 1VHQA 2IE0A 4DL9A 1LSUA 1Z0FA 2C4HA 1U2TA 5CX1A 3RVMA 1PJTA 2EATA 2YRFA 2NSJA 1RPTA 4DUZB 5L45A 1QV7A 4FTWA 4WV3A 5AOBA 2OCLA 4P82A 3IIMA 2CWWA 1BZYA 1U2SA 1ICIA 4H9GA 1F9AA 5H68A 4YAKA 1THZA 3F3KA 3O93A 4PCVA 1NM5C 1C0LA 1TYAE 4EGFA 1E9CA 1SXQA 2X4GA 3PEFA 3T7TA 5K6TA 4NOMA 3MQFA 4NZNA 4OQDA 1NT4A 2Q41A 4B74A 4BLSA 3K0AA 2Q1WA 1W96A 3Q6MA 4OEHA 4FC7A 4E94A 2G25A 5J2TF 1L8QA 4WERA 3EH2A 2XUPA 2OXTA 4LHXA 4BGEA 4HAYA 1TQ2A 2HSJA 3AF1A 4KE6A 1Q22A 1TZKA 4GMDA 3TX6A 4B4VA 4RMJA 5AI5A 3HKDB 3VA7A 3EGIA 1CVIA 3D64A 1HFWA 3HCAA 4ZVMA 3D0RA 1P5ZB 3G7NA 3PDCA 4N0MA 1FS6A 1GWNA 4M22A 1BDMA 4HYTA 5GP1A 4NV3A 1NL3A 4IUDS 2YUIA 2WYOA 1PJSA 1GG2A 2ZI6A 3F67A 1OPRA 2AXPA 1L4NA 1W4BA 3DJYA 1QIHA 3GLHA 5JXHA 1EFRA 3DONA 1EM8B 3HYNA 1RPJA 2A9FA 4AXXA 4B3IA 4F2WA 1X1BA 5J2TA 1MEJA 3D0QA 1J7KA 3QLTA 4TPKA 4J16C 1KQNA 1TO2E 2C2MA 4B46A 5CB4A 1CVLA 4PQGA 1ULAA 4B9AA 4PHCA 1P6UA 4DAOA 1MAWA 1EUYA 1MX9A 3RS4A 2FP4B 2P5UA 2SNIE 2D5IA 2XRYA 3LW7A 1TF5A 1OFUX 3PTLA 4M7WA 4OU4A 3TRIA 1R64A 4KWHA 1KP9A 1Q0SA 1G38A 4HNSA 1Y8QA 3I2JA 3J7TA 3R41A 4XGIA 3H0EA 4WLFA 1HDRA 4F9TA 4L0DA 3ZHRA 2ZWMA 3GQVA 3F96A 4M6WA 5E9JA 5A0VA 4QYMA 4TQ9A 4BVAA 5KQSA 1CQXA 3KQLA 5J40A 3HYSA 4HQKA 1D03A 5A5VA 3L1HA 2WKQA 1TNDA 2H8KA 3H1EA 5AD1A 1R9NA 3FFAA 3U7FB 4HDMA 1NW4A 3UA4A 1O0SA 1XDGA 1CP3A 4M7RA 4YLGA 3D4LA 5ECGC 2ODAA 1H94A 2FLKA 2QF7A 3HYCA 5JQGF 3VNAA 2V0NA 4RJ2A 3KQHA 1N5RA 2ZJ2A 1OFHA 3FE2A 3V32A 2XB6A 4E5PA 4YV0A 3BH6A 1ISHA 1A9OA 4YLEA 1GZ5A 4XQCA 5K3EA 4FNMA 1PWZA 1RACA 3QFRA 1FRFS 1D3AA 1T8PA 1VLMA 3A3OA 3OJCA 4HNGA 4WK2B 4ZARA 3CGGA 1CF9A 4TGLA 4ZYUA 2WSMA 2FN8A 4YFYA 3ROFA 4UVIA 4IWXA 3BMNA 5ADWA 2EAUA 1MJGM 3H84A 4LHEA 3BMCB 4WY5A 4OB8A 5DNAA 4E7OA 1CZUA 1DXYA 1Z28A 4UREA 3TN7A 4IZIA 4BTEA 2RHBA 1GZVA 3H5AA 3Q6IA 4NYIQ 4FGZA 2OMKA 5HYVA 5JQGA 3T3IA 1R15A 1CR2A 3HACA 2GPNA 5FBKA 1I6WA 1Y42X 3F78A 2XE6A 3UXYA 3AHJA 4JV5B 3PDIB 1QHGA 3V1KA 1EX9A 4I5GA 1M72A 2BMFA 4WOKA 5KKCA 1T9GS 5L6MB 2I03A 1EIWA 1UBUS 3Q3IA 3Q15C 3R2JA 4YRJA 3S27A 4JLWA 1X2BA 2O4UX 1KI7A 1BWSA 1U6IA 3HV2A 2DLDA 2EP8A 1P17A 1GZSA 3N8GA 4AY2A 1K86A 1QYXA 1RWPA 1YS6A 4LX0A 4XQGA 4RABA 3V1TC 3EHEA 2C7GA 1DXQA 4DSZA 3WIDA 4YRBA 5HX7A 1PV1A 1ZYUA 1JPNA 3ADCA 2CSUA 2RHGB 3KQWA 4C89A 2APJA 3TLEA 1HZJA 4ZA2A 2IOFK 2DHCA 3K1AA 3LQ2A 5TT1A 2E4YA 3FKJA 4XB2A 3ZHTA 3NHUA 4AUNA 2PX4A 2JIOA 3DH0A 4BP8A 1IUOA 3UT6A 1RXEA 2FEAA 4RW0A 1DQRA 1S2NA 5FTJA 1XKXA 1XI2A 2X22A 2O2YA 2GKGA 2ZIXA 1OH8A 2UZ1B 3G82C 4DMHA 4IKEA 1ZJ4A 4TV8F 1IPHA 5KNBH 1V6AA 5LZ8A 4DGSA 5U4QA 2AJLI 2K4MA 3IVCA 1NKVA 4BFXA 5D3MA 3HKBB 4DR7B 1ESDA 2XUJA 1CBUA 1Z74A 3FMIA 2WMDA 4FDUA 2OG2A 3P9ZA 4P4GA 2J6HA 3FZNA 2V7EA 3GEEA 1NVWQ 4UCXA 2JJ2D 3E0QA 3K9HA 2D8MA 1RJEA 3OT1A 2J3EA 3KFVA 4AULA 5AHWA 5HGXA 5JSUA 4GC9A 4B8WA 4DKXA 2CMKA 1DQPA 3MVEA 2NZUG 2QSUA 1RKQA 1Z5WA 4RD2A 1RJFA 4PFQA 1KAEA 2CBXA 1Y1LA 5D5PA 1M2FA 2PEZA 3TTUA 2JFUA 3PC8A 3WNDA 1RIIA 3JV7A 4TV8A 1RFLA 4O3FA 1GUDA 1SA0B 2G72A 4HEA6 5TGTA 3CIOA 2IYAA 1E8MA 3QVMA 4XUGB 4DWOA 3LBHA 4TVBA 4DM3A 3Q0TA 1LU9A 1N4DA 1YVRA 4UPEA 1RCUA 1FU7A 1L4UA 2V9ZA 3PVZA 2OXRA 3JSAA 3K5WA 3Q11A 1W36D 1W2WB 4ERNA 4AX8A 4KXWA 1R4NA 2BHLA 3GGPA 2OGWA 4F92B 5KJCA 1I1OA 1VTKA 2QPLA 1BKYA 2VTEA 3WOVA 1BU5A 1ZONA 3HSYA 3UF0A 4M54A 3HN2A 3CX3A 2I1LA 1DCFA 3MMXA 3OPYB 4MI6A 1V96A 4B76A 3GJ7A 2F1HA 4FS8A 4TMKA 2O7NA 1QZXA 4B3RB 2A5LA 3PEWA 5FT9A 1SCJA 1BWQA 3UHAA 3CH4B 1T2VA 4BXOA 4BTVA 5CBPB 3DOJA 4KHZA 4HUQB 3EPLA 2VUUA 1KKLA 4CMEC 3R3WA 4QTZA 3HXQA 2WUWE 4HS9A 1WHSA 3EVBA 5KUTA 4MITA 3OIYA 2R00C 621PA 1VBKA 4QG3A 1V2HE 2FWPA 3KT6A 4I81A 1U1EA 1NNSA 2GJ4A 4IEIA 2Y2UA 2H1RA 4J4HA 4IFTA 4KRYA 3ES9A 5HF5A 4XOUA 5I4BA 2VAPA 3H3FA 5CVJA 3T12A 2E49A 2X77A 2P3LA 1URPA 3O8CA 1X15A 1K7FB 4IX9A 4V24A 1R0CA 1R5NA 5KQMA 3CNBA 2CF5A 3CNOA 3LBYA 4D9MA 2NLOA 1GLNA 1CQZA 1BJTA 1G1AA 4UCWA 4IYJA 1OWMA 4RADA 2QZ4A 4QVGA 2OKGA 4CUJA 1S3IA 3K0SA 3BA6A 1LQ2A 4W7SA 1I9CA 3ZWDA 3IBSA 1VGVA 1W5FA 3ESBA 4L73A 4BNXA 3RNLA 3IUJA 3TI7A 3CLSD 1YC2A 4WSOA 4YX9A 4BCCA 1AKQA 2YV5A 3LDFA 1BS9A 2IBTA 3UEOA 2Q4RA 4LF5B 2CHEA 4KPEC 1UOQA 3EC2A 1N1DA 3RK4A 3MT0A 5B1SA 3VAAA 5AWFC 2A94A 2CB0A 4BFUA 2VATA 2VBFA 1AKYA 2XTNA 3ICVA 4E15A 2YR0A 1GPKA 1QYCA 2J32A 4ZQIA 1RDFA 3A9TA 3PXUA 1EWTA 4B4DA 1HQYE 1DP4A 3OQHA 4LFAB 3B9BA 3OQBA 5C51B 2WA1A 2ZDGA 4DVJA 4WY2A 1YR1A 4PGMA 4P4TA 1GCGA 4ER0A 2ZTLA 3AOEC 3ICQB 2DWUA 4CJXA 4EL0A 3LHFA 1MW8X 1RXCA 2X0KA 4TMYA 1Z0ZA 1E66A 4ED9A 4PGFA 1QO0D 2CJWA 3H83A 3WGJA 2IIVA 4EW2A 4MWSA 3TM5A 1YL5A 4X84A 4YO8A 3ONEA 1GZ6A 1YB2A 3KPJA 3ABQB 4QU9A 5FUXA