3OP4A

Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. n16961 in complex with nadp+
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
247
structure length
247
Chain Sequence
SQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier protein] reductase
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Oxidoreductase
total genus 81
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2010-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3op4A00
1ZBQA 3SBOA 4N5NA 3DTTA 4I5FA 4EUEA 5EQDA 3MJ4A 4FR5A 1YVEI 1ZK2A 5A3JA 2FZWA 4HFRA 2WM3A 5A9TA 1IZ9A 3AUTA 3S8MA 2AEFA 3W8DA 1DHTA 1EE2A 3PLNA 3QHAA 4XWYA 1Y8RB 2F1KA 3ZWAA 1I10A 3ASVA 1NVMB 1ONOA 3HDJA 4OKNA 4QFDA 1O89A 5ITWA 4HY3A 3U09A 1DC3A 4NU5A 3ADPA 2VYNA 4M89A 1KY4A 4DREA 1BG6A 4DL9A 3JQFC 1BWSA 1C0KA 1LSSA 3JQCA 1KEPA 3LT4A 3U9LA 1GAEO 1NP3A 3FNFA 3K8ZA 4FOOA 4J4HA 4DYVA 1PU2A 4R01A 4NHEA 3KRTA 4TRMA 3WIEA 4IQ8A 3D64A 2IXBA 2IE0A 1DEHA 1PJBA 4DTIA 1DRUA 2VZ8A 3QA9A 1LDNA 2ZJ0A 4NU6A 3UCEA 2BI7A 4BIIA 1YDWA 1MB4A 3D3WB 1QR6A 3AI1A 3AOEC 5KCZA 4EDFA 3AOEA 4CLOB 3O03A 4CLEA 4I9NA 2O4UX 5AXBA 4ONEA 1GV0A 1M75A 3LF1A 3ETGA 1O9BA 3CH6A 4NBVA 3NTRA 4L0QA 1E1LA 1B8PA 1BXGB 1ISGA 1Z82A 2FMUA 3PQDA 5T8KA 1Z7EA 4I9HA 3QVXA 3E82A 4TQGA 2CZCA 1PX0A 1EE9A 1B8UA 2B37A 2P2SA 4OXNA 4CR8A 1EBUA 4IXTA 4ID9A 3PFFA 1HKUA 1J49A 4HKTA 1G0NA 5JBIA 5HM8A 1EK5A 2JAPA 1Y1PA 2VYVA 1JVBA 1ZZEA 4MJLA 1YWGO 1AHHA 4WOKA 4Q3AA 2PTGA 2VUSA 2CF6A 2O3UA 1HF3A 1PJSA 3GDFA 4MKXA 5EJ2A 2F00A 3SC6A 2IEDA 1IPEA 3GHHA 1EQ2A 3L4SO 4OAQA 4JBIA 1ZSYA 4CM9A 3BHIA 5A06A 1B8VA 5IG2A 1ULSA 4JXKA 3EZYA 4MO2A 1H2HA 1C3VA 4LRSB 3ROKA 4YRBA 2PZKA 4XJSA 1XHLA 1Y9AA 4Y6PA 3OJOA 5B12A 4CR7A 2B83A 4CODB 1WAMA 4CM6A 4FFRA 2P5YA 4PLZA 1Y8QB 3E18A 4R68A 3VPHA 1HT0A 2EW2A 4MVJG 2QIOA 5G4KB 4PLCA 1IYZA 1E5LA 2NSDA 3AJRA 3QWBA 2BH9A 2W8ZA 1IE3A 2O48X 4BO7A 1TEHA 3OEYA 1VSVA 5TT0A 1R0SA 5KNLA 3TDKA 5JAMA 3K31A 2RAFA 2CD9A 3ZNPA 4J16A 2WDZA 3JQ7B 4RF4A 2Q1UA 1A5ZA 2FOIA 2J3JA 5DDIP 2X8LA 5KJ6A 1KC3A 4FCCA 4PG6A 4PIVA 4R1TA 3CXRA 4CM7A 3C1OA 3KYDA 2E6UX 2G17A 3BA1A 4Z0TA 5I8ZA 2EWMA 5BQFA 2JFGA 4CMEC 4AJEA 3OMLA 2GO1A 3P7MA 1Q1NA 3FN4A 2E82A 1NVGA 1GV1A 1K89A 3VZRA 5GZ6A 3LYLA 3T4XA 1Z7BA 4CLRA 1X1EA 1JWAB 3UICA 1E7QA 2C07A 1I2CA 2FHSA 3ANMA 3JYQA 3IL2A 5H81A 3C85A 3KV3O 4IDBA 4WNIA 4U7WA 3MOGA 5C37A 5JDCC 1JW9B 4TZTA 1M6WA 4EJMA 1U7HA 4Q9NA 5JFOA 3E9NA 4UVGA 4UVEA 4RLSA 5IN5A 3B6ZA 5ENDA 2X0RA 2W90A 3OJ0A 4BNIA 2B4RO 5KTKA 4QXMA 4WPGA 1JKFA 3V8BA 2P4HX 3U5TA 4G65A 3CSDA 2CDCA 3PWKA 4PG5A 5CHEA 3UGKA 4IY1A 4XYEA 1I0ZA 5CP8A 4WCFC 1KS9A 4RCVA 1T26A 1IHXA 3HQ4O 3A4VA 1OI7A 3ZWCA 9LDTA 3JQ8B 1U2GA 2H6EA 1ZO8A 4CPDA 2QRKA 1R0KA 4Q39A 4QO7A 4XCVA 2DBRA 2BGLA 2WJPA 3FWNA 1QYXA 4B7CA 4FFMA 1KEWA 3JQ6A 4MOWA 4PCVA 2V6MA 1YQDA 1ZK0A 5B4VA 3FTPA 4K6FA 5DNAA 1NFFA 1UR5A 3RROA 4PLYA 4LRTB 3SXPA 2AW5A 3G49A 2O2YA 1JAXA 4NFHA 2ZB3A 5ILOA 3PHGA 1TT5A 3VVCA 5L51A 3OH8A 1A27A 1LJ8A 4ZICA 1EQUA 1H0KA 3EMKA 3TZ6A 3PI7A 1DIAA 2VYND 3IOYA 1V8BA 1LLDA 2VNAA 1DIRA 4IBOA 2Y05A 3S2FA 5F21A 4F46A 4L4XA 1KC1A 4XIYA 5KIAA 3K2EA 4PGFA 3E6AA 2Q2VA 1CRWG 1HE5A 1JTVA 3K2BA 4CV0A 3ZU3A 3DMTC 4XKJA 1T4BA 2EJVA 3JQGA 5THKA 3I9KA 3AU9A 4CQMA 4E4YA 4E2ZA 3FSRA 1H6BA 3LC1O 4FS3A 4JIGA 4LW8A 4JN6B 1I33A 5KVQA 2OO5A 5A5EA 4Y98A 4YPOA 5KVCA 1AN9A 3W4JA 4NFYA 5TC4A 3GEGA 4CQLA 1FJHA 4J2HA 5H83A 1HYGA 2QHXA 3FPLA 3ZU2A 1QLHA 5DN9A 3GG2A 1QORA 4U6QA 3KEQA 3BHJA 3Q2IA 5JYEA 5G0UA 1RKXA 1EMDA 5BNTA 1PL6A 2EGGA 1DO8A 1N7GA 4M54A 3F46A 2VNSA 2H1SA 4PVDA 5EL0A 1UDBA 5ER9A 4EJ0A 4JK3A 4IPTA 4DC1A 5CFZA 2VYVD 2X1HA 4PRLA 3B1FA 2NVWA 1R37A 1NFQA 3I1JA 4LCJA 3VH4A 3ZN2A 1UXGA 4BNXA 2HMVA 3JQBC 5AOVA 4TZKA 2O7SA 3AY6A 5ILGA 5JS6A 3DR3A 3ROMA 3FD8A 2D1YA 3KYDB 4NBTA 1MC5A 1WDKA 4CM9D 5IN4A 1ZEMA 3HJAA 4D41A 4J43A 4BNJA 4PLVA 4GPD1 5A1TA 1ENOA 4O1MA 1NAHA 1DJQA 3TZQA 3GHYA 4TRRA 4J1SA 5DULA 3Q9UA 5A04A 1PIWA 4IGEA 4CR6A 4CMHA 3OP4A 3V2HA 2XAAA 4KMSA 4A10A 7ADHA 1U8XX 4BQRA 2HK7A 2DBVO 2BKAA 1KOLA 1TI7A 2DPGA 1HDZA 1J0XO 3GRPA 1PQUA 5G2OA 5BT9A 5G4LA 4CMJA 4AJIA 3ITKA 4J1QA 3TZHA 4F6CA 4M87A 5A3VA 1HL3A 3UFXA 1NTOA 3E9QA 5FI3A 3QVTA 2J5RA 1M67A 4MPDA 2Q2QA 3OJEA 3RJ9A 3WGTA 1K6JA 4P4NA 1J5PA 2O23A 4WCFB 3RVDA 2VHZA 1OAAA 2YW9A 2PFGA 5EESA 1EFKA 4GKBA 2AEJA 4B8ZA 4GVLA 4RZIA 3HFGA 2QYSA 3JD0A 1HETA 3GR6A 1GCOA 4MP6A 1K3TA 3QRWA 3PK0A 5CAEA 3BMQB 1NFRA 3WJAA 4JBHA 1QYDA 4XB2A 3BMCA 5JY6A 3WBFA 4ROSA 3CTMA 4BVAA 1NQAO 4WASA 4P8RA 1T2EA 3BTSA 3GVPA 3H3FA 1I01A 1MG5A 1DFHA 2HDHA 5KWEA 4K9DA 1E5QA 5EINA 1TT5B 1BXKA 2IYOA 3CE6A 4TROA 4PZEA 2PH3A 3PZRA 5IDYA 5GY7A 2FP4A 3SJ7A 2HSDA 1Y5RA 2X4GA 2ZYGA 1QXSA 4E6PA 5HA5A 5KJEA 1VPDA 3WQQA 3VDQA 3DEYX 1CJCA 1I3NA 2I99A 2UYYA 3ABIA 1ISJA 1I32A 2TMDA 1GUYA 4E5YA 3D5TA 4IDAA 1XU7A 4PLHA 3LLVA 1HSOA 2BF7A 4XQEA 1KERA 4J0EA 2AE2A 3U49A 3WYCA 1D1TA 1MC4A 3G79A 4MP3A 4BGIA 4GAEA 1NPYA 1U1IA 1SEPA 3WGOA 4D3DA 3RUEA 4BO2A 3AOGA 5KVSA 1DLIA 4GL4A 5TSDA 3PZBA 3KO8A 2RH8A 4IIUA 4HNHA 3CEAA 1V6AA 5C3MA 2P5UA 5I9NA 3CUKA 3RI3A 1PJCA 3D1LA 4UEKA 2O3SA 5JYDA 3L9WA 4CUJA 2FR1A 2OMEA 4W7HA 4K28A 4E5MA 3DFUA 3L0DA 2VZ9A 4U6SA 1PWXA 5AQ1A 1GEGA 3DXFA 3GG9A 1XYGA 2P68A 1GEEA 2H9IA 3QIVA 2Y1CA 5DP1A 2NTJA 1UZNA 4CMGA 3KM0A 3WGZA 2GN8A 4IZIA 3WB9A 1K2WA 4YQYA 4CMCA 5TJ9A 4AJLA 3RC7A 1OC2A 3ETEA 2O7QA 5JPIA 3TWOA 4CQMD 2YV3A 2OOSA 4RVUA 5A4DA 4BNHA 4M1QA 3KOUA 2BELA 1BVRA 1BRMA 1MP0A 3EHEA 3D4OA 3WWZA 3OBBA 1EVIA 1HZJA 1NWHA 2O3JA 3LT1A 4JROA 5T64A 4A27A 1F8GA 3H5RA 3QV1A 3WNVA 3G0OA 1R4MA 1E3SA 3D5QA 5IDQA 5JW6A 2HRBA 3DZHA 1O6ZA 2ZYDA 2DM6A 1F06A 4YT4A 1TXGA 3HSKA 2OFPA 3WNQA 4KUGA 4O6VA 1PGNA 3ZGYA 1YBMA 3GN1A 1LSJA 1R4NA 4HWKA 3B1KA 2C82A 4QQRA 5DCYA 4PLFA 3PQEA 3FRJA 3VHRA 2C0CA 5L4SA 4JCOA 3ZW9A 3AFMA 3WJ7A 4A5OA 1CDOA 1VJTA 4MVJE 3WSWA 4D42A 3HN2A 2GN4A 1R6DA 2V7PA 1F0YA 3I4CA 4KWHA 4R5MA 3KSZO 1YXMA 4XJTA 1U7TA 1JKIA 2DU8A 2VHXA 4MVJI 4FC7A 1UH5A 1SOVA 4II3A 1PJLA 1QYCA 4RPGA 1ZJYA 1VKOA 2X9GA 3KSUA 1GR0A 3OA0A 2EKLA 4BB5A 4NIMA 5KKCA 1Y81A 3NDRA 1GQQA 1VJ1A 2H5LA 4YJFB 2ZB7A 3BMCB 4YRDA 4UVDA 3E48A 3HB5X 1VL8A 2WYUA 3KZVA 3EAGA 1ZVMA 4ZD6A 1ISHA 3F47A 1WMAA 4CUZA 5JO9A 1KYQA 4ITUA 4ZRNA 2Q46A 2RCYA 3IP1A 4UUPA 1EVZA 5COAA 4WLNA 4YTEA 5HRUA 3OQ1A 2RIRA 2QX7A 4K26A 3BAZA 3A06A 3RFVA 1E92A 5ADHA 4D43A 3WIDA 1GUFA 1HEUA 1ZSNA 4TRJA 3GA0A 4RL6A 3V5NA 1ZMTA 1ID1A 3WICA 1BGVA 3ONDA 4OQYA 4DA9A 5JMWA 4RF5A 5ES3A 3GK3A 1LDYA 1J4AA 1Q0QA 3AM3A 3NT2A 2BFPA 4PRKA 2H63A 4DPKA 1UP7A 5AXAA 3RKUA 4NQZA 3OIFA 4UEJA 3GVIA 3TN7A 2HKIA 1F8FA 1MGOA 1Q7GA 4FFOA 5C5IA 3GEMA 4W4TA 1LXCA 2WEKA 3D4NA 5IDXA 1AGNA 1B0AA 1PS8A 2JCVA 3F3SA 1SO8A 2PD4A 3MWEB 4YT5A 2DUUA 4BO6A 3EY4A 3N7UA 1ZMOA 3BXXA 1MA0A 3BTVA 3F5QA 4E31A 5I7VA 4IINA 4N5MA 3WMXA 1ZH8A 4ZJUA 2Z5LA 2AQHA 3HUDA 3I9OA 4J0FA 4AJ4A 4X54A 2PKQO 4XR9A 2GYYA 3C8MA 1A72A 3P5SA 3GC6A 1CQJA 3RU9A 4QTZA 5KOIA 5A02A 1XQ6A 3OECA 4WJZA 1B15A 5KJ1A 3BIOA 4L4SA 3ZI0A 3ICCA 1YJ8A 3LZ6A 3S2GA 1NWCA 1NR1A 1PR9A 4BS9A 2Z1MA 2OXIA 4D0SA 3KLPX 1UDAA 4E3ZA 2NTNA 4K1LA 4GBJA 3WGIA 1Z73A 4J90A 4J6FA 1OMOA 3HN7A 1BDMA 2CY0A 1TT7A 4Y8VA 1E7YA 3S2EA 3VPSA 3ANNA 3IUPA 2G76A 4E5NA 1HDYA 4B3HA 2GASA 2UUPA 5G0VA 2CFCA 3W4KA 3MJVA 2B5VA 3G1UA 3ZZNA 4YT8A 3GNTA 4DVJA 1FDTA 4GVXA 4GLLA 3OIDA 3EDMA 2AQKA 4YJHB 2J5QA 1VL0A 3DQPA 1V0JA 5FFFA 3QVWA 2UAGA 4YBZA 2Y1EA 2YHUA 3VH3A 4BKOA 4J1TA 4DBZA 1VL6A 4O5OA 2WD7A 4NFSA 1GADO 3VTFA 2W2LA 3K9QO 4FFNA 1HDGO 1KVRA 4DLLA 1Q7CA 4N18A 4D3FA 4J3FA 3TOZA 4RV9A 1PSDA 1IOLA 4BMVA 2QRJA 5JE8A 2IEBA 3WX0A 2V65A 3DBRB 4GKVA 5JO0A 5C7LO 2WD8A 4J7CA 2I3GA 1VJ0A 1GCUA 1L7EA 2UUOA 4CM8A 1CYDA 3U4HA 3AWDA 1MG0A 3FNGA 4B3IA 5A9SB 4JLWA 4FGSA 3GAZA 1MXHA 2EIHA 2W98A 4OJNA 4QECA 4LSMA 4BNKA 2EW8A 2YJZA 5ICMA 1ADFA 1S7CA 3CZRA 4NR0A 1U5AA 4UULA 4IZHA 1N1GA 3RD5A 5C7OO 4CMIA 1DDOA 1YS4A 4E2WA 1CEQA 1P74A 2Q49A 3Q9NA 2P91A 3DTYA 2GDZA 1X1TA 3TPCA 3VPFA 8LDHA 2HK9A 4E0BA 4MVJH 3BMNA 1SB9A 2X9VA 3H65A 1QV7A 5GMOA 3VTZA 1D1SA 5TIIA 1HYHA 5CG2A 2X0JA 4TMFA 1ENZA 3C1TA 3BTUA 3ZU4A 1SBYA 3COSA 1YB4A 4AVYA 1C1DB 3SJUA 4WLFA 4BNZA 2PNFA 2X6TA 4RPJA 3W8EA 1PEDA 2I66A 2IZ0A 2AEMA 2GN6A 3K73O 3BYZA 3K92A 1GUZA 2CDBA 3W6UA 1NNUA 4I5GA 5T8KC 1XDWA 1LDEA 1SOWA 4R54A 2GSDA 4RQTA 4FIZA 1X0VA 1W4ZA 5DBIA 1PS9A 1DC6A 4ALMA 1X14A 5IJZA 4NPCA 5COQA 2ZJ1A 4Y9DA 1P1IA 1LC0A 4INAA 2IZ1A 4GWGA 2OBNA 2Q4BA 3IKVA 3QQPA 1E3IA 3FI9A 4NZ9A 2C2XA 3ENNA 1U9JA 2CDAA 1GQ2A 2X5JO 3RASA 4JBGA 4AJ1A 1IL0A 3NAQA 2EKPA 1GPDG 3O38A 4FJ2A 1ONPA 3AUUA 1IULA 2EP5A 5T6BA 3U0BA 1UZMA 1RWBA 2IXAA 4U0KA 4CJXA 3Q1LA 2NM0A 1Y5MA 2Y1DA 2QYTA 3CMCO 1PJ2A 1T2DA 3GPIA 3EVTA 1H9AA 3DBHA 1P1KA 5F1OA 3PHJA 3HDQA 2Y1GA 4FSHA 4TSKA 4M55A 4HP8A 2OP1A 4BGVA 4BNUA 1R12A 1CETA 1RPNA 1YBAA 4I5DA 3V1UA 3DHEA 2AHRA 3LC7O 3AFNA 4FOSA 2X22A 3PYMA 1PGJA 2RBEA 4KOAA 4JP2A 3WFIA 3VAZA 4DLAA 1PWZA 1A71A 2Z95A 4LCEA 2FWMX 1C14A 2GZ3A 3KYCA 2EJWA 1ISMA 2X0NA 4YCAA 1TLTA 2HK8A 2NNLD 2WD7B 2RH4A 4G2NA 4NBUA 3ZWVA 3JYLA 3F1KA 3GGPA 4NBWA 1B26A 2D3TA 1ZKMA 1C0IA 3H6KA 4R41A 4O59O 4WKGA 5IXYA 4E12A 5L4NA 2O4CA 4YAKA 4Y67A 1D3AA 1BTOA 4CL8A 1T25A 2FN7A 4LVUA 5EN4A 3H9GA 3CKYA 3DZBA 3L6OO 4WNCA 5I8WA 4F6LA 1IHYA 1YGYA 2BMAA 4EW6A 4GX1A 3M6IA 4J9VA 4DIBA 3BZUA 2A9FA 5DOZA 1F14A 4AJHA 2HMSA 4CLXA 1B14A 4E2YA 3WQSB 5THQA 4P38A 4ND2A 2ZATA 3PRJA 5DF1A 3PP8A 4AICA 4CMIB 4XQCA 1I36A 2OP0A 3GF4A 4IGFA 3GZ4A 3AUSA 2DTEA 4MIOA 3UXYA 1HDRA 2ZCUA 4LK3A 1P0CA 3TF5A 4C7KA 4OH1A 4HX5A 1SPXA 1PJQA 3ZWOA 4YAEA 1U8FO 2W2LD 5HTOA 4E5PA 4KDFA 2A92A 1KY5A 4IDDA 3ADOA 2CVOA 4DWVA 4KTVE 2C54A 2DLDA 4OOFA 4CM5A 1TVEA 4GGPA 2RHCA 4BL5A 4GMFA 3KHUA 5J23A 5JNLA 1PZEA 1E3JA 4MKZA 3OIGA 1GZ3A 3ULKA 3RBZA 4YJDA 3P2OA 1XELA 1ONNA 2WE8A 1EUDA 2R2GA 3NTQA 1QKIA 3GUYA 3PVZA 4GSKA 3MCVA 2NACA 3JD2A 2DT5A 2E37A 4TKLA 2EHDA 5IXSA 4NMHA 1NQOA 1X0XA 4JP3A 2FR8A 3CZMA 1G0OA 1WZIA 1O94A 4CM4A 5F1KA 3GMSA 3KEOA 3NUGA 4DBVO 2FZEA 4EYEA 2ZQYA 5FI5A 3AU8A 3JTMA 4YQZA 3JQ9A 1GPJA 3PHHA 2ZB4A 4RPKA 3W8FA 3DHYA 1P3DA 4WEQA 2AXQA 2R00A 3CPSA 2Y99A 3AI3A 4KWIA 4WCDA 2FY8A 2NVBA 4UUOA 1YONA 1E6EA 5JY1A 2PZLA 4TKMA 4IDFA 3UKOA 1M76A 1VE9A 1I3LA 1NBOA 4G5HA 4C4OA 2UV8A 1DB3A 4H15A 4BNYA 3I6IA 3WR5A 3K5PA 2GPTA 1A9ZA 3TFOA 3PYXA 4IXWA 4NG5A 1U3VA 2HLPA 4QT0A 4HADA 4JJFA 3VZSA 2AG5A 3H9JA 2QQ5A 3I6QA 1LSUA 2ZTUA 3PGXA 5A03A 2VT3A 2JCYA 3I9JA 5TQVA 3UF0A 1LI4A 3UCXA 2NUAA 1DHRA 4M86A 4AFNA 4EI2A 3EW7A 3QWHA 3GDOA 1DIGA 4E32A 4GQAA 3D3EA 1LLQA 3ICPA 2I3AA 1V35A 2YUTA 3P2YA 3ZHBA 4XYLA 5FEUA 3F1LA 2TMGA 4FN4A 4HFJA 1DSSG 3KB6A 1P9LA 2G5CA 4FPXA 4UVIA 3RJ5A 2EP7A 3DBLA 4MKRA 3AM5A 3L6DA 4J91A 4Z9FA 5COBA 3ZWPA 4GX2A 1LDMA 1NXQA 1SMKA 3OM9A 3DDNA 2XPCA 5L95A 4NNJA 4YT2A 1U4OA 3M1AA 4RPLA 5I7SA 4TVOA 2Q4EA 3GN2A 4J7XA 1OBFO 1P45A 1XKQA 4CLRB 1CERA 1IB6A 1PJTA 2X5OA 3N58A 4OHUA 4DPLA 5JAIA 3I23A 3GVCA 1W0CA 5U9CA 2NU9A 3JCZA 1LTHR 1Y6JA 3MEQA 4ZU3A 1ISFA 1DIHA 1XU9A 4RORA 6LDHA 3ST7A 2ZB8A 3GPDG 1ZUD1 4K6CA 1SNYA 1KEUA 4Q3NA 3IUSA 3DBVO 4LSWA 2SCUA 5LDHA 1WVGA 4AJJA 4R5HA 5DCWA 5JDIA 4RVSA 5TT1A 1OZAA 4PLTA 5DBGA 2NU6A 4IJVA 1Q0HA 4FFLA 2AMFA 3WYBA 4DQUA 2YHIA 4ALJA 4B7XA 4YR9A 2C5AA 3NJ4A 1X7HA 3LQFA 1LRJA 4DC0A 3R6DA 5JMPA 1AHIA 3C7DB 3R3JA 1QSGA 4OL9A 3X2FA 3QW2A 4BUCA 1F12A 1I2BA 1WWKA 2DAPA 1ISIA 3H7AA 3WS7A 2BHLA 1D4FA 3STHA 2XXBA 4EEXA 2VOJA 4KTTE 5I7EA 2VTDA 4FQ8A 2GR9A 1YE3A 1E7SA 3L6EA 5B4UA 9LDBA 4P4GA 4BHTA 5L7YA 3VDRA 1WDMA 4D79A 4DIOA 2YQ5A 3ORFA 1TA4A 3ANLA 3ZWXA 2B0JA 4GMGA 5AXCA 4D44A 3IJRA 1HDOA 4YWJA 5DOVA 3F4BA 1WXDA 2JAHA 4AL4A 3S55A 3ZHXA 4BNLA 4WK6A 4RZHA 4J7UA 5IZCA 3AI2A 1NQ5A 4DGSA 4MP8A 4J4TA 1KVTA 4R1NA 1ENYA 4AG3A 1LEHA 3GEDA 3ZV6A 4NJMA 3GFBA 1PGPA 1KBZA 3GRKA 4ZA2A 3JQGB 2Q3EA 1NX6A 3B70A 2EKQA 3VC7A 4CQMB 2DKNA 3ENKA 4NDNE 3QE3A 3H9EO 3L9XA 1GL3A 3PTZA 1NHGA 4HUJA 3RBXA 1X15A 1RJWA 5CDSA 1YJQA 2JJYA 2RHRA 2P9GA 4UVHA 3A9WA 3HWRA 2VWQA 3FR7A 4CQLB 4F45A 1ULUA 1JVSA 4IQGA 1Z6ZA 1RYEA 3ROQA 1I3MA 4GWKA 4MINA 3TSCA 3JV7A 4PZDA 3GVXA 4R9SA 4I08A 4GX0A 2CNBA 2X7HA 3C7AA 2D2IA 2HMWA 1T1SA 2P9EA 3DAGA 4I1IA 4AJPA 4D7AA 1P33A 2ZK7A 3DAFA 1WW8A 2AA3A 4H3VA 4Q3BA 1E3LA 5K6AA 3I4FA 3ITDA 1SB8A 2C20A 3T7EA 2VHYA 5CG1A 3SVTA 1ZXBA 1N5DA 3AUAA 1H5QA 1YOVA 2IODA 3NDJA 3HNPA 5H82A 2VOEA 4Z9XA 4QSMA 3RKRA 4QUKA 5G0SA 1WLYA 1T2CA 3GNSA 1ADBA 3DBLB 1GU7A 3WLFA 4YAIA 2UVDA 2V6BA 5ENVA 2OZPA 2Y1FA 1Z45A 2BFAA 3E8XA 1E77A 1OC4A 3FPCA 2VWGA 2E49A 2PR2A 2CMDA 4GGOA 2NVUA 2HMUA 3U4IA 1KIFA 4Q3CA 2A4KA 3WTBA 1FDWA 2FR0A 3AY7A 4FB5A 2LDXA 4BO0A 4XQGA 2VHVA 4L75A 3QWAA 5KJFA 2HU2A 3NT5A 5BSGA 4B4OA 5EMHA 3DAPA 1W8DA 4D3SA 3ZV5A 1A7AA 2J3IA 3IKTA 1NVTA 1NHWA 1HTBA 2EGHA 1N92A 2GZ2A 3AK4A 3OFSA 3OJLA 1X13A 5ER6A 2YV1A 1DAPA 2B4QA 3FNEA 4JGBA 3BMOA 1WMBA 3L4BA 4OGWA 4UUMA 1H93A 1ZK1A 3PXXA 4B79A 3WGQA 1JWBB 1QYVA 2PA3A 2Q2WA 3RUCA 1I24A 2VTEA 4N5LA 4YJGA 5MGBA 1LU9A 3U4DA 1UAYA 3A28A 4IS2A 4CV3A 2VWPA 1CIVA 4YYZA 2ZTMA 5HS6A 1GTMA 1XEAA 1LUAA 2EV9A 1Q7BA 3Q6IA 1RM4A 5ICSA 3PHIA 3DZFA 1PS0A 4BNNA 1WNTA 4DQXA 2Q50A 3FTNA 2PH5A 1PJ4A 4GH5A 4B3JA 1HRDA 3JYPA 2HJSA 2NQ8A 3TZCA 3FBTA 5TRTA 2BRUA 1GDHA 4L74A 1Z74A 4ZQBA 2GNAA 3EGOA 1ADCA 2ZIZA 4E13A 1JU9A 1HSZA 4CMKA 1IY8A 1Y8RA 1UAGA 2XXJA 3M1LA 4AJNA 2GRAA 4XA8A 3FWZA 2WWRA 1PL7A 3RC9A 4R51A 1DFIA 2DVMA 4B7UA 1S6YA 2ZCVA 4CLDA 4ZN6A 4CL3A 4WE3A 2YZ7A 4NBRA 5LCXA 2AQIA 3A14A 1WP4A 1N2SA 4II2A 4AJOA 4B4UA 4WOJA 3RWBA 3PIIA 4I5EA 1MXFA 2J5KA 1MV8A 3FNHA 5I7FA 1WZEA 1LDGA 3I5MA 4YA6A 3ZWWA 1QG6A 3RSHA 3INTA 4U8GA 1N8KA 1FXSA 1EBFA 2VN8A 3T4EA 3FCOA 3OHSX 2YFHA 1ZXLA 4GX5A 4BO3A 1ARZA 1U3TA 4DMLA 4ND3A 1H94A 3D3WA 4M49A 1XR3A 2AG8A 4RVGA 1XQ1A 4Z0HO 5L7WA 5JCJA 4NJOA 2G0TA 2ILTA 3EC7A 4S1VA 1LA2A 2FPIA 1WPQA 3UN1A 1VSUA 3JD3A 1BXGA 5DCUA 4YDRA 3PJDA 5FWNA 1K6XA 3WLEA 2BFOA 1YB5A 5F3RA 3PJFA 2G1UA 1YQGA 3NDIA 2OUIA 2VCYA 2D5CA 2ZKLA 4BO4A 1K5HA 1R16A 4IS3A 4AJKA 1U3UA 3KYBA 3V2GA 4YRAA 3UCFA 3KVOA 2GCGA 3KBOA 4UEOA 5KKAA 4MVJM 3ONEA 2PGDA 4FW8A 5B4TA 3MJTA 4WGGA 3H9UA 4Z3KA 4IQ0A 2D0IA 2NVUB 5T57A 4IUYA 4XD2A 3GDGA 1R4MB 3DC2A 4HNGA 1VI2A 1O8CA 3EUWA 1EVYA 4Y6SA 5JCXA 3PLRA 1DC5A 1W73A 3EYWA 1R4NB 4BNWA 1DRVA 1Y8QA 1E0DA 2VRBA 3JQDA 4NI5A 1BDBA 4EZBA 3JYOA 3HDHA 2JFHA 3DHNA 5BSEA 3DOCA 2Y0DA 5G4KA 1GFSA 1V3TA 1GQYA 1KETA 3S1LA 2X58A 4W9NA 8ADHA 3GGGA 4XDZA 1AXEA 1E3WA 4BO8A 3VPGA 3PJGA 4O0LA 3WMWA 4ZGWA 4XGNA 3D7LA 4ZQGA 1ZK4A 2X5KO 3JQ7A 2BD0A 3V1TC 4XEHA 4AJ2A 3ZW8A 4YJGB 4PLWA 3UHAA 4RLHA 3WG9A 2HAEA 1HLPA 2PWZA 4ZQEA 1HLDA 2CVZA 2XOXA 3PJEA 1VC2A 2WMDA 1F17A 3IDSA 4IDCA 5B1YA 4MVJA 2D4AA 3H4VA 4WUVA 4KZPA 1GYPA 5A05A 5TGDA 3PDUA 3DOJA 1ORRA 1XSEA 4W6ZA 4OXYA 3LK7A 1GZ6A 3AW9A 3E9MA 1X7DA 1M2WA 3RCBA 2G82A 1HWYA 4FC6A 3WTCA 2VRCA 3TOXA 4BKPA 4DRYA 3L07A 5FF9A 4J1NA 3INRA 4TRNA 2PKQP 5CDUA 1XCBA 3DZKA 1T24A 5EQFA 1UXHA 2HO5A 4Y6RA 5IFLA 2PLAA 3SX2A 1UP4A 1E1MA 5JXWA 3GUCA 3MJCA 3UVEA 1N1EA 1AE1A 3IAHA 5BSFA 5CPBA 3QLJA 4LMRA 4E30A 2DQ4A 3LDHA 3IC5A 4H7PA 1BSVA 4R3NA 3TNLA 4XR4A 4ZQHA 5AYVA 3SC4A 2BFMA 1ML3A 3WQRA 5AXDA 1B7GO 2DPHA 3K30A 4PZCA 3WGYA 3JQFA 1GD1O 5CDGA 3INGA 1RM5A 4D46A 4GSLA 3I3OA 4BMNA 4FBGA 2P4QA 1DC4A 3GVHA 3JQ8A 4A2CA 3I9MA 3MTGA 2NU8A 4FFPA 1RM0A 2UDPA 1DXYA 4CLHA 2PGLA 2HQ1A 4BKQA 2YQ4A 1CQIA 3SEFA 1DPGA 4I9UA 2O3TA 3PPIA 1U2DA 1KVSA 3RUHA 3DFZA 5JC1A 4L9RA 4LISA 1DLJA 1XWFA 1EUCA 4ALIA 1P31A 3KETA 1K0UA 3NGXA 2HJRA 4Q3DA 1N9GA 1EDZA 5ITVA 1I8TA 3OEWA 4YXFA 2PV7A 1EEHA 3KSDO 1WDLA 4RVHA 3T7CA 5BSHA 4ESOA 1HE3A 1ZJZA 1LLCA 2Y1OA 1YDEA 3C24A 3OETA 3PFWO 4RF3A 1NPTO 3D4PA 1NQTA 4RVDA 3ROPA 3WXBA 2Q1WA 3LSYA 1HDXA 5TNXA 5TJHA 4L4RA 2ZQZA 2PD3A 1B16A 2FPPA 5LDGA 3L77A 3HFSA 1SEVA 4BNTA 2D8AA 3SLKA 3DB2A 4B4VA 4DXHA 3ZHYA 1V3VA 1Y7TA 4IJUA 4WEOA 1JDJA 3ZNQA 4RVFA 4KQXA 5T5QA 2B4TO 2YDXA 4DUPA 1I30A 1RM3A 4ILKA 3QSGA 4E21A 5I9MA 1O0SA 2POQX 2Y0CA 5JCJD 4ALNA 1C0PA 2ZTLA 1FF9A 1NASA 3GOHA 4Z0PA 3U62A 4E33A 5HS4A 3WWYA 1QRRA 4BNFA 3EZLA 5KJCA 4OO3A 5G0WA 3B1JA 4XIJA 4TWRA 2A35A 3TFQA 1QV6A 2C5EA 2P9CA 2JD1A 4BGEA 1DRWA 4YAGA 1E3WB 2I5PO 2HMTA 2NU7A 4DLBA 4KUEA 2VUTA 3FHLA 1ZEJA 2X23A 4CM8B 3CIFA 1A7KA 3GH3A 3KXDA 4NK4A 1MUUA 2EEZA 4ALLA 4XDYA 4BQPA 3HHPA 2CF5A 1JN0A 1OOEA 1HE4A 3PGJA 3W6ZA 2AQ8A 4CMEA 4RPHA 4MVJP 4R69A 1RYDA 3RUDA 1BW9A 4UUNA 4A0SA 1QYWA 1JLLA 5F1PA 3IMFA 4EGFA 3ZHZA 4BV9A 3F4LA 1C0LA 1LNQA 4A26A 4W82A 4J49A 1U5CA 1CF2O 4JNKA 2C29D 2JHGA 3VPXA 1LX6A 2OHXA 3IS3A 4OSOA 5DBFA 3I9LA 1YQXA 5IZ4A 4M8SA 3QVOA 1UDCA 3MJSA 1NYTA 3BMNB 4Z6KA 4ZVVA 3TJRA 5JDCA 1BMDA 3PHLA 3JD1A 4XYMA 1ZIDA 2EF1A 3WGGA 5A9RA 1HDCA 1T4DA 2WE7A 2J6IA 4XYBA 3R0IA 2GLXA 5C7IO 1H9BA 2FRDA 1BXZA 4IM7A 2O3QA 4E5KA 3JSAA 2CVQA 4JJGA 3R1IA 4HV4A 3GY0A 3RQSA 2YFQA 1K6IA 1T2AA 4MVJD 3C7CB 2WTBA 5DP2A 1UXJA 2VWHA 1HXHA 4W7IA 4WCFA 4XX0A 4EUFA 1YL5A 3LU1A 1A4IA 4RF2A 2C2YA 2C7GA 3BHMA 2NQTA 3RAJA 1UP6A 1XGKA 4EBFA 4BGUA 3BMQA 3FBGA 4Q3EA 1L7DA 4CM3A 2VRCD 1SAYA 5KVVA 2O50A 4NK5A 4XGKA 3JD4A 3JQ9C 2IZZA 1YL7A 2R00C 5F5NA 1NAIA 2DTXA 2IDZA 3HDYA 5K0ZA 4LMPA 4RGBA 1N9GB 3SLGA 1IZ0A 3H2SA 1UUFA 1UXIA 3N74A 4C7JA 1U28A 1YL6A 3TL2A 4BO5A 3RUIA 3DL2A 4OXKA 5L45A 3I52A 4RJTA 3LF2A 2Y66A 1H6DA 3H3JA 4CUKA 3WOHA 1P1FA 3DOOA 2C59A 3DBHB 4QO8A 1ZSVA 3AM4A 4R1SA 4D45A 3M2TA 2GZ1A 3H9QA 1SZJG 3DMTA 4Z9YA 4JQCA 3PWSA 4IJKA 4LVCA 1PJ3A 4A7PA 1YKFA 3M2PA 4L76A 5L7TA 1I2ZA 4WLVA 4O63O 5EPOA 4P4LA 5JSFA 2XF8A 1IUKA 1XIVA 4OQZA 3TRIA 1PR3A 4YVFA 5B37A 4L8VA 1EVJA 3Q2KA 2OORA 5BNIA 2W2KA 3ONFA 4QEDA 4EJ6A 3LC2O 2DBQA 4ZQFA 2NWQA 4W99A 3KYCB 1FDSA 3GT0A 4XGIA 4MIYA 3PIDA 2J3HA 2OBYA 2WSBA 1O5IA 4R4JA 2X0IA 2PY6A 4BO1A 1AXGA 1OFGA 1LDBA 4IDGA 4OKIA 1Y9EA 7MDHA 2PK3A 3U4CA 3ON5A 3NX4A 4DIFA 5MDHA 1J6UA 1NPDA 4PVCA 1EFLA 5BNFA 5GZ1A 1EK6A 1N7HA 3JQBA 2W4QA 3VVBA 4KDEA 3EVNA 1KEVA 1EDOA 4LGVA 2PZMA 5DT9A 1E1KA 1VKNA 4CV1A 4IDEA 1D7OA 2BLLA 4UAGA 1VRWA 2E48A 1X7GA 1ZW1A 3C1AA 5CDYA 1BW9B 5A5FA 5JDIC 3JQEA 4CV2A 5U4QA 2ZYAA 2EXXA 1JAYA 3RFXA 5AVOA 1YRLA 1DFGA 2E4AA 2VHWA 4CMAA 3QY9A 4A03A 2QG4A 3U3XA 3ZWNA 3HE3A 3NT4A 1YH3A 1KVQA 1LQTA 3PDJA 1MLDA 4QFCA 5HBRA 1CWUA 3O9ZA 3S2IA 4I8XA 3VZQA 4PLGA 1ADGA 1PQWA 2IYPA 3OICA 4L73A 4J4BA 4RQUA 4EEZA 2D59A 2R6JA 3RBVA 3X2EA 3MJEA 4FGWA 2VZ0A 3UOGA 4R3WA 4D0RA 1A4UA 3C3XA 1P1HA 4RDIA 5JC8A 3LVFO 5T67A 3OSUA 5CEFA 4WLEA 3IQDB 1PZGA 1U3WA 3UUWA 1A9YA 2JL1A 3Q3CA 1YO6A 3W4IA 3WYEA 2FSSA 4CM4B 1PQPA 1R66A 4YJFA 3O8QA 5IZCC 1O95A 5EIOA 3UAGA 3DONA 3TL3A 3OQ6A 4KP7A 1FDUA 2I65A 4FJ0A 5DZSA 1P0FA 3QWFA 4IJWA 4U5QA 4OSPA 2GD1O 4H16A 3GZNA 1V3UA 3DZIA 5CEEA 3OF2A 3RC1A 1ZCJA 1SC6A 2DUWA 1MX3A 2BI8A 4E2XA 1G6KA 3JQAA 5CDTA 4BV8A 2HUNA 3ASUA 3I83A 3G3EA 3MOIA 4IMRA 2C7VA 3HADA 4IIVA 4HFMA 4RO0A 1P77A 2OGUA 1Q0LA 3IP3A 2J8ZA 2YDYA 2Q99A 1QLJA 4OMUA 3LT0A 3WDSA 2Y0EA 3TZKA 1BVUA 4ND4A 2O3RA 4IMPA 4B4WA 1DJNA 1SCUA 1P1JA 5K6AC 4DYDA 3CMMA 1I5RA 4PG4A 4OIMA 1L1FA 1V9LA 4BNMA 2B69A 4BB6A 3GQVA 4GLOA 4OOEA 1ZK3A 3NYWA 2BGKA 5L53A 2W2KB 4BOYA 1T1RA 2JD2A 1PZFA 1YB1A 4XZ3A 2Y68A 5TLSA 4PFJA 5L9AA 5I9LA 2WYVA 2GUGA 4F3YA 5JLAA 1TB4A 1QP8A 3BTOA 4ALKA 3VKUA 2V6GA 3FF4A 4OM8A 3WBBA 2VQ3A 4N54A 1JA9A 4YEDA 3HG7A 2EG9A 3MWDB 2NADA 4BNVA 4XQ9A 1E7WA 1JQBA 2QZZA 3WFJA 1B3RA 4YB8A 1R0LA 5BR7A 1LSOA 5F5LA 1LBEA 3UH1A 3PEFA 4HBGA 3WSVA 2HRZA 4PLPA 2DC1A 1LLUA 3ZDFA 1PL8A 4BNGA 1PTJA 1C1XA 2Y93A 1E6WA 1H6CA 4YACA 3OQBA 2QW8A 2OL4A 2Q1TA 3F5SA 4R1UA 5CEJA 3WGHA 5GZ3A 2CSUA 3RFTA 2I6TA 3G17A 1B3BA 2JCXA 4JJIA 4JX8A 3RU7A 1MFZA 1EUZA 5TF4A 1W6UA 3DZGA 1PGOA 1DOHA 3L4BC 1VM6A 3Q11A 3IIEA 4S3MA 1LQUA 2YHIB 2GN9A 3RUFA 4YJHA 3ZNOA 3H5NA 2V6FA 1GZ4A 1I3KA 3I9NA 1Q2XA 3V2UA 3LLSA 1T2FA 1HZZA 4U0JA 3NGLA 2NTVA 3HB4X 1VLLA 3JYNA 2JKVA 3NV9A 4DQVA 3ZCXA 5HWSA 2YY7A 1BHSA 3QVSA 4HXYA 1E7RA 4G81A 1R15A 3PQFA 2VUUA 3DZJA 4R9RA 4NH4A 4P22A 3ZV3A 1NR7A 4XRGA 3FR8A 1UXKA 3E1KA 4BKUA 4TVBA 3DBRA 3ETDA 2B5WA 3ZV4A 2J3KA 1LRLA 1G1AA 1ENPA 3E5RA 3GAFA 3NRCA 1E6UA 3GNQA 2X9NA 2DFDA 5G0TA 3VH1A 2IRWA 3NKLA 3UW3A 5LC1A 3KLMX 4XRRA 5A9SA 1XG5A 1EZ4A 4ND1A 2AE1A 2JD0A 5IAAA 4URFA 3TQHA 5JAZA 3VOSA 4EUHA 1LC3A 2YV2A 3NTOA 4MIEA 3CINA 3ZNNA 2QRLA 1FK8A 4HFNA 3O8QB 3EK2A 3E03A 1HYEA 3GFGA 1NM5A 1E7MA 5U1PA 1HE2A 3ZWYA 4WLOA 4NJMB 4J2OA 4PG8A 4XYGA 2GF2A 3VKVA 3GZNB 4CM1A 2GERA 1KVUA 3E5MA 5FYDA 3RIHA 2FPGA 2O2SA 2Q1SA 5K9ZA 1FMCA 5IF3A 1U4SA 2JFFA 3AY3A 3IJPA 1IPFA 5L3ZA 3JQAB 1P44A 3KTDA 2X86A 3RUAA 4A73A 2Z1NA 1QMGA 1M6HA 3H8VA 4BMSA 1C1DA 3B20A 3GMDA 3HZZA 5CPFA 1LRKA 1B2LA 4FJ1A 2YYYA 5EERA 1MFPA 4CMBA 4CLOA 4ZRMA 3MTJA 4Z3DA 1DAOA 3ZWMA 1XLTA 3R3SA 4BO9A 4FDAA 1DBVO 3ZU5A 1E1NA 4ZHSA 6ADHA 3DO5A 3RC2A 1ZFNA 1UZLA 2PD6A 3ZH2A 1JKJA 2B35A 2B36A 1Z75A 3A1NA 3PYLA 1YOVB 5L4LA 2CUKA 3GGOA 4PG7A 3P19A 2Q45A 4UREA 3ZWBA 3O26A 4LN1A 2I9PA 3OA2A 3QJ5A 3VH2A 4R16A 2BGMA 3LT2A 4MDHA 2WYWA 4KUHA 4YAJA 1H6AA 4B8WA 3GLQA 1GYQA 2HCTA 2EERA 4MVJF 4KQWA 2ZTVA 2LDBA 3JQAD 2ET6A 4ND5A 2I67A 2QZ9A 4WLUA 3K6JA 3VZPA 3K96A 1DIBA 4N7RA 2D5AA 2PZJA 5L40A 4OYRA 3D0OA 4QX6A 1PGQA 1GYRA 3O4RA 3H5AA 1M66A 2Y67A 3V1YA 5JAQA 2FSVA 4J9UE 1C1XB 3OJFA 1XA0A 2DTDA 3NJ8A 2PKRA 4PN3A 1AUPA 1YBVA 1P1RA 4XB1A 2A94A 3DWFA 3G1TA 4W9NC 3QP9A 2I76A 2GGSA 5TX7A 1PZHA 4RDHA 2PGJA 4BKRA 3BMOB 1H2BA 4DPMA 2NLOA 1D8AA 2JHFA 1UJMA 3W1VA 2DBZA 4FD3A 3PWZA 4WECA 3H2ZA 3F6YA 4GI2A 1FDVA 4EITA 2NV6A 3Q0EA 2DFVA 1GY8A 1E3EA 5TS3A 4DMMA 2VT2A 3DMYA 1ZNQO 5IDWA 3NEPX 3KUXA 3F9IA 3MZ0A 3QWIA
chains in the Genus database with same CATH superfamily
3OQMA 1AK9A 3P9KA 1ZBQA 4F71A 3BWMA 3VPCA 4I5FA 2DUMA 4OI1A 3G85A 3M5DA 3HJTA 5CW1A 4REMA 4EUEA 4B6FA 2V4ZA 5IMSA 4YASA 3M3HA 3EGIA 3R8FA 2WNIA 5LIPA 1QU2A 1Y9JA 2FZWA 2PVCA 5AKHA 3TTTA 4HFRA 3PEYA 2AUNA 2I6SA 3G2OA 1K5PA 1IZ9A 4MWEA 3EAFA 4PBTA 4QPDA 5E9JA 3FYSA 2AEFA 3L6CA 2BL4A 3W8DA 4Y2VA 4BMXA 5K0TA 4LBZA 3IDQA 3F7NA 4AY5A 2FPKA 1LI7A 1Y8RB 1QTRA 3GJ6A 3FHTA 4UBKA 3DEZA 2EEPA 3JS5A 3G0IA 1DOZA 1L4NA 1GPLA 3X1MA 5BPHA 3ADPA 3JQPA 5HJ7A 2VYNA 4M0DA 1I80A 6NULA 2PL5A 5KNDD 3H1GA 1A1SA 4DL9A 3JQFC 2HBZA 1BWSA 1LSSA 3GX1A 4KL8S 4WWHA 1EYZA 4QL3A 3D0KA 3COWA 4MV7A 4B84A 4RLQA 1KEPA 1D6MA 3HNOA 3LT4A 4AXBA 3FNFA 4HAXA 2OB2A 1V1MB 3K8ZA 4DYVA 1RHJA 3D02A 4L6IA 4R01A 4ZO6A 2Y1LA 1BA3A 1JMKC 1UBLS 3C45A 4YXWD 2J6HA 3N5KA 4IQ8A 1WD5A 2ZAMA 1DKUA 2ZM6B 5I8PA 3T9FA 1EP2B 4DWJA 3UIEA 4DTIA 1DRUA 1F4VA 3KWLA 3LFHA 1BD4A 1C1HA 1U2DC 2YIJA 3NKVA 3QA9A 4G5FA 1N57A 4F9TA 1AO3A 1G19A 2BEUA 2H2AA 5AKEA 3UCEA 4B31A 1QVWA 4BLPA 2JGFA 1SBTA 1YDWA 2YR0A 1ESEA 3D3WB 5KCZA 5K8LA 1NYQA 2E21A 1KMMA 2J9RA 4Z1MD 4I9NA 2QLNA 4P4SA 3H6GA 3CH6A 2Z6QA 3H04A 3KB8A 1BXGB 2FMUA 1VYHA 2RGRA 3FGPA 5FOQA 5HILA 2QD4A 5TQ2A 4TQGA 3MUFA 4I55A 3VZBA 1QO0A 1VB3A 3BJRA 2P2SA 3VC2A 1RQLA 2Q9BA 2E4YA 2WJVA 3UB3A 1N1MA 3DO8A 4HKTA 4L27A 1G0NA 3BC1A 1WO8A 2RHDA 2RHMA 2VYVA 1Y1PA 2E89A 2XUDA 3C97A 4FOLA 3RABA 3EG9B 2J9GA 5EP3A 1BE1A 2PTGA 2CF6A 1PJSA 3AF4A 1T29A 3V7NA 1F2DA 1JHYA 3L46A 2WABA 3UNXA 5AOAA 1T8SA 3W2GA 1FYFA 4EHDA 5FNVB 4OAQA 4P3YA 3OF5A 5GM1A 2LD4A 2XMQA 2P2ZA 4WIAA 3ZS8A 1B8VA 5A06A 1ULSA 5HZGA 2B78A 2MYTA 2YY5A 3WNBA 4OYYA 1H2HA 4NC9A 4OFBA 4LRSB 1EWKA 2PH1A 3OJOA 3GBSA 4KR3A 2QAGC 3GLGA 2VSOA 4QASA 3RS3A 4J3NA 1P39A 3H11A 2Q1XA 5BYAA 3WHLA 1G291 4JITA 4MV0A 1WU8A 1QP7A 2P5YA 4PLZA 3VPHA 4PYNA 3EGDB 3PXBA 1WPGA 1HT0A 1P4GA 4IMIB 2EW2A 4WKOA 2QIOA 4DLNA 7GPBA 4PLCA 1IYZA 3SDZA 5AMXA 3WJ2A 3GQBB 2JG3A 3VGJA 2MOKA 1IE3A 1ZNXA 2GLTA 3S2UA 4BO7A 1QS0A 4DLWA 5K0NA 5TT0A 1FFEA 3WVNA 5FWYA 1A98A 1E1CB 3PUWA 5JAMA 1EIZA 2RAFA 3DPUA 4CI9A 2BKUA 4J8PA 3ZVNA 3WBJA 3MGGA 3V97A 2ORWA 3RDPA 3JQ7B 1QPBA 2Q1UA 1QAOA 1SKYE 1YF3A 3A2MA 1G5HA 3EBLA 3P45A 4UU7A 1P5ZB 1VE6A 4ZWNA 3QLTA 3FZNA 3IV9A 1YBHA 3I01A 5E2AA 4GF5A 5J2UB 4CMEC 4IJQA 3E3LA 3LUAA 4M7RA 4TKUB 1EVQA 4JCCA 3RHZA 4ER3A 3ZKWA 5D3KA 3EUFA 4IEIA 3LYLA 1LBTA 4LY3A 2FCAA 4GT1A 5LBIA 3AESA 1IOZA 2C07A 3F3YA 2CL5A 3EXHA 5H81A 3C85A 2FCRA 3U39A 2JC3A 2XYGA 2VLIA 2YWGA 4NP6A 2Y0PA 2FNAA 2ZSHA 3WAGA 3THYA 1QWSA 4B3TB 2RGWA 4MVCA 3E9NA 4UVGA 1I51A 5IN5A 1L4FA 1TYCA 1J9GA 2YVQA 5AW4A 3B6ZA 3JR3A 1NVAA 4JJ6A 5IT5A 2OD9A 1TM2A 1WQ1R 3U3KA 1U65A 3R0QA 4DSUA 3I76A 3ND8A 4RABA 2G4VA 3RYTC 3EXEA 4EMUA 4G65A 3CBGA 4DFDA 2XE6A 2Q0QA 5CHEA 3PHBE 1WB6A 4B48A 1HNWB 2GSWA 4MUKA 3L93A 3O75A 2WAMA 5C8YA 4A15A 1T26A 1IHXA 3L8FA 9LDTA 1OI7A 4FLFA 3RK0A 2E5LB 1RRCA 2X3UA 4ZC8A 1C9MA 2AK3A 1T13A 3E3MA 5IRCD 2DBRA 2BGLA 2WJPA 4G24A 1ZD8A 3ZHOA 4NAVA 1Z35A 2NXJA 3UBMA 4F86A 1XDZA 5B1EA 3O47A 4C0HA 1KEWA 3AL0C 2COEA 1OYWA 2YMPA 1W94A 5ALNA 1GPAA 3DCIA 4PHGA 4B2YA 1UCFA 1JYFA 3F8SA 4QNNA 1YE8A 5G1PA 2BEUB 1JSLA 2Z4TA 3DYIA 3V7WA 4AMYA 1MHTA 2VH5R 1B74A 1AKWA 2HN9A 3LQRA 5DNAA 5AI0A 3DLBA 1M72A 1HPLA 2J9FA 4BDSA 1R8YA 3SXPA 2JJ1A 3L6BA 1DV2A 4LQDA 1JAXA 4D9KA 2VQDA 2ZB3A 4PPNA 3PHGA 3Q3VA 4I7EA 1NUSA 3VVCA 1Z4IA 5C53B 8AT1A 4UDNA 4C76A 2JHCA 3PGA1 1SQFA 3I34X 4ZT7A 1N2IA 2IYQA 2GD0A 2Q0XA 5TQ2B 4I55B 1FRQA 1E2KA 1A4XA 2OGZA 1LLDA 3LG2A 4V0OA 1DIRA 2FDCA 5DYIA 3OX1A 1KQGA 3QPWA 2M6SA 3HJUA 4IHAA 3RGGA 3V32A 1GPH1 3P0FA 1X7WA 1D2NA 1DAHA 1U9CA 2Y6UA 3E6AA 1CRWG 2GJSA 2OSBA 3K2BA 4PZ9A 2CHGA 4TMZA 5CB0A 2CWDA 4F4IA 2P6NA 1YZUA 5KOJA 1U90A 2JPDA 1I9CA 4S35A 5DMHA 4F85A 3AU9A 1OFIA 3DCYA 3CONA 3DPIA 4LW8A 1S4QA 3LC1O 4BEWA 4GXTA 4RENA 3ZD6A 5B7GA 5KVQA 1JBKA 3TIXB 2OO5A 4KLCA 1ZGCA 5I3CA 5HIJA 1O5OA 5TC4A 2FI1A 4I1VA 1ESCA 4CQLA 5H83A 1W4CA 2OZVA 5F7OA 4ROTA 5FWDA 3VNUA 3DEHA 1CUWA 1OKKD 2OM6A 3GG2A 1QORA 4U6QA 5TEWA 3KEQA 3BHJA 5JYEA 4ZEMA 1VPVA 3OCJA 2WUGA 1RPTA 4G1BA 4WOPA 1Y3BE 4KE9A 2CE2X 4BX9A 3UJDA 4Z3OA 3G6KA 3F6RA 2C7BA 1SQ5A 1CUZA 2B6NA 3USES 3L6UA 4RCZA 4MROA 5LZ8A 4F11A 2AEEA 1BU5A 1HT2E 4FU0A 2VJNA 2IYSA 4R2LA 2XGGA 4EJ0A 8OHMA 5FWYB 4DC1A 3NKFA 3CNEA 2YWJA 1LW7A 2Z5GA 3JWGA 1PW7A 1WD7A 1PFVA 3BRSA 3WB1A 3LWBA 2A0FA 3DMGA 3HMKA 4LCJA 4A92A 4DJTA 3PNLA 4ZANA 2DX7A 3KALA 4EO9A 1PEKE 3SI7A 1T5HX 1SOAA 1RWVA 3T1TA 4Y2JA 2C4WA 1FNCA 3AY6A 5JS6A 3SQOA 3TF5A 1OX4B 3ROMA 5JI2E 1K75A 4Q3KA 4NBTA 3RAFC 4DMGA 4ZVOA 1MC5A 3NATA 4M8NE 4WQMA 4CM9D 1D6NA 3R0XA 3D8NA 3VYSB 3NTUA 1U0FA 3WDMA 2VP4A 4C4AA 2UUBB 1CB7A 4F91B 1HEIA 2HW8A 1I7PA 3CTPA 3W5BA 1XMPA 4RWEA 5JJCA 2QL9A 3KQMA 2JGMA 1QKKA 1AZLA 1P2BA 1RC1A 3AESB 3MSCA 4TRRA 1X8LA 5A04A 5LIRA 1JPUA 4CMHA 5AJXA 3V2HA 1JIIA 2XAAA 3NWPA 3UK7A 1HOTA 1Z5UA 3F4KA 2PJZA 3KDPA 3IA7A 4KG7A 5CVEA 1J39A 5DLEA 2Y71A 3THYB 2DBVO 4HAVA 4WFKA 3VXKA 3X1XA 4NG4A 4A3SA 5JROA 4ZXFA 5DXJA 5JS7A 1TI7A 5BR1A 1HDZA 2WPNA 3BL5A 2QE7D 4A2QA 3GRPA 1ABEA 3IPYA 4Y1GA 5BT9A 3FAKA 5EEHA 3KE9A 1T9GR 3TZHA 3AO0B 5A3VA 3NIBA 3O93A 2DJIA 3E9QA 3OT4A 4U39A 5FI3A 4YMUA 5AK3A 3RVMA 3KCNA 1M67A 4M1KA 3MVEA 3I2HA 2BTQB 3BWCA 2DQSA 3KKNA 4QDUA 4G0YA 4W7SA 1K6JA 3KOYA 1BRTA 5C8YB 1J5PA 2O23A 2FEAA 2SHKA 1KJ9A 1O6GA 4EVSA 2FTKE 1SCQA 4RH1A 1YVRA 3WWCA 4UBNA 3HFGA 3Q2OA 1HQKA 1XZAA 3JD0A 2O8FA 3QVUA 2CLHB 4YROA 3LCCA 3RS4A 3NOVA 5LZ9A 4C6HA 1MGPA 4BMPB 2HSZA 2ZVJA 2PSEA 3PK0A 1DAKA 3BMQB 3AR4A 1NFRA 4ILEA 3WWEA 4TLDA 2HCFA 4JA0A 1XT6A 5GONF 2HHLA 1RAIA 2C2OA 4ROSA 4ZZ3A 2Q6TA 4BVAA 4YRFA 3GLUA 4W5NA 1SZDA 3CM0A 3U2QA 4ZGBA 4REOA 1I01A 1MG5A 1FVFA 1ZHFA 2F1HA 1RAEA 4RY8A 4WK0B 4F93B 5LLTA 5KU1A 3COVA 2YJGA 1BXKA 1I5OA 1U3CA 4MUBA 4X92A 4RMJA 1G64A 4AK9A 1E5VA 4PZEA 1J1UA 2PH3A 2HIHA 3ED5A 3HKDB 3I2YX 3JQRA 4I2NA 2Q6VA 2FP4A 5E4JA 1DIOB 1Y5RA 1GAJA 1TJ4A 2NT4A 2X4GA 4NOJA 4E6PA 4O2BA 1EFVA 1ZW6A 3WNCA 1I3NA 3ABIA 3G2MA 3PQ2A 1I32A 3QBEA 4EJFA 4ERXA 3URKA 1ZOOA 2N46A 4H9GA 4IHJA 1GUYA 3LK6A 5C8XA 3U48A 2HK6A 2A3RA 2Q62A 4WV3A 1XNJA 3AQ4A 1L5FA 1XU7A 1P3Y1 2Q2OA 2QUBA 2YS6A 3E5NA 3DHVA 4XQEA 5JYCA 2H2WA 2B7BA 1D6JA 3F6CA 4J0EA 4YMLA 3WYCA 1KAHA 1MC4A 3HBJA 1NLUA 1PJRA 4CF5A 1R9JA 2RBKA 1Z2PX 4UOQA 4KVAA 2Y1XA 1SEPA 4YECA 4ZCRA 3GLTA 3IUNA 4G4SP 4IXMA 1TFRA 1WL8A 3AOGA 2F3RA 1X3SA 5TQ0A 5K6TA 4HLCA 3LUFA 4TLLB 1NA5A 2VSQA 2ZDHA 4QU8A 3GIDA 3UZUA 3KQWA 1TZJA 1NDUA 2AF4C 3CEAA 3DL7A 2P5UA 4OEHA 3KC2A 3O7MA 3BIJA 1OE0A 4UEKA 5A3SA 5JYDA 1NJGA 3VX4A 4AMGA 4KHZA 3F9RA 4W7HA 3EFEA 4K28A 4E5MA 2VZ9A 4C5BA 2QDKA 2JFVA 2BPOA 3T5BA 1V8PA 2IYVA 1PWEA 1Y63A 4CTJA 1USIA 1AX9A 3MT9A 4RTMA 3ONVA 2P68A 1OFUX 3JASB 3MCAA 4Z53A 3QIVA 2F43B 4LDAA 1R00A 4DBLC 2NTJA 3VAAA 1IATA 4MZDA 4WHMA 1J7JA 1U6IA 4IZIA 3WGZA 5LUAA 1Z6YA 5K0JA 3RNOA 3RC7A 3D7RA 3ETEA 4WNAB 5F52A 2JLWA 5DSZA 3RSLA 1RAHA 4CQMD 3EGXA 5A4DA 1JJFA 2HREA 3KOUA 2BELA 2C8KA 2GZDA 5C1DA 2P0YA 3OX4A 3QPVA 1FYWA 2BMWA 2GAFA 3NASA 5CT9A 5ICCA 2WWTA 1HZJA 1XU4A 2HJGA 4Y0AA 3L7OA 2WKWA 3PD0A 5T64A 1TK9A 3WV4A 2YBEA 2AOXA 3QV1A 4X97A 3LDFA 3G0OA 3ZD9A 1D5WA 1FU8A 1NE2A 2E1RA 1E3SA 1NL3A 4RMIA 4EAQA 4K8OA 5IDQA 3SDSA 2HRBA 3KE8A 4L5IA 1O6ZA 4MUNA 2DM6A 3RTCA 1SXJA 3WRVA 3X43A 3ZR4B 4WT7A 2EKZA 2R6CA 1VQ1A 3UWPA 1ZD9A 5AJYA 1KMQA 1KSJA 1KZ4A 3H4IA 4HDKA 1VA4A 3CUSA 5LXTA 5EZYF 1R4NA 3NOXA 3QEAZ 4DT1A 2Q0HA 5LQNA 4XVCA 2WJ6A 2C82A 4QQRA 1NXXA 2AGVA 1TJYA 2G71A 1HTWA 3FRJA 4TS4A 4DV7B 4XJXA 3CF2A 1RE1A 3N05A 2J1LA 4MYUA 3WJ7A 1DG9A 2CXTA 4LKRA 2ID4A 4V1CI 5CBPA 1Z4MA 3EZXA 3NDPA 3VU8A 2JFQA 4I5IA 4D42A 2CMGA 4XWKA 3HN2A 2A9JA 2GN4A 4IO1A 1ZJ4A 4D4MA 4EKDA 3HXQA 1L7RA 2QPLA 3VYTB 1SC1A 2JDID 2IYLD 4YJKA 1EXWA 1U7TA 3C5CA 4ARZA 1KI2A 4KR0A 2XOKD 3THOA 1NSYA 4MRMB 1SBHA 5DISB 5JAZA 2VJMA 4IIXA 1NZDA 2EKLA 5KKCA 1RKQA 4B74A 2FN9A 3IELA 1T9HA 2AMYA 3MUOA 1FDIA 1GQQA 3UPDA 4KXMA 5BQPA 3QF4A 4OFZA 5DM4A 2OQRA 1MC1A 3E48A 2N1MA 2CJWB 3ESCA 4D9GA 2EP8A 4Q1EA 3U19A 2BBTA 1PT8A 3ABSB 1ZVMA 4ZD6A 3X1JA 1ISHA 1VA5A 4CUZA 1TLLA 1X2EA 3K0EA 5E0OA 4AM8A 3BH0A 5DYTA 4BJHB 3B3AA 2VK8A 4JHXA 2Q46A 2V4UA 2QTTA 3IP1A 4UM7A 5HKLA 5LBUA 1W75A 3GFTA 4C0SA 5A62A 1GP2A 3E1SA 4WLNA 4ZZ2A 2QX7A 2C92A 4YRRA 1FVOA 1E6KA 3BAZA 2PZBA 3A06A 5TVGA 4KR6A 1LGYA 3ENWA 3GUZA 4JB2A 4NONA 2ODAA 2YNMD 3K8YA 1JQJC 4GP6A 3ROTA 4AN4A 1EFVB 2DPYA 1ZSNA 4TRJA 5GINE 1FOEB 3V5NA 1JA0A 3WICA 1T2VA 4Y6OA 3SJAA 4RF5A 2FH5B 3O2SB 4XWWA 3PR1A 1LDYA 1IM8A 1J4AA 4RD4A 4C5AA 3AB7A 1XL0A 4MQEA 2BFPA 4XCXA 4EG4A 1KEKA 3BA6A 4MUHA 5K0LA 4PYMA 2HBQA 1CR2A 3RKUA 3LKZA 3WBKA 4M9RA 2XB9A 2HKIA 4WVFA 1F8FA 3NHMA 4KYTA 1JKMA 4PWYA 4V3CA 5LOVA 3DV2A 4I0WB 1HI9A 1LXCA 4RK4A 5IDXA 1YHZA 4BVEA 4B3RB 1P9OA 5GONB 1QIIA 4DZTA 1UEIA 3MWEB 4BO6A 3AGPA 2VDUE 3EY4A 4NZMA 1VOTA 3BSFA 2ODWA 3BXXA 2ZZNA 4LYGA 4E31A 5I7VA 4IINA 1R9GA 1M1YE 3FLMA 4N5MA 2N47A 4EB3A 4WDQA 1ZH8A 4AF7A 2AQHA 1TUBA 3GI1A 4DR2B 1JEOA 1N6NA 2NXNA 5FA8A 3RVJA 3G7SA 2PKQO 2VPYA 3CG0A 1A72A 4GW3A 4DAOA 5HW0A 4EY5A 4JI0B 3H2GA 1G5IA 4JYBA 5IHPA 2E4VA 2C2HA 2BGNA 2QTHA 4G26A 5KJ1A 1YU9A 3NHJA 4GPBA 4L4SA 3H9CA 1DG1G 3A25A 1NWCA 4E7OA 4GE3A 4B2IA 1ZUNA 1ZN8A 2Z1MA 1LV7A 5JCOA 4ARBA 3HH8A 4R8RA 4RFLA 2FSVC 1CCWA 4D0SA 4ZZIA 1PK8A 1UDAA 3B8EA 4HZIA 3EGXB 4Q9LA 1K63A 1ZXXA 2QLLA 4QBFA 4ZC1A 4J6FA 4FR2A 5DNDA 1OMOA 1FSGA 2R4QA 2CY0A 3AEKB 2J5BA 2AJCA 1ZONA 3HN7A 1CNMA 4HVAA 4Y8VA 4IH4A 1NJ6A 3KEMA 1A9XA 5JVDA 2DGDA 2EZUA 5BWCA 4G84A 2UUPA 2GFQA 5G0VA 1YA8A 2CFCA 2L18A 1JECA 4EHAA 2QY9A 1MX9A 2XNDD 2J5XA 3FTDA 3ZZNA 4N48A 2J33A 2WF6A 3WLKX 2HPAA 3AUKA 4EUNA 4LY9A 1DJLA 3B13B 4KV9A 5FTKA 3M8KA 3RODA 2OCKA 4DG8A 4UTPA 1GTJ1 3OIDA 3DQPA 1PRYA 1VL0A 2ZIWB 4L3WA 1ZGHA 3A9TA 3U4QB 3LV8A 4DT1B 4M1EA 4YS6A 3SICE 3L0BA 4YBZA 1VBNA 4N8SA 3VH3A 5HZMA 4J1TA 4UNSA 2ZAGA 2WIAA 5B1IA 2JI8A 4NFSA 3IBYA 4AZ3B 1J07A 2XMBA 3VTFA 2W2LA 5CBPB 3K9QO 3LFUA 2GEUA 4FFNA 1KVRA 4DLLA 1CRZA 2M2IA 3LQ4A 1U7UA 2EKBA 3H4TA 1RJGA 1ZI8A 2ZRHA 1PSDA 4YRSA 4V1CA 1IEQA 4BMVA 2PRKA 4Q03A 4DV4B 1R50A 3WX0A 4ON9A 4ARZB 2WD8A 3FNRA 2I3GA 721PA 5CFQA 3MD9A 1L7EA 2B8TA 3GFOA 1QQ5A 4FNMA 3WKBA 4CM8A 5AW8A 1CYDA 3M3DA 3U4HA 4BP1A 4B3IA 3X0DA 3AR6A 2VR1A 2J85A 2JH9A 3EQ8A 3GAZA 4OJMX 1I0IA 2CHVA 1TGVA 1SHLA 4D4GA 3OE7A 3ETLA 2Z2YA 3FWHA 1YAHA 4KO8A 2QT0A 4NR0A 1XP8A 1RQ2A 1RQ7A 1ACMA 2M1XA 1N1GA 2Y4NA 1N0HA 3EH2A 3P0HA 2IU4A 1WXQA 4NMLA 2IELA 3DTVB 1U81A 3L0PA 5K4AA 5JJLA 4NVRA 1OH6A 3QTTA 4AXXA 3HXOA 4HPXB 4W9RA 3W7BA 3BFJA 3TLBA 1UMDA 3DE2X 3DTYA 9ATCA 2GDZA 1X1TA 3K09A 5B6IA 1FFXA 5KI6A 1EEXB 4UDYX 2C4HA 1N6KA 1TPZA 3R0ZA 3S5JA 1SB9A 1QX3A 3BDVA 3N2IA 3L7CA 3PFKA 3VHXA 1AMOA 1KH3A 3HBMA 1GITA 1SVWA 3V6MA 5TIIA 1R1DA 3ZDQA 2X0JA 1T4CA 1ENZA 2FWPA 3WK9A 3BORA 4LJRA 1GPUA 2C5LA 4FFSA 3CCBA 5FYQA 1JPNA 1RZRA 4UU0A 3OE4A 2M98A 5JZVA 1C1DB 1IJFA 1IB0A 3DQZA 5FLEX 1THZA 1L4EA 3DMFA 3DZCA 1KIAA 1UINA 2VJCA 1LS1A 3DM9B 2ERCA 2LNDA 3MNFA 4AMUA 5BPFA 5HFJA 3RK4A 5FL7D 3W6UA 4FMBB 4II7A 2AI3A 4I5GA 5D3QA 3D8UA 4RHCA 2GSDA 3WQHA 4FIZA 1X0VA 1VIAA 4NBLA 4R2IA 4MRPA 5DBIA 5KEIA 1DC6A 2F64A 1JKJB 2OLJA 4WTOA 4D80A 1CJSA 2P2CA 4YMGA 5IJZA 5K45A 3G2KA 2HSWA 2V7GA 5F4BA 3PPWA 4Y9DA 5COQA 3ZIDA 2ZRBA 1LC0A 1THGA 4INAA 4GWGA 3QQPA 1O77A 1E3IA 2ATEA 4DMKA 2D1QA 1XJWA 4K2AA 3PQ8A 2LVBA 4QJIA 4UTOA 3BXFA 3FMOB 3BD9A 2C2XA 1TUBB 3ENNA 1ZIXA 4BJ1A 5IBCA 1XYYA 2CDAA 4IYRA 1GKYA 1GQ2A 4C08A 1R0BA 4JBGA 1YIAA 2EKPA 4BWVA 1WXXA 2IGBA 3DVAB 3OIUA 1EFCA 3HA2A 4ZVQA 5DHQA 2QBYB 4YCCA 2ZEJA 3AUUA 4HDRA 3U0BA 1WLSA 3GLKA 3VSDA 4CJXA 2IXAA 3EPRA 2FSPA 2IHVA 2NM0A 2V7WA 4HTFA 4A82A 4HDMA 3W5SA 1ZUNB 1G3MA 4UTRA 4P84A 4POOA 3LXUX 4TUYF 3QXGA 2C2MA 1UDXA 2HBRA 2LCQA 2OCBA 3DW3X 4DM3A 4K3VA 5FBQB 1H9AA 4C0LA 1JRLA 1XVTA 1GKIA 1VYTA 3EQ7A 3PHJA 3HDQA 2Y1GA 2GCIA 1AUXA 4F3RA 1T5LA 3ZY2A 4M55A 3MYRA 4BNUA 5JVDB 4ZI5A 1R12A 1RPNA 1JPVA 2IOFA 5JADA 3LC7O 3AFNA 4FOSA 1NXTA 2IHYA 2BGUA 2FQYA 3BFXA 1X7ZA 3BWEA 3HPRA 4WAUA 1QVRA 2RBEA 2G67A 4CN9A 1N4DA 1NGSA 1PWZA 1ABFA 1LF5A 3NM5A 4BIMA 4Y6LA 2VPPA 2CXHA 1C14A 2WU1A 4P7FA 5D1NA 2GZ3A 3KYCA 4QYIB 3DR5A 5SZKB 4BP9A 2X0NA 1G21E 1YR7A 2HK8A 2YWXA 4C04A 1TM7E 4G0UA 4NE2A 3P8ZA 1TVKB 2G4LA 2JJ8A 2B21A 1P19A 1T1GA 2ETVA 1RJEA 3BL6A 4NBWA 1Y6GA 3NCTA 1W1WA 3U7QA 3QUSA 5EQTA 4IXDA 1T5SA 4R41A 4WKGA 4AUKA 4Q34A 4E11A 5IXYA 5JTTA 1KZ1A 4E12A 5K0EA 4RTLA 5K6RA 1KOJA 2D00A 4X64B 4S2UA 3FWPA 4N5HX 1L5MA 2XUPA 5EHNA 4CU5A 2ODQA 3K3PA 1YI8A 1Q21A 1VG9B 3LHKA 5DO9A 4V38A 3KOWA 3U17A 4PNPA 4G9GA 3CKYA 5I8WA 1I6MA 4F6LA 3UHFA 3P32A 1FU7A 2TYSB 1K8XB 4NEHB 2XB2A 2A9FA 1F14A 2P2YA 1KKLA 4XWOA 4CLXA 5JTUA 3GP8A 4ZOAA 3PEUA 3CGGA 3WQSB 5GPBA 1EIWA 4P38A 2YMMA 2N0SA 2ZATA 1TX4B 5BMVB 1TZCA 3L7AA 4XQCA 4D74A 2TRSB 3GF4A 2IUUA 4IGFA 3GZ4A 4AMBA 4DCCA 3UTCA 2Q5HA 3AUSA 1UMDB 1P0CA 1SQGA 4C7KA 3LRPA 3STYA 4OH1A 1D09A 2HEGA 3PQ3A 1FFXB 2QTBA 2I2BA 1PJQA 3K0HA 4H17A 4MGYR 4O2LA 4BRZA 3H6HA 3A1SA 3R6TA 4P82A 2JCBA 5IK2A 4Q19A 2ADFA 1T4CB 4OOFA 2H9YA 3REQA 4CM5A 4YRMA 1MOSA 3FDXA 5FHQA 4FKBA 3HYTA 1RRMA 4ZO9A 4BC1A 4PSVA 5J23A 1OBOA 5CLIA 1KA9H 2IVZA 1E3JA 5F9MA 3GO4A 3DT8A 4MKZA 3RREA 1E79D 4E5UA 3KD2A 3AF2A 5CB4A 2EFEB 4EFNA 2C9ZA 3DLTA 4PO9A 5FWXA 4Z4GA 2FMXA 3GUYA 1E2UA 2QVYX 1Y98A 3HJCA 1AF7A 3PVZA 2ZWAA 4Z51A 2DT5A 4HHEA 4N40A 4K6HA 3ZX4A 2OQIA 3UWKA 4NMHA 4DY4A 1HE1C 1VBFA 2R751 4EH1A 2P5TB 4V0SA 2FR8A 1KHHA 2AWOA 1RI2A 3AJDA 3LKVA 3DMPA 4XASA 1YR2A 4DMRA 3NO4A 4CM4A 4HDCA 5F1KA 4AQ7A 2QTZA 5I3ZA 1NLFA 4MYDA 1PV4A 4AZ0B 4JMLA 1J06A 3AU8A 3T4PA 1ZRSA 1RKVA 3HJNA 2F3PA 4MV6A 3W8FA 1P3DA 3KZOA 3PNOA 2F4VB 2AXQA 2IZ6A 3IT1A 4IGIA 1WUHS 1OHHA 4KW7A 4X00A 4WCDA 2PFSA 2FY8A 3QE4A 3RRMA 3K1YA 3OY2A 3T34A 3B3FA 4DCTA 1E6EA 5JY1A 7REQA 2AR9A 4X1IB 3FGNA 2G9QA 4YRPA 4CVNA 2Z6VA 3O82A 1PD1A 2KE5A 1NBOA 5DGDA 1CF9A 5FOTA 5FBRB 4HTFB 4EAAA 4HDNA 4S24A 4ER5A 2X8WA 2YJ3A 4RIIA 4H15A 2VK2A 5ES4B 4B45A 5KTNA 3I6IA 3SMVA 1M0TA 3O9MA 3BHNA 1YQEA 3O4JA 1ABBA 4KBGA 3TFOA 4BMZA 1U3VA 4AIRA 1XTJA 1OFUA 4HADA 2QQ5A 3B48A 5EPUA 4C5CA 1LSUA 1RBZA 4C6SA 5AUNB 1JR3E 1O9GA 1SVKA 2II6A 3I9JA 3P0RA 5TQVA 2WILA 2XD4A 3QYPA 2RFLA 3BILA 1P8AA 1LI4A 3IUYA 4LWPA 5LQKA 2JGDB 5I47A 4G23A 4K81B 4M86A 1DKNA 1QQBA 2Q7DA 5FUBA 4BFLA 1X7ZB 3NZEA 1XDDA 2GS9A 1R0CA 1K3UB 3ZHBA 1ZM3A 2I3AA 2YUTA 3Q6NA 4CKBA 2IJGX 1XALA 1M6EX 4ASUA 2WJZB 4Q24A 1P7VA 4EX6A 4IZOA 4HFJA 2O8EB 2EX4A 3KB6A 2GVNA 1XZBA 4TS3A 4FPXA 2R8PA 1XQ9A 3ZQ4A 4MKRA 2FSUA 2MT9A 3KOMA 1IEVA 4YCSA 1RDFA 5AWFC 5JIBA 2P75A 4MV8A 4Z9FA 3U6KA 2LPMA 2SBTA 4MRVA 2OZLB 3ZWPA 1ORDA 4DARA 1OH5A 1LDMA 1RZUA 3RVLA 4RKWA 4OXXA 1E62A 4HX2A 2XPCA 2Q1YA 4YFYA 3TSZA 3T06B 3U7QB 3UV3A 1L8XA 3G0CA 3GN2A 4J7XA 4V3BA 4KPFC 1YQWA 1EAMA 4V0RA 4DG9A 1P45A 1ZD2P 3C5EA 1CERA 2P41A 2ODEA 3A6GA 3FPJA 3ND5A 4NMXB 4TUYB 3IJEB 3QLUC 1XZ8A 4J7AA 2ZBVA 4FT4A 5E38A 3LCJA 1G21A 3QG5A 5ITSA 5U9CA 1J90A 2X77A 5JZ9A 3JCZA 4PYJA 4LXYA 3CZQA 4FXPA 3MEQA 3PKZA 1ISFA 3IP9A 1PV2A 3HCWA 1Y5IA 4JLKA 4RORA 4ZU3A 1GTVA 1GKUB 3NTVA 3WRWA 1H4TA 5JPCA 3LQYA 1F7VA 4BFWA 1WM1A 3FUCA 1SXQA 1L5HA 3QV2A 4QU5A 5LDHA 2V97A 4V2IA 5CGQB 1Z0FA 1SA0A 4QQFA 3KG2A 4NCAA 1KYIA 3JVEA 4J94A 4X20B 4CIBA 5I48A 1Q0HA 1CNEA 3DMRA 4A8JC 1CDEA 1KYWA 1G7CA 4ZXPA 4WK2B 4B7XA 2TECE 2PSSA 4Z54A 1CY8A 3CLSD 4DC0A 4PANA 1SK9A 4QVKA 4RU1A 2MU1A 3MPUA 2Z2ZA 4L8WB 4HCJA 1AHIA 1J2YA 3V8QA 2G3YA 3REQB 3X2FA 1JU3A 5I6DA 2RK3A 4M0UA 2Z98A 3AZQA 3WL8A 3D59A 1H8EA 1JDNA 4DA7A 2LIVA 3FZYA 4PSAA 4YK7A 1NSTA 2C9CA 2XXBA 4AY3A 4P3PA 2VTDA 1NU6A 3NYIA 4AX4A 2R6AA 1E7SA 4QULA 4LF7B 2PX3A 2JIZD 3A6JA 4MPTA 3TOVA 1XTKA 3S7ZA 2HU7A 1PBTA 3G0GA 4PAGA 4D79A 5JMOA 2C7PA 2XE8A 2AC2A 2OGWA 2WIFA 2HYIC 1TA4A 1Z2DA 2FF7A 3ANLA 3G2NA 5FQOA 3EFBA 3ZWXA 2EFJA 3SC2A 1XK6A 1BQEA 4GMGA 3T7KA 2UXDB 1WR8A 2BMVA 3H05A 2WJJA 5DOVA 4CCAA 4LOHA 3ZLVA 1WXDA 4OK5A 2JAHA 4AL4A 4DC9A 4BNLA 3N70A 5A3RA 1F9AA 1HQCA 1LNSA 1NQ5A 4J4TA 1KVTA 2PZ8A 3K9BA 4R1NA 4C2AA 4RXUA 2BGTA 3ZV6A 2YS7A 1VKZA 3B6MA 3O2JA 5E9AA 2CE7A 2B1IA 4JEMA 1WY7A 4AWAA 1AA9A 3TCKA 3JQGB 4EGSA 2GH1A 3TTYA 1EDEA 1NX6A 1T4MA 3TLMA 3VV3A 5LA6F 2JZCA 2IITA 4YQFA 2CT8A 4NDNE 1FS4A 2W83A 3TMKA 3PTZA 7REQB 5LQRA 1NHGA 4KBYA 3C3KA 3C6QA 2P9GA 3GBVA 3CLHA 4FI3F 2ISQA 2COUA 2VWQA 2XUZA 1S01A 1ULUA 1JVSA 3OZTA 4HDNB 1P7YA 4JP8A 4F45A 4G0WA 3S44A 4CHGA 2O2CA 2HJHA 5HEKA 3W5CA 5KBYA 4PZDA 4I08A 2ORIA 5JNTA 2HI0A 3ZTWA 1A5TA 2HMWA 5JNWA 1GN8A 1JQLB 3JRWA 1V48A 2PRZA 2P9EA 4QREA 1KQPA 2DQYA 5BW8A 2P9FA 2PVPA 2ZRFA 4KYIB 4XI9A 4LV5B 2F62A 2C2KA 3I4FA 1DUIA 1K8RA 1SB8A 2WBLC 5TS2A 2OV3A 3RYHB 4EKIA 1U7PA 5ADUS 3OX2A 4G5SA 5H82A 1FMJA 3HNPA 2VOEA 4QUKA 3KQLA 5D6OA 3F3KA 2ZIXA 1G3RA 1X1CA 1ACJA 3GUUA 5IAOA 3WLFA 5DULA 2WKPA 2FVXA 4YAIA 4QEZA 2UVDA 4EHHA 1P4HA 3QLVC 2Y1FA 1Z45A 3I64A 1E77A 3I53A 4L0MA 1CE8B 4DWOA 4PN7A 2VWGA 4IG9A 2X9LA 4L50A 1CDZA 2BFDB 1JALA 4W1PA 2PO5A 4FI3C 5JNVA 5J4HA 5J1SB 3U4IA 1D9ZA 3GJQA 4LJYA 4R3UC 3WTBA 2FR0A 4FB5A 1IVNA 3GCWA 3PITA 1WULS 1UJ5A 2E7ZA 1VMAA 3LA6A 3F78A 4L7VA 4DNPA 2HU2A 6ABPA 4J0HA 4TKZA 2RJOA 3DL0A 5LQDA 3IKTA 2PX6A 2O0JA 5HF5A 2WIDA 4IUDS 2FSGA 1HTBA 2BSAA 5AJHA 1KDYA 2EGHA 2IXDA 2VDOB 4KLZA 2P5SA 5LR6A 2XY4A 1GTSA 1T6YA 3QXHA 1Z5WA 3DF9A 3R8CA 3OHPA 5IAEA 1TTTA 1L5HB 3D2BA 1MRSA 1R0YA 4KN5A 1RSZA 4C7MA 3BDAA 4AKHA 1CW2B 2YV1A 4YO7A 1D6SA 1W88B 2CHEA 5KREA 3FNEA 2GPAA 3BMOA 4BB0A 2CUNA 3LP8A 5A4MS 1H93A 2JJ2A 5TMPA 3L02A 1QHHA 1QYVA 2PA3A 1XOIA 2Q2WA 2IKQA 1I24A 1XVVA 1BDIA 1TU3A 2ALJA 1RZVA 1LPMA 2GKGA 2EZ4A 3FM9A 3GRRA 4EJSC 2VPZA 1A9RA 4F72A 1WCIB 1UAYA 3OZXA 5HG0A 2OV4A 2XZLA 2D06A 4AWBA 4FT2A 1UBGA 1AUQA 1F4LA 4ME6A 5LNK1 1XROA 3ZGNA 1UJ4A 1LUAA 2G06A 2EV9A 4DIKA 5A1JA 1JZSA 1O08A 1S8AA 2JLXA 4ZCQA 5CAEB 3DZFA 1PS0A 3KJXA 4JLBA 4LZNA 2Q50A 4N0MA 4BNNA 4DQXA 4BE7B 4FILA 1WG8A 2VNIA 3JTEA 4DG5A 3CVVA 3EUAA 1EKXA 4IFEA 5KAPA 3T8YA 4IYJA 3M89A 3AHGA 3CLTD 5KNCH 5MF6A 4Q1CA 3R5SA 5TRTA 1GDHA 4IF6A 4G4GA 2NP7A 1Z74A 5AJUA 2C4TA 4RC9A 1BJKA 1CUHA 4FIDA 4PAOA 2GF9A 2ZIZA 3AERA 3SC2B 3WV5A 4V0NA 4CMKA 2XXJA 3W2HA 1UAGA 3CZCA 1XJQA 4YCJA 2GRAA 1GGJA 2WAAA 4OUDA 3SIXA 3A1FA 1A9QA 1PL7A 2BLNA 2WWRA 4OA5A 4AT1A 1DQRA 2GEJA 4UBMA 1EM6A 2EOAA 1T0PA 1RQRA 3NHBA 2YZ7A 3EMDA 2ZSFA 3I5AA 3TW4A 4HVCA 5JD3A 2AQIA 3BF7A 1JLKA 2QJRA 3Q12A 1K06A 4RKQA 1N2SA 4H2DA 1U63A 3GJ5A 2P6RA 4WOJA 3RWBA 4ZEVA 1YVUA 3ZWDA 1KP9A 2V7UA 3OZBA 4ZCPA 5LWHA 1MXFA 2Q21A 4JODA 4RK6A 1QG2A 4MS4A 2YFYA 4NS4A 1SD5A 3HYSA 1M33A 2XVZA 3SVLA 4FZ5A 4C7OA 2PBLA 1DE0A 1LDGA 1WS6A 2HSEA 1DCKA 2VYQA 4UOZA 1F7UA 1UKAA 1QG6A 2OBXA 4LDZA 2ECKA 3TKAA 1ZAYA 3INTA 2OCIA 1EBFA 2I9KA 2O1EA 3FLBA 4PE5B 1YK1A 3OLZA 2VN8A 3RADC 2FK7A 4EHFA 5JU6A 3HA5A 3DOIA 2DWCA 2YZGA 3LYUA 3OHSX 3PA8A 1M0EA 4QGHA 4BO3A 5BWMA 1XZEA 2Q3MA 3IR5A 3QPCA 4ND3A 3VKGA 2OYSA 2POCA 1AKYA 1XR3A 2P1RA 4RVGA 4Z0HO 1GNVA 4ITVA 1P1CA 5KSOA 3ZJUA 1XTBA 3EC7A 1VL2A 1FQOA 3A6KA 3I04A 1MH9A 5ESXA 3OEHA 1VSUA 3MSXA 1RR6A 3AFGA 5DCUA 4D25A 2G7ZA 3PJDA 1CY2A 1W29A 4NZNA 3WLEA 2IIQA 1I2DA 1WHTA 3AH8A 1GNSA 2OZEA 1K08A 4GSYA 2P9BA 4KXWA 3E15A 4RSMA 1FNDA 2V7QD 2CJPA 2IUTA 2W6JA 3B6EA 4FYJA 4M53A 2VCYA 4X6YA 1FQJA 2K5UA 3IAEA 4EDHA 1I7SB 2ZKLA 1X1RA 1AUVA 3GL9A 3LJKA 1ZH6A 1YQUA 4IS3A 2E5WA 3DWEX 5CJJA 3RW9A 4E5VA 1ZC3A 2C4UA 1V5WA 1H2RS 3A2LA 3AV3A 4YRAA 1EWTA 5LA6B 2JBAB 2ZUSA 1PJ8A 1YDHA 4MVJM 3T99A 4R81A 3LL7A 1Q17A 5TB5A 4WGGA 4RA9B 1SUDA 4RSHA 3WRXA 4AB1A 1GT91 5C4MA