3OP7A

Crystal structure of a plp-dependent aminotransferase (zp_03625122.1) from streptococcus suis 89-1591 at 1.70 a resolution
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
372
structure length
371
Chain Sequence
GMKLPRFGVEEWLNVHENSAIYDIAGVSISSLTLEELFALSGTNPEDFYKKLQGTKLNYGWIEGSPAFKKSVSQLYTGVKPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIEEENGWLPDLEKLRQLIRPTTKMICINNANNPTGAVMDRTYLEELVEIASEVGAYILSDEVYRSFSELDVPSIIEVYDKGIAVNSLSTYSLPGIRIGWVAANHQVTDILRDYRDYTMICAGVFDDLVAQLALAHYQEILERNRHILEENLAILDQWIEEEPLVSYIRPAVVSTSFVKIAVDMPMEDFCLQLLQEHGVLLVPGNRFERDGYVRLGFACEQETLIKGLEKLSQFLRRFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminotransferase class I and II
publication title Crystal structure of a PLP-dependent aminotransferase (ZP_03625122.1) from Streptococcus suis 89-1591 at 1.70 A resolution
rcsb
source organism Streptococcus suis 89/1591
molecule tags Transferase
total genus 137
structure length 371
sequence length 372
ec nomenclature
pdb deposition date 2010-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3op7A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3op7A01
3WLXA 1I43A 5FT4A 4ITXA 1TOIA 2YCNA 2C44A 3GJUA 4OCAA 4B98A 3KGXA 3DXWA 3AATA 1BJOB 3EZSA 3NYSA 2BIEA 3DZZA 5DB5A 3QN6A 1BS0A 4MKKA 1JS6A 2JJEA 1OXPA 3VK4A 1QISA 5EIGA 4AO4A 2HUUA 3JTXA 1LKCA 4JF1A 3MKJA 3F0HA 1I48A 1ARTA 2YKYA 1W7NA 1GD9A 2JGTA 3QBOA 3PDBA 1YIZA 2VMZA 4E77A 2W8VA 1PMMA 1J04A 1AHYA 5I92A 1G4XA 3NDNA 2OQXA 2BI3A 1ASMA 2ORDA 4CXQA 1P3WA 2ZY2A 4OT8A 4GE4A 4WB0A 1GBNA 4IYOA 3EZ1A 1V2FA 3QHXA 2QA3A 4ITGA 2AATA 1AY5A 3E2FA 4FL0A 3FSLA 3H7FA 4ADEA 3EI5A 3K28A 2C0RA 3LVMA 4XJOA 1S06A 4LC3A 1BW0A 2ZJGA 3RQ1A 3DXVA 1M0QA 4AO9A 1SFFA 1UU2A 1ZODA 2DR1A 4E3RA 1B9IA 3UAKA 2VMTA 2D7ZA 4IXZA 1ELUA 3PAAA 2BKWA 2YKUA 1WYVA 2O7CA 2DKBA 2R5CA 3ISLA 3HL2A 2CY8A 2HZPA 1ASDA 3KE3A 4W5KA 2CFBA 2VMWA 4JEYA 2TPLA 5EAVA 2HOXA 1XI9A 2CSTA 1X28A 2VGVA 4ISYA 4WLJA 3DRDA 5DX5A 2CJDA 3E2ZB 4K2MA 1EJIA 4A0HA 4TMRA 3D6KA 2QMAA 3MADA 4H51A 2Z9WA 2ZC0A 3CQ6A 2BI1A 1YOOA 1AIBA 1KMJA 4W1VA 5G09A 4A6RA 4M2JA 1CZEA 1YNUA 3B8XA 2E7IA 3EIBA 3JW9A 5EFSA 2OKKA 2Z9UA 4PIWA 1O69A 2WKAA 1YJZA 1AKBA 1AJRA 2BHXA 4WXFA 3N0LA 4E3QA 5E3KA 1CQ7A 3WKRA 3E6GA 2W7LA 2O0RA 3W1IA 2EZ2A 4LNLA 4MQPA 4Q75A 4MSOA 4F5FA 3OKSA 4AZKA 1IAYA 3ZRRA 3DYDA 4F5LA 5EUDA 2VGWA 3NUBA 2W7IA 4W91A 3IHJA 3W1HA 1YJSA 4CBRA 1AJSB 4B9BA 1E5FA 2YCPA 2YRIA 3GZCA 3WGBA 3MAFB 4GDYA 5E4ZA 3HBXA 1IVRA 3FRKA 2Z61A 4WYCA 4A72A 7AATA 1ASBA 1Z7DA 2AY3A 2JJGA 3LY1A 4WYAA 3BWOA 1MGVA 4CXRA 2CB1A 4AH3A 1OXOA 4OMAA 3EI7A 5M46A 2DGMA 1C7GA 1PMOA 1MDZA 1ASNA 2FNUA 1IX8A 1DFOA 3HDOA 2FQ6A 3TQXA 1O4SA 1S08A 1MDXA 1MLZA 1BJ4A 2GMUA 1ASFA 3DODA 5HDMA 1X29A 3EIAA 3LVLB 4J8LA 4ADBA 5C6UA 2ZY5A 2EH6A 2VIAA 4GE9A 4GEBA 3ASBA 4L0OA 2WK8A 3B1DA 4XJLA 2YCTA 1UU0A 2GMSA 4LW2A 1MAPA 1VP4A 2VMSA 2GSAA 1AHGA 4A00A 3ZRQA 4WLHA 4U1TA 3FZ8A 1CL2A 1S09A 2DGKA 3RI6A 2V0YA 1EG5A 1W7MA 1WYUA 2VGSA 4UHMA 1J32A 3E2ZA 4Y0HA 1AMAA 1MAQA 2EO5A 2W7KA 2EZ1A 1AHXA 2R5EA 4CVQA 8AATA 2R0TA 2OGEA 4LNMA 5IWQA 1QGNA 2W8WA 2AY1A 2E7JA 1U08A 2ZSLA 3FD0A 4RIZA 4EMYA 4F5HA 1OHVA 2BIAA 5G4IA 1AHEA 3LV2A 2JISA 4RJ0A 4RKCA 3USFA 1KL1A 2Z20A 1FC4A 1OATA 3G0TA 1CQ6A 3BCBA 3ZZJA 1C9CA 3IF2A 2AY7A 2CTZA 3TFUA 2Z1YA 2DKJA 4OTLA 1RVYA 2CH1A 5HHYA 2VMQA 3NX3A 4OBUA 4ZSYA 4PFFA 3ZZKA 1C7OA 1IAXA 3K7YA 1UU1A 1TOGA 3PA9A 4XQ2A 4BA4A 1C7NA 1RV3A 1ZC9A 3PPLA 5EAAA 2XBNA 1PFFA 1C4KA 4JEVA 5G4JA 4F4EA 3FZ6A 3A9YA 2OATA 3GWPA 2AY2A 3PD6A 2ZP7A 1AKCA 3P6KA 4Q6RA 4AZJA 3BWNC 5F9SA 3QPGA 4WYFA 3VK2A 3L44A 5DJ1A 3NU7A 1G7XA 1QJ3A 3G7QA 3HVYA 4RJYA 2W7DA 1GC3A 2VGZA 4JE5A 3FDDA 4A6TA 3FTBA 4XJPA 3UWCA 1WYTA 4LW4A 4Y0IA 1M7YA 3NYTA 3WY7A 3PJ0A 5BJ3A 3AEOA 2HORA 2FNIA 5FT6A 3FDBA 2QB3A 3FCRA 4HVKA 2ZYJA 4XAUA 3HLMA 4ZASA 3W1JA 5EQCA 3CQ5A 1CL1A 4IX8A 1M32A 2JJFA 1BJNA 4EFFA 1I29A 1BQAA 3AEPA 3LVJA 5G2QA 2Z1ZA 2HP2A 2W7EA 3FFHA 1LC8A 2HUFA 3RBFA 4BA5A 3AENB 3N5MA 3WGCA 3FKDA 4W8IA 1VJOA 1SZSA 1GC0A 2QLRA 4A0FA 3NU8A 4U2HA 1TPLA 2EGYA 4IW7A 3VOMA 1V2EA 2C81A 1YIYA 1O62A 2FN6A 4WYEA 1MLYA 3ATHA 4UOYA 3I4JA 2E7UA 2W7JA 4Y0DA 2HUIA 2AY6A 3LG0A 3DU4A 1QIRA 2E54A 4KYOA 4NOGA 3WCNA 1BJOA 3WX9A 3OP7A 1O61A 3NYUA 2AY5A 4M2MA 1N31A 3AEJC 1ASCA 3FZ7A 4F5JA 1LS3A 4ZSWA 3NRAA 1G7WA 3F6TA 4ATPA 2W7FA 3E9KA 1C0NA 1ASGA 3ELEA 2RFVA 3FFRA 1YAAA 1DGDA 2BIGA 4IXOA 3COGA 4GRXA 4XK1A 3F9TA 4A0RA 3CAIA 2BI2A 3VK3A 2Z9VA 3FQ8A 4IXSA 4EU1A 2VI9A 3BWNA 1H0CA 2QBTA 4ZM4A 2EPJA 2JG2A 2W8JA 1JG8A 2VGUA 4F5IA 1G4VA 1FG7A 1JF9A 3I16A 1GEWA 1IX7A 2XH1A 3B1EA 3JZLA 5M49A 1N2TA 3R4TA 1BT4A 3PDBB 1D7VA 2GB3A 2VMVA 2YHKA 1CJ0A 1DGEA 3EI6A 5FT8A 4ZDPA 1ARHA 2NMPA 4FFCA 3JU7A 5E5IA 4EB5A 3MBBA 1QITA 5M4BA 1X0MA 5F8VA 4WB0B 2AY4A 4IYOB 4DGTA 1DTYA 1S0AA 1GC4A 5AX8A 1DJ9A 1ARSA 1BKGA 1M6SA 3PDXA 3B46A 1EQBA 1ELQA 1SVVA 2YRRA 3GZDC 4MY5A 2BI5A 1D7RA 3RBLA 1CS1A 3GSBA 4ZLVA 3HMUA 3L8AA 4DQ6A 3BB8A 1DKAA 2WK7A 4Q76A 4ADCA 4TV7A 3I5TA 3UE8A 1SZUA 2OKJA 3QI6A 3AENA 2R5CB 3FVSA 4DBCA 1AMQA 1B9HA 3AOWA 2VMNA 4R2NA 4MQQA 1SF2A 1AICA 4WP0A 1AX4A 1LW4A 3AEJA 3QM2A 2D66A 4J5UA 4JEXA 4WYGA 2VIBA 2R2NA 1AAMA 3WCOA 2Z67A 3HQTA 2D61A 2GQNA 1GEXA 2ZSMA 3LWSA 4RM1A 3A8UX 4QGRA 1WKHA 4TN4A 3BN1A 4UQVA 3FQ7A 1S07A 2DGLA 2VI8A 1LC7A 1E5EA 3ASAA 3DR7A 3JWAA 4R5ZA 1WSTA 1X2AA 1Y4IA 3BCXA 4PVFA 2QB2A 4P3MA 3FQAA 2W7HA 2YKXA 1AY4A 5FT5A 2YKVA 1IBJA 1OHWA 1W23A 1YJYA 3AELA 3FVUA 2VMPA 3E2YA 3KKIA 1AJSA 1AAWA 1AHFA 3BCAA 2VMUA 1TOEA 4KAMA 5HXXA 1ECXA 1RVUA 1KKPA 2AEVA 2W8TA 3DR4A 4MKJA 3Q8NA 5JAYA 2ZY3A 3N75A 2WK9A 2VMYA 3MAFA 2Z9XA 3A9ZA 3NTJA 4BHDA 4Q31A 4PFNA 2G6WA 1GDEA 1AY8A 1B5OA 1M0NA 3EI8A 1D7UA 3TATA 3TFTA 2OGAA 4ZDLA 3MEBA 4O6ZA 1MDOA 1ASEA 2HOZA 2BWPA 1BJWA 3LVKA 1ASLA 3T32A 2DOUA 3BV0A 1T3IA 4ZDOA 1ARIA 1JS3A 1TASA 4OBVA 2VLHA 3VAXA 1V72A 2D7YA 1KL2A 4GSAA 4M2KA 4OC9A 2F8JA 9AATA 2PO3A 4ZAHA 3RCHB 5G0AA 3WZFA 3GZDA 1TOKA 4ATQA 3WKSA 3DC1A 4EB7A 2YOBA 2W8UA 4WBTA 4R8DA 1SZKA 1KKJA 3AOVA 1ORDA 1B8GA 4AOAA 1M4NA 2BWNA 2VMXA 2W7GA 3FVXA 3B1CA 3GBXA 1GCKA 2VMRA 5D5SA 4I8AA 1I41A 1KMKA 1SPAA 5BJ4A 1DJUA 2BWOA 4CBSA 1UKJA 3MC6C 3GETA 5DJ9A 5J8QA 1WKGA 3EUCA 5EUEA 4ZWVA 1ZOBA 3R9AA 3AEMC 1M0OA 4MGRA 3ACZA 1XEYA 1AMRA 2FM1A 3VP6A 4JF0A 1WYUB 1AIAA 3E77A 1H1CA 1QJ5A 2FYFA 4ZWMA 3CQ4A 3ECDA 3EI9A 1N8PA 2VLFA 1W3UA 3QGUA 3PGYA 2W7MA 3JWBA 2BYJA 4R5FA 1VEFA 1IX6A 2CH2A 1FG3A 2HP1A 3P1TA 4HF8A 2ZY4A 3GR9A 4W1WA 1AMSA 2V1PA 2VYCA 4OYTA 3H14A 4E1OA 4MQRA 2BI9A 2AY9A 2D65A 3HT4A 2ZUKA 2D5YA 5TF5A 4XJMA 2VGTA 2VMOA 4A6UA 4RITA 2C7TA 5EIGB 1ASAA 3G8MA 1AKAA 5M4DA 4GE7A 4K2BA 3ZRPA 4JEWA 3TCMA 1D2FA 1GEYA 4F5MA 5LH9A 2CANA 3ELPA 3A9XA 1V2DA 1LC5A 1M0PA 4IY7A 4LNJA 4UHNA 5D95A 3A2BA 1W7LA 4WYDA 5G2PA 5K8BA 2AY8A 3M5UA 1ARGA 4RAEA 3PD6B 1CQ8A 3CBFA 3BC8A 2PB0A 1B4XA 1BQDA 4F5KA 4UHOA 4ZM3A 3RCHA 2BYLA 2X8UA 4N0WA 1PG8A 4ADDA 4W1XA 2CJHA 1TATA 2CJGA 4P7YA 3AV7A 1Z3ZA 1LK9A 3BS8A 4JEZA 1OHYA 1WYTB 3MC6A 4N0BA 5LHAA 3NUIA 1TOJA 3RUYA 4A0GA 4F5GA 1WYVB 4WXGA 4BMKA 4JE5D 1QZ9A 3NNKA 2X3LA 3AEMA 3K40A 4WD2A 1IJIA 1B5PA 1GC2A 2JJHA 4KXKA 2X5FA 2PB2A 4K2IA 3PIUA 1CZCA 2O1BA 1TARA 3II0A 1RV4A 2AEUA 4WXBA 3KGWA 2D63A 2D64A 1LW5A 3MAUA 2Q7WA 4RLGA 1D7SA 5EUNA 1DJEA 2HOYA 2CINA 2X5DA 1IUGA 4XEWA 4BQ0A 4RKDA
chains in the Genus database with same CATH superfamily
3WLXA 1I43A 5FT4A 4ITXA 1TOIA 2YCNA 2C44A 3GJUA 4OCAA 4B98A 3KGXA 3DXWA 3AATA 1BJOB 3EZSA 3NYSA 2BIEA 3DZZA 5DB5A 3QN6A 1BS0A 4MKKA 3H9XA 1JS6A 2JJEA 1OXPA 3VK4A 1QISA 5EIGA 4AO4A 2HUUA 3JTXA 5KTBA 1LKCA 4JF1A 3MKJA 3F0HA 1I48A 1ARTA 2YKYA 3N4SA 1W7NA 1GD9A 2JGTA 3QBOA 3PDBA 1YIZA 2VMZA 4E77A 2W8VA 1PMMA 1J04A 1AHYA 5I92A 1G4XA 3NDNA 2OQXA 2BI3A 1ASMA 2ORDA 4CXQA 1P3WA 2ZY2A 4OT8A 4GE4A 4WB0A 1GBNA 4IYOA 3EZ1A 1V2FA 3QHXA 2QA3A 4ITGA 2AATA 1AY5A 3E2FA 4FL0A 3FSLA 3H7FA 4ADEA 3EI5A 3K28A 2C0RA 3LVMA 4XJOA 1S06A 4LC3A 1BW0A 2ZJGA 3RQ1A 3DXVA 1M0QA 4AO9A 1SFFA 1UU2A 1ZODA 2DR1A 4E3RA 1B9IA 3UAKA 2VMTA 2D7ZA 4IXZA 1ELUA 3PAAA 2BKWA 2YKUA 1WYVA 2O7CA 2DKBA 2R5CA 3ISLA 3HL2A 2CY8A 2HZPA 1ASDA 3KE3A 4W5KA 2CFBA 2VMWA 4JEYA 2TPLA 5EAVA 2HOXA 1XI9A 2CSTA 1X28A 2VGVA 4ISYA 4WLJA 3DRDA 5DX5A 2CJDA 3E2ZB 4K2MA 1EJIA 4A0HA 4TMRA 3D6KA 2QMAA 3MADA 4H51A 2Z9WA 2ZC0A 3CQ6A 2BI1A 1YOOA 1AIBA 1KMJA 4W1VA 5G09A 4A6RA 2FKIA 4M2JA 1CZEA 1YNUA 3B8XA 2E7IA 3EIBA 3JW9A 5EFSA 2OKKA 2Z9UA 4PIWA 1O69A 2WKAA 1YJZA 1AKBA 1AJRA 2BHXA 4WXFA 3N0LA 4E3QA 5E3KA 1CQ7A 3WKRA 3E6GA 2W7LA 2O0RA 3W1IA 2EZ2A 4LNLA 4MQPA 4Q75A 4MSOA 4F5FA 3OKSA 4AZKA 1IAYA 3ZRRA 3DYDA 4F5LA 5EUDA 2VGWA 3NUBA 2W7IA 4W91A 3IHJA 3W1HA 1YJSA 4CBRA 1AJSB 4B9BA 2WB6A 1E5FA 2YCPA 2YRIA 3GZCA 3WGBA 3MAFB 4GDYA 5E4ZA 3HBXA 1IVRA 3FRKA 2Z61A 4WYCA 4A72A 7AATA 1ASBA 1Z7DA 2AY3A 2JJGA 3LY1A 4WYAA 3BWOA 1MGVA 4CXRA 2CB1A 4AH3A 1OXOA 4OMAA 3EI7A 5M46A 2EYQA 2DGMA 1C7GA 1PMOA 1MDZA 1ASNA 2FNUA 1IX8A 1DFOA 3HDOA 2FQ6A 3TQXA 1O4SA 1S08A 1MDXA 1MLZA 1BJ4A 2GMUA 1ASFA 3DODA 5HDMA 1X29A 3EIAA 3LVLB 4J8LA 4ADBA 5C6UA 2ZY5A 2EH6A 2VIAA 4GE9A 4GEBA 3ASBA 4L0OA 2WK8A 3B1DA 4XJLA 2YCTA 1UU0A 2GMSA 4LW2A 1MAPA 1VP4A 2VMSA 2GSAA 1AHGA 4A00A 3ZRQA 4WLHA 4U1TA 3FZ8A 1CL2A 1S09A 2DGKA 3RI6A 2V0YA 1EG5A 1W7MA 1WYUA 2VGSA 4UHMA 1J32A 3E2ZA 4Y0HA 1AMAA 1MAQA 2EO5A 2W7KA 2EZ1A 1AHXA 2R5EA 4CVQA 8AATA 2R0TA 2OGEA 4LNMA 5IWQA 1QGNA 2W8WA 2AY1A 2E7JA 1U08A 2ZSLA 3FD0A 4RIZA 4EMYA 4F5HA 1OHVA 2BIAA 5G4IA 1AHEA 3LV2A 2JISA 4RJ0A 4RKCA 3USFA 1KL1A 2Z20A 1FC4A 1OATA 4H63Q 3G0TA 1CQ6A 3BCBA 3ZZJA 1C9CA 3IF2A 2AY7A 2CTZA 3TFUA 2Z1YA 2DKJA 4OTLA 1RVYA 2CH1A 5HHYA 2VMQA 3NX3A 4OBUA 4ZSYA 4PFFA 3ZZKA 1C7OA 1IAXA 3K7YA 1UU1A 1TOGA 3PA9A 4XQ2A 4BA4A 1C7NA 1RV3A 3N4XA 1ZC9A 3PPLA 5EAAA 2KFPA 2XBNA 1PFFA 1C4KA 4JEVA 5G4JA 4F4EA 3FZ6A 3A9YA 2OATA 3GWPA 2AY2A 3PD6A 2ZP7A 1AKCA 3P6KA 4Q6RA 4AZJA 3BWNC 5F9SA 3QPGA 4WYFA 3VK2A 3L44A 5DJ1A 3NU7A 1G7XA 1QJ3A 3G7QA 3HVYA 4RJYA 2W7DA 1GC3A 2VGZA 2QSRA 4JE5A 3FDDA 4A6TA 3FTBA 4XJPA 3UWCA 1WYTA 4LW4A 4Y0IA 1M7YA 3NYTA 3WY7A 3PJ0A 5BJ3A 3AEOA 2HORA 2FNIA 5FT6A 3FDBA 2QB3A 3FCRA 4HVKA 2ZYJA 4XAUA 3HLMA 4ZASA 3W1JA 5EQCA 3CQ5A 1CL1A 1KAFA 4IX8A 1M32A 2JJFA 1BJNA 4EFFA 1I29A 1BQAA 3AEPA 3LVJA 5G2QA 2Z1ZA 2HP2A 2W7EA 3FFHA 1LC8A 2HUFA 3RBFA 4BA5A 3AENB 3N5MA 3WGCA 3FKDA 4W8IA 1VJOA 1SZSA 1GC0A 2QLRA 4A0FA 3NU8A 4U2HA 1TPLA 2EGYA 4IW7A 3VOMA 1V2EA 2C81A 1YIYA 1O62A 2FN6A 4WYEA 1MLYA 3ATHA 4UOYA 3I4JA 2E7UA 2W7JA 4Y0DA 2HUIA 2AY6A 3LG0A 3DU4A 1QIRA 2E54A 4KYOA 4NOGA 3WCNA 1BJOA 3WX9A 3OP7A 1O61A 3NYUA 2AY5A 4M2MA 1N31A 3AEJC 1ASCA 3FZ7A 4F5JA 1LS3A 4ZSWA 3NRAA 1G7WA 3F6TA 4ATPA 2W7FA 3E9KA 1C0NA 1ASGA 3ELEA 2RFVA 3FFRA 1YAAA 1DGDA 2BIGA 4IXOA 3COGA 4GRXA 4XK1A 3F9TA 4A0RA 3CAIA 2BI2A 3VK3A 2Z9VA 3FQ8A 4IXSA 4EU1A 2VI9A 3BWNA 1H0CA 2QBTA 4ZM4A 2EPJA 2JG2A 2W8JA 1JG8A 2VGUA 4F5IA 1G4VA 1FG7A 1JF9A 3I16A 1GEWA 1IX7A 2XH1A 3B1EA 3JZLA 5M49A 1N2TA 3R4TA 1BT4A 3PDBB 1D7VA 2GB3A 2VMVA 2YHKA 1CJ0A 1DGEA 3EI6A 5FT8A 4ZDPA 1ARHA 2NMPA 4FFCA 3JU7A 5E5IA 4EB5A 3MBBA 1QITA 5M4BA 1X0MA 5F8VA 4WB0B 2AY4A 4IYOB 4DGTA 1DTYA 1S0AA 1GC4A 5AX8A 1DJ9A 1ARSA 1BKGA 1M6SA 3PDXA 3B46A 1EQBA 1ELQA 1SVVA 2YRRA 3GZDC 4MY5A 2BI5A 1D7RA 3RBLA 1CS1A 3GSBA 4ZLVA 3HMUA 3L8AA 4DQ6A 3BB8A 1DKAA 2WK7A 4Q76A 4ADCA 4TV7A 3I5TA 3UE8A 1SZUA 2OKJA 2G7JA 3QI6A 3AENA 2R5CB 3FVSA 3N4RA 4DBCA 1AMQA 1B9HA 3AOWA 2VMNA 4R2NA 4MQQA 1SF2A 1AICA 4WP0A 1AX4A 1LW4A 3AEJA 3QM2A 2D66A 4J5UA 4JEXA 4WYGA 2VIBA 2R2NA 1AAMA 3WCOA 2Z67A 3HQTA 2D61A 2GQNA 1GEXA 2ZSMA 3LWSA 4RM1A 3A8UX 4QGRA 1WKHA 4TN4A 3BN1A 4UQVA 3FQ7A 1S07A 2DGLA 2VI8A 1LC7A 1E5EA 3ASAA 3DR7A 3JWAA 4R5ZA 1WSTA 1X2AA 1Y4IA 3BCXA 4PVFA 2QB2A 4P3MA 3FQAA 2W7HA 2YKXA 1AY4A 5FT5A 2YKVA 1IBJA 1OHWA 1W23A 1YJYA 3AELA 3FVUA 2VMPA 3E2YA 3KKIA 1AJSA 1AAWA 1AHFA 3BCAA 2VMUA 1TOEA 4KAMA 5HXXA 1ECXA 1RVUA 1KKPA 2AEVA 2W8TA 3DR4A 4MKJA 3Q8NA 5JAYA 2ZY3A 3N75A 2WK9A 2VMYA 3MAFA 2Z9XA 3A9ZA 3NTJA 4BHDA 4Q31A 4PFNA 2G6WA 1GDEA 1AY8A 1B5OA 1M0NA 3EI8A 1D7UA 3TATA 3TFTA 2OGAA 4ZDLA 3MEBA 4O6ZA 1MDOA 1ASEA 2HOZA 2BWPA 1BJWA 3LVKA 1ASLA 3T32A 2DOUA 3BV0A 1T3IA 4ZDOA 1ARIA 1JS3A 1TASA 4OBVA 2VLHA 3VAXA 1V72A 2D7YA 1KL2A 4GSAA 4M2KA 4OC9A 2F8JA 9AATA 2PO3A 4ZAHA 3RCHB 5G0AA 3WZFA 3GZDA 1TOKA 3N7NA 4ATQA 3WKSA 3DC1A 4EB7A 2YOBA 2W8UA 4WBTA 4R8DA 1SZKA 1KKJA 3AOVA 1ORDA 1B8GA 4AOAA 1M4NA 2BWNA 2VMXA 2W7GA 3FVXA 3B1CA 3GBXA 1GCKA 2VMRA 5D5SA 4I8AA 1I41A 1KMKA 1SPAA 5BJ4A 1DJUA 2BWOA 4CBSA 1UKJA 3MC6C 3GETA 5DJ9A 5J8QA 1WKGA 3EUCA 5EUEA 4ZWVA 1ZOBA 3R9AA 3AEMC 1M0OA 4MGRA 3ACZA 1XEYA 1AMRA 2FM1A 3VP6A 4JF0A 1WYUB 1AIAA 3E77A 1H1CA 1QJ5A 2FYFA 4ZWMA 3CQ4A 3ECDA 3EI9A 1N8PA 2VLFA 1W3UA 3QGUA 3PGYA 2W7MA 2A1VA 3JWBA 2BYJA 4R5FA 1VEFA 1IX6A 2CH2A 1FG3A 2HP1A 3P1TA 4HF8A 2ZY4A 3GR9A 4W1WA 1AMSA 2V1PA 2VYCA 4OYTA 3H14A 4E1OA 4MQRA 2BI9A 2AY9A 2D65A 3HT4A 2ZUKA 2D5YA 5TF5A 4XJMA 2VGTA 2VMOA 4A6UA 4RITA 2C7TA 5EIGB 1ASAA 3G8MA 1AKAA 5M4DA 4GE7A 4K2BA 3ZRPA 4JEWA 3TCMA 1D2FA 1GEYA 4F5MA 5LH9A 2CANA 3ELPA 3A9XA 1V2DA 1LC5A 1M0PA 4IY7A 4LNJA 4UHNA 4K05A 5D95A 3A2BA 1W7LA 4WYDA 5G2PA 5K8BA 2AY8A 3M5UA 1ARGA 4RAEA 3PD6B 1CQ8A 3CBFA 3BC8A 2PB0A 1B4XA 1BQDA 4F5KA 4UHOA 4ZM3A 3RCHA 2BYLA 2X8UA 4N0WA 1PG8A 4ADDA 4W1XA 2CJHA 1TATA 2CJGA 4P7YA 3AV7A 1Z3ZA 1LK9A 3BS8A 4JEZA 1OHYA 1WYTB 3MC6A 4N0BA 5LHAA 3NUIA 1TOJA 3RUYA 4A0GA 4F5GA 1WYVB 4WXGA 4BMKA 4JE5D 1QZ9A 3NNKA 2X3LA 3AEMA 3K40A 4WD2A 1IJIA 1B5PA 1GC2A 2JJHA 4KXKA 2X5FA 2PB2A 4K2IA 3PIUA 1CZCA 2O1BA 1TARA 3II0A 1RV4A 2AEUA 4WXBA 3KGWA 2D63A 2D64A 1LW5A 3MAUA 2Q7WA 4RLGA 1D7SA 5EUNA 1DJEA 2HOYA 2CINA 2X5DA 1IUGA 4XEWA 4BQ0A 4RKDA
chains in the Genus database with same CATH topology
3WLXA 1I43A 5FT4A 4ITXA 1TOIA 2YCNA 2C44A 3GJUA 4OCAA 4B98A 3KGXA 3DXWA 3AATA 1BJOB 3EZSA 3NYSA 2BIEA 3DZZA 5DB5A 3QN6A 1BS0A 4MKKA 3H9XA 1JS6A 2JJEA 1OXPA 3VK4A 1QISA 5EIGA 4AO4A 2HUUA 3JTXA 5KTBA 1LKCA 4JF1A 3MKJA 3F0HA 1I48A 1ARTA 2YKYA 3N4SA 1W7NA 1GD9A 2JGTA 3QBOA 3PDBA 1YIZA 2VMZA 4E77A 2W8VA 1PMMA 1J04A 1AHYA 5I92A 1G4XA 3NDNA 2OQXA 2BI3A 1ASMA 2ORDA 4CXQA 1P3WA 2ZY2A 4OT8A 4GE4A 4WB0A 1GBNA 4IYOA 3EZ1A 1V2FA 3QHXA 2QA3A 4ITGA 2AATA 1AY5A 3E2FA 4FL0A 3FSLA 3H7FA 4ADEA 3EI5A 3K28A 2C0RA 3LVMA 4XJOA 1S06A 4LC3A 1BW0A 2ZJGA 3RQ1A 3DXVA 1M0QA 4AO9A 1SFFA 1UU2A 1ZODA 2DR1A 4E3RA 1B9IA 3UAKA 2VMTA 2D7ZA 4IXZA 1ELUA 3PAAA 2BKWA 2YKUA 1WYVA 2O7CA 2DKBA 2R5CA 3ISLA 3HL2A 2CY8A 2HZPA 1ASDA 3KE3A 4W5KA 2CFBA 2VMWA 4JEYA 2TPLA 5EAVA 2HOXA 1XI9A 2CSTA 1X28A 2VGVA 4ISYA 4WLJA 3DRDA 5DX5A 2CJDA 3E2ZB 4K2MA 1EJIA 4A0HA 4TMRA 3D6KA 2QMAA 3MADA 4H51A 2Z9WA 2ZC0A 3CQ6A 2BI1A 1YOOA 1AIBA 1KMJA 4W1VA 5G09A 4A6RA 2FKIA 4M2JA 1CZEA 1YNUA 3B8XA 2E7IA 3EIBA 3JW9A 5EFSA 2OKKA 2Z9UA 4PIWA 1O69A 2WKAA 1YJZA 1AKBA 1AJRA 2BHXA 4WXFA 3N0LA 4E3QA 5E3KA 1CQ7A 3WKRA 3E6GA 2W7LA 2O0RA 3W1IA 2EZ2A 4LNLA 4MQPA 4Q75A 4MSOA 4F5FA 3OKSA 4AZKA 1IAYA 3ZRRA 3DYDA 4F5LA 5EUDA 2VGWA 3NUBA 2W7IA 4W91A 3IHJA 3W1HA 1YJSA 4CBRA 1AJSB 4B9BA 2WB6A 1E5FA 2YCPA 2YRIA 3GZCA 3WGBA 3MAFB 4GDYA 5E4ZA 3HBXA 1IVRA 3FRKA 2Z61A 4WYCA 4A72A 7AATA 1ASBA 1Z7DA 2AY3A 2JJGA 3LY1A 4WYAA 3BWOA 1MGVA 4CXRA 2CB1A 4AH3A 1OXOA 4OMAA 3EI7A 5M46A 2EYQA 2DGMA 1C7GA 1PMOA 1MDZA 1ASNA 2FNUA 1IX8A 1DFOA 3HDOA 2FQ6A 3TQXA 1O4SA 1S08A 1MDXA 1MLZA 1BJ4A 2GMUA 1ASFA 3DODA 5HDMA 1X29A 3EIAA 3LVLB 4J8LA 4ADBA 5C6UA 2ZY5A 2EH6A 2VIAA 4GE9A 4GEBA 3ASBA 4L0OA 2WK8A 3B1DA 4XJLA 2YCTA 1UU0A 2GMSA 4LW2A 1MAPA 1VP4A 2VMSA 2GSAA 1AHGA 4A00A 3ZRQA 4WLHA 4U1TA 3FZ8A 1CL2A 1S09A 2DGKA 3RI6A 2V0YA 1EG5A 1W7MA 1WYUA 2VGSA 4UHMA 1J32A 3E2ZA 4Y0HA 1AMAA 1MAQA 2EO5A 2W7KA 2EZ1A 1AHXA 2R5EA 4CVQA 8AATA 2R0TA 2OGEA 4LNMA 5IWQA 1QGNA 2W8WA 2AY1A 2E7JA 1U08A 2ZSLA 3FD0A 4RIZA 4EMYA 4F5HA 1OHVA 2BIAA 5G4IA 1AHEA 3LV2A 2JISA 4RJ0A 4RKCA 3USFA 1KL1A 2Z20A 1FC4A 1OATA 4H63Q 3G0TA 1CQ6A 3BCBA 3ZZJA 1C9CA 3IF2A 2AY7A 2CTZA 3TFUA 2Z1YA 2DKJA 4OTLA 1RVYA 2CH1A 5HHYA 2VMQA 3NX3A 4OBUA 4ZSYA 4PFFA 3ZZKA 1C7OA 1IAXA 3K7YA 1UU1A 1TOGA 3PA9A 4XQ2A 4BA4A 1C7NA 1RV3A 3N4XA 1ZC9A 3PPLA 5EAAA 2KFPA 2XBNA 1PFFA 1C4KA 4JEVA 5G4JA 4F4EA 3FZ6A 3A9YA 2OATA 3GWPA 2AY2A 3PD6A 2ZP7A 1AKCA 3P6KA 4Q6RA 4AZJA 3BWNC 5F9SA 3QPGA 4WYFA 3VK2A 3L44A 5DJ1A 3NU7A 1G7XA 1QJ3A 3G7QA 3HVYA 4RJYA 2W7DA 1GC3A 2VGZA 2QSRA 4JE5A 3FDDA 4A6TA 3FTBA 4XJPA 3UWCA 1WYTA 4LW4A 4Y0IA 1M7YA 3NYTA 3WY7A 3PJ0A 5BJ3A 3AEOA 2HORA 2FNIA 5FT6A 3FDBA 2QB3A 3FCRA 4HVKA 2ZYJA 4XAUA 3HLMA 4ZASA 3W1JA 5EQCA 3CQ5A 1CL1A 4IX8A 1M32A 2JJFA 1BJNA 4EFFA 1I29A 1BQAA 3AEPA 3LVJA 5G2QA 2Z1ZA 2HP2A 2W7EA 3FFHA 1LC8A 2HUFA 3RBFA 4BA5A 3AENB 3N5MA 3WGCA 3FKDA 4W8IA 1VJOA 1SZSA 1GC0A 2QLRA 4A0FA 3NU8A 4U2HA 1TPLA 2EGYA 4IW7A 3VOMA 1V2EA 2C81A 1YIYA 1O62A 2FN6A 4WYEA 1MLYA 3ATHA 4UOYA 3I4JA 2E7UA 2W7JA 4Y0DA 2HUIA 2AY6A 3LG0A 3DU4A 1QIRA 2E54A 4KYOA 4NOGA 3WCNA 1BJOA 3WX9A 3OP7A 1O61A 3NYUA 2AY5A 4M2MA 1N31A 3AEJC 1ASCA 3FZ7A 4F5JA 1LS3A 4ZSWA 3NRAA 1G7WA 3F6TA 4ATPA 2W7FA 3E9KA 1C0NA 1ASGA 3ELEA 2RFVA 3FFRA 1YAAA 1DGDA 2BIGA 4IXOA 3COGA 4GRXA 4XK1A 3F9TA 4A0RA 3CAIA 2BI2A 3VK3A 2Z9VA 3FQ8A 4IXSA 4EU1A 2VI9A 3BWNA 1H0CA 2QBTA 4ZM4A 2EPJA 2JG2A 2W8JA 1JG8A 2VGUA 4F5IA 1G4VA 1FG7A 1JF9A 3I16A 1GEWA 1IX7A 2XH1A 3B1EA 3JZLA 5M49A 1N2TA 3R4TA 1BT4A 3PDBB 1D7VA 2GB3A 2VMVA 2YHKA 1CJ0A 1DGEA 3EI6A 5FT8A 4ZDPA 1ARHA 2NMPA 4FFCA 3JU7A 5E5IA 4EB5A 3MBBA 1QITA 5M4BA 1X0MA 5F8VA 4WB0B 2AY4A 4IYOB 4DGTA 1DTYA 1S0AA 1GC4A 5AX8A 1DJ9A 1ARSA 1BKGA 1M6SA 3PDXA 3B46A 1EQBA 1ELQA 1SVVA 2YRRA 3GZDC 4MY5A 2BI5A 1D7RA 3RBLA 1CS1A 3GSBA 4ZLVA 3HMUA 3L8AA 4DQ6A 3BB8A 1DKAA 2WK7A 4Q76A 4ADCA 4TV7A 3I5TA 3UE8A 1SZUA 2OKJA 2G7JA 3QI6A 3AENA 2R5CB 3FVSA 3N4RA 4DBCA 1AMQA 1B9HA 3AOWA 2VMNA 4R2NA 4MQQA 1SF2A 1AICA 4WP0A 1AX4A 1LW4A 3AEJA 3QM2A 2D66A 4J5UA 4JEXA 4WYGA 2VIBA 2R2NA 1AAMA 3WCOA 2Z67A 3HQTA 2D61A 2GQNA 1GEXA 2ZSMA 3LWSA 4RM1A 3A8UX 4QGRA 1WKHA 4TN4A 3BN1A 4UQVA 3FQ7A 1S07A 2DGLA 2VI8A 1LC7A 1E5EA 3ASAA 3DR7A 3JWAA 4R5ZA 1WSTA 1X2AA 1Y4IA 3BCXA 4PVFA 2QB2A 4P3MA 3FQAA 2W7HA 2YKXA 1AY4A 5FT5A 2YKVA 1IBJA 1OHWA 1W23A 1YJYA 3AELA 3FVUA 2VMPA 3E2YA 3KKIA 1AJSA 1AAWA 1AHFA 3BCAA 2VMUA 1TOEA 4KAMA 5HXXA 1ECXA 1RVUA 1KKPA 2AEVA 2W8TA 3DR4A 4MKJA 3Q8NA 5JAYA 2ZY3A 3N75A 2WK9A 2VMYA 3MAFA 2Z9XA 3A9ZA 3NTJA 4BHDA 4Q31A 4PFNA 2G6WA 1GDEA 1AY8A 1B5OA 1M0NA 3EI8A 1D7UA 3TATA 3TFTA 2OGAA 4ZDLA 3MEBA 4O6ZA 1MDOA 1ASEA 2HOZA 2BWPA 1BJWA 3LVKA 1ASLA 3T32A 2DOUA 3BV0A 1T3IA 4ZDOA 1ARIA 1JS3A 1TASA 4OBVA 2VLHA 3VAXA 1V72A 2D7YA 1KL2A 4GSAA 4M2KA 4OC9A 2F8JA 9AATA 2PO3A 4ZAHA 3RCHB 5G0AA 3WZFA 3GZDA 1TOKA 3N7NA 4ATQA 3WKSA 3DC1A 4EB7A 2YOBA 2W8UA 4WBTA 4R8DA 1SZKA 1KKJA 3AOVA 1ORDA 1B8GA 4AOAA 1M4NA 2BWNA 2VMXA 2W7GA 3FVXA 3B1CA 3GBXA 1GCKA 2VMRA 5D5SA 4I8AA 1I41A 1KMKA 1SPAA 5BJ4A 1DJUA 2BWOA 4CBSA 1UKJA 3MC6C 3GETA 5DJ9A 5J8QA 1WKGA 3EUCA 5EUEA 4ZWVA 1ZOBA 3R9AA 3AEMC 1M0OA 4MGRA 3ACZA 1XEYA 1AMRA 2FM1A 3VP6A 4JF0A 1WYUB 1AIAA 3E77A 1H1CA 1QJ5A 2FYFA 4ZWMA 3CQ4A 3ECDA 3EI9A 1N8PA 2VLFA 1W3UA 3QGUA 3PGYA 2W7MA 2A1VA 3JWBA 2BYJA 4R5FA 1VEFA 1IX6A 2CH2A 1FG3A 2HP1A 3P1TA 4HF8A 2ZY4A 3GR9A 4W1WA 1AMSA 2V1PA 2VYCA 4OYTA 3H14A 4E1OA 4MQRA 2BI9A 2AY9A 2D65A 3HT4A 2ZUKA 2D5YA 5TF5A 4XJMA 2VGTA 2VMOA 4A6UA 4RITA 2C7TA 5EIGB 1ASAA 3G8MA 1AKAA 5M4DA 4GE7A 4K2BA 3ZRPA 4JEWA 3TCMA 1D2FA 1GEYA 4F5MA 5LH9A 2CANA 3ELPA 3A9XA 1V2DA 1LC5A 1M0PA 4IY7A 4LNJA 4UHNA 4K05A 5D95A 3A2BA 1W7LA 4WYDA 5G2PA 5K8BA 2AY8A 3M5UA 1ARGA 4RAEA 3PD6B 1CQ8A 3CBFA 3BC8A 2PB0A 1B4XA 1BQDA 4F5KA 4UHOA 4ZM3A 3RCHA 2BYLA 2X8UA 4N0WA 1PG8A 4ADDA 4W1XA 2CJHA 1TATA 2CJGA 4P7YA 3AV7A 1Z3ZA 1LK9A 3BS8A 4JEZA 1OHYA 1WYTB 3MC6A 4N0BA 5LHAA 3NUIA 1TOJA 3RUYA 4A0GA 4F5GA 1WYVB 4WXGA 4BMKA 4JE5D 1QZ9A 3NNKA 2X3LA 3AEMA 3K40A 4WD2A 1IJIA 1B5PA 1GC2A 2JJHA 4KXKA 2X5FA 2PB2A 4K2IA 3PIUA 1CZCA 2O1BA 1TARA 3II0A 1RV4A 2AEUA 4WXBA 3KGWA 2D63A 2D64A 1LW5A 3MAUA 2Q7WA 4RLGA 1D7SA 5EUNA 1DJEA 2HOYA 2CINA 2X5DA 1IUGA 4XEWA 4BQ0A 4RKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WLX A;  1I43 A;  5FT4 A;  4ITX A;  1TOI A;  2YCN A;  2C44 A;  3GJU A;  4OCA A;  4B98 A;  3KGX A;  3DXW A;  3AAT A;  1BJO B;  3EZS A;  3NYS A;  2BIE A;  3DZZ A;  5DB5 A;  3QN6 A;  1BS0 A;  4MKK A;  1JS6 A;  2JJE A;  1OXP A;  3VK4 A;  1QIS A;  5EIG A;  4AO4 A;  2HUU A;  3JTX A;  1LKC A;  4JF1 A;  3MKJ A;  3F0H A;  1I48 A;  1ART A;  2YKY A;  1W7N A;  1GD9 A;  2JGT A;  3QBO A;  3PDB A;  1YIZ A;  2VMZ A;  4E77 A;  2W8V A;  1PMM A;  1J04 A;  1AHY A;  5I92 A;  1G4X A;  3NDN A;  2OQX A;  2BI3 A;  1ASM A;  2ORD A;  4CXQ A;  1P3W A;  2ZY2 A;  4OT8 A;  4GE4 A;  4WB0 A;  1GBN A;  4IYO A;  3EZ1 A;  1V2F A;  3QHX A;  2QA3 A;  4ITG A;  2AAT A;  1AY5 A;  3E2F A;  4FL0 A;  3FSL A;  3H7F A;  4ADE A;  3EI5 A;  3K28 A;  2C0R A;  3LVM A;  4XJO A;  1S06 A;  4LC3 A;  1BW0 A;  2ZJG A;  3RQ1 A;  3DXV A;  1M0Q A;  4AO9 A;  1SFF A;  1UU2 A;  1ZOD A;  2DR1 A;  4E3R A;  1B9I A;  3UAK A;  2VMT A;  2D7Z A;  4IXZ A;  1ELU A;  3PAA A;  2BKW A;  2YKU A;  1WYV A;  2O7C A;  2DKB A;  2R5C A;  3ISL A;  3HL2 A;  2CY8 A;  2HZP A;  1ASD A;  3KE3 A;  4W5K A;  2CFB A;  2VMW A;  4JEY A;  2TPL A;  5EAV A;  2HOX A;  1XI9 A;  2CST A;  1X28 A;  2VGV A;  4ISY A;  4WLJ A;  3DRD A;  5DX5 A;  2CJD A;  3E2Z B;  4K2M A;  1EJI A;  4A0H A;  4TMR A;  3D6K A;  2QMA A;  3MAD A;  4H51 A;  2Z9W A;  2ZC0 A;  3CQ6 A;  2BI1 A;  1YOO A;  1AIB A;  1KMJ A;  4W1V A;  5G09 A;  4A6R A;  4M2J A;  1CZE A;  1YNU A;  3B8X A;  2E7I A;  3EIB A;  3JW9 A;  5EFS A;  2OKK A;  2Z9U A;  4PIW A;  1O69 A;  2WKA A;  1YJZ A;  1AKB A;  1AJR A;  2BHX A;  4WXF A;  3N0L A;  4E3Q A;  5E3K A;  1CQ7 A;  3WKR A;  3E6G A;  2W7L A;  2O0R A;  3W1I A;  2EZ2 A;  4LNL A;  4MQP A;  4Q75 A;  4MSO A;  4F5F A;  3OKS A;  4AZK A;  1IAY A;  3ZRR A;  3DYD A;  4F5L A;  5EUD A;  2VGW A;  3NUB A;  2W7I A;  4W91 A;  3IHJ A;  3W1H A;  1YJS A;  4CBR A;  1AJS B;  4B9B A;  1E5F A;  2YCP A;  2YRI A;  3GZC A;  3WGB A;  3MAF B;  4GDY A;  5E4Z A;  3HBX A;  1IVR A;  3FRK A;  2Z61 A;  4WYC A;  4A72 A;  7AAT A;  1ASB A;  1Z7D A;  2AY3 A;  2JJG A;  3LY1 A;  4WYA A;  3BWO A;  1MGV A;  4CXR A;  2CB1 A;  4AH3 A;  1OXO A;  4OMA A;  3EI7 A;  5M46 A;  2DGM A;  1C7G A;  1PMO A;  1MDZ A;  1ASN A;  2FNU A;  1IX8 A;  1DFO A;  3HDO A;  2FQ6 A;  3TQX A;  1O4S A;  1S08 A;  1MDX A;  1MLZ A;  1BJ4 A;  2GMU A;  1ASF A;  3DOD A;  5HDM A;  1X29 A;  3EIA A;  3LVL B;  4J8L A;  4ADB A;  5C6U A;  2ZY5 A;  2EH6 A;  2VIA A;  4GE9 A;  4GEB A;  3ASB A;  4L0O A;  2WK8 A;  3B1D A;  4XJL A;  2YCT A;  1UU0 A;  2GMS A;  4LW2 A;  1MAP A;  1VP4 A;  2VMS A;  2GSA A;  1AHG A;  4A00 A;  3ZRQ A;  4WLH A;  4U1T A;  3FZ8 A;  1CL2 A;  1S09 A;  2DGK A;  3RI6 A;  2V0Y A;  1EG5 A;  1W7M A;  1WYU A;  2VGS A;  4UHM A;  1J32 A;  3E2Z A;  4Y0H A;  1AMA A;  1MAQ A;  2EO5 A;  2W7K A;  2EZ1 A;  1AHX A;  2R5E A;  4CVQ A;  8AAT A;  2R0T A;  2OGE A;  4LNM A;  5IWQ A;  1QGN A;  2W8W A;  2AY1 A;  2E7J A;  1U08 A;  2ZSL A;  3FD0 A;  4RIZ A;  4EMY A;  4F5H A;  1OHV A;  2BIA A;  5G4I A;  1AHE A;  3LV2 A;  2JIS A;  4RJ0 A;  4RKC A;  3USF A;  1KL1 A;  2Z20 A;  1FC4 A;  1OAT A;  3G0T A;  1CQ6 A;  3BCB A;  3ZZJ A;  1C9C A;  3IF2 A;  2AY7 A;  2CTZ A;  3TFU A;  2Z1Y A;  2DKJ A;  4OTL A;  1RVY A;  2CH1 A;  5HHY A;  2VMQ A;  3NX3 A;  4OBU A;  4ZSY A;  4PFF A;  3ZZK A;  1C7O A;  1IAX A;  3K7Y A;  1UU1 A;  1TOG A;  3PA9 A;  4XQ2 A;  4BA4 A;  1C7N A;  1RV3 A;  1ZC9 A;  3PPL A;  5EAA A;  2XBN A;  1PFF A;  1C4K A;  4JEV A;  5G4J A;  4F4E A;  3FZ6 A;  3A9Y A;  2OAT A;  3GWP A;  2AY2 A;  3PD6 A;  2ZP7 A;  1AKC A;  3P6K A;  4Q6R A;  4AZJ A;  3BWN C;  5F9S A;  3QPG A;  4WYF A;  3VK2 A;  3L44 A;  5DJ1 A;  3NU7 A;  1G7X A;  1QJ3 A;  3G7Q A;  3HVY A;  4RJY A;  2W7D A;  1GC3 A;  2VGZ A;  4JE5 A;  3FDD A;  4A6T A;  3FTB A;  4XJP A;  3UWC A;  1WYT A;  4LW4 A;  4Y0I A;  1M7Y A;  3NYT A;  3WY7 A;  3PJ0 A;  5BJ3 A;  3AEO A;  2HOR A;  2FNI A;  5FT6 A;  3FDB A;  2QB3 A;  3FCR A;  4HVK A;  2ZYJ A;  4XAU A;  3HLM A;  4ZAS A;  3W1J A;  5EQC A;  3CQ5 A;  1CL1 A;  4IX8 A;  1M32 A;  2JJF A;  1BJN A;  4EFF A;  1I29 A;  1BQA A;  3AEP A;  3LVJ A;  5G2Q A;  2Z1Z A;  2HP2 A;  2W7E A;  3FFH A;  1LC8 A;  2HUF A;  3RBF A;  4BA5 A;  3AEN B;  3N5M A;  3WGC A;  3FKD A;  4W8I A;  1VJO A;  1SZS A;  1GC0 A;  2QLR A;  4A0F A;  3NU8 A;  4U2H A;  1TPL A;  2EGY A;  4IW7 A;  3VOM A;  1V2E A;  2C81 A;  1YIY A;  1O62 A;  2FN6 A;  4WYE A;  1MLY A;  3ATH A;  4UOY A;  3I4J A;  2E7U A;  2W7J A;  4Y0D A;  2HUI A;  2AY6 A;  3LG0 A;  3DU4 A;  1QIR A;  2E54 A;  4KYO A;  4NOG A;  3WCN A;  1BJO A;  3WX9 A;  3OP7 A;  1O61 A;  3NYU A;  2AY5 A;  4M2M A;  1N31 A;  3AEJ C;  1ASC A;  3FZ7 A;  4F5J A;  1LS3 A;  4ZSW A;  3NRA A;  1G7W A;  3F6T A;  4ATP A;  2W7F A;  3E9K A;  1C0N A;  1ASG A;  3ELE A;  2RFV A;  3FFR A;  1YAA A;  1DGD A;  2BIG A;  4IXO A;  3COG A;  4GRX A;  4XK1 A;  3F9T A;  4A0R A;  3CAI A;  2BI2 A;  3VK3 A;  2Z9V A;  3FQ8 A;  4IXS A;  4EU1 A;  2VI9 A;  3BWN A;  1H0C A;  2QBT A;  4ZM4 A;  2EPJ A;  2JG2 A;  2W8J A;  1JG8 A;  2VGU A;  4F5I A;  1G4V A;  1FG7 A;  1JF9 A;  3I16 A;  1GEW A;  1IX7 A;  2XH1 A;  3B1E A;  3JZL A;  5M49 A;  1N2T A;  3R4T A;  1BT4 A;  3PDB B;  1D7V A;  2GB3 A;  2VMV A;  2YHK A;  1CJ0 A;  1DGE A;  3EI6 A;  5FT8 A;  4ZDP A;  1ARH A;  2NMP A;  4FFC A;  3JU7 A;  5E5I A;  4EB5 A;  3MBB A;  1QIT A;  5M4B A;  1X0M A;  5F8V A;  4WB0 B;  2AY4 A;  4IYO B;  4DGT A;  1DTY A;  1S0A A;  1GC4 A;  5AX8 A;  1DJ9 A;  1ARS A;  1BKG A;  1M6S A;  3PDX A;  3B46 A;  1EQB A;  1ELQ A;  1SVV A;  2YRR A;  3GZD C;  4MY5 A;  2BI5 A;  1D7R A;  3RBL A;  1CS1 A;  3GSB A;  4ZLV A;  3HMU A;  3L8A A;  4DQ6 A;  3BB8 A;  1DKA A;  2WK7 A;  4Q76 A;  4ADC A;  4TV7 A;  3I5T A;  3UE8 A;  1SZU A;  2OKJ A;  3QI6 A;  3AEN A;  2R5C B;  3FVS A;  4DBC A;  1AMQ A;  1B9H A;  3AOW A;  2VMN A;  4R2N A;  4MQQ A;  1SF2 A;  1AIC A;  4WP0 A;  1AX4 A;  1LW4 A;  3AEJ A;  3QM2 A;  2D66 A;  4J5U A;  4JEX A;  4WYG A;  2VIB A;  2R2N A;  1AAM A;  3WCO A;  2Z67 A;  3HQT A;  2D61 A;  2GQN A;  1GEX A;  2ZSM A;  3LWS A;  4RM1 A;  3A8U X;  4QGR A;  1WKH A;  4TN4 A;  3BN1 A;  4UQV A;  3FQ7 A;  1S07 A;  2DGL A;  2VI8 A;  1LC7 A;  1E5E A;  3ASA A;  3DR7 A;  3JWA A;  4R5Z A;  1WST A;  1X2A A;  1Y4I A;  3BCX A;  4PVF A;  2QB2 A;  4P3M A;  3FQA A;  2W7H A;  2YKX A;  1AY4 A;  5FT5 A;  2YKV A;  1IBJ A;  1OHW A;  1W23 A;  1YJY A;  3AEL A;  3FVU A;  2VMP A;  3E2Y A;  3KKI A;  1AJS A;  1AAW A;  1AHF A;  3BCA A;  2VMU A;  1TOE A;  4KAM A;  5HXX A;  1ECX A;  1RVU A;  1KKP A;  2AEV A;  2W8T A;  3DR4 A;  4MKJ A;  3Q8N A;  5JAY A;  2ZY3 A;  3N75 A;  2WK9 A;  2VMY A;  3MAF A;  2Z9X A;  3A9Z A;  3NTJ A;  4BHD A;  4Q31 A;  4PFN A;  2G6W A;  1GDE A;  1AY8 A;  1B5O A;  1M0N A;  3EI8 A;  1D7U A;  3TAT A;  3TFT A;  2OGA A;  4ZDL A;  3MEB A;  4O6Z A;  1MDO A;  1ASE A;  2HOZ A;  2BWP A;  1BJW A;  3LVK A;  1ASL A;  3T32 A;  2DOU A;  3BV0 A;  1T3I A;  4ZDO A;  1ARI A;  1JS3 A;  1TAS A;  4OBV A;  2VLH A;  3VAX A;  1V72 A;  2D7Y A;  1KL2 A;  4GSA A;  4M2K A;  4OC9 A;  2F8J A;  9AAT A;  2PO3 A;  4ZAH A;  3RCH B;  5G0A A;  3WZF A;  3GZD A;  1TOK A;  4ATQ A;  3WKS A;  3DC1 A;  4EB7 A;  2YOB A;  2W8U A;  4WBT A;  4R8D A;  1SZK A;  1KKJ A;  3AOV A;  1ORD A;  1B8G A;  4AOA A;  1M4N A;  2BWN A;  2VMX A;  2W7G A;  3FVX A;  3B1C A;  3GBX A;  1GCK A;  2VMR A;  5D5S A;  4I8A A;  1I41 A;  1KMK A;  1SPA A;  5BJ4 A;  1DJU A;  2BWO A;  4CBS A;  1UKJ A;  3MC6 C;  3GET A;  5DJ9 A;  5J8Q A;  1WKG A;  3EUC A;  5EUE A;  4ZWV A;  1ZOB A;  3R9A A;  3AEM C;  1M0O A;  4MGR A;  3ACZ A;  1XEY A;  1AMR A;  2FM1 A;  3VP6 A;  4JF0 A;  1WYU B;  1AIA A;  3E77 A;  1H1C A;  1QJ5 A;  2FYF A;  4ZWM A;  3CQ4 A;  3ECD A;  3EI9 A;  1N8P A;  2VLF A;  1W3U A;  3QGU A;  3PGY A;  2W7M A;  3JWB A;  2BYJ A;  4R5F A;  1VEF A;  1IX6 A;  2CH2 A;  1FG3 A;  2HP1 A;  3P1T A;  4HF8 A;  2ZY4 A;  3GR9 A;  4W1W A;  1AMS A;  2V1P A;  2VYC A;  4OYT A;  3H14 A;  4E1O A;  4MQR A;  2BI9 A;  2AY9 A;  2D65 A;  3HT4 A;  2ZUK A;  2D5Y A;  5TF5 A;  4XJM A;  2VGT A;  2VMO A;  4A6U A;  4RIT A;  2C7T A;  5EIG B;  1ASA A;  3G8M A;  1AKA A;  5M4D A;  4GE7 A;  4K2B A;  3ZRP A;  4JEW A;  3TCM A;  1D2F A;  1GEY A;  4F5M A;  5LH9 A;  2CAN A;  3ELP A;  3A9X A;  1V2D A;  1LC5 A;  1M0P A;  4IY7 A;  4LNJ A;  4UHN A;  5D95 A;  3A2B A;  1W7L A;  4WYD A;  5G2P A;  5K8B A;  2AY8 A;  3M5U A;  1ARG A;  4RAE A;  3PD6 B;  1CQ8 A;  3CBF A;  3BC8 A;  2PB0 A;  1B4X A;  1BQD A;  4F5K A;  4UHO A;  4ZM3 A;  3RCH A;  2BYL A;  2X8U A;  4N0W A;  1PG8 A;  4ADD A;  4W1X A;  2CJH A;  1TAT A;  2CJG A;  4P7Y A;  3AV7 A;  1Z3Z A;  1LK9 A;  3BS8 A;  4JEZ A;  1OHY A;  1WYT B;  3MC6 A;  4N0B A;  5LHA A;  3NUI A;  1TOJ A;  3RUY A;  4A0G A;  4F5G A;  1WYV B;  4WXG A;  4BMK A;  4JE5 D;  1QZ9 A;  3NNK A;  2X3L A;  3AEM A;  3K40 A;  4WD2 A;  1IJI A;  1B5P A;  1GC2 A;  2JJH A;  4KXK A;  2X5F A;  2PB2 A;  4K2I A;  3PIU A;  1CZC A;  2O1B A;  1TAR A;  3II0 A;  1RV4 A;  2AEU A;  4WXB A;  3KGW A;  2D63 A;  2D64 A;  1LW5 A;  3MAU A;  2Q7W A;  4RLG A;  1D7S A;  5EUN A;  1DJE A;  2HOY A;  2CIN A;  2X5D A;  1IUG A;  4XEW A;  4BQ0 A;  4RKD A; 
#chains in the Genus database with same CATH topology
 3WLX A;  1I43 A;  5FT4 A;  4ITX A;  1TOI A;  2YCN A;  2C44 A;  3GJU A;  4OCA A;  4B98 A;  3KGX A;  3DXW A;  3AAT A;  1BJO B;  3EZS A;  3NYS A;  2BIE A;  3DZZ A;  5DB5 A;  3QN6 A;  1BS0 A;  4MKK A;  3H9X A;  1JS6 A;  2JJE A;  1OXP A;  3VK4 A;  1QIS A;  5EIG A;  4AO4 A;  2HUU A;  3JTX A;  5KTB A;  1LKC A;  4JF1 A;  3MKJ A;  3F0H A;  1I48 A;  1ART A;  2YKY A;  3N4S A;  1W7N A;  1GD9 A;  2JGT A;  3QBO A;  3PDB A;  1YIZ A;  2VMZ A;  4E77 A;  2W8V A;  1PMM A;  1J04 A;  1AHY A;  5I92 A;  1G4X A;  3NDN A;  2OQX A;  2BI3 A;  1ASM A;  2ORD A;  4CXQ A;  1P3W A;  2ZY2 A;  4OT8 A;  4GE4 A;  4WB0 A;  1GBN A;  4IYO A;  3EZ1 A;  1V2F A;  3QHX A;  2QA3 A;  4ITG A;  2AAT A;  1AY5 A;  3E2F A;  4FL0 A;  3FSL A;  3H7F A;  4ADE A;  3EI5 A;  3K28 A;  2C0R A;  3LVM A;  4XJO A;  1S06 A;  4LC3 A;  1BW0 A;  2ZJG A;  3RQ1 A;  3DXV A;  1M0Q A;  4AO9 A;  1SFF A;  1UU2 A;  1ZOD A;  2DR1 A;  4E3R A;  1B9I A;  3UAK A;  2VMT A;  2D7Z A;  4IXZ A;  1ELU A;  3PAA A;  2BKW A;  2YKU A;  1WYV A;  2O7C A;  2DKB A;  2R5C A;  3ISL A;  3HL2 A;  2CY8 A;  2HZP A;  1ASD A;  3KE3 A;  4W5K A;  2CFB A;  2VMW A;  4JEY A;  2TPL A;  5EAV A;  2HOX A;  1XI9 A;  2CST A;  1X28 A;  2VGV A;  4ISY A;  4WLJ A;  3DRD A;  5DX5 A;  2CJD A;  3E2Z B;  4K2M A;  1EJI A;  4A0H A;  4TMR A;  3D6K A;  2QMA A;  3MAD A;  4H51 A;  2Z9W A;  2ZC0 A;  3CQ6 A;  2BI1 A;  1YOO A;  1AIB A;  1KMJ A;  4W1V A;  5G09 A;  4A6R A;  2FKI A;  4M2J A;  1CZE A;  1YNU A;  3B8X A;  2E7I A;  3EIB A;  3JW9 A;  5EFS A;  2OKK A;  2Z9U A;  4PIW A;  1O69 A;  2WKA A;  1YJZ A;  1AKB A;  1AJR A;  2BHX A;  4WXF A;  3N0L A;  4E3Q A;  5E3K A;  1CQ7 A;  3WKR A;  3E6G A;  2W7L A;  2O0R A;  3W1I A;  2EZ2 A;  4LNL A;  4MQP A;  4Q75 A;  4MSO A;  4F5F A;  3OKS A;  4AZK A;  1IAY A;  3ZRR A;  3DYD A;  4F5L A;  5EUD A;  2VGW A;  3NUB A;  2W7I A;  4W91 A;  3IHJ A;  3W1H A;  1YJS A;  4CBR A;  1AJS B;  4B9B A;  2WB6 A;  1E5F A;  2YCP A;  2YRI A;  3GZC A;  3WGB A;  3MAF B;  4GDY A;  5E4Z A;  3HBX A;  1IVR A;  3FRK A;  2Z61 A;  4WYC A;  4A72 A;  7AAT A;  1ASB A;  1Z7D A;  2AY3 A;  2JJG A;  3LY1 A;  4WYA A;  3BWO A;  1MGV A;  4CXR A;  2CB1 A;  4AH3 A;  1OXO A;  4OMA A;  3EI7 A;  5M46 A;  2EYQ A;  2DGM A;  1C7G A;  1PMO A;  1MDZ A;  1ASN A;  2FNU A;  1IX8 A;  1DFO A;  3HDO A;  2FQ6 A;  3TQX A;  1O4S A;  1S08 A;  1MDX A;  1MLZ A;  1BJ4 A;  2GMU A;  1ASF A;  3DOD A;  5HDM A;  1X29 A;  3EIA A;  3LVL B;  4J8L A;  4ADB A;  5C6U A;  2ZY5 A;  2EH6 A;  2VIA A;  4GE9 A;  4GEB A;  3ASB A;  4L0O A;  2WK8 A;  3B1D A;  4XJL A;  2YCT A;  1UU0 A;  2GMS A;  4LW2 A;  1MAP A;  1VP4 A;  2VMS A;  2GSA A;  1AHG A;  4A00 A;  3ZRQ A;  4WLH A;  4U1T A;  3FZ8 A;  1CL2 A;  1S09 A;  2DGK A;  3RI6 A;  2V0Y A;  1EG5 A;  1W7M A;  1WYU A;  2VGS A;  4UHM A;  1J32 A;  3E2Z A;  4Y0H A;  1AMA A;  1MAQ A;  2EO5 A;  2W7K A;  2EZ1 A;  1AHX A;  2R5E A;  4CVQ A;  8AAT A;  2R0T A;  2OGE A;  4LNM A;  5IWQ A;  1QGN A;  2W8W A;  2AY1 A;  2E7J A;  1U08 A;  2ZSL A;  3FD0 A;  4RIZ A;  4EMY A;  4F5H A;  1OHV A;  2BIA A;  5G4I A;  1AHE A;  3LV2 A;  2JIS A;  4RJ0 A;  4RKC A;  3USF A;  1KL1 A;  2Z20 A;  1FC4 A;  1OAT A;  4H63 Q;  3G0T A;  1CQ6 A;  3BCB A;  3ZZJ A;  1C9C A;  3IF2 A;  2AY7 A;  2CTZ A;  3TFU A;  2Z1Y A;  2DKJ A;  4OTL A;  1RVY A;  2CH1 A;  5HHY A;  2VMQ A;  3NX3 A;  4OBU A;  4ZSY A;  4PFF A;  3ZZK A;  1C7O A;  1IAX A;  3K7Y A;  1UU1 A;  1TOG A;  3PA9 A;  4XQ2 A;  4BA4 A;  1C7N A;  1RV3 A;  3N4X A;  1ZC9 A;  3PPL A;  5EAA A;  2KFP A;  2XBN A;  1PFF A;  1C4K A;  4JEV A;  5G4J A;  4F4E A;  3FZ6 A;  3A9Y A;  2OAT A;  3GWP A;  2AY2 A;  3PD6 A;  2ZP7 A;  1AKC A;  3P6K A;  4Q6R A;  4AZJ A;  3BWN C;  5F9S A;  3QPG A;  4WYF A;  3VK2 A;  3L44 A;  5DJ1 A;  3NU7 A;  1G7X A;  1QJ3 A;  3G7Q A;  3HVY A;  4RJY A;  2W7D A;  1GC3 A;  2VGZ A;  2QSR A;  4JE5 A;  3FDD A;  4A6T A;  3FTB A;  4XJP A;  3UWC A;  1WYT A;  4LW4 A;  4Y0I A;  1M7Y A;  3NYT A;  3WY7 A;  3PJ0 A;  5BJ3 A;  3AEO A;  2HOR A;  2FNI A;  5FT6 A;  3FDB A;  2QB3 A;  3FCR A;  4HVK A;  2ZYJ A;  4XAU A;  3HLM A;  4ZAS A;  3W1J A;  5EQC A;  3CQ5 A;  1CL1 A;  1KAF A;  4IX8 A;  1M32 A;  2JJF A;  1BJN A;  4EFF A;  1I29 A;  1BQA A;  3AEP A;  3LVJ A;  5G2Q A;  2Z1Z A;  2HP2 A;  2W7E A;  3FFH A;  1LC8 A;  2HUF A;  3RBF A;  4BA5 A;  3AEN B;  3N5M A;  3WGC A;  3FKD A;  4W8I A;  1VJO A;  1SZS A;  1GC0 A;  2QLR A;  4A0F A;  3NU8 A;  4U2H A;  1TPL A;  2EGY A;  4IW7 A;  3VOM A;  1V2E A;  2C81 A;  1YIY A;  1O62 A;  2FN6 A;  4WYE A;  1MLY A;  3ATH A;  4UOY A;  3I4J A;  2E7U A;  2W7J A;  4Y0D A;  2HUI A;  2AY6 A;  3LG0 A;  3DU4 A;  1QIR A;  2E54 A;  4KYO A;  4NOG A;  3WCN A;  1BJO A;  3WX9 A;  3OP7 A;  1O61 A;  3NYU A;  2AY5 A;  4M2M A;  1N31 A;  3AEJ C;  1ASC A;  3FZ7 A;  4F5J A;  1LS3 A;  4ZSW A;  3NRA A;  1G7W A;  3F6T A;  4ATP A;  2W7F A;  3E9K A;  1C0N A;  1ASG A;  3ELE A;  2RFV A;  3FFR A;  1YAA A;  1DGD A;  2BIG A;  4IXO A;  3COG A;  4GRX A;  4XK1 A;  3F9T A;  4A0R A;  3CAI A;  2BI2 A;  3VK3 A;  2Z9V A;  3FQ8 A;  4IXS A;  4EU1 A;  2VI9 A;  3BWN A;  1H0C A;  2QBT A;  4ZM4 A;  2EPJ A;  2JG2 A;  2W8J A;  1JG8 A;  2VGU A;  4F5I A;  1G4V A;  1FG7 A;  1JF9 A;  3I16 A;  1GEW A;  1IX7 A;  2XH1 A;  3B1E A;  3JZL A;  5M49 A;  1N2T A;  3R4T A;  1BT4 A;  3PDB B;  1D7V A;  2GB3 A;  2VMV A;  2YHK A;  1CJ0 A;  1DGE A;  3EI6 A;  5FT8 A;  4ZDP A;  1ARH A;  2NMP A;  4FFC A;  3JU7 A;  5E5I A;  4EB5 A;  3MBB A;  1QIT A;  5M4B A;  1X0M A;  5F8V A;  4WB0 B;  2AY4 A;  4IYO B;  4DGT A;  1DTY A;  1S0A A;  1GC4 A;  5AX8 A;  1DJ9 A;  1ARS A;  1BKG A;  1M6S A;  3PDX A;  3B46 A;  1EQB A;  1ELQ A;  1SVV A;  2YRR A;  3GZD C;  4MY5 A;  2BI5 A;  1D7R A;  3RBL A;  1CS1 A;  3GSB A;  4ZLV A;  3HMU A;  3L8A A;  4DQ6 A;  3BB8 A;  1DKA A;  2WK7 A;  4Q76 A;  4ADC A;  4TV7 A;  3I5T A;  3UE8 A;  1SZU A;  2OKJ A;  2G7J A;  3QI6 A;  3AEN A;  2R5C B;  3FVS A;  3N4R A;  4DBC A;  1AMQ A;  1B9H A;  3AOW A;  2VMN A;  4R2N A;  4MQQ A;  1SF2 A;  1AIC A;  4WP0 A;  1AX4 A;  1LW4 A;  3AEJ A;  3QM2 A;  2D66 A;  4J5U A;  4JEX A;  4WYG A;  2VIB A;  2R2N A;  1AAM A;  3WCO A;  2Z67 A;  3HQT A;  2D61 A;  2GQN A;  1GEX A;  2ZSM A;  3LWS A;  4RM1 A;  3A8U X;  4QGR A;  1WKH A;  4TN4 A;  3BN1 A;  4UQV A;  3FQ7 A;  1S07 A;  2DGL A;  2VI8 A;  1LC7 A;  1E5E A;  3ASA A;  3DR7 A;  3JWA A;  4R5Z A;  1WST A;  1X2A A;  1Y4I A;  3BCX A;  4PVF A;  2QB2 A;  4P3M A;  3FQA A;  2W7H A;  2YKX A;  1AY4 A;  5FT5 A;  2YKV A;  1IBJ A;  1OHW A;  1W23 A;  1YJY A;  3AEL A;  3FVU A;  2VMP A;  3E2Y A;  3KKI A;  1AJS A;  1AAW A;  1AHF A;  3BCA A;  2VMU A;  1TOE A;  4KAM A;  5HXX A;  1ECX A;  1RVU A;  1KKP A;  2AEV A;  2W8T A;  3DR4 A;  4MKJ A;  3Q8N A;  5JAY A;  2ZY3 A;  3N75 A;  2WK9 A;  2VMY A;  3MAF A;  2Z9X A;  3A9Z A;  3NTJ A;  4BHD A;  4Q31 A;  4PFN A;  2G6W A;  1GDE A;  1AY8 A;  1B5O A;  1M0N A;  3EI8 A;  1D7U A;  3TAT A;  3TFT A;  2OGA A;  4ZDL A;  3MEB A;  4O6Z A;  1MDO A;  1ASE A;  2HOZ A;  2BWP A;  1BJW A;  3LVK A;  1ASL A;  3T32 A;  2DOU A;  3BV0 A;  1T3I A;  4ZDO A;  1ARI A;  1JS3 A;  1TAS A;  4OBV A;  2VLH A;  3VAX A;  1V72 A;  2D7Y A;  1KL2 A;  4GSA A;  4M2K A;  4OC9 A;  2F8J A;  9AAT A;  2PO3 A;  4ZAH A;  3RCH B;  5G0A A;  3WZF A;  3GZD A;  1TOK A;  3N7N A;  4ATQ A;  3WKS A;  3DC1 A;  4EB7 A;  2YOB A;  2W8U A;  4WBT A;  4R8D A;  1SZK A;  1KKJ A;  3AOV A;  1ORD A;  1B8G A;  4AOA A;  1M4N A;  2BWN A;  2VMX A;  2W7G A;  3FVX A;  3B1C A;  3GBX A;  1GCK A;  2VMR A;  5D5S A;  4I8A A;  1I41 A;  1KMK A;  1SPA A;  5BJ4 A;  1DJU A;  2BWO A;  4CBS A;  1UKJ A;  3MC6 C;  3GET A;  5DJ9 A;  5J8Q A;  1WKG A;  3EUC A;  5EUE A;  4ZWV A;  1ZOB A;  3R9A A;  3AEM C;  1M0O A;  4MGR A;  3ACZ A;  1XEY A;  1AMR A;  2FM1 A;  3VP6 A;  4JF0 A;  1WYU B;  1AIA A;  3E77 A;  1H1C A;  1QJ5 A;  2FYF A;  4ZWM A;  3CQ4 A;  3ECD A;  3EI9 A;  1N8P A;  2VLF A;  1W3U A;  3QGU A;  3PGY A;  2W7M A;  2A1V A;  3JWB A;  2BYJ A;  4R5F A;  1VEF A;  1IX6 A;  2CH2 A;  1FG3 A;  2HP1 A;  3P1T A;  4HF8 A;  2ZY4 A;  3GR9 A;  4W1W A;  1AMS A;  2V1P A;  2VYC A;  4OYT A;  3H14 A;  4E1O A;  4MQR A;  2BI9 A;  2AY9 A;  2D65 A;  3HT4 A;  2ZUK A;  2D5Y A;  5TF5 A;  4XJM A;  2VGT A;  2VMO A;  4A6U A;  4RIT A;  2C7T A;  5EIG B;  1ASA A;  3G8M A;  1AKA A;  5M4D A;  4GE7 A;  4K2B A;  3ZRP A;  4JEW A;  3TCM A;  1D2F A;  1GEY A;  4F5M A;  5LH9 A;  2CAN A;  3ELP A;  3A9X A;  1V2D A;  1LC5 A;  1M0P A;  4IY7 A;  4LNJ A;  4UHN A;  4K05 A;  5D95 A;  3A2B A;  1W7L A;  4WYD A;  5G2P A;  5K8B A;  2AY8 A;  3M5U A;  1ARG A;  4RAE A;  3PD6 B;  1CQ8 A;  3CBF A;  3BC8 A;  2PB0 A;  1B4X A;  1BQD A;  4F5K A;  4UHO A;  4ZM3 A;  3RCH A;  2BYL A;  2X8U A;  4N0W A;  1PG8 A;  4ADD A;  4W1X A;  2CJH A;  1TAT A;  2CJG A;  4P7Y A;  3AV7 A;  1Z3Z A;  1LK9 A;  3BS8 A;  4JEZ A;  1OHY A;  1WYT B;  3MC6 A;  4N0B A;  5LHA A;  3NUI A;  1TOJ A;  3RUY A;  4A0G A;  4F5G A;  1WYV B;  4WXG A;  4BMK A;  4JE5 D;  1QZ9 A;  3NNK A;  2X3L A;  3AEM A;  3K40 A;  4WD2 A;  1IJI A;  1B5P A;  1GC2 A;  2JJH A;  4KXK A;  2X5F A;  2PB2 A;  4K2I A;  3PIU A;  1CZC A;  2O1B A;  1TAR A;  3II0 A;  1RV4 A;  2AEU A;  4WXB A;  3KGW A;  2D63 A;  2D64 A;  1LW5 A;  3MAU A;  2Q7W A;  4RLG A;  1D7S A;  5EUN A;  1DJE A;  2HOY A;  2CIN A;  2X5D A;  1IUG A;  4XEW A;  4BQ0 A;  4RKD A; 
#chains in the Genus database with same CATH homology
 3WLX A;  1I43 A;  5FT4 A;  4ITX A;  1TOI A;  2YCN A;  2C44 A;  3GJU A;  4OCA A;  4B98 A;  3KGX A;  3DXW A;  3AAT A;  1BJO B;  3EZS A;  3NYS A;  2BIE A;  3DZZ A;  5DB5 A;  3QN6 A;  1BS0 A;  4MKK A;  3H9X A;  1JS6 A;  2JJE A;  1OXP A;  3VK4 A;  1QIS A;  5EIG A;  4AO4 A;  2HUU A;  3JTX A;  5KTB A;  1LKC A;  4JF1 A;  3MKJ A;  3F0H A;  1I48 A;  1ART A;  2YKY A;  3N4S A;  1W7N A;  1GD9 A;  2JGT A;  3QBO A;  3PDB A;  1YIZ A;  2VMZ A;  4E77 A;  2W8V A;  1PMM A;  1J04 A;  1AHY A;  5I92 A;  1G4X A;  3NDN A;  2OQX A;  2BI3 A;  1ASM A;  2ORD A;  4CXQ A;  1P3W A;  2ZY2 A;  4OT8 A;  4GE4 A;  4WB0 A;  1GBN A;  4IYO A;  3EZ1 A;  1V2F A;  3QHX A;  2QA3 A;  4ITG A;  2AAT A;  1AY5 A;  3E2F A;  4FL0 A;  3FSL A;  3H7F A;  4ADE A;  3EI5 A;  3K28 A;  2C0R A;  3LVM A;  4XJO A;  1S06 A;  4LC3 A;  1BW0 A;  2ZJG A;  3RQ1 A;  3DXV A;  1M0Q A;  4AO9 A;  1SFF A;  1UU2 A;  1ZOD A;  2DR1 A;  4E3R A;  1B9I A;  3UAK A;  2VMT A;  2D7Z A;  4IXZ A;  1ELU A;  3PAA A;  2BKW A;  2YKU A;  1WYV A;  2O7C A;  2DKB A;  2R5C A;  3ISL A;  3HL2 A;  2CY8 A;  2HZP A;  1ASD A;  3KE3 A;  4W5K A;  2CFB A;  2VMW A;  4JEY A;  2TPL A;  5EAV A;  2HOX A;  1XI9 A;  2CST A;  1X28 A;  2VGV A;  4ISY A;  4WLJ A;  3DRD A;  5DX5 A;  2CJD A;  3E2Z B;  4K2M A;  1EJI A;  4A0H A;  4TMR A;  3D6K A;  2QMA A;  3MAD A;  4H51 A;  2Z9W A;  2ZC0 A;  3CQ6 A;  2BI1 A;  1YOO A;  1AIB A;  1KMJ A;  4W1V A;  5G09 A;  4A6R A;  2FKI A;  4M2J A;  1CZE A;  1YNU A;  3B8X A;  2E7I A;  3EIB A;  3JW9 A;  5EFS A;  2OKK A;  2Z9U A;  4PIW A;  1O69 A;  2WKA A;  1YJZ A;  1AKB A;  1AJR A;  2BHX A;  4WXF A;  3N0L A;  4E3Q A;  5E3K A;  1CQ7 A;  3WKR A;  3E6G A;  2W7L A;  2O0R A;  3W1I A;  2EZ2 A;  4LNL A;  4MQP A;  4Q75 A;  4MSO A;  4F5F A;  3OKS A;  4AZK A;  1IAY A;  3ZRR A;  3DYD A;  4F5L A;  5EUD A;  2VGW A;  3NUB A;  2W7I A;  4W91 A;  3IHJ A;  3W1H A;  1YJS A;  4CBR A;  1AJS B;  4B9B A;  2WB6 A;  1E5F A;  2YCP A;  2YRI A;  3GZC A;  3WGB A;  3MAF B;  4GDY A;  5E4Z A;  3HBX A;  1IVR A;  3FRK A;  2Z61 A;  4WYC A;  4A72 A;  7AAT A;  1ASB A;  1Z7D A;  2AY3 A;  2JJG A;  3LY1 A;  4WYA A;  3BWO A;  1MGV A;  4CXR A;  2CB1 A;  4AH3 A;  1OXO A;  4OMA A;  3EI7 A;  5M46 A;  2EYQ A;  2DGM A;  1C7G A;  1PMO A;  1MDZ A;  1ASN A;  2FNU A;  1IX8 A;  1DFO A;  3HDO A;  2FQ6 A;  3TQX A;  1O4S A;  1S08 A;  1MDX A;  1MLZ A;  1BJ4 A;  2GMU A;  1ASF A;  3DOD A;  5HDM A;  1X29 A;  3EIA A;  3LVL B;  4J8L A;  4ADB A;  5C6U A;  2ZY5 A;  2EH6 A;  2VIA A;  4GE9 A;  4GEB A;  3ASB A;  4L0O A;  2WK8 A;  3B1D A;  4XJL A;  2YCT A;  1UU0 A;  2GMS A;  4LW2 A;  1MAP A;  1VP4 A;  2VMS A;  2GSA A;  1AHG A;  4A00 A;  3ZRQ A;  4WLH A;  4U1T A;  3FZ8 A;  1CL2 A;  1S09 A;  2DGK A;  3RI6 A;  2V0Y A;  1EG5 A;  1W7M A;  1WYU A;  2VGS A;  4UHM A;  1J32 A;  3E2Z A;  4Y0H A;  1AMA A;  1MAQ A;  2EO5 A;  2W7K A;  2EZ1 A;  1AHX A;  2R5E A;  4CVQ A;  8AAT A;  2R0T A;  2OGE A;  4LNM A;  5IWQ A;  1QGN A;  2W8W A;  2AY1 A;  2E7J A;  1U08 A;  2ZSL A;  3FD0 A;  4RIZ A;  4EMY A;  4F5H A;  1OHV A;  2BIA A;  5G4I A;  1AHE A;  3LV2 A;  2JIS A;  4RJ0 A;  4RKC A;  3USF A;  1KL1 A;  2Z20 A;  1FC4 A;  1OAT A;  4H63 Q;  3G0T A;  1CQ6 A;  3BCB A;  3ZZJ A;  1C9C A;  3IF2 A;  2AY7 A;  2CTZ A;  3TFU A;  2Z1Y A;  2DKJ A;  4OTL A;  1RVY A;  2CH1 A;  5HHY A;  2VMQ A;  3NX3 A;  4OBU A;  4ZSY A;  4PFF A;  3ZZK A;  1C7O A;  1IAX A;  3K7Y A;  1UU1 A;  1TOG A;  3PA9 A;  4XQ2 A;  4BA4 A;  1C7N A;  1RV3 A;  3N4X A;  1ZC9 A;  3PPL A;  5EAA A;  2KFP A;  2XBN A;  1PFF A;  1C4K A;  4JEV A;  5G4J A;  4F4E A;  3FZ6 A;  3A9Y A;  2OAT A;  3GWP A;  2AY2 A;  3PD6 A;  2ZP7 A;  1AKC A;  3P6K A;  4Q6R A;  4AZJ A;  3BWN C;  5F9S A;  3QPG A;  4WYF A;  3VK2 A;  3L44 A;  5DJ1 A;  3NU7 A;  1G7X A;  1QJ3 A;  3G7Q A;  3HVY A;  4RJY A;  2W7D A;  1GC3 A;  2VGZ A;  2QSR A;  4JE5 A;  3FDD A;  4A6T A;  3FTB A;  4XJP A;  3UWC A;  1WYT A;  4LW4 A;  4Y0I A;  1M7Y A;  3NYT A;  3WY7 A;  3PJ0 A;  5BJ3 A;  3AEO A;  2HOR A;  2FNI A;  5FT6 A;  3FDB A;  2QB3 A;  3FCR A;  4HVK A;  2ZYJ A;  4XAU A;  3HLM A;  4ZAS A;  3W1J A;  5EQC A;  3CQ5 A;  1CL1 A;  4IX8 A;  1M32 A;  2JJF A;  1BJN A;  4EFF A;  1I29 A;  1BQA A;  3AEP A;  3LVJ A;  5G2Q A;  2Z1Z A;  2HP2 A;  2W7E A;  3FFH A;  1LC8 A;  2HUF A;  3RBF A;  4BA5 A;  3AEN B;  3N5M A;  3WGC A;  3FKD A;  4W8I A;  1VJO A;  1SZS A;  1GC0 A;  2QLR A;  4A0F A;  3NU8 A;  4U2H A;  1TPL A;  2EGY A;  4IW7 A;  3VOM A;  1V2E A;  2C81 A;  1YIY A;  1O62 A;  2FN6 A;  4WYE A;  1MLY A;  3ATH A;  4UOY A;  3I4J A;  2E7U A;  2W7J A;  4Y0D A;  2HUI A;  2AY6 A;  3LG0 A;  3DU4 A;  1QIR A;  2E54 A;  4KYO A;  4NOG A;  3WCN A;  1BJO A;  3WX9 A;  3OP7 A;  1O61 A;  3NYU A;  2AY5 A;  4M2M A;  1N31 A;  3AEJ C;  1ASC A;  3FZ7 A;  4F5J A;  1LS3 A;  4ZSW A;  3NRA A;  1G7W A;  3F6T A;  4ATP A;  2W7F A;  3E9K A;  1C0N A;  1ASG A;  3ELE A;  2RFV A;  3FFR A;  1YAA A;  1DGD A;  2BIG A;  4IXO A;  3COG A;  4GRX A;  4XK1 A;  3F9T A;  4A0R A;  3CAI A;  2BI2 A;  3VK3 A;  2Z9V A;  3FQ8 A;  4IXS A;  4EU1 A;  2VI9 A;  3BWN A;  1H0C A;  2QBT A;  4ZM4 A;  2EPJ A;  2JG2 A;  2W8J A;  1JG8 A;  2VGU A;  4F5I A;  1G4V A;  1FG7 A;  1JF9 A;  3I16 A;  1GEW A;  1IX7 A;  2XH1 A;  3B1E A;  3JZL A;  5M49 A;  1N2T A;  3R4T A;  1BT4 A;  3PDB B;  1D7V A;  2GB3 A;  2VMV A;  2YHK A;  1CJ0 A;  1DGE A;  3EI6 A;  5FT8 A;  4ZDP A;  1ARH A;  2NMP A;  4FFC A;  3JU7 A;  5E5I A;  4EB5 A;  3MBB A;  1QIT A;  5M4B A;  1X0M A;  5F8V A;  4WB0 B;  2AY4 A;  4IYO B;  4DGT A;  1DTY A;  1S0A A;  1GC4 A;  5AX8 A;  1DJ9 A;  1ARS A;  1BKG A;  1M6S A;  3PDX A;  3B46 A;  1EQB A;  1ELQ A;  1SVV A;  2YRR A;  3GZD C;  4MY5 A;  2BI5 A;  1D7R A;  3RBL A;  1CS1 A;  3GSB A;  4ZLV A;  3HMU A;  3L8A A;  4DQ6 A;  3BB8 A;  1DKA A;  2WK7 A;  4Q76 A;  4ADC A;  4TV7 A;  3I5T A;  3UE8 A;  1SZU A;  2OKJ A;  2G7J A;  3QI6 A;  3AEN A;  2R5C B;  3FVS A;  3N4R A;  4DBC A;  1AMQ A;  1B9H A;  3AOW A;  2VMN A;  4R2N A;  4MQQ A;  1SF2 A;  1AIC A;  4WP0 A;  1AX4 A;  1LW4 A;  3AEJ A;  3QM2 A;  2D66 A;  4J5U A;  4JEX A;  4WYG A;  2VIB A;  2R2N A;  1AAM A;  3WCO A;  2Z67 A;  3HQT A;  2D61 A;  2GQN A;  1GEX A;  2ZSM A;  3LWS A;  4RM1 A;  3A8U X;  4QGR A;  1WKH A;  4TN4 A;  3BN1 A;  4UQV A;  3FQ7 A;  1S07 A;  2DGL A;  2VI8 A;  1LC7 A;  1E5E A;  3ASA A;  3DR7 A;  3JWA A;  4R5Z A;  1WST A;  1X2A A;  1Y4I A;  3BCX A;  4PVF A;  2QB2 A;  4P3M A;  3FQA A;  2W7H A;  2YKX A;  1AY4 A;  5FT5 A;  2YKV A;  1IBJ A;  1OHW A;  1W23 A;  1YJY A;  3AEL A;  3FVU A;  2VMP A;  3E2Y A;  3KKI A;  1AJS A;  1AAW A;  1AHF A;  3BCA A;  2VMU A;  1TOE A;  4KAM A;  5HXX A;  1ECX A;  1RVU A;  1KKP A;  2AEV A;  2W8T A;  3DR4 A;  4MKJ A;  3Q8N A;  5JAY A;  2ZY3 A;  3N75 A;  2WK9 A;  2VMY A;  3MAF A;  2Z9X A;  3A9Z A;  3NTJ A;  4BHD A;  4Q31 A;  4PFN A;  2G6W A;  1GDE A;  1AY8 A;  1B5O A;  1M0N A;  3EI8 A;  1D7U A;  3TAT A;  3TFT A;  2OGA A;  4ZDL A;  3MEB A;  4O6Z A;  1MDO A;  1ASE A;  2HOZ A;  2BWP A;  1BJW A;  3LVK A;  1ASL A;  3T32 A;  2DOU A;  3BV0 A;  1T3I A;  4ZDO A;  1ARI A;  1JS3 A;  1TAS A;  4OBV A;  2VLH A;  3VAX A;  1V72 A;  2D7Y A;  1KL2 A;  4GSA A;  4M2K A;  4OC9 A;  2F8J A;  9AAT A;  2PO3 A;  4ZAH A;  3RCH B;  5G0A A;  3WZF A;  3GZD A;  1TOK A;  3N7N A;  4ATQ A;  3WKS A;  3DC1 A;  4EB7 A;  2YOB A;  2W8U A;  4WBT A;  4R8D A;  1SZK A;  1KKJ A;  3AOV A;  1ORD A;  1B8G A;  4AOA A;  1M4N A;  2BWN A;  2VMX A;  2W7G A;  3FVX A;  3B1C A;  3GBX A;  1GCK A;  2VMR A;  5D5S A;  4I8A A;  1I41 A;  1KMK A;  1SPA A;  5BJ4 A;  1DJU A;  2BWO A;  4CBS A;  1UKJ A;  3MC6 C;  3GET A;  5DJ9 A;  5J8Q A;  1WKG A;  3EUC A;  5EUE A;  4ZWV A;  1ZOB A;  3R9A A;  3AEM C;  1M0O A;  4MGR A;  3ACZ A;  1XEY A;  1AMR A;  2FM1 A;  3VP6 A;  4JF0 A;  1WYU B;  1AIA A;  3E77 A;  1H1C A;  1QJ5 A;  2FYF A;  4ZWM A;  3CQ4 A;  3ECD A;  3EI9 A;  1N8P A;  2VLF A;  1W3U A;  3QGU A;  3PGY A;  2W7M A;  2A1V A;  3JWB A;  2BYJ A;  4R5F A;  1VEF A;  1IX6 A;  2CH2 A;  1FG3 A;  2HP1 A;  3P1T A;  4HF8 A;  2ZY4 A;  3GR9 A;  4W1W A;  1AMS A;  2V1P A;  2VYC A;  4OYT A;  3H14 A;  4E1O A;  4MQR A;  2BI9 A;  2AY9 A;  2D65 A;  3HT4 A;  2ZUK A;  2D5Y A;  5TF5 A;  4XJM A;  2VGT A;  2VMO A;  4A6U A;  4RIT A;  2C7T A;  5EIG B;  1ASA A;  3G8M A;  1AKA A;  5M4D A;  4GE7 A;  4K2B A;  3ZRP A;  4JEW A;  3TCM A;  1D2F A;  1GEY A;  4F5M A;  5LH9 A;  2CAN A;  3ELP A;  3A9X A;  1V2D A;  1LC5 A;  1M0P A;  4IY7 A;  4LNJ A;  4UHN A;  4K05 A;  5D95 A;  3A2B A;  1W7L A;  4WYD A;  5G2P A;  5K8B A;  2AY8 A;  3M5U A;  1ARG A;  4RAE A;  3PD6 B;  1CQ8 A;  3CBF A;  3BC8 A;  2PB0 A;  1B4X A;  1BQD A;  4F5K A;  4UHO A;  4ZM3 A;  3RCH A;  2BYL A;  2X8U A;  4N0W A;  1PG8 A;  4ADD A;  4W1X A;  2CJH A;  1TAT A;  2CJG A;  4P7Y A;  3AV7 A;  1Z3Z A;  1LK9 A;  3BS8 A;  4JEZ A;  1OHY A;  1WYT B;  3MC6 A;  4N0B A;  5LHA A;  3NUI A;  1TOJ A;  3RUY A;  4A0G A;  4F5G A;  1WYV B;  4WXG A;  4BMK A;  4JE5 D;  1QZ9 A;  3NNK A;  2X3L A;  3AEM A;  3K40 A;  4WD2 A;  1IJI A;  1B5P A;  1GC2 A;  2JJH A;  4KXK A;  2X5F A;  2PB2 A;  4K2I A;  3PIU A;  1CZC A;  2O1B A;  1TAR A;  3II0 A;  1RV4 A;  2AEU A;  4WXB A;  3KGW A;  2D63 A;  2D64 A;  1LW5 A;  3MAU A;  2Q7W A;  4RLG A;  1D7S A;  5EUN A;  1DJE A;  2HOY A;  2CIN A;  2X5D A;  1IUG A;  4XEW A;  4BQ0 A;  4RKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...