3OP9A

Crystal structure of transcriptional regulator from listeria innocua
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
109
structure length
107
Chain Sequence
IQHQFAENLSRLKKEHGLKNHQIAELLNVQTRTVAYYMSGETKPDIEKLIRLATYFHLSIDELVGYVQEVWNDLSLKQWLLSLNLRSEEEIAKIKILVDTVETLYPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of transcriptional regulator from Listeria innocua
rcsb
source organism Listeria innocua
molecule tags Transcription regulator
molecule keywords Pli0006 protein
total genus 33
structure length 107
sequence length 109
ec nomenclature
pdb deposition date 2010-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3op9A01
3PXPA 3QF3A 2GRLA 2KPJA 2PPXA 3G7DA 3GN5A 3H5TA 2IU7A 3OP9A 1ZUGA 4FN3A 2CSFA 4PU4C 1S7EA 2LYQA 4Z5HA 2O4AA 1XWRA 4J1XA 2WUSR 2R63A 4Y42A 2R1JL 1UXDA 2XI8A 4IVZA 4X4FA 4JCXA 4IWRA 5K98B 1LQCA 2AWIA 2XJ3A 1HF0A 2H8RA 4YG7B 3OMTA 1IC8A 2EBYA 1ZZBA 4PU7A 2IVBA 1RZRA 4X4BA 4MCXA 1L1MA 1WH8A 1EFAA 1E3OC 2D5VA 2PUFA 1PRVA 1SQ8A 1DWKA 2O38A 2PIJA 2XIUA 3FYAA 2LYKA 2GRMA 1PRAA 3KJXA 2XSDC 1QQBA 3OQNA 4NDWA 1BDIA 4GHJA 2BJCA 2EF8A 3F6WA 1O4XA 3KXAA 1QP7A 1PERL 3QWGA 4IA8A 2IV1A 3R1FA 1ZAYA 1ZS4A 2LYLA 1PRUA 1YSEA 2AUWA 2B5AA 1ZVVA 1QP0A 1UXCA 2MEZA 1JFSA 1UTXA 2PUGA 1WIZA 2FJRA 4OB4A 1LLIA 2AXUA 2MQKA 2WIUB 3EUSA 3ZKCA 3O9XA 4Z5DA 2KZ8A 2L8NA 4GQMA 3VK0A 2EWTA 3B7HA 1RIOA 2ICTA 3FMYA 2BNNA 4FBIA 1NEQA 3U3WA 1JH9A 2HINA 1WH6A 1ZPQA 3SCHA 3DNVB 3SCFA 3OQMA 1POUA 4YARA 1RPEL 1Y7YA 2ICPA 1ZZ8A 4I6TA 5A7LA 2XCJA 1X57A 4Z59A 3QQ6A 4MCTA 4I6UA 3CROL 3TRBA 2AW6A 4X4GA 3FYMA 1BDHA 1DW9A 2PUCA 4JQDA 1LMB3 1R69A 1B0NA 1JWLA 4F8DA 4I6RA 3SCGA 4J1WA 3LFPA 4PU3C 1LCDA 2AXVA 4X4IA 1JFTA 1RZRD 3CLCA 3JXBC 2O49A 1QQAA 2LYRA 3JXCL 2OR1L 3LISA 2LCVA 1OSLA 1ZZCA 2JVLA 1LCCA 1VPWA 1ZZ7A 4JCYA 1OCTC 4PU8A 3CECA 3QYXA 2PUDA 2PE5A 2LYSA 3ZHIA 3HZIB 1CJGA 1R63A 2BNOA 2OFYA 4Z5CA 1NERA 2AXZA 3JXDL 1ZZ9A 4X4HA 2KEJA 3UFDA 2PUAA 2IUOA 2L49A 2GZUA 4YG1A 2BNMA 1RZSA 2JCGA 4O8BA 1ADRA 2LYPA 3MLFA 2CROA 1QP4A 2PUEA 2KEIA 3OQOA 2LYJA 4X4DA 3F51A 3BS3A 3D1NI 3GBFA 1X2LA 1Y9QA 3F52A 4YBAA 1ZZ6A 1PNRA 3RZZA 4X4CA 3BDNA 3S8QA 4YG4A 4Z58A 3KZ3A 1CQTA 3IVPA 3GN5B 1GT0C 2KEKA 2PUBA 2IVQA 2HSGA 1AU7A 1QPZA 3BD1A 4X4EA 3L1PA 4I8TA 3G5GA 2A6CA 1WETA 2IVGA 3ZHMA
chains in the Genus database with same CATH superfamily
2GRLA 3GN5A 2O4AA 2LYQA 2WUSR 4Y42A 3QOWA 2XI8A 4JCXA 4IWRA 3OMTA 1ZZBA 4PU7A 2LNMA 2PUFA 1DWKA 2PIJA 2XIUA 2XSDC 2GRMA 5GAHi 3OQNA 4GHJA 2BJCA 2XXPA 3KXAA 1QP7A 4IA8A 3R1FA 1ZS4A 3QOXA 2LLWA 2AUWA 2B5AA 1QP0A 4DE9A 1JFSA 4ER7A 2FJRA 2AXUA 2EWTA 1RIOA 3U3WA 2HINA 3OQMA 1ZZ8A 5A7LA 3GUUA 5DT2A 1DULA 3TRBA 3FYMA 1BDHA 1R69A 3UWPA 3LFPA 3ME5A 3GZDC 4X4IA 1RZRD 2J7WA 3JXBC 2O49A 2LYRA 3OKZA 2ODRD 2LCVA 1LCCA 1ZZCA 2JVLA 1OCTC 3QYXA 2PUDA 3A9XA 2LYSA 3ZHIA 1CJGA 4ER3A 3JXDL 2PXFA 2BNMA 1RZSA 2PUEA 3DM5A 2LYJA 2PXDA 3BS3A 1Y9QA 1PNRA 1ZZ6A 3SR4A 5DTRA 4X4CA 4Z58A 1CQTA 3GN5B 1GT0C 2PUBA 2IVQA 2HSGA 2HCSA 3BD1A 3G5GA 3PE5A 1LLIA 3ZHMA 3H5TA 2PPXA 4Z5HA 1XWRA 3A9YA 5K98B 1LQCA 1HQ1A 2H8RA 1WH8A 1EFAA 2O38A 3LQXA 2LYKA 1PRAA 1QQBA 3M9LA 2JQEA 1ZAYA 1YSEA 1UXCA 3TFLA 1QB2A 3O9XA 5DRTA 2L8NA 2PXUA 3VK0A 3B7HA 2ICTA 3FMYA 3SCFA 1RPEL 4I6TA 3GZDA 2XCJA 4Z59A 4MCTA 2PXTA 3CROL 4X4GA 2PUCA 3MEJA 1JWLA 4J1WA 2AXVA 1QQAA 3LISA 1VPWA 2L1PA 4JCYA 2FFHA 3HZIB 2BNOA 4Z5CA 1NERA 2KEJA 2GZUA 1NW3A 4YG1A 3QFIA 2JCGA 3MLFA 2KEIA 3OQOA 4X4DA 3F51A 2PXEA 4ER0A 1X2LA 2VEOA 3KZ3A 2V3CC 2KEKA 1QPZA 4X4EA 4I8TA 1WETA 2PXLA 3A9ZA 3PXPA 3QF3A 3KL4A 3G7DA 2YBDA 3OP9A 4PU4C 1JFTA 1MFQC 2R63A 4IVZA 2PXVA 2AWIA 4EK9A 1HF0A 2EBYA 2M4HA 2IVBA 1RZRA 4MCXA 1L1MA 5GAGi 2D5VA 1PRVA 1SQ8A 3VWSA 3FYAA 5DRYA 2XXAA 4EKGA 1BDIA 4NDWA 2EF8A 3F6WA 1U2ZA 2LYLA 1WIZA 5DSXA 4OB4A 2MQKA 2WIUB 3ZKCA 2KZ8A 4Q2JA 2BNNA 4FBIA 3SCHA 3DNVB 5DTMA 1POUA 2ICPA 2PXKA 1X57A 4JQDA 2AW6A 2J7UA 1LMB3 4I6RA 3SCGA 3CLCA 2PXQA 3JXCL 2OR1L 1OSLA 1ZZ7A 3CECA 2HFZA 2PE5A 1R63A 2OFYA 1ZZ9A 3UFDA 3G0TA 2PUAA 2IUOA 2L49A 2XXQA 3NZLA 4O8BA 1ADRA 2MXDA 2CROA 3NROA 3GZCA 3R09A 3GBFA 4YBAA 3BDNA 3S8QA 4YG4A 4ER5A 3IVPA 4EQZA 2KPJA 3OWQA 2IU7A 1ZUGA 4FN3A 2CSFA 1S7EA 4J1XA 2R1JL 1UXDA 4X4FA 2XJ3A 4YG7B 1IC8A 4EZIA 4X4BA 1E3OC 4HRAA 3KJXA 1O4XA 4DE8A 1PERL 3QWGA 2IV1A 1PRUA 3TELA 3TEPA 1ZVVA 2MEZA 1UTXA 2PUGA 3ZPXA 4OBMA 3NDBB 3EUSA 4ER6A 4Z5DA 4GQMA 2LLVA 1QZXA 1NEQA 2HCNA 1JH9A 1WH6A 1ZPQA 4YARA 1Y7YA 5DTQA 3QQ6A 4I6UA 1DW9A 3SX0A 1B0NA 4F8DA 4PU3C 1LCDA 4EKIA 4PU8A 2AXZA 4X4HA 4WVLA 2LYPA 1QP4A 5JUWA 3D1NI 3F52A 3RZZA 3NXHA 1AU7A 3L1PA 2PXPA 2PXBA 2A6CA 2IVGA
chains in the Genus database with same CATH topology
3PXPA 3QF3A 2GRLA 2KPJA 2PPXA 3G7DA 3GN5A 3H5TA 2IU7A 3OP9A 1ZUGA 4FN3A 2CSFA 4PU4C 1S7EA 2LYQA 4Z5HA 2O4AA 1XWRA 4J1XA 2WUSR 2R63A 4Y42A 2R1JL 1UXDA 2XI8A 4IVZA 4X4FA 4JCXA 4IWRA 5K98B 1LQCA 2AWIA 2XJ3A 1HF0A 2H8RA 4YG7B 3OMTA 1IC8A 2EBYA 1ZZBA 4PU7A 2IVBA 1RZRA 4X4BA 4MCXA 1L1MA 1WH8A 1EFAA 1E3OC 2D5VA 2PUFA 1PRVA 1SQ8A 1DWKA 2O38A 2PIJA 2XIUA 3FYAA 2LYKA 2GRMA 1PRAA 3KJXA 2XSDC 1QQBA 3OQNA 4NDWA 1BDIA 4GHJA 2BJCA 2EF8A 3F6WA 1O4XA 3KXAA 1QP7A 1PERL 3QWGA 4IA8A 2IV1A 3R1FA 1ZAYA 1ZS4A 2LYLA 1PRUA 1YSEA 2AUWA 2B5AA 1ZVVA 1QP0A 1UXCA 2MEZA 1JFSA 1UTXA 2PUGA 1WIZA 2FJRA 4OB4A 1LLIA 2AXUA 2MQKA 2WIUB 3EUSA 3ZKCA 3O9XA 4Z5DA 2KZ8A 2L8NA 4GQMA 3VK0A 2EWTA 3B7HA 1RIOA 2ICTA 3FMYA 2BNNA 4FBIA 1NEQA 3U3WA 1JH9A 2HINA 1WH6A 1ZPQA 3SCHA 3DNVB 3SCFA 3OQMA 1POUA 4YARA 1RPEL 1Y7YA 2ICPA 1ZZ8A 4I6TA 5A7LA 2XCJA 1X57A 4Z59A 3QQ6A 4MCTA 4I6UA 3CROL 3TRBA 2AW6A 4X4GA 3FYMA 1BDHA 1DW9A 2PUCA 4JQDA 1LMB3 1R69A 1B0NA 1JWLA 4F8DA 4I6RA 3SCGA 4J1WA 3LFPA 4PU3C 1LCDA 2AXVA 4X4IA 1JFTA 1RZRD 3CLCA 3JXBC 2O49A 1QQAA 2LYRA 3JXCL 2OR1L 3LISA 2LCVA 1OSLA 1ZZCA 2JVLA 1LCCA 1VPWA 1ZZ7A 4JCYA 1OCTC 4PU8A 3CECA 3QYXA 2PUDA 2PE5A 2LYSA 3ZHIA 3HZIB 1CJGA 1R63A 2BNOA 2OFYA 4Z5CA 1NERA 2AXZA 3JXDL 1ZZ9A 4X4HA 2KEJA 3UFDA 2PUAA 2IUOA 2L49A 2GZUA 4YG1A 2BNMA 1RZSA 2JCGA 4O8BA 1ADRA 2LYPA 3MLFA 2CROA 1QP4A 2PUEA 2KEIA 3OQOA 2LYJA 4X4DA 3F51A 3BS3A 3D1NI 3GBFA 1X2LA 1Y9QA 3F52A 4YBAA 1ZZ6A 1PNRA 3RZZA 4X4CA 3BDNA 3S8QA 4YG4A 4Z58A 3KZ3A 1CQTA 3IVPA 3GN5B 1GT0C 2KEKA 2PUBA 2IVQA 2HSGA 1AU7A 1QPZA 3BD1A 4X4EA 3L1PA 4I8TA 3G5GA 2A6CA 1WETA 2IVGA 3ZHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXP A;  3QF3 A;  2GRL A;  2KPJ A;  2PPX A;  3G7D A;  3GN5 A;  3H5T A;  2IU7 A;  3OP9 A;  1ZUG A;  4FN3 A;  2CSF A;  4PU4 C;  1S7E A;  2LYQ A;  4Z5H A;  2O4A A;  1XWR A;  4J1X A;  2WUS R;  2R63 A;  4Y42 A;  2R1J L;  1UXD A;  2XI8 A;  4IVZ A;  4X4F A;  4JCX A;  4IWR A;  5K98 B;  1LQC A;  2AWI A;  2XJ3 A;  1HF0 A;  2H8R A;  4YG7 B;  3OMT A;  1IC8 A;  2EBY A;  1ZZB A;  4PU7 A;  2IVB A;  1RZR A;  4X4B A;  4MCX A;  1L1M A;  1WH8 A;  1EFA A;  1E3O C;  2D5V A;  2PUF A;  1PRV A;  1SQ8 A;  1DWK A;  2O38 A;  2PIJ A;  2XIU A;  3FYA A;  2LYK A;  2GRM A;  1PRA A;  3KJX A;  2XSD C;  1QQB A;  3OQN A;  4NDW A;  1BDI A;  4GHJ A;  2BJC A;  2EF8 A;  3F6W A;  1O4X A;  3KXA A;  1QP7 A;  1PER L;  3QWG A;  4IA8 A;  2IV1 A;  3R1F A;  1ZAY A;  1ZS4 A;  2LYL A;  1PRU A;  1YSE A;  2AUW A;  2B5A A;  1ZVV A;  1QP0 A;  1UXC A;  2MEZ A;  1JFS A;  1UTX A;  2PUG A;  1WIZ A;  2FJR A;  4OB4 A;  1LLI A;  2AXU A;  2MQK A;  2WIU B;  3EUS A;  3ZKC A;  3O9X A;  4Z5D A;  2KZ8 A;  2L8N A;  4GQM A;  3VK0 A;  2EWT A;  3B7H A;  1RIO A;  2ICT A;  3FMY A;  2BNN A;  4FBI A;  1NEQ A;  3U3W A;  1JH9 A;  2HIN A;  1WH6 A;  1ZPQ A;  3SCH A;  3DNV B;  3SCF A;  3OQM A;  1POU A;  4YAR A;  1RPE L;  1Y7Y A;  2ICP A;  1ZZ8 A;  4I6T A;  5A7L A;  2XCJ A;  1X57 A;  4Z59 A;  3QQ6 A;  4MCT A;  4I6U A;  3CRO L;  3TRB A;  2AW6 A;  4X4G A;  3FYM A;  1BDH A;  1DW9 A;  2PUC A;  4JQD A;  1LMB 3;  1R69 A;  1B0N A;  1JWL A;  4F8D A;  4I6R A;  3SCG A;  4J1W A;  3LFP A;  4PU3 C;  1LCD A;  2AXV A;  4X4I A;  1JFT A;  1RZR D;  3CLC A;  3JXB C;  2O49 A;  1QQA A;  2LYR A;  3JXC L;  2OR1 L;  3LIS A;  2LCV A;  1OSL A;  1ZZC A;  2JVL A;  1LCC A;  1VPW A;  1ZZ7 A;  4JCY A;  1OCT C;  4PU8 A;  3CEC A;  3QYX A;  2PUD A;  2PE5 A;  2LYS A;  3ZHI A;  3HZI B;  1CJG A;  1R63 A;  2BNO A;  2OFY A;  4Z5C A;  1NER A;  2AXZ A;  3JXD L;  1ZZ9 A;  4X4H A;  2KEJ A;  3UFD A;  2PUA A;  2IUO A;  2L49 A;  2GZU A;  4YG1 A;  2BNM A;  1RZS A;  2JCG A;  4O8B A;  1ADR A;  2LYP A;  3MLF A;  2CRO A;  1QP4 A;  2PUE A;  2KEI A;  3OQO A;  2LYJ A;  4X4D A;  3F51 A;  3BS3 A;  3D1N I;  3GBF A;  1X2L A;  1Y9Q A;  3F52 A;  4YBA A;  1ZZ6 A;  1PNR A;  3RZZ A;  4X4C A;  3BDN A;  3S8Q A;  4YG4 A;  4Z58 A;  3KZ3 A;  1CQT A;  3IVP A;  3GN5 B;  1GT0 C;  2KEK A;  2PUB A;  2IVQ A;  2HSG A;  1AU7 A;  1QPZ A;  3BD1 A;  4X4E A;  3L1P A;  4I8T A;  3G5G A;  2A6C A;  1WET A;  2IVG A;  3ZHM A; 
#chains in the Genus database with same CATH topology
 2GRL A;  3GN5 A;  2O4A A;  2LYQ A;  2WUS R;  4Y42 A;  3QOW A;  2XI8 A;  4JCX A;  4IWR A;  3OMT A;  1ZZB A;  4PU7 A;  2LNM A;  2PUF A;  1DWK A;  2PIJ A;  2XIU A;  2XSD C;  2GRM A;  5GAH i;  3OQN A;  4GHJ A;  2BJC A;  2XXP A;  3KXA A;  1QP7 A;  4IA8 A;  3R1F A;  1ZS4 A;  3QOX A;  2LLW A;  2AUW A;  2B5A A;  1QP0 A;  4DE9 A;  1JFS A;  4ER7 A;  2FJR A;  2AXU A;  2EWT A;  1RIO A;  3U3W A;  2HIN A;  3OQM A;  1ZZ8 A;  5A7L A;  3GUU A;  5DT2 A;  1DUL A;  3TRB A;  3FYM A;  1BDH A;  1R69 A;  3UWP A;  3LFP A;  3ME5 A;  3GZD C;  4X4I A;  1RZR D;  2J7W A;  3JXB C;  2O49 A;  2LYR A;  3OKZ A;  2ODR D;  2LCV A;  1LCC A;  1ZZC A;  2JVL A;  1OCT C;  3QYX A;  2PUD A;  3A9X A;  2LYS A;  3ZHI A;  1CJG A;  4ER3 A;  3JXD L;  2PXF A;  2BNM A;  1RZS A;  2PUE A;  3DM5 A;  2LYJ A;  2PXD A;  3BS3 A;  1Y9Q A;  1PNR A;  1ZZ6 A;  3SR4 A;  5DTR A;  4X4C A;  4Z58 A;  1CQT A;  3GN5 B;  1GT0 C;  2PUB A;  2IVQ A;  2HSG A;  2HCS A;  3BD1 A;  3G5G A;  3PE5 A;  1LLI A;  3ZHM A;  3H5T A;  2PPX A;  4Z5H A;  1XWR A;  3A9Y A;  5K98 B;  1LQC A;  1HQ1 A;  2H8R A;  1WH8 A;  1EFA A;  2O38 A;  3LQX A;  2LYK A;  1PRA A;  1QQB A;  3M9L A;  2JQE A;  1ZAY A;  1YSE A;  1UXC A;  3TFL A;  1QB2 A;  3O9X A;  5DRT A;  2L8N A;  2PXU A;  3VK0 A;  3B7H A;  2ICT A;  3FMY A;  3SCF A;  1RPE L;  4I6T A;  3GZD A;  2XCJ A;  4Z59 A;  4MCT A;  2PXT A;  3CRO L;  4X4G A;  2PUC A;  3MEJ A;  1JWL A;  4J1W A;  2AXV A;  1QQA A;  3LIS A;  1VPW A;  2L1P A;  4JCY A;  2FFH A;  3HZI B;  2BNO A;  4Z5C A;  1NER A;  2KEJ A;  2GZU A;  1NW3 A;  4YG1 A;  3QFI A;  2JCG A;  3MLF A;  2KEI A;  3OQO A;  4X4D A;  3F51 A;  2PXE A;  4ER0 A;  1X2L A;  2VEO A;  3KZ3 A;  2V3C C;  2KEK A;  1QPZ A;  4X4E A;  4I8T A;  1WET A;  2PXL A;  3A9Z A;  3PXP A;  3QF3 A;  3KL4 A;  3G7D A;  2YBD A;  3OP9 A;  4PU4 C;  1JFT A;  1MFQ C;  2R63 A;  4IVZ A;  2PXV A;  2AWI A;  4EK9 A;  1HF0 A;  2EBY A;  2M4H A;  2IVB A;  1RZR A;  4MCX A;  1L1M A;  5GAG i;  2D5V A;  1PRV A;  1SQ8 A;  3VWS A;  3FYA A;  5DRY A;  2XXA A;  4EKG A;  1BDI A;  4NDW A;  2EF8 A;  3F6W A;  1U2Z A;  2LYL A;  1WIZ A;  5DSX A;  4OB4 A;  2MQK A;  2WIU B;  3ZKC A;  2KZ8 A;  4Q2J A;  2BNN A;  4FBI A;  3SCH A;  3DNV B;  5DTM A;  1POU A;  2ICP A;  2PXK A;  1X57 A;  4JQD A;  2AW6 A;  2J7U A;  1LMB 3;  4I6R A;  3SCG A;  3CLC A;  2PXQ A;  3JXC L;  2OR1 L;  1OSL A;  1ZZ7 A;  3CEC A;  2HFZ A;  2PE5 A;  1R63 A;  2OFY A;  1ZZ9 A;  3UFD A;  3G0T A;  2PUA A;  2IUO A;  2L49 A;  2XXQ A;  3NZL A;  4O8B A;  1ADR A;  2MXD A;  2CRO A;  3NRO A;  3GZC A;  3R09 A;  3GBF A;  4YBA A;  3BDN A;  3S8Q A;  4YG4 A;  4ER5 A;  3IVP A;  4EQZ A;  2KPJ A;  3OWQ A;  2IU7 A;  1ZUG A;  4FN3 A;  2CSF A;  1S7E A;  4J1X A;  2R1J L;  1UXD A;  4X4F A;  2XJ3 A;  4YG7 B;  1IC8 A;  4EZI A;  4X4B A;  1E3O C;  4HRA A;  3KJX A;  1O4X A;  4DE8 A;  1PER L;  3QWG A;  2IV1 A;  1PRU A;  3TEL A;  3TEP A;  1ZVV A;  2MEZ A;  1UTX A;  2PUG A;  3ZPX A;  4OBM A;  3NDB B;  3EUS A;  4ER6 A;  4Z5D A;  4GQM A;  2LLV A;  1QZX A;  1NEQ A;  2HCN A;  1JH9 A;  1WH6 A;  1ZPQ A;  4YAR A;  1Y7Y A;  5DTQ A;  3QQ6 A;  4I6U A;  1DW9 A;  3SX0 A;  1B0N A;  4F8D A;  4PU3 C;  1LCD A;  4EKI A;  4PU8 A;  2AXZ A;  4X4H A;  4WVL A;  2LYP A;  1QP4 A;  5JUW A;  3D1N I;  3F52 A;  3RZZ A;  3NXH A;  1AU7 A;  3L1P A;  2PXP A;  2PXB A;  2A6C A;  2IVG A; 
#chains in the Genus database with same CATH homology
 3PXP A;  3QF3 A;  2GRL A;  2KPJ A;  2PPX A;  3G7D A;  3GN5 A;  3H5T A;  2IU7 A;  3OP9 A;  1ZUG A;  4FN3 A;  2CSF A;  4PU4 C;  1S7E A;  2LYQ A;  4Z5H A;  2O4A A;  1XWR A;  4J1X A;  2WUS R;  2R63 A;  4Y42 A;  2R1J L;  1UXD A;  2XI8 A;  4IVZ A;  4X4F A;  4JCX A;  4IWR A;  5K98 B;  1LQC A;  2AWI A;  2XJ3 A;  1HF0 A;  2H8R A;  4YG7 B;  3OMT A;  1IC8 A;  2EBY A;  1ZZB A;  4PU7 A;  2IVB A;  1RZR A;  4X4B A;  4MCX A;  1L1M A;  1WH8 A;  1EFA A;  1E3O C;  2D5V A;  2PUF A;  1PRV A;  1SQ8 A;  1DWK A;  2O38 A;  2PIJ A;  2XIU A;  3FYA A;  2LYK A;  2GRM A;  1PRA A;  3KJX A;  2XSD C;  1QQB A;  3OQN A;  4NDW A;  1BDI A;  4GHJ A;  2BJC A;  2EF8 A;  3F6W A;  1O4X A;  3KXA A;  1QP7 A;  1PER L;  3QWG A;  4IA8 A;  2IV1 A;  3R1F A;  1ZAY A;  1ZS4 A;  2LYL A;  1PRU A;  1YSE A;  2AUW A;  2B5A A;  1ZVV A;  1QP0 A;  1UXC A;  2MEZ A;  1JFS A;  1UTX A;  2PUG A;  1WIZ A;  2FJR A;  4OB4 A;  1LLI A;  2AXU A;  2MQK A;  2WIU B;  3EUS A;  3ZKC A;  3O9X A;  4Z5D A;  2KZ8 A;  2L8N A;  4GQM A;  3VK0 A;  2EWT A;  3B7H A;  1RIO A;  2ICT A;  3FMY A;  2BNN A;  4FBI A;  1NEQ A;  3U3W A;  1JH9 A;  2HIN A;  1WH6 A;  1ZPQ A;  3SCH A;  3DNV B;  3SCF A;  3OQM A;  1POU A;  4YAR A;  1RPE L;  1Y7Y A;  2ICP A;  1ZZ8 A;  4I6T A;  5A7L A;  2XCJ A;  1X57 A;  4Z59 A;  3QQ6 A;  4MCT A;  4I6U A;  3CRO L;  3TRB A;  2AW6 A;  4X4G A;  3FYM A;  1BDH A;  1DW9 A;  2PUC A;  4JQD A;  1LMB 3;  1R69 A;  1B0N A;  1JWL A;  4F8D A;  4I6R A;  3SCG A;  4J1W A;  3LFP A;  4PU3 C;  1LCD A;  2AXV A;  4X4I A;  1JFT A;  1RZR D;  3CLC A;  3JXB C;  2O49 A;  1QQA A;  2LYR A;  3JXC L;  2OR1 L;  3LIS A;  2LCV A;  1OSL A;  1ZZC A;  2JVL A;  1LCC A;  1VPW A;  1ZZ7 A;  4JCY A;  1OCT C;  4PU8 A;  3CEC A;  3QYX A;  2PUD A;  2PE5 A;  2LYS A;  3ZHI A;  3HZI B;  1CJG A;  1R63 A;  2BNO A;  2OFY A;  4Z5C A;  1NER A;  2AXZ A;  3JXD L;  1ZZ9 A;  4X4H A;  2KEJ A;  3UFD A;  2PUA A;  2IUO A;  2L49 A;  2GZU A;  4YG1 A;  2BNM A;  1RZS A;  2JCG A;  4O8B A;  1ADR A;  2LYP A;  3MLF A;  2CRO A;  1QP4 A;  2PUE A;  2KEI A;  3OQO A;  2LYJ A;  4X4D A;  3F51 A;  3BS3 A;  3D1N I;  3GBF A;  1X2L A;  1Y9Q A;  3F52 A;  4YBA A;  1ZZ6 A;  1PNR A;  3RZZ A;  4X4C A;  3BDN A;  3S8Q A;  4YG4 A;  4Z58 A;  3KZ3 A;  1CQT A;  3IVP A;  3GN5 B;  1GT0 C;  2KEK A;  2PUB A;  2IVQ A;  2HSG A;  1AU7 A;  1QPZ A;  3BD1 A;  4X4E A;  3L1P A;  4I8T A;  3G5G A;  2A6C A;  1WET A;  2IVG A;  3ZHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...