3OPFA

Crystal structure of ttha0988 in space group p212121
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
493
structure length
490
Chain Sequence
MVRGFYLRFGEGVSEEANRRALALAEALLRAPPPGLLDAVPAYGVLYLEYDPRRLSRGRLLRLLKGLPQERARVVEIPVRYDGEDLPEVASRLGLSLEAVKALHQKPLYRVYALGFTPGFPFLAEVEPALRLPRKPHPRPRVPAHAVAVAGVQTGIYPLPSPGGWNLLGTSLVAVYDPHRETPFLLRPGDRVRFLEAEGPTPPEPRPLELLPEEPRLPALLVEEPGLMDLVVDGGRFLGGHLGLARSGPLDAPSARLANRLVGNGAGAPLLEFAYKGPVLTALRDLVAAFAGYGFVALLEGEEIPPGQSFLWPRGKTLRFRPRGPGVRGYLAVAGGLEVRPFLGSASPDLRGRIGRPLWAGDVLGLEALRPVRPGRAFPQRPLPEAFRLRLLPGPQFAGEAFRALCSGPFRVARADRVGVELLGPEVPGGEGLSEPTPLGGVQVPPSGRPLVLLADKGSLGGYAKPALVDPRDLWLLGQARPGVEIHFTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative uncharacterized protein TTHA0988
publication title The structure of TTHA0988 from Thermus thermophilus, a KipI-KipA homologue incorrectly annotated as an allophanate hydrolase
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 126
structure length 490
sequence length 493
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02626 CT_A_B Carboxyltransferase domain, subdomain A and B
A PF02682 CT_C_D Carboxyltransferase domain, subdomain C and D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3opfA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3opfA04
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3opfA01
2N0TA 2HE9A 4YUNA 4KC6A 4ZSDA 4YUMA 2BIUX 2IGWA 5JVOA 3K2CA 1M9FA 4YUHA 5KV3A 3O7TA 4N1RA 3R54A 4J5EX 4DGBA 4TOTA 2WFJA 1E8KA 2C3BA 3K0PA 4DDQA 1J2AA 1VAIA 1V9TA 4HY7A 5CCRA 1AWUA 3OEPA 4KB4A 2XGYB 1VBSA 3K0RA 3R4GA 3VA7A 2RGRA 1ISEA 5CCNA 3LAPA 4J5CX 2RMBA 2OK3A 1WQFA 2BITX 2X25B 4KB2A 4N1OA 5CJ9A 1CWAA 1CWIA 3ICHA 1CWBA 1AWSA 2MVZA 3RCGA 2MC9A 1BGWA 1QNGA 1RMHA 4YUIA 4XNCA 3RDDA 3RDCA 1AB4A 1F9NA 2A2NA 4ZSCA 4JJMA 5KV2A 1CWHA 1XXBA 1XYHA 4N1MA 3K0OA 1MIKA 4CYHA 3T1UA 1DYWA 4YUJA 3R57A 1AWTA 4J5DX 1WIHA 1ZMFA 1IHGA 1CWJA 2X7KA 1AK4A 2POYA 1XXCA 1CWKA 1QNHA 2POEA 3OPFA 5KUZA 1EK8A 1WQGA 4R3EA 3PMPA 3FOEA 1XO7A 3ICIA 1X7FA 3BKPA 3FOFA 4N1NA 1W8VA 4I9YA 4DGCA 4R3FA 3LAJA 4S1EA 4DGEA 4EYVA 1AWVA 1XQ7A 1M9DA 3R59A 3RCFA 4E1QA 4GFQA 3BO7A 5KUSA 2WFIA 3L4KA 2RS4A 1NMKA 1B4AA 4FM9A 3CYHA 3RD9X 5LUDA 2IGVA 2GW2A 1W8MA 4J5BA 1XXAA 1W74A 1W8LA 3RCLA 2X2DB 4G0UA 3UCHA 1M9CA 1VDNA 2MS4A 1C5FA 1CLHA 2RMCA 5CCSX 2ESLA 1OCAA 1H0PA 5KURA 5KUQA 3LPXA 3ERED 3JB9d 3QX3A 5KV6A 2WLWA 3ODLA 3ODIA 3NUHA 4O8IA 4N1SA 1LOPA 4N1PA 1Z81A 3QYUA 4S1JA 4O8HA 3RFYA 4YUKA 5CBTA 3K0QA 2P5MA 1MF8C 5DUDA 5KV4A 1YNDA 2PLUA 4FRVA 5KUUA 3K0MA 4J3NA 2XCQA 2ZP2A 1AWQA 5CBWA 5JHEA 5CYHA 4KAWX 1ZVUA 4YUOA 1VBTA 2HQ6A 2ZFZA 2CPLA 1EH1A 2OJUA 3MMLA 2X2CK 4DGDA 5KULA 2CK1A 2P0OA 4YUGA 4J58A 2OSEA 5F66A 1M63C 4J59A 3OREA 1CWLA 2QERA 1IS1A 5CBVA 4G0WA 4YUPA 2Y3PA 4N1QA 3CAGA 1A33A 3L4JA 5A0EA 1E3BA 1A58A 3S6MA 4J5AX 2B71A 1CWOA 5KV0A 1MZWA 2PHCB 1BJTA 1CWFA 5CCQA 3BUEA 5KV1A 1ISTA 1DD5A 3MMLB 4IPZA 1M9XA 1CWCA 3BT8A 5KUOA 2K7NA 3R56A 2X83B 1BCKA 2NULA 3RCKX 2CMTA 2KWAA 2RMAA 4DGAA 3CYSA 3RDAX 3V4GA 3RCIX 1XWNA 1B4BA 5CBUA 1FGLA 3K0NA 4JCPA 1CWMA 5KUNA 2HQJA 1M9YA 5KV7A 4YULA 2X2AA 1IIPA 5KV5A 4LQWA 3RDBA 1ZKFA 2CYHA 2R99A 5KUWA 2ALFA 3R49A 3EOVA 2HAQA 5KUVA 2Z6WA 2XCRB 4KDDA 2XCOA 1ZKCA 3FHZA 1WQHA 1AWRA 2CFEA 1M9EA 4G0VA 4FRUA 1GE9A 2FU0A 1CYNA 1QOIA 2MZUA
chains in the Genus database with same CATH superfamily
2N0TA 3G4AA 4AYBL 4KASA 3GTGA 2HE9A 1VJEA 3GTJK 5IP9K 4YUNA 4KC6A 1DCPA 4ZSDA 1KQ4A 1O27A 4YUMA 2JA7K 3HOWC 2BIUX 2IGWA 1YCLA 5IP7K 4A3EC 2KA0A 5JVOA 3K2CA 1M9FA 4A93K 1EFWA 4YUHA 1ZX8A 5KV3A 3HOVC 3O7TA 4N1RA 3R54A 4J5EX 4OIQA 4DGBA 4TOTA 2WFJA 1E8KA 2C3BA 3K0PA 4GTLA 1TWFA 2NVQK 2A6EA 1J2AA 2GSNA 4DDQA 3N0CA 1VAIA 1V9TA 4KARA 5TMCA 4HY7A 3S1MK 4LK1A 5CCRA 2NVXK 3ADAC 1AWUA 4A3FK 3OEPA 3FKIC 4KB4A 2XGYB 1VBSA 2E2HK 3K0RA 1I3QA 3R4GA 3VA7A 2RGRA 3IPJA 1I6VA 2PA8L 4BY7C 1O29A 4A3MK 1ISEA 1J6WA 3KOPA 1PJ7A 5CCNA 3TFJA 3GTQC 3LAPA 3I4NK 4J5CX 2RMBA 4C3IC 2OK3A 4QIWL 3S14C 4Q5SA 4LOWA 3H3VD 1O2AA 4G7ZA 4A3IK 1WQFA 5FLMK 4GTEA 2BITX 2X25B 4KB2A 4N1OA 3GTJA 1TWHC 4A3KC 3HOYC 3I4MC 4KMHA 3HOUK 5CJ9A 1CWAA 3TTGA 2JA7A 1ZYRA 3HOXC 2A6HA 5IYDC 1HI9A 2R92C 1CWIA 3ICHA 1SFOC 1CWBA 1AWSA 2MVZA 3RCGA 2MC9A 1EI6A 1BGWA 1TWGK 1JOEA 1QNGA 3TFIA 1RMHA 5C3EK 4YUIA 4XNCA 3RDDA 3S2HC 3GTPC 1I50K 3RDCA 5EGEA 5M5WK 1L0WA 1AB4A 1F9NA 2A2NA 5IP9C 4ZSCA 1WSRA 4JJMA 2R7ZA 1IQ0A 5KV2A 1CWHA 4C3JK 1XXBA 1I6HK 1XYHA 4N1MA 3M3YC 3K0OA 1MIKA 5IP7C 4Y7NK 4CYHA 2V6TA 5TJ3A 4BLBA 3T1UA 5FJ8K 4KN7A 4A3JK 1DYWA 4O2DA 2O5IA 4YUJA 3R57A 1AWTA 4J5DX 5JFEA 1WIHA 2E2HA 1ZMFA 4Y52K 5D4DA 1IHGA 1O28A 1CWJA 2X7KA 4Q4ZA 2ZUFA 4PABA 1AK4A 2POYA 1XXCA 1CWKA 1XPPA 1QNHA 2ZUEA 2POEA 3OPFA 5KUZA 1EK8A 1WQGA 2NVYK 4R3EA 4AH6A 4G7OA 3PMPA 1PJ6A 4X6AK 3FOEA 2NVXC 1XO7A 3ICIA 1X7FA 3BKPA 3FOFA 1K83K 4A3DK 4N1NA 1J6XA 3GTKK 1TWCK 2E2HC 3S17C 1Y1VK 5IYBC 1W8VA 4I9YA 4DGCA 4R3FA 5E68A 3LAJA 3M4OC 1VLOA 4S1EA 3RZOC 4BY1K 4DGEA 1DCOA 4EYVA 2NNZA 2GSUA 3I4NC 5C4XK 1AWVA 1WOSA 1TWGA 1XQ7A 2JA8K 3GTOC 1INNA 4C3HC 3GTMC 1M9DA 3R59A 3GTGC 1I50A 3RCFA 4E1QA 1O2FB 4C2MC 4GFQA 3BO7A 5KUSA 2GAGC 3GSIA 2WFIA 3L4KA 4A3LC 4PAAA 2R7ZK 2WB1L 2RS4A 1NMKA 3RZDK 2E2IA 1B4AA 4FM9A 3S16K 3S1RK 3CYHA 1O26A 1G51A 3RD9X 3K7AC 5LUDA 5IOTA 2IGVA 1I50C 3A8KA 4XCHA 1BS2A 2GW2A 5IYCK 4ZH4A 5M3MK 3BP8C 4A3GK 1W8MA 4XSXA 2E2JK 4A3CK 1TWFC 4OINA 3BP3A 3PO3K 1I6HC 1V5VA 4J5BA 1XZPA 1XXAA 1W74A 1W8LA 2PA8D 3RCLA 2X2DB 2NVYA 4GTAA 3S2DK 1Y1WK 2R93K 4G0UA 4GTCA 3UCHA 1M9CA 1USMA 4A3JC 1TWAK 1I3QC 1WSVA 3CQZK 1VDNA 2MS4A 1XZQA 4QIWD 1K83A 1C5FA 4YFXA 1CLHA 2RMCA 1TWCA 3GTLA 3GTKA 1F93A 1Y1VA 3TFHA 3HKZL 4Y52C 5CCSX 2ESLA 1OCAA 1O25A 5M3FK 2V6UA 2FQOA 3AH5A 1H0PA 5KURA 1UV7A 1ZBSA 1JVIA 5KUQA 4XLPA 4A3BC 3LPXA 3ERED 3JB9d 2NVYC 3QX3A 5IORA 2WAQL 5EGHA 4BKWA 5KV6A 2JA5A 3H0GK 3GTJC 2WLWA 3ODLA 2P8TA 1K83C 3SZYA 3S0XA 2E2IK 4A3DC 1TWCC 2JA7C 3ODIA 1WOOA 1Y1VC 4LLGA 3NUHA 4O8IA 4N1SA 3A8JA 3X27A 1LOPA 4N1PA 1Z81A 4LJZA 4GZYA 3QYUA 4BY1C 4S1JA 1IL2A 4O8HA 2CFAA 3FKIK 3RFYA 4WJ4A 4YUKA 5C4XC 5CBTA 3K0QA 2P5MA 1MF8C 5DUDA 2Y0SL 2JA8C 5KV4A 4YFNA 5IOSA 4A93C 3S1QK 1WORA 2BE5A 1YNDA 2PLUA 4FRVA 5KUUA 4YFKA 3K0MA 4J3NA 1XZPB 5C44K 4LK0A 2XCQA 3GDZA 1IE0A 3GTQK 2R7ZC 1O2BA 2ZP2A 4C3IK 2PMZL 1X31C 3S14K 1AWQA 3S1NK 4FZBA 4BBRK 2NVQC 3T00A 1XZQB 5CBWA 5JHEA 1YNJA 2CW0A 4KATA 3S1RC 2JA6K 1C0AA 5CYHA 3S1MC 3GEIA 5C4JK 4A3FC 2R93A 1Y1WA 4KAWX 1WCMK 1ZVUA 1IW7A 4YUOA 1VBTA 1J98A 2HQ6A 3HOXK 1TWAA 3GTLK 2O5JA 2ZFZA 5IYDK 3CQZA 1R9TK 2CPLA 4QJVB 5IYCC 1SFOK 1EH1A 2OJUA 4KM9A 4AYBD 3GEEA 2B63K 3MMLA 4BBSK 2X2CK 4DGDA 3AD9C 1SMYA 5KULA 2E2JC 3AD7C 2CK1A 2P0OA 4A3CC 4YUGA 4XLNA 4A3MC 3PO3C 4J58A 3S2HK 3GTPK 2OSEA 5F66A 5L46A 1M63C 1IBAA 4J59A 3OREA 2JA5K 2A69A 4OIRA 1CWLA 2QERA 1YNNA 5FLMC 4A3IC 1Y1WC 3S15K 1IS1A 2R93C 1F7VA 5CBVA 4G0WA 4YUPA 3N3YA 4BXXK 3H0GA 1VH2A 4XSZA 1TWAC 2CFAB 2YU9K 1HQMA 4N1QA 2Y3PA 3CQZC 3M3YK 3CAGA 3HOUC 2VUMK 1J6VA 3PO2K 5M5YK 1A33A 4JK1A 4KMUA 2NVTK 3L4JA 1WOPA 3WODA 5A0EA 1E3BA 4GT9A 1TWGC 2WB1D 3FKIA 4WJ3M 1A58A 5C3EC 3S6MA 4J5AX 1BDFA 2GSOA 4KMDA 4NOIA 4LR2A 2B71A 1CWOA 3H0GC 5KV0A 1MZWA 2PHCB 3HOZK 1BJTA 1PJ5A 1CWFA 3HXAA 2E2IC 3GTQA 5CCQA 3BUEA 4C3JC 3T02A 1O24A 2PPBA 5KV1A 2V6SA 4LQYA 4Y7NC 3T01A 1ISTA 4WILA 1DD5A 3MMLB 1VGXA 2A68A 2JA6A 4IPZA 3HOWK 2EBBA 1M9XA 1TWHA 3S17K 1WCMA 4G7HA 3S1QC 1CWCA 5IYBK 3M4OK 4MEXA 3JSTA 3BT8A 5C44C 4A3EK 3H3VL 4GTFA 1R9TA 3RZOK 1SFOA 3AQOA 2R92A 5KUOA 2B63A 2FQTA 3N0BA 2K7NA 3R56A 2X83B 4KN4A 3GTOK 3AQPA 1BCKA 2NULA 4C3HK 3RCKX 2CMTA 4BBRC 3GTMK 3S1NC 4QJVA 3GTPA 1VRQC 4M1XA 3GTGK 3HOVK 4OIPA 4C2MK 3HKZD 5M5XK 2GAHC 2RMAA 2KWAA 3AD8C 4RMFA 4DGAA 2JA6C 4X6AC 3CYSA 3RDAX 3V4GA 4A3LK 5C4JC 3RCIX 2W7VA 1WCMC 4ILDA 4MEYA 1XWNA 1B4BA 5CBUA 3GIRA 5IOQA 2YU9A 3GTKC 3GTLC 1R9TC 1FGLA 3DXJA 3K0NA 2B63C 2WAQD 2VUMA 4BBSC 1JQWA 5HL8A 3K7AK 5TMFA 4KM8A 4JCPA 1USOA 1CWMA 5KUNA 3Q3QA 3S2DC 3G4CA 4BLAA 2HQJA 1M9YA 3GEHA 1YX2A 3A8IA 4MQ9A 5CHPA 5KV7A 4YULA 1ZQ1C 2X2AA 1IIPA 2JA5C 3S15C 5KV5A 4GTBA 4LQWA 4BY7K 3RDBA 4BXXC 1TWFK 1ZKFA 2YU9C 2CYHA 2Y0SD 3SZZA 1F7UA 2R99A 3RZDC 5KUWA 2ALFA 3R49A 1EQRA 2VUMC 3PO2C 3EOVA 3S16C 2JH3A 2NVTC 2RH6A 2D6FC 2HAQA 5KUVA 4C45A 1RU0A 2Z6WA 2XCRB 4P9SA 4KDDA 2NVXA 2XCOA 1TWHK 1ZKCA 1I3QK 3FHZA 4A3KK 3HOYK 4YG2A 2PMZD 1WQHA 3I4MK 1AWRA 2CFEA 1M9EA 4G0VA 2R92K 4KMAA 4FRUA 4OIOA 4GTDA 4P5AA 4A3GC 1DCHA 1GE9A 3HOZC 3EQLA 2FU0A 1CYNA 1QOIA 4P5BA 4A3BK 3GTOA 2MZUA 3GTMA 1ZXOA
chains in the Genus database with same CATH topology
2N0TA 3G4AA 4KASA 3GTGA 2HE9A 4YUNA 4KC6A 4ZSDA 1KQ4A 1O27A 4YUMA 2BIUX 2IGWA 5JVOA 3K2CA 1M9FA 4YUHA 5KV3A 3O7TA 4N1RA 3R54A 4J5EX 4DGBA 4TOTA 2WFJA 1E8KA 2C3BA 3K0PA 4GTLA 1TWFA 4DDQA 1J2AA 2GSNA 3N0CA 1VAIA 1V9TA 4KARA 4HY7A 5CCRA 1AWUA 3OEPA 4KB4A 2XGYB 1VBSA 3K0RA 1I3QA 3R4GA 3VA7A 2RGRA 1O29A 1ISEA 5CCNA 3LAPA 4J5CX 2RMBA 4C3IC 2OK3A 1O2AA 1WQFA 4GTEA 2BITX 2X25B 4KB2A 4N1OA 3GTJA 4KMHA 5CJ9A 1CWAA 2JA7A 1CWIA 3ICHA 1CWBA 1AWSA 2MVZA 3RCGA 2MC9A 1BGWA 1QNGA 1RMHA 4YUIA 4XNCA 3RDDA 5EGEA 3RDCA 1AB4A 1F9NA 2A2NA 4ZSCA 4JJMA 2R7ZA 5KV2A 1CWHA 1XXBA 1XYHA 4N1MA 3K0OA 1MIKA 4CYHA 5TJ3A 4BLBA 3T1UA 1DYWA 4YUJA 3R57A 1AWTA 4J5DX 5JFEA 1WIHA 2E2HA 1ZMFA 1IHGA 1O28A 1CWJA 2X7KA 1AK4A 2POYA 1XXCA 1CWKA 1QNHA 2POEA 3OPFA 5KUZA 1EK8A 1WQGA 4R3EA 3PMPA 3FOEA 1XO7A 3ICIA 1X7FA 3BKPA 3FOFA 4N1NA 1W8VA 4I9YA 4DGCA 4R3FA 3LAJA 4S1EA 4DGEA 4EYVA 2GSUA 1AWVA 1TWGA 1XQ7A 4C3HC 1M9DA 3R59A 1I50A 3RCFA 4E1QA 4C2MC 4GFQA 3BO7A 5KUSA 2WFIA 3L4KA 2RS4A 1NMKA 2E2IA 1B4AA 4FM9A 3CYHA 1O26A 3RD9X 5LUDA 5IOTA 2IGVA 2GW2A 1W8MA 4J5BA 1XXAA 1W74A 1W8LA 3RCLA 2X2DB 2NVYA 4GTAA 4G0UA 4GTCA 3UCHA 1M9CA 1VDNA 2MS4A 1K83A 1C5FA 3GTLA 1CLHA 2RMCA 1TWCA 3GTKA 1Y1VA 5CCSX 2ESLA 1OCAA 1O25A 3AH5A 1H0PA 5KURA 1ZBSA 5KUQA 3LPXA 3ERED 3JB9d 3QX3A 5IORA 5EGHA 4BKWA 5KV6A 2JA5A 2WLWA 3ODLA 3S0XA 3ODIA 3NUHA 4O8IA 4N1SA 1LOPA 4N1PA 1Z81A 3QYUA 4S1JA 4O8HA 2CFAA 3RFYA 4YUKA 5CBTA 3K0QA 2P5MA 1MF8C 5DUDA 5KV4A 5IOSA 1YNDA 2PLUA 4FRVA 5KUUA 3K0MA 4J3NA 2XCQA 1O2BA 2ZP2A 1AWQA 4FZBA 5CBWA 5JHEA 4KATA 5CYHA 2R93A 1Y1WA 4KAWX 1ZVUA 4YUOA 1VBTA 2HQ6A 1TWAA 2ZFZA 3CQZA 2CPLA 1EH1A 2OJUA 4KM9A 3MMLA 2X2CK 4DGDA 5KULA 2CK1A 2P0OA 4YUGA 4J58A 2OSEA 5F66A 1M63C 4J59A 3OREA 1CWLA 2QERA 1IS1A 5CBVA 4G0WA 4YUPA 3N3YA 3H0GA 2CFAB 2Y3PA 4N1QA 3CAGA 1A33A 3L4JA 5A0EA 1E3BA 4GT9A 3FKIA 1A58A 3S6MA 4J5AX 2GSOA 4KMDA 4LR2A 2B71A 1CWOA 5KV0A 1MZWA 2PHCB 1BJTA 1CWFA 3GTQA 5CCQA 3BUEA 4C3JC 1O24A 5KV1A 4LQYA 1ISTA 1DD5A 3MMLB 2JA6A 4IPZA 1M9XA 1TWHA 1WCMA 1CWCA 3BT8A 4GTFA 1R9TA 2R92A 1SFOA 3AQOA 5KUOA 2B63A 3N0BA 2K7NA 3R56A 2X83B 3AQPA 1BCKA 2NULA 3RCKX 2CMTA 3GTPA 4M1XA 2KWAA 2RMAA 4DGAA 3CYSA 3RDAX 3V4GA 3RCIX 4ILDA 1XWNA 1B4BA 5CBUA 5IOQA 2YU9A 1FGLA 3K0NA 2VUMA 4KM8A 4JCPA 1CWMA 5KUNA 3Q3QA 3G4CA 4BLAA 2HQJA 1M9YA 5CHPA 5KV7A 4YULA 2X2AA 1IIPA 5KV5A 4GTBA 4LQWA 3RDBA 1ZKFA 2CYHA 2R99A 5KUWA 2ALFA 3R49A 3EOVA 2JH3A 2RH6A 2HAQA 5KUVA 2Z6WA 2XCRB 4KDDA 2NVXA 2XCOA 1ZKCA 3FHZA 1WQHA 1AWRA 2CFEA 1M9EA 4G0VA 4KMAA 4FRUA 4GTDA 4P5AA 1GE9A 2FU0A 1CYNA 1QOIA 4P5BA 3GTOA 2MZUA 3GTMA 1ZXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N0T A;  2HE9 A;  4YUN A;  4KC6 A;  4ZSD A;  4YUM A;  2BIU X;  2IGW A;  5JVO A;  3K2C A;  1M9F A;  4YUH A;  5KV3 A;  3O7T A;  4N1R A;  3R54 A;  4J5E X;  4DGB A;  4TOT A;  2WFJ A;  1E8K A;  2C3B A;  3K0P A;  4DDQ A;  1J2A A;  1VAI A;  1V9T A;  4HY7 A;  5CCR A;  1AWU A;  3OEP A;  4KB4 A;  2XGY B;  1VBS A;  3K0R A;  3R4G A;  3VA7 A;  2RGR A;  1ISE A;  5CCN A;  3LAP A;  4J5C X;  2RMB A;  2OK3 A;  1WQF A;  2BIT X;  2X25 B;  4KB2 A;  4N1O A;  5CJ9 A;  1CWA A;  1CWI A;  3ICH A;  1CWB A;  1AWS A;  2MVZ A;  3RCG A;  2MC9 A;  1BGW A;  1QNG A;  1RMH A;  4YUI A;  4XNC A;  3RDD A;  3RDC A;  1AB4 A;  1F9N A;  2A2N A;  4ZSC A;  4JJM A;  5KV2 A;  1CWH A;  1XXB A;  1XYH A;  4N1M A;  3K0O A;  1MIK A;  4CYH A;  3T1U A;  1DYW A;  4YUJ A;  3R57 A;  1AWT A;  4J5D X;  1WIH A;  1ZMF A;  1IHG A;  1CWJ A;  2X7K A;  1AK4 A;  2POY A;  1XXC A;  1CWK A;  1QNH A;  2POE A;  3OPF A;  5KUZ A;  1EK8 A;  1WQG A;  4R3E A;  3PMP A;  3FOE A;  1XO7 A;  3ICI A;  1X7F A;  3BKP A;  3FOF A;  4N1N A;  1W8V A;  4I9Y A;  4DGC A;  4R3F A;  3LAJ A;  4S1E A;  4DGE A;  4EYV A;  1AWV A;  1XQ7 A;  1M9D A;  3R59 A;  3RCF A;  4E1Q A;  4GFQ A;  3BO7 A;  5KUS A;  2WFI A;  3L4K A;  2RS4 A;  1NMK A;  1B4A A;  4FM9 A;  3CYH A;  3RD9 X;  5LUD A;  2IGV A;  2GW2 A;  1W8M A;  4J5B A;  1XXA A;  1W74 A;  1W8L A;  3RCL A;  2X2D B;  4G0U A;  3UCH A;  1M9C A;  1VDN A;  2MS4 A;  1C5F A;  1CLH A;  2RMC A;  5CCS X;  2ESL A;  1OCA A;  1H0P A;  5KUR A;  5KUQ A;  3LPX A;  3ERE D;  3JB9 d;  3QX3 A;  5KV6 A;  2WLW A;  3ODL A;  3ODI A;  3NUH A;  4O8I A;  4N1S A;  1LOP A;  4N1P A;  1Z81 A;  3QYU A;  4S1J A;  4O8H A;  3RFY A;  4YUK A;  5CBT A;  3K0Q A;  2P5M A;  1MF8 C;  5DUD A;  5KV4 A;  1YND A;  2PLU A;  4FRV A;  5KUU A;  3K0M A;  4J3N A;  2XCQ A;  2ZP2 A;  1AWQ A;  5CBW A;  5JHE A;  5CYH A;  4KAW X;  1ZVU A;  4YUO A;  1VBT A;  2HQ6 A;  2ZFZ A;  2CPL A;  1EH1 A;  2OJU A;  3MML A;  2X2C K;  4DGD A;  5KUL A;  2CK1 A;  2P0O A;  4YUG A;  4J58 A;  2OSE A;  5F66 A;  1M63 C;  4J59 A;  3ORE A;  1CWL A;  2QER A;  1IS1 A;  5CBV A;  4G0W A;  4YUP A;  2Y3P A;  4N1Q A;  3CAG A;  1A33 A;  3L4J A;  5A0E A;  1E3B A;  1A58 A;  3S6M A;  4J5A X;  2B71 A;  1CWO A;  5KV0 A;  1MZW A;  2PHC B;  1BJT A;  1CWF A;  5CCQ A;  3BUE A;  5KV1 A;  1IST A;  1DD5 A;  3MML B;  4IPZ A;  1M9X A;  1CWC A;  3BT8 A;  5KUO A;  2K7N A;  3R56 A;  2X83 B;  1BCK A;  2NUL A;  3RCK X;  2CMT A;  2KWA A;  2RMA A;  4DGA A;  3CYS A;  3RDA X;  3V4G A;  3RCI X;  1XWN A;  1B4B A;  5CBU A;  1FGL A;  3K0N A;  4JCP A;  1CWM A;  5KUN A;  2HQJ A;  1M9Y A;  5KV7 A;  4YUL A;  2X2A A;  1IIP A;  5KV5 A;  4LQW A;  3RDB A;  1ZKF A;  2CYH A;  2R99 A;  5KUW A;  2ALF A;  3R49 A;  3EOV A;  2HAQ A;  5KUV A;  2Z6W A;  2XCR B;  4KDD A;  2XCO A;  1ZKC A;  3FHZ A;  1WQH A;  1AWR A;  2CFE A;  1M9E A;  4G0V A;  4FRU A;  1GE9 A;  2FU0 A;  1CYN A;  1QOI A;  2MZU A; 
#chains in the Genus database with same CATH topology
 2N0T A;  3G4A A;  4AYB L;  4KAS A;  3GTG A;  2HE9 A;  1VJE A;  3GTJ K;  5IP9 K;  4YUN A;  4KC6 A;  1DCP A;  4ZSD A;  1KQ4 A;  1O27 A;  4YUM A;  2JA7 K;  3HOW C;  2BIU X;  2IGW A;  1YCL A;  5IP7 K;  4A3E C;  2KA0 A;  5JVO A;  3K2C A;  1M9F A;  4A93 K;  1EFW A;  4YUH A;  1ZX8 A;  5KV3 A;  3HOV C;  3O7T A;  4N1R A;  3R54 A;  4J5E X;  4OIQ A;  4DGB A;  4TOT A;  2WFJ A;  1E8K A;  2C3B A;  3K0P A;  4GTL A;  1TWF A;  2NVQ K;  2A6E A;  1J2A A;  2GSN A;  4DDQ A;  3N0C A;  1VAI A;  1V9T A;  4KAR A;  5TMC A;  4HY7 A;  3S1M K;  4LK1 A;  5CCR A;  2NVX K;  3ADA C;  1AWU A;  4A3F K;  3OEP A;  3FKI C;  4KB4 A;  2XGY B;  1VBS A;  2E2H K;  3K0R A;  1I3Q A;  3R4G A;  3VA7 A;  2RGR A;  3IPJ A;  1I6V A;  2PA8 L;  4BY7 C;  1O29 A;  4A3M K;  1ISE A;  1J6W A;  3KOP A;  1PJ7 A;  5CCN A;  3TFJ A;  3GTQ C;  3LAP A;  3I4N K;  4J5C X;  2RMB A;  4C3I C;  2OK3 A;  4QIW L;  3S14 C;  4Q5S A;  4LOW A;  3H3V D;  1O2A A;  4G7Z A;  4A3I K;  1WQF A;  5FLM K;  4GTE A;  2BIT X;  2X25 B;  4KB2 A;  4N1O A;  3GTJ A;  1TWH C;  4A3K C;  3HOY C;  3I4M C;  4KMH A;  3HOU K;  5CJ9 A;  1CWA A;  3TTG A;  2JA7 A;  1ZYR A;  3HOX C;  2A6H A;  5IYD C;  1HI9 A;  2R92 C;  1CWI A;  3ICH A;  1SFO C;  1CWB A;  1AWS A;  2MVZ A;  3RCG A;  2MC9 A;  1EI6 A;  1BGW A;  1TWG K;  1JOE A;  1QNG A;  3TFI A;  1RMH A;  5C3E K;  4YUI A;  4XNC A;  3RDD A;  3S2H C;  3GTP C;  1I50 K;  3RDC A;  5EGE A;  5M5W K;  1L0W A;  1AB4 A;  1F9N A;  2A2N A;  5IP9 C;  4ZSC A;  1WSR A;  4JJM A;  2R7Z A;  1IQ0 A;  5KV2 A;  1CWH A;  4C3J K;  1XXB A;  1I6H K;  1XYH A;  4N1M A;  3M3Y C;  3K0O A;  1MIK A;  5IP7 C;  4Y7N K;  4CYH A;  2V6T A;  5TJ3 A;  4BLB A;  3T1U A;  5FJ8 K;  4KN7 A;  4A3J K;  1DYW A;  4O2D A;  2O5I A;  4YUJ A;  3R57 A;  1AWT A;  4J5D X;  5JFE A;  1WIH A;  2E2H A;  1ZMF A;  4Y52 K;  5D4D A;  1IHG A;  1O28 A;  1CWJ A;  2X7K A;  4Q4Z A;  2ZUF A;  4PAB A;  1AK4 A;  2POY A;  1XXC A;  1CWK A;  1XPP A;  1QNH A;  2ZUE A;  2POE A;  3OPF A;  5KUZ A;  1EK8 A;  1WQG A;  2NVY K;  4R3E A;  4AH6 A;  4G7O A;  3PMP A;  1PJ6 A;  4X6A K;  3FOE A;  2NVX C;  1XO7 A;  3ICI A;  1X7F A;  3BKP A;  3FOF A;  1K83 K;  4A3D K;  4N1N A;  1J6X A;  3GTK K;  1TWC K;  2E2H C;  3S17 C;  1Y1V K;  5IYB C;  1W8V A;  4I9Y A;  4DGC A;  4R3F A;  5E68 A;  3LAJ A;  3M4O C;  1VLO A;  4S1E A;  3RZO C;  4BY1 K;  4DGE A;  1DCO A;  4EYV A;  2NNZ A;  2GSU A;  3I4N C;  5C4X K;  1AWV A;  1WOS A;  1TWG A;  1XQ7 A;  2JA8 K;  3GTO C;  1INN A;  4C3H C;  3GTM C;  1M9D A;  3R59 A;  3GTG C;  1I50 A;  3RCF A;  4E1Q A;  1O2F B;  4C2M C;  4GFQ A;  3BO7 A;  5KUS A;  2GAG C;  3GSI A;  2WFI A;  3L4K A;  4A3L C;  4PAA A;  2R7Z K;  2WB1 L;  2RS4 A;  1NMK A;  3RZD K;  2E2I A;  1B4A A;  4FM9 A;  3S16 K;  3S1R K;  3CYH A;  1O26 A;  1G51 A;  3RD9 X;  3K7A C;  5LUD A;  5IOT A;  2IGV A;  1I50 C;  3A8K A;  4XCH A;  1BS2 A;  2GW2 A;  5IYC K;  4ZH4 A;  5M3M K;  3BP8 C;  4A3G K;  1W8M A;  4XSX A;  2E2J K;  4A3C K;  1TWF C;  4OIN A;  3BP3 A;  3PO3 K;  1I6H C;  1V5V A;  4J5B A;  1XZP A;  1XXA A;  1W74 A;  1W8L A;  2PA8 D;  3RCL A;  2X2D B;  2NVY A;  4GTA A;  3S2D K;  1Y1W K;  2R93 K;  4G0U A;  4GTC A;  3UCH A;  1M9C A;  1USM A;  4A3J C;  1TWA K;  1I3Q C;  1WSV A;  3CQZ K;  1VDN A;  2MS4 A;  1XZQ A;  4QIW D;  1K83 A;  1C5F A;  4YFX A;  1CLH A;  2RMC A;  1TWC A;  3GTL A;  3GTK A;  1F93 A;  1Y1V A;  3TFH A;  3HKZ L;  4Y52 C;  5CCS X;  2ESL A;  1OCA A;  1O25 A;  5M3F K;  2V6U A;  2FQO A;  3AH5 A;  1H0P A;  5KUR A;  1UV7 A;  1ZBS A;  1JVI A;  5KUQ A;  4XLP A;  4A3B C;  3LPX A;  3ERE D;  3JB9 d;  2NVY C;  3QX3 A;  5IOR A;  2WAQ L;  5EGH A;  4BKW A;  5KV6 A;  2JA5 A;  3H0G K;  3GTJ C;  2WLW A;  3ODL A;  2P8T A;  1K83 C;  3SZY A;  3S0X A;  2E2I K;  4A3D C;  1TWC C;  2JA7 C;  3ODI A;  1WOO A;  1Y1V C;  4LLG A;  3NUH A;  4O8I A;  4N1S A;  3A8J A;  3X27 A;  1LOP A;  4N1P A;  1Z81 A;  4LJZ A;  4GZY A;  3QYU A;  4BY1 C;  4S1J A;  1IL2 A;  4O8H A;  2CFA A;  3FKI K;  3RFY A;  4WJ4 A;  4YUK A;  5C4X C;  5CBT A;  3K0Q A;  2P5M A;  1MF8 C;  5DUD A;  2Y0S L;  2JA8 C;  5KV4 A;  4YFN A;  5IOS A;  4A93 C;  3S1Q K;  1WOR A;  2BE5 A;  1YND A;  2PLU A;  4FRV A;  5KUU A;  4YFK A;  3K0M A;  4J3N A;  1XZP B;  5C44 K;  4LK0 A;  2XCQ A;  3GDZ A;  1IE0 A;  3GTQ K;  2R7Z C;  1O2B A;  2ZP2 A;  4C3I K;  2PMZ L;  1X31 C;  3S14 K;  1AWQ A;  3S1N K;  4FZB A;  4BBR K;  2NVQ C;  3T00 A;  1XZQ B;  5CBW A;  5JHE A;  1YNJ A;  2CW0 A;  4KAT A;  3S1R C;  2JA6 K;  1C0A A;  5CYH A;  3S1M C;  3GEI A;  5C4J K;  4A3F C;  2R93 A;  1Y1W A;  4KAW X;  1WCM K;  1ZVU A;  1IW7 A;  4YUO A;  1VBT A;  1J98 A;  2HQ6 A;  3HOX K;  1TWA A;  3GTL K;  2O5J A;  2ZFZ A;  5IYD K;  3CQZ A;  1R9T K;  2CPL A;  4QJV B;  5IYC C;  1SFO K;  1EH1 A;  2OJU A;  4KM9 A;  4AYB D;  3GEE A;  2B63 K;  3MML A;  4BBS K;  2X2C K;  4DGD A;  3AD9 C;  1SMY A;  5KUL A;  2E2J C;  3AD7 C;  2CK1 A;  2P0O A;  4A3C C;  4YUG A;  4XLN A;  4A3M C;  3PO3 C;  4J58 A;  3S2H K;  3GTP K;  2OSE A;  5F66 A;  5L46 A;  1M63 C;  1IBA A;  4J59 A;  3ORE A;  2JA5 K;  2A69 A;  4OIR A;  1CWL A;  2QER A;  1YNN A;  5FLM C;  4A3I C;  1Y1W C;  3S15 K;  1IS1 A;  2R93 C;  1F7V A;  5CBV A;  4G0W A;  4YUP A;  3N3Y A;  4BXX K;  3H0G A;  1VH2 A;  4XSZ A;  1TWA C;  2CFA B;  2YU9 K;  1HQM A;  4N1Q A;  2Y3P A;  3CQZ C;  3M3Y K;  3CAG A;  3HOU C;  2VUM K;  1J6V A;  3PO2 K;  5M5Y K;  1A33 A;  4JK1 A;  4KMU A;  2NVT K;  3L4J A;  1WOP A;  3WOD A;  5A0E A;  1E3B A;  4GT9 A;  1TWG C;  2WB1 D;  3FKI A;  4WJ3 M;  1A58 A;  5C3E C;  3S6M A;  4J5A X;  1BDF A;  2GSO A;  4KMD A;  4NOI A;  4LR2 A;  2B71 A;  1CWO A;  3H0G C;  5KV0 A;  1MZW A;  2PHC B;  3HOZ K;  1BJT A;  1PJ5 A;  1CWF A;  3HXA A;  2E2I C;  3GTQ A;  5CCQ A;  3BUE A;  4C3J C;  3T02 A;  1O24 A;  2PPB A;  5KV1 A;  2V6S A;  4LQY A;  4Y7N C;  3T01 A;  1IST A;  4WIL A;  1DD5 A;  3MML B;  1VGX A;  2A68 A;  2JA6 A;  4IPZ A;  3HOW K;  2EBB A;  1M9X A;  1TWH A;  3S17 K;  1WCM A;  4G7H A;  3S1Q C;  1CWC A;  5IYB K;  3M4O K;  4MEX A;  3JST A;  3BT8 A;  5C44 C;  4A3E K;  3H3V L;  4GTF A;  1R9T A;  3RZO K;  1SFO A;  3AQO A;  2R92 A;  5KUO A;  2B63 A;  2FQT A;  3N0B A;  2K7N A;  3R56 A;  2X83 B;  4KN4 A;  3GTO K;  3AQP A;  1BCK A;  2NUL A;  4C3H K;  3RCK X;  2CMT A;  4BBR C;  3GTM K;  3S1N C;  4QJV A;  3GTP A;  1VRQ C;  4M1X A;  3GTG K;  3HOV K;  4OIP A;  4C2M K;  3HKZ D;  5M5X K;  2GAH C;  2RMA A;  2KWA A;  3AD8 C;  4RMF A;  4DGA A;  2JA6 C;  4X6A C;  3CYS A;  3RDA X;  3V4G A;  4A3L K;  5C4J C;  3RCI X;  2W7V A;  1WCM C;  4ILD A;  4MEY A;  1XWN A;  1B4B A;  5CBU A;  3GIR A;  5IOQ A;  2YU9 A;  3GTK C;  3GTL C;  1R9T C;  1FGL A;  3DXJ A;  3K0N A;  2B63 C;  2WAQ D;  2VUM A;  4BBS C;  1JQW A;  5HL8 A;  3K7A K;  5TMF A;  4KM8 A;  4JCP A;  1USO A;  1CWM A;  5KUN A;  3Q3Q A;  3S2D C;  3G4C A;  4BLA A;  2HQJ A;  1M9Y A;  3GEH A;  1YX2 A;  3A8I A;  4MQ9 A;  5CHP A;  5KV7 A;  4YUL A;  1ZQ1 C;  2X2A A;  1IIP A;  2JA5 C;  3S15 C;  5KV5 A;  4GTB A;  4LQW A;  4BY7 K;  3RDB A;  4BXX C;  1TWF K;  1ZKF A;  2YU9 C;  2CYH A;  2Y0S D;  3SZZ A;  1F7U A;  2R99 A;  3RZD C;  5KUW A;  2ALF A;  3R49 A;  1EQR A;  2VUM C;  3PO2 C;  3EOV A;  3S16 C;  2JH3 A;  2NVT C;  2RH6 A;  2D6F C;  2HAQ A;  5KUV A;  4C45 A;  1RU0 A;  2Z6W A;  2XCR B;  4P9S A;  4KDD A;  2NVX A;  2XCO A;  1TWH K;  1ZKC A;  1I3Q K;  3FHZ A;  4A3K K;  3HOY K;  4YG2 A;  2PMZ D;  1WQH A;  3I4M K;  1AWR A;  2CFE A;  1M9E A;  4G0V A;  2R92 K;  4KMA A;  4FRU A;  4OIO A;  4GTD A;  4P5A A;  4A3G C;  1DCH A;  1GE9 A;  3HOZ C;  3EQL A;  2FU0 A;  1CYN A;  1QOI A;  4P5B A;  4A3B K;  3GTO A;  2MZU A;  3GTM A;  1ZXO A; 
#chains in the Genus database with same CATH homology
 2N0T A;  3G4A A;  4KAS A;  3GTG A;  2HE9 A;  4YUN A;  4KC6 A;  4ZSD A;  1KQ4 A;  1O27 A;  4YUM A;  2BIU X;  2IGW A;  5JVO A;  3K2C A;  1M9F A;  4YUH A;  5KV3 A;  3O7T A;  4N1R A;  3R54 A;  4J5E X;  4DGB A;  4TOT A;  2WFJ A;  1E8K A;  2C3B A;  3K0P A;  4GTL A;  1TWF A;  4DDQ A;  1J2A A;  2GSN A;  3N0C A;  1VAI A;  1V9T A;  4KAR A;  4HY7 A;  5CCR A;  1AWU A;  3OEP A;  4KB4 A;  2XGY B;  1VBS A;  3K0R A;  1I3Q A;  3R4G A;  3VA7 A;  2RGR A;  1O29 A;  1ISE A;  5CCN A;  3LAP A;  4J5C X;  2RMB A;  4C3I C;  2OK3 A;  1O2A A;  1WQF A;  4GTE A;  2BIT X;  2X25 B;  4KB2 A;  4N1O A;  3GTJ A;  4KMH A;  5CJ9 A;  1CWA A;  2JA7 A;  1CWI A;  3ICH A;  1CWB A;  1AWS A;  2MVZ A;  3RCG A;  2MC9 A;  1BGW A;  1QNG A;  1RMH A;  4YUI A;  4XNC A;  3RDD A;  5EGE A;  3RDC A;  1AB4 A;  1F9N A;  2A2N A;  4ZSC A;  4JJM A;  2R7Z A;  5KV2 A;  1CWH A;  1XXB A;  1XYH A;  4N1M A;  3K0O A;  1MIK A;  4CYH A;  5TJ3 A;  4BLB A;  3T1U A;  1DYW A;  4YUJ A;  3R57 A;  1AWT A;  4J5D X;  5JFE A;  1WIH A;  2E2H A;  1ZMF A;  1IHG A;  1O28 A;  1CWJ A;  2X7K A;  1AK4 A;  2POY A;  1XXC A;  1CWK A;  1QNH A;  2POE A;  3OPF A;  5KUZ A;  1EK8 A;  1WQG A;  4R3E A;  3PMP A;  3FOE A;  1XO7 A;  3ICI A;  1X7F A;  3BKP A;  3FOF A;  4N1N A;  1W8V A;  4I9Y A;  4DGC A;  4R3F A;  3LAJ A;  4S1E A;  4DGE A;  4EYV A;  2GSU A;  1AWV A;  1TWG A;  1XQ7 A;  4C3H C;  1M9D A;  3R59 A;  1I50 A;  3RCF A;  4E1Q A;  4C2M C;  4GFQ A;  3BO7 A;  5KUS A;  2WFI A;  3L4K A;  2RS4 A;  1NMK A;  2E2I A;  1B4A A;  4FM9 A;  3CYH A;  1O26 A;  3RD9 X;  5LUD A;  5IOT A;  2IGV A;  2GW2 A;  1W8M A;  4J5B A;  1XXA A;  1W74 A;  1W8L A;  3RCL A;  2X2D B;  2NVY A;  4GTA A;  4G0U A;  4GTC A;  3UCH A;  1M9C A;  1VDN A;  2MS4 A;  1K83 A;  1C5F A;  3GTL A;  1CLH A;  2RMC A;  1TWC A;  3GTK A;  1Y1V A;  5CCS X;  2ESL A;  1OCA A;  1O25 A;  3AH5 A;  1H0P A;  5KUR A;  1ZBS A;  5KUQ A;  3LPX A;  3ERE D;  3JB9 d;  3QX3 A;  5IOR A;  5EGH A;  4BKW A;  5KV6 A;  2JA5 A;  2WLW A;  3ODL A;  3S0X A;  3ODI A;  3NUH A;  4O8I A;  4N1S A;  1LOP A;  4N1P A;  1Z81 A;  3QYU A;  4S1J A;  4O8H A;  2CFA A;  3RFY A;  4YUK A;  5CBT A;  3K0Q A;  2P5M A;  1MF8 C;  5DUD A;  5KV4 A;  5IOS A;  1YND A;  2PLU A;  4FRV A;  5KUU A;  3K0M A;  4J3N A;  2XCQ A;  1O2B A;  2ZP2 A;  1AWQ A;  4FZB A;  5CBW A;  5JHE A;  4KAT A;  5CYH A;  2R93 A;  1Y1W A;  4KAW X;  1ZVU A;  4YUO A;  1VBT A;  2HQ6 A;  1TWA A;  2ZFZ A;  3CQZ A;  2CPL A;  1EH1 A;  2OJU A;  4KM9 A;  3MML A;  2X2C K;  4DGD A;  5KUL A;  2CK1 A;  2P0O A;  4YUG A;  4J58 A;  2OSE A;  5F66 A;  1M63 C;  4J59 A;  3ORE A;  1CWL A;  2QER A;  1IS1 A;  5CBV A;  4G0W A;  4YUP A;  3N3Y A;  3H0G A;  2CFA B;  2Y3P A;  4N1Q A;  3CAG A;  1A33 A;  3L4J A;  5A0E A;  1E3B A;  4GT9 A;  3FKI A;  1A58 A;  3S6M A;  4J5A X;  2GSO A;  4KMD A;  4LR2 A;  2B71 A;  1CWO A;  5KV0 A;  1MZW A;  2PHC B;  1BJT A;  1CWF A;  3GTQ A;  5CCQ A;  3BUE A;  4C3J C;  1O24 A;  5KV1 A;  4LQY A;  1IST A;  1DD5 A;  3MML B;  2JA6 A;  4IPZ A;  1M9X A;  1TWH A;  1WCM A;  1CWC A;  3BT8 A;  4GTF A;  1R9T A;  2R92 A;  1SFO A;  3AQO A;  5KUO A;  2B63 A;  3N0B A;  2K7N A;  3R56 A;  2X83 B;  3AQP A;  1BCK A;  2NUL A;  3RCK X;  2CMT A;  3GTP A;  4M1X A;  2KWA A;  2RMA A;  4DGA A;  3CYS A;  3RDA X;  3V4G A;  3RCI X;  4ILD A;  1XWN A;  1B4B A;  5CBU A;  5IOQ A;  2YU9 A;  1FGL A;  3K0N A;  2VUM A;  4KM8 A;  4JCP A;  1CWM A;  5KUN A;  3Q3Q A;  3G4C A;  4BLA A;  2HQJ A;  1M9Y A;  5CHP A;  5KV7 A;  4YUL A;  2X2A A;  1IIP A;  5KV5 A;  4GTB A;  4LQW A;  3RDB A;  1ZKF A;  2CYH A;  2R99 A;  5KUW A;  2ALF A;  3R49 A;  3EOV A;  2JH3 A;  2RH6 A;  2HAQ A;  5KUV A;  2Z6W A;  2XCR B;  4KDD A;  2NVX A;  2XCO A;  1ZKC A;  3FHZ A;  1WQH A;  1AWR A;  2CFE A;  1M9E A;  4G0V A;  4KMA A;  4FRU A;  4GTD A;  4P5A A;  1GE9 A;  2FU0 A;  1CYN A;  1QOI A;  4P5B A;  3GTO A;  2MZU A;  3GTM A;  1ZXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...