3OPFA

Crystal structure of ttha0988 in space group p212121
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
493
structure length
490
Chain Sequence
b'MVRGFYLRFGEGVSEEANRRALALAEALLRAPPPGLLDAVPAYGVLYLEYDPRRLSRGRLLRLLKGLPQERARVVEIPVRYDGEDLPEVASRLGLSLEAVKALHQKPLYRVYALGFTPGFPFLAEVEPALRLPRKPHPRPRVPAHAVAVAGVQTGIYPLPSPGGWNLLGTSLVAVYDPHRETPFLLRPGDRVRFLEAEGPTPPEPRPLELLPEEPRLPALLVEEPGLMDLVVDGGRFLGGHLGLARSGPLDAPSARLANRLVGNGAGAPLLEFAYKGPVLTALRDLVAAFAGYGFVALLEGEEIPPGQSFLWPRGKTLRFRPRGPGVRGYLAVAGGLEVRPFLGSASPDLRGRIGRPLWAGDVLGLEALRPVRPGRAFPQRPLPEAFRLRLLPGPQFAGEAFRALCSGPFRVARADRVGVELLGPEVPGGEGLSEPTPLGGVQVPPSGRPLVLLADKGSLGGYAKPALVDPRDLWLLGQARPGVEIHFTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative uncharacterized protein TTHA0988
publication title The structure of TTHA0988 from Thermus thermophilus, a KipI-KipA homologue incorrectly annotated as an allophanate hydrolase
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 126
structure length 490
sequence length 493
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02626 CT_A_B Carboxyltransferase domain, subdomain A and B
A PF02682 CT_C_D Carboxyltransferase domain, subdomain C and D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3opfA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3opfA04
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3opfA01
2X2DB 4J59A 3ODIA 2ZP2A 4DGDA 5CCRA 5CBWA 1XXAA 5KV4A 3K0RA 4E1QA 4GFQA 3V4GA 1CWBA 4YULA 5JHEA 4G0UA 1VBTA 2MS4A 3RCLA 1QNHA 1B4AA 2GW2A 1M9EA 4J5CX 2HAQA 4JCPA 3K0NA 1AWVA 3K0PA 4KB2A 3UCHA 1CWFA 1M9CA 1A58A 1H0PA 5CBVA 2B71A 5KUOA 4DGBA 4IPZA 5CJ9A 4S1EA 2XGYB 4XNCA 1CWOA 3RDBA 4DGCA 5CCSX 1BJTA 4J5BA 3MMLB 3BUEA 5KUZA 3BKPA 3FOEA 2PHCB 1MIKA 3JB9d 5JVOA 4R3FA 1X7FA 5KUVA 1MZWA 3R4GA 1XQ7A 1VAIA 5KUWA 2IGWA 2OK3A 4N1PA 2MZUA 4N1SA 4YUGA 1VBSA 4YUPA 1BGWA 2K7NA 4O8HA 5KUQA 4KB4A 2MVZA 4J3NA 3RCGA 1OCAA 4YUOA 4N1QA 3RCIX 3LAPA 5KV3A 2PLUA 4EYVA 3VA7A 4YUNA 5KV2A 4N1RA 4R3EA 3RCFA 1ZKFA 1AWUA 1DD5A 5CBTA 2BITX 1B4BA 4FRUA 1XYHA 2P0OA 2Z6WA 2CMTA 2N0TA 4DGAA 3L4KA 1WQGA 5KUNA 3R57A 1CWIA 1XXBA 1XWNA 1YNDA 5KULA 4J5EX 3R59A 1CWMA 1M9FA 3T1UA 2XCQA 4KC6A 2OSEA 3O7TA 5A0EA 2MC9A 4HY7A 4YUHA 2A2NA 5CBUA 2X25B 3S6MA 3RCKX 1CYNA 3OPFA 4N1OA 2RGRA 1EK8A 1W8MA 2CPLA 4FM9A 3BT8A 4O8IA 3ICIA 5KV6A 1WQFA 2X83B 4YUJA 2CFEA 3ERED 4I9YA 1RMHA 4DDQA 4JJMA 3OREA 1ZMFA 2X2CK 3K0QA 5KUSA 4LQWA 5KV5A 3K2CA 2R99A 1AWQA 5KURA 3CYSA 4N1MA 2ESLA 1E3BA 1AWTA 3MMLA 1EH1A 4CYHA 2HQ6A 1J2AA 5LUDA 5F66A 2FU0A 2QERA 1AK4A 4DGEA 3NUHA 3QYUA 2RS4A 1CLHA 4J5DX 4S1JA 2HE9A 4N1NA 1A33A 1ZVUA 4KAWX 5KV0A 1WQHA 3K0MA 3K0OA 1XXCA 4TOTA 2ZFZA 1BCKA 1VDNA 3CYHA 1ISTA 2P5MA 4YUIA 2XCRB 2IGVA 2WLWA 1CWHA 3PMPA 1CWAA 2HQJA 1W74A 3RDDA 1ISEA 4G0VA 2WFIA 1NMKA 3CAGA 4YUMA 2WFJA 5CYHA 1M63C 1QOIA 2X7KA 1E8KA 3EOVA 1DYWA 5DUDA 3RFYA 1WIHA 1Z81A 4J5AX 5KUUA 2NULA 2Y3PA 1MF8C 1LOPA 1CWJA 1V9TA 5CCNA 1QNGA 2RMAA 2ALFA 4ZSDA 3ODLA 4FRVA 2POYA 2CK1A 3OEPA 2KWAA 2X2AA 1CWLA 5CCQA 1ZKCA 1AB4A 3R54A 1GE9A 1FGLA 4J58A 1F9NA 1IS1A 1CWCA 1W8LA 3LAJA 1M9YA 4G0WA 1CWKA 3FHZA 3RDCA 1M9DA 4YUKA 4ZSCA 2RMBA 1IIPA 2BIUX 2XCOA 1AWRA 2C3BA 2OJUA 3R56A 5KV7A 3R49A 1IHGA 3BO7A 1AWSA 2RMCA 3RD9X 1XO7A 1M9XA 3LPXA 3RDAX 1W8VA 3L4JA 3QX3A 5KV1A 2CYHA 4KDDA 3FOFA 2POEA 1C5FA 3ICHA
chains in the Genus database with same CATH superfamily
2X2DB 5EGHA 4LK1A 5JFEA 4J59A 1TWFA 5TMFA 2JA6C 3HOYK 3S1MC 3S17K 3JSTA 2GAGC 3WODA 2NVYA 3ODIA 1K83K 4C2MC 2ZP2A 4DGDA 4PAAA 5CCRA 5CBWA 1XXAA 3AD9C 5KV4A 4A3GC 2YU9C 3K0RA 4E1QA 3S1QK 3RZOC 4GFQA 2Y0SL 4AYBL 1VGXA 4KN7A 3V4GA 4A3JK 4A3DK 1CWBA 4YULA 5JHEA 1DCOA 4P5AA 3HOUC 4WJ3M 4XSZA 3H3VD 5C3EK 4A93C 4G0UA 1Y1VC 3GTJA 4PABA 1F93A 5IYDC 1JQWA 3HKZL 1O24A 4BBRK 1VBTA 2MS4A 3RCLA 1QNHA 1B4AA 2KA0A 3GEEA 1TWGC 5IP7C 3FKIC 2GW2A 1M9EA 3GTOA 2R92K 3T00A 4J5CX 2HAQA 3SZYA 4GT9A 4JCPA 3K0NA 3HOVK 1Y1WA 4BY7C 4KASA 2B63C 2E2IA 4BKWA 1AWVA 3K0PA 1J98A 4KB2A 3GTMA 1YNNA 1R9TA 1TWFK 3EQLA 3UCHA 3HOYC 3I4NK 3S17C 1CWFA 1JVIA 1M9CA 3GSIA 2NVYK 1A58A 1H0PA 5CBVA 2B71A 5KUOA 4DGBA 4IPZA 4C3HK 4BY1K 3H3VL 3BP8C 1K83C 1YX2A 3ADAC 5CJ9A 4S1EA 2GAHC 3X27A 3S1QC 2XGYB 4XNCA 1BS2A 4YFKA 1CWOA 4KMAA 3RDBA 3CQZA 4GTAA 4A3JC 1SFOA 4DGCA 2A69A 5CCSX 1WCMA 1BJTA 3GTJK 2JA8K 5C3EC 4J5BA 3MMLB 1I50A 2R7ZA 3BUEA 5KUZA 2NVXA 3S2HC 3T02A 3BKPA 3FOEA 4BBSK 2PHCB 4KATA 5E68A 4C3JC 1MIKA 3JB9d 5JVOA 1Y1WK 4R3FA 4ZH4A 4LQYA 1X7FA 5KUVA 1MZWA 3R4GA 1XQ7A 2E2IK 1VAIA 4A3CK 3S2DK 1WOOA 3GTMK 4BXXK 5KUWA 1R9TK 2IGWA 4OINA 1HQMA 2OK3A 1VLOA 4QJVA 1IBAA 4N1PA 3I4MK 1WOPA 3I4NC 3GEIA 2NVYC 5TMCA 2MZUA 4Y52C 4N1SA 4A3KK 4C3IK 3S0XA 4YUGA 1VBSA 1WORA 3RZDK 2JA5A 4YUPA 1TWCC 4GTCA 4AYBD 1BGWA 5CHPA 3M4OK 4A3EC 2K7NA 4O8HA 3CQZK 5IYBK 4X6AK 1SFOK 5KUQA 4M1XA 1DCHA 4KB4A 1J6VA 3S1NK 4YFXA 2MVZA 3GTKA 2VUMC 3S16K 1O2AA 4J3NA 2A68A 3HKZD 2JA8C 1I50K 2FQOA 1TWHA 3RCGA 1OCAA 4YUOA 4N1QA 2NVXK 3RCIX 3S15C 4GTEA 5C4JK 5L46A 2CFAA 2ZUEA 4LK0A 1JOEA 1O25A 4BBSC 3LAPA 5KV3A 4XSXA 5M5XK 2PLUA 4EYVA 5M5YK 2PPBA 3VA7A 4YUNA 2WAQD 4XLNA 5C44K 3HOXK 5KV2A 4N1RA 4A3FK 5TJ3A 1J6XA 4A3LK 2V6UA 2E2IC 5HL8A 1INNA 5FLMK 4A3CC 4R3EA 3RCFA 3S2DC 1ZKFA 1AWUA 4BLAA 3PO2C 1SMYA 3GTMC 4BXXC 1I3QA 1R9TC 3N0BA 1DD5A 5CBTA 3I4MC 4KMDA 2BITX 1V5VA 3IPJA 4OIPA 3GTQA 1B4BA 4A3KC 4FRUA 4C3IC 3TFHA 1IL2A 2JA5K 1XYHA 4GZYA 3RZDC 2P0OA 1USOA 3GTLA 2Z6WA 1XZQA 1YNJA 4A3MK 2CMTA 2N0TA 4DGAA 3L4KA 3M4OC 3CQZC 3GTGK 4X6AC 1WQGA 4KN4A 5KUNA 1SFOC 3S1NC 2R93A 1ZXOA 3GTKK 3R57A 1CWIA 2WAQL 3S16C 1XXBA 2E2JK 2RH6A 1XWNA 2D6FC 5IOSA 1YNDA 5KULA 1IQ0A 1TWHK 1X31C 4G7ZA 1I50C 4A3BC 1ZQ1C 4NOIA 3GTPA 3HXAA 4LR2A 5C4JC 2NVQK 4J5EX 3R59A 1CWMA 4OIOA 1VJEA 4WILA 2GSUA 3TFIA 5C44C 3HOXC 1M9FA 3T1UA 4P5BA 4A3FC 2XCQA 4A3LC 3PO3K 3AH5A 1UV7A 4KC6A 2OSEA 5FLMC 3G4AA 4GTFA 3O7TA 5A0EA 1I3QK 1EQRA 2MC9A 4HY7A 4YUHA 2A2NA 4A3DC 5CBUA 2X25B 3S6MA 4LLGA 3RCKX 4QJVB 2GSOA 1CYNA 4LJZA 4QIWL 3OPFA 4N1OA 4BBRC 1Y1VA 2JA5C 2PA8D 3GTLK 1I6HK 4MEXA 2RGRA 1TWAA 3GTOK 4MQ9A 1EK8A 3A8IA 2FQTA 4Q4ZA 2R92C 3GTGC 4XLPA 1W8MA 2R93K 2CPLA 4FM9A 3BT8A 4O8IA 3ICIA 1ZYRA 3TFJA 3N3YA 3GTKC 3HOVC 3HOZK 5KV6A 1WQFA 2X83B 1KQ4A 3AQPA 2E2JC 4JK1A 4Q5SA 1TWHC 4YUJA 3M3YK 2V6TA 2CFEA 3A8JA 3ERED 1TWFC 2NVQC 5M5WK 3S14K 1ZX8A 3S1RK 4I9YA 1RMHA 2CFAB 4DDQA 5IOTA 4JJMA 3OREA 4FZBA 4C3HC 4BY1C 1O2FB 1YCLA 1ZMFA 2X2CK 3K0QA 5KUSA 3PO3C 4LQWA 3GIRA 5KV5A 3K2CA 2R99A 1O26A 2PA8L 1C0AA 1AWQA 3AD7C 4OIQA 2WB1L 5KURA 5IYCK 3CYSA 2NVTK 4N1MA 1USMA 1BDFA 3Q3QA 2ESLA 1WCMK 2A6HA 1E3BA 1AWTA 4YG2A 3GTJC 3MMLA 1EH1A 2O5IA 2R7ZK 4CYHA 2HQ6A 1VRQC 5IP9K 4A93K 1Y1VK 5C4XK 1J2AA 5LUDA 1WSRA 3GTLC 5F66A 1TWAK 2FU0A 3GTOC 1PJ6A 2QERA 1AK4A 4DGEA 3NUHA 3QYUA 1EFWA 1XZQB 2RS4A 4Y7NK 1CLHA 5IORA 1Y1WC 1WOSA 4OIRA 1EI6A 3HOZC 4J5DX 4S1JA 3GDZA 3KOPA 2GSNA 2HE9A 4KM9A 1XZPA 4N1NA 1A33A 1ZVUA 2JA7A 3S14C 4KAWX 3S1RC 1WSVA 4XCHA 1O28A 5KV0A 4G7OA 5M3MK 1HI9A 3GEHA 4KMHA 1WQHA 3K0MA 1L0WA 3K0OA 1XXCA 4TOTA 2ZFZA 4ILDA 1BCKA 1TWCA 5IYBC 1VDNA 1O29A 3HOWK 3CYHA 5IYCC 2PMZL 2NVTC 1ISTA 2P5MA 1PJ7A 3DXJA 1WCMC 4YUIA 2XCRB 4QIWD 4O2DA 3H0GA 2IGVA 2E2HA 2R7ZC 2WLWA 5IP9C 2VUMA 1CWHA 3PMPA 1I6VA 1CWAA 2HQJA 2P8TA 2NVXC 5C4XC 1W74A 3RDDA 1ISEA 3AQOA 4G7HA 3K7AK 4G0VA 1TWAC 3SZZA 2WFIA 3S2HK 1NMKA 1J6WA 1G51A 3CAGA 4YUMA 2WFJA 5CYHA 2JA6A 1M63C 1QOIA 2X7KA 4KMUA 4Y7NC 1PJ5A 4C3JK 1E8KA 4A3IK 3EOVA 1DYWA 5DUDA 3RFYA 1WIHA 1Z81A 4J5AX 2YU9A 2JH3A 5KUUA 2NULA 2Y3PA 3G4CA 2JA7K 1MF8C 1LOPA 1F7VA 1CWJA 1V9TA 3AD8C 1DCPA 3GTQK 5CCNA 1QNGA 4Y52K 5EGEA 3BP3A 2RMAA 2ALFA 5D4DA 4ZSDA 3ODLA 4FRVA 2POYA 2WB1D 1TWCK 2CK1A 4A3MC 4KM8A 1TWGA 3OEPA 2O5JA 2KWAA 3FKIA 3HOWC 2X2AA 1CWLA 4A3EK 4WJ4A 5CCQA 1ZKCA 1AB4A 1F7UA 2EBBA 1O2BA 3R54A 5IOQA 1GE9A 3H0GK 2E2HK 2VUMK 1FGLA 1XPPA 4J58A 1F9NA 3GTPK 4KARA 2B63A 1IS1A 1CWCA 3K7AC 1W8LA 3LAJA 3S15K 1O27A 1M9YA 2BE5A 4P9SA 1CWKA 3FHZA 4G0WA 3RDCA 1M9DA 2JA6K 4GTDA 4LOWA 4AH6A 3S1MK 4YUKA 4ZSCA 2W7VA 2RMBA 1IIPA 2BIUX 4A3IC 2XCOA 1AWRA 4C2MK 1K83A 1RU0A 5M3FK 2YU9K 4A3GK 1I3QC 2C3BA 2A6EA 2OJUA 3RZOK 3PO2K 2JA7C 3R56A 2ZUFA 5KV7A 3N0CA 1XZPB 4C45A 3R49A 1IHGA 3BO7A 4YFNA 3HOUK 5FJ8K 1AWSA 2RMCA 3RD9X 3GTQC 1XO7A 1M9XA 2NNZA 3LPXA 3RDAX 1W8VA 1IE0A 5IYDK 1ZBSA 1I6HC 2CW0A 2Y0SD 1TWGK 1VH2A 2PMZD 3T01A 3FKIK 5IP7K 5KV1A 3L4JA 3QX3A 2CYHA 4KDDA 4BLBA 3FOFA 2R93C 2POEA 4MEYA 2V6SA 2R92A 1C5FA 3GTGA 4GTLA 4BY7K 3H0GC 3TTGA 1IW7A 2E2HC 3A8KA 4RMFA 2B63K 3GTPC 4A3BK 3ICHA 3M3YC 4GTBA
chains in the Genus database with same CATH topology
2X2DB 5EGHA 5JFEA 4J59A 1TWFA 2NVYA 3ODIA 4C2MC 2ZP2A 4DGDA 5CCRA 5CBWA 1XXAA 5KV4A 3K0RA 4E1QA 4GFQA 3V4GA 1CWBA 4YULA 5JHEA 4P5AA 4G0UA 3GTJA 1O24A 1VBTA 2MS4A 3RCLA 1QNHA 1B4AA 2GW2A 1M9EA 3GTOA 4J5CX 2HAQA 4GT9A 4JCPA 3K0NA 1Y1WA 4KASA 2E2IA 4BKWA 1AWVA 3K0PA 4KB2A 3GTMA 1R9TA 3UCHA 1CWFA 1M9CA 1A58A 1H0PA 5CBVA 2B71A 5KUOA 4DGBA 4IPZA 5CJ9A 4S1EA 2XGYB 4XNCA 1CWOA 4KMAA 3RDBA 3CQZA 4GTAA 1SFOA 4DGCA 5CCSX 1WCMA 1BJTA 4J5BA 3MMLB 1I50A 2R7ZA 3BUEA 5KUZA 2NVXA 3BKPA 3FOEA 2PHCB 4KATA 4C3JC 1MIKA 3JB9d 5JVOA 4R3FA 4LQYA 1X7FA 5KUVA 1MZWA 3R4GA 1XQ7A 1VAIA 5KUWA 2IGWA 2OK3A 4N1PA 2MZUA 4N1SA 3S0XA 4YUGA 1VBSA 2JA5A 4YUPA 4GTCA 1BGWA 5CHPA 2K7NA 4O8HA 5KUQA 4M1XA 4KB4A 2MVZA 3GTKA 1O2AA 4J3NA 1TWHA 3RCGA 1OCAA 4YUOA 4N1QA 3RCIX 4GTEA 2CFAA 1O25A 3LAPA 5KV3A 2PLUA 4EYVA 3VA7A 4YUNA 5KV2A 4N1RA 5TJ3A 4R3EA 3RCFA 1ZKFA 1AWUA 4BLAA 1I3QA 3N0BA 1DD5A 5CBTA 4KMDA 2BITX 3GTQA 1B4BA 4FRUA 4C3IC 1XYHA 2P0OA 3GTLA 2Z6WA 2CMTA 2N0TA 4DGAA 3L4KA 1WQGA 5KUNA 2R93A 1ZXOA 3R57A 1CWIA 1XXBA 2RH6A 1XWNA 5IOSA 1YNDA 5KULA 3GTPA 4LR2A 4J5EX 3R59A 1CWMA 2GSUA 1M9FA 3T1UA 4P5BA 2XCQA 3AH5A 4KC6A 2OSEA 3G4AA 4GTFA 3O7TA 5A0EA 2MC9A 4HY7A 4YUHA 2A2NA 5CBUA 2X25B 3S6MA 3RCKX 2GSOA 1CYNA 3OPFA 4N1OA 1Y1VA 2RGRA 1TWAA 1EK8A 1W8MA 2CPLA 4FM9A 3BT8A 4O8IA 3ICIA 3N3YA 5KV6A 1WQFA 2X83B 1KQ4A 3AQPA 4YUJA 2CFEA 3ERED 4I9YA 1RMHA 2CFAB 4DDQA 5IOTA 4JJMA 3OREA 4FZBA 4C3HC 1ZMFA 2X2CK 3K0QA 5KUSA 4LQWA 5KV5A 3K2CA 2R99A 1O26A 1AWQA 5KURA 3CYSA 4N1MA 3Q3QA 2ESLA 1E3BA 1AWTA 3MMLA 1EH1A 4CYHA 2HQ6A 1J2AA 5LUDA 5F66A 2FU0A 2QERA 1AK4A 4DGEA 3NUHA 3QYUA 2RS4A 1CLHA 5IORA 4J5DX 4S1JA 2GSNA 2HE9A 4KM9A 4N1NA 1A33A 1ZVUA 2JA7A 4KAWX 1O28A 5KV0A 4KMHA 1WQHA 3K0MA 3K0OA 1XXCA 4TOTA 2ZFZA 4ILDA 1TWCA 1BCKA 1VDNA 1O29A 3CYHA 1ISTA 2P5MA 4YUIA 2XCRB 3H0GA 2IGVA 2E2HA 2VUMA 2WLWA 1CWHA 3PMPA 1CWAA 2HQJA 1W74A 3RDDA 1ISEA 3AQOA 4G0VA 2WFIA 1NMKA 3CAGA 4YUMA 2WFJA 5CYHA 2JA6A 1M63C 1QOIA 2X7KA 1E8KA 3EOVA 1DYWA 5DUDA 3RFYA 1WIHA 1Z81A 4J5AX 2YU9A 2JH3A 5KUUA 2NULA 2Y3PA 3G4CA 1MF8C 1LOPA 1CWJA 1V9TA 5CCNA 1QNGA 5EGEA 2RMAA 2ALFA 4ZSDA 3ODLA 4FRVA 2POYA 2CK1A 4KM8A 1TWGA 3OEPA 2KWAA 3FKIA 2X2AA 1CWLA 5CCQA 1ZKCA 1AB4A 1O2BA 3R54A 5IOQA 1GE9A 1FGLA 4J58A 1F9NA 4KARA 2B63A 1IS1A 1CWCA 1W8LA 3LAJA 1O27A 1M9YA 4G0WA 1CWKA 3FHZA 3RDCA 1M9DA 4GTDA 4YUKA 4ZSCA 2RMBA 1IIPA 2BIUX 2XCOA 1AWRA 1K83A 2C3BA 2OJUA 3R56A 5KV7A 3N0CA 3R49A 1IHGA 3BO7A 1AWSA 2RMCA 3RD9X 1XO7A 1M9XA 3LPXA 3RDAX 1W8VA 1ZBSA 3L4JA 3QX3A 5KV1A 2CYHA 4KDDA 4BLBA 3FOFA 2POEA 2R92A 1C5FA 3GTGA 4GTLA 3ICHA 4GTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X2D B;  4J59 A;  3ODI A;  2ZP2 A;  4DGD A;  5CCR A;  5CBW A;  1XXA A;  5KV4 A;  3K0R A;  4E1Q A;  4GFQ A;  3V4G A;  1CWB A;  4YUL A;  5JHE A;  4G0U A;  1VBT A;  2MS4 A;  3RCL A;  1QNH A;  1B4A A;  2GW2 A;  1M9E A;  4J5C X;  2HAQ A;  4JCP A;  3K0N A;  1AWV A;  3K0P A;  4KB2 A;  3UCH A;  1CWF A;  1M9C A;  1A58 A;  1H0P A;  5CBV A;  2B71 A;  5KUO A;  4DGB A;  4IPZ A;  5CJ9 A;  4S1E A;  2XGY B;  4XNC A;  1CWO A;  3RDB A;  4DGC A;  5CCS X;  1BJT A;  4J5B A;  3MML B;  3BUE A;  5KUZ A;  3BKP A;  3FOE A;  2PHC B;  1MIK A;  3JB9 d;  5JVO A;  4R3F A;  1X7F A;  5KUV A;  1MZW A;  3R4G A;  1XQ7 A;  1VAI A;  5KUW A;  2IGW A;  2OK3 A;  4N1P A;  2MZU A;  4N1S A;  4YUG A;  1VBS A;  4YUP A;  1BGW A;  2K7N A;  4O8H A;  5KUQ A;  4KB4 A;  2MVZ A;  4J3N A;  3RCG A;  1OCA A;  4YUO A;  4N1Q A;  3RCI X;  3LAP A;  5KV3 A;  2PLU A;  4EYV A;  3VA7 A;  4YUN A;  5KV2 A;  4N1R A;  4R3E A;  3RCF A;  1ZKF A;  1AWU A;  1DD5 A;  5CBT A;  2BIT X;  1B4B A;  4FRU A;  1XYH A;  2P0O A;  2Z6W A;  2CMT A;  2N0T A;  4DGA A;  3L4K A;  1WQG A;  5KUN A;  3R57 A;  1CWI A;  1XXB A;  1XWN A;  1YND A;  5KUL A;  4J5E X;  3R59 A;  1CWM A;  1M9F A;  3T1U A;  2XCQ A;  4KC6 A;  2OSE A;  3O7T A;  5A0E A;  2MC9 A;  4HY7 A;  4YUH A;  2A2N A;  5CBU A;  2X25 B;  3S6M A;  3RCK X;  1CYN A;  3OPF A;  4N1O A;  2RGR A;  1EK8 A;  1W8M A;  2CPL A;  4FM9 A;  3BT8 A;  4O8I A;  3ICI A;  5KV6 A;  1WQF A;  2X83 B;  4YUJ A;  2CFE A;  3ERE D;  4I9Y A;  1RMH A;  4DDQ A;  4JJM A;  3ORE A;  1ZMF A;  2X2C K;  3K0Q A;  5KUS A;  4LQW A;  5KV5 A;  3K2C A;  2R99 A;  1AWQ A;  5KUR A;  3CYS A;  4N1M A;  2ESL A;  1E3B A;  1AWT A;  3MML A;  1EH1 A;  4CYH A;  2HQ6 A;  1J2A A;  5LUD A;  5F66 A;  2FU0 A;  2QER A;  1AK4 A;  4DGE A;  3NUH A;  3QYU A;  2RS4 A;  1CLH A;  4J5D X;  4S1J A;  2HE9 A;  4N1N A;  1A33 A;  1ZVU A;  4KAW X;  5KV0 A;  1WQH A;  3K0M A;  3K0O A;  1XXC A;  4TOT A;  2ZFZ A;  1BCK A;  1VDN A;  3CYH A;  1IST A;  2P5M A;  4YUI A;  2XCR B;  2IGV A;  2WLW A;  1CWH A;  3PMP A;  1CWA A;  2HQJ A;  1W74 A;  3RDD A;  1ISE A;  4G0V A;  2WFI A;  1NMK A;  3CAG A;  4YUM A;  2WFJ A;  5CYH A;  1M63 C;  1QOI A;  2X7K A;  1E8K A;  3EOV A;  1DYW A;  5DUD A;  3RFY A;  1WIH A;  1Z81 A;  4J5A X;  5KUU A;  2NUL A;  2Y3P A;  1MF8 C;  1LOP A;  1CWJ A;  1V9T A;  5CCN A;  1QNG A;  2RMA A;  2ALF A;  4ZSD A;  3ODL A;  4FRV A;  2POY A;  2CK1 A;  3OEP A;  2KWA A;  2X2A A;  1CWL A;  5CCQ A;  1ZKC A;  1AB4 A;  3R54 A;  1GE9 A;  1FGL A;  4J58 A;  1F9N A;  1IS1 A;  1CWC A;  1W8L A;  3LAJ A;  1M9Y A;  4G0W A;  1CWK A;  3FHZ A;  3RDC A;  1M9D A;  4YUK A;  4ZSC A;  2RMB A;  1IIP A;  2BIU X;  2XCO A;  1AWR A;  2C3B A;  2OJU A;  3R56 A;  5KV7 A;  3R49 A;  1IHG A;  3BO7 A;  1AWS A;  2RMC A;  3RD9 X;  1XO7 A;  1M9X A;  3LPX A;  3RDA X;  1W8V A;  3L4J A;  3QX3 A;  5KV1 A;  2CYH A;  4KDD A;  3FOF A;  2POE A;  1C5F A;  3ICH A; 
#chains in the Genus database with same CATH topology
 2X2D B;  5EGH A;  4LK1 A;  5JFE A;  4J59 A;  1TWF A;  5TMF A;  2JA6 C;  3HOY K;  3S1M C;  3S17 K;  3JST A;  2GAG C;  3WOD A;  2NVY A;  3ODI A;  1K83 K;  4C2M C;  2ZP2 A;  4DGD A;  4PAA A;  5CCR A;  5CBW A;  1XXA A;  3AD9 C;  5KV4 A;  4A3G C;  2YU9 C;  3K0R A;  4E1Q A;  3S1Q K;  3RZO C;  4GFQ A;  2Y0S L;  4AYB L;  1VGX A;  4KN7 A;  3V4G A;  4A3J K;  4A3D K;  1CWB A;  4YUL A;  5JHE A;  1DCO A;  4P5A A;  3HOU C;  4WJ3 M;  4XSZ A;  3H3V D;  5C3E K;  4A93 C;  4G0U A;  1Y1V C;  3GTJ A;  4PAB A;  1F93 A;  5IYD C;  1JQW A;  3HKZ L;  1O24 A;  4BBR K;  1VBT A;  2MS4 A;  3RCL A;  1QNH A;  1B4A A;  2KA0 A;  3GEE A;  1TWG C;  5IP7 C;  3FKI C;  2GW2 A;  1M9E A;  3GTO A;  2R92 K;  3T00 A;  4J5C X;  2HAQ A;  3SZY A;  4GT9 A;  4JCP A;  3K0N A;  3HOV K;  1Y1W A;  4BY7 C;  4KAS A;  2B63 C;  2E2I A;  4BKW A;  1AWV A;  3K0P A;  1J98 A;  4KB2 A;  3GTM A;  1YNN A;  1R9T A;  1TWF K;  3EQL A;  3UCH A;  3HOY C;  3I4N K;  3S17 C;  1CWF A;  1JVI A;  1M9C A;  3GSI A;  2NVY K;  1A58 A;  1H0P A;  5CBV A;  2B71 A;  5KUO A;  4DGB A;  4IPZ A;  4C3H K;  4BY1 K;  3H3V L;  3BP8 C;  1K83 C;  1YX2 A;  3ADA C;  5CJ9 A;  4S1E A;  2GAH C;  3X27 A;  3S1Q C;  2XGY B;  4XNC A;  1BS2 A;  4YFK A;  1CWO A;  4KMA A;  3RDB A;  3CQZ A;  4GTA A;  4A3J C;  1SFO A;  4DGC A;  2A69 A;  5CCS X;  1WCM A;  1BJT A;  3GTJ K;  2JA8 K;  5C3E C;  4J5B A;  3MML B;  1I50 A;  2R7Z A;  3BUE A;  5KUZ A;  2NVX A;  3S2H C;  3T02 A;  3BKP A;  3FOE A;  4BBS K;  2PHC B;  4KAT A;  5E68 A;  4C3J C;  1MIK A;  3JB9 d;  5JVO A;  1Y1W K;  4R3F A;  4ZH4 A;  4LQY A;  1X7F A;  5KUV A;  1MZW A;  3R4G A;  1XQ7 A;  2E2I K;  1VAI A;  4A3C K;  3S2D K;  1WOO A;  3GTM K;  4BXX K;  5KUW A;  1R9T K;  2IGW A;  4OIN A;  1HQM A;  2OK3 A;  1VLO A;  4QJV A;  1IBA A;  4N1P A;  3I4M K;  1WOP A;  3I4N C;  3GEI A;  2NVY C;  5TMC A;  2MZU A;  4Y52 C;  4N1S A;  4A3K K;  4C3I K;  3S0X A;  4YUG A;  1VBS A;  1WOR A;  3RZD K;  2JA5 A;  4YUP A;  1TWC C;  4GTC A;  4AYB D;  1BGW A;  5CHP A;  3M4O K;  4A3E C;  2K7N A;  4O8H A;  3CQZ K;  5IYB K;  4X6A K;  1SFO K;  5KUQ A;  4M1X A;  1DCH A;  4KB4 A;  1J6V A;  3S1N K;  4YFX A;  2MVZ A;  3GTK A;  2VUM C;  3S16 K;  1O2A A;  4J3N A;  2A68 A;  3HKZ D;  2JA8 C;  1I50 K;  2FQO A;  1TWH A;  3RCG A;  1OCA A;  4YUO A;  4N1Q A;  2NVX K;  3RCI X;  3S15 C;  4GTE A;  5C4J K;  5L46 A;  2CFA A;  2ZUE A;  4LK0 A;  1JOE A;  1O25 A;  4BBS C;  3LAP A;  5KV3 A;  4XSX A;  5M5X K;  2PLU A;  4EYV A;  5M5Y K;  2PPB A;  3VA7 A;  4YUN A;  2WAQ D;  4XLN A;  5C44 K;  3HOX K;  5KV2 A;  4N1R A;  4A3F K;  5TJ3 A;  1J6X A;  4A3L K;  2V6U A;  2E2I C;  5HL8 A;  1INN A;  5FLM K;  4A3C C;  4R3E A;  3RCF A;  3S2D C;  1ZKF A;  1AWU A;  4BLA A;  3PO2 C;  1SMY A;  3GTM C;  4BXX C;  1I3Q A;  1R9T C;  3N0B A;  1DD5 A;  5CBT A;  3I4M C;  4KMD A;  2BIT X;  1V5V A;  3IPJ A;  4OIP A;  3GTQ A;  1B4B A;  4A3K C;  4FRU A;  4C3I C;  3TFH A;  1IL2 A;  2JA5 K;  1XYH A;  4GZY A;  3RZD C;  2P0O A;  1USO A;  3GTL A;  2Z6W A;  1XZQ A;  1YNJ A;  4A3M K;  2CMT A;  2N0T A;  4DGA A;  3L4K A;  3M4O C;  3CQZ C;  3GTG K;  4X6A C;  1WQG A;  4KN4 A;  5KUN A;  1SFO C;  3S1N C;  2R93 A;  1ZXO A;  3GTK K;  3R57 A;  1CWI A;  2WAQ L;  3S16 C;  1XXB A;  2E2J K;  2RH6 A;  1XWN A;  2D6F C;  5IOS A;  1YND A;  5KUL A;  1IQ0 A;  1TWH K;  1X31 C;  4G7Z A;  1I50 C;  4A3B C;  1ZQ1 C;  4NOI A;  3GTP A;  3HXA A;  4LR2 A;  5C4J C;  2NVQ K;  4J5E X;  3R59 A;  1CWM A;  4OIO A;  1VJE A;  4WIL A;  2GSU A;  3TFI A;  5C44 C;  3HOX C;  1M9F A;  3T1U A;  4P5B A;  4A3F C;  2XCQ A;  4A3L C;  3PO3 K;  3AH5 A;  1UV7 A;  4KC6 A;  2OSE A;  5FLM C;  3G4A A;  4GTF A;  3O7T A;  5A0E A;  1I3Q K;  1EQR A;  2MC9 A;  4HY7 A;  4YUH A;  2A2N A;  4A3D C;  5CBU A;  2X25 B;  3S6M A;  4LLG A;  3RCK X;  4QJV B;  2GSO A;  1CYN A;  4LJZ A;  4QIW L;  3OPF A;  4N1O A;  4BBR C;  1Y1V A;  2JA5 C;  2PA8 D;  3GTL K;  1I6H K;  4MEX A;  2RGR A;  1TWA A;  3GTO K;  4MQ9 A;  1EK8 A;  3A8I A;  2FQT A;  4Q4Z A;  2R92 C;  3GTG C;  4XLP A;  1W8M A;  2R93 K;  2CPL A;  4FM9 A;  3BT8 A;  4O8I A;  3ICI A;  1ZYR A;  3TFJ A;  3N3Y A;  3GTK C;  3HOV C;  3HOZ K;  5KV6 A;  1WQF A;  2X83 B;  1KQ4 A;  3AQP A;  2E2J C;  4JK1 A;  4Q5S A;  1TWH C;  4YUJ A;  3M3Y K;  2V6T A;  2CFE A;  3A8J A;  3ERE D;  1TWF C;  2NVQ C;  5M5W K;  3S14 K;  1ZX8 A;  3S1R K;  4I9Y A;  1RMH A;  2CFA B;  4DDQ A;  5IOT A;  4JJM A;  3ORE A;  4FZB A;  4C3H C;  4BY1 C;  1O2F B;  1YCL A;  1ZMF A;  2X2C K;  3K0Q A;  5KUS A;  3PO3 C;  4LQW A;  3GIR A;  5KV5 A;  3K2C A;  2R99 A;  1O26 A;  2PA8 L;  1C0A A;  1AWQ A;  3AD7 C;  4OIQ A;  2WB1 L;  5KUR A;  5IYC K;  3CYS A;  2NVT K;  4N1M A;  1USM A;  1BDF A;  3Q3Q A;  2ESL A;  1WCM K;  2A6H A;  1E3B A;  1AWT A;  4YG2 A;  3GTJ C;  3MML A;  1EH1 A;  2O5I A;  2R7Z K;  4CYH A;  2HQ6 A;  1VRQ C;  5IP9 K;  4A93 K;  1Y1V K;  5C4X K;  1J2A A;  5LUD A;  1WSR A;  3GTL C;  5F66 A;  1TWA K;  2FU0 A;  3GTO C;  1PJ6 A;  2QER A;  1AK4 A;  4DGE A;  3NUH A;  3QYU A;  1EFW A;  1XZQ B;  2RS4 A;  4Y7N K;  1CLH A;  5IOR A;  1Y1W C;  1WOS A;  4OIR A;  1EI6 A;  3HOZ C;  4J5D X;  4S1J A;  3GDZ A;  3KOP A;  2GSN A;  2HE9 A;  4KM9 A;  1XZP A;  4N1N A;  1A33 A;  1ZVU A;  2JA7 A;  3S14 C;  4KAW X;  3S1R C;  1WSV A;  4XCH A;  1O28 A;  5KV0 A;  4G7O A;  5M3M K;  1HI9 A;  3GEH A;  4KMH A;  1WQH A;  3K0M A;  1L0W A;  3K0O A;  1XXC A;  4TOT A;  2ZFZ A;  4ILD A;  1BCK A;  1TWC A;  5IYB C;  1VDN A;  1O29 A;  3HOW K;  3CYH A;  5IYC C;  2PMZ L;  2NVT C;  1IST A;  2P5M A;  1PJ7 A;  3DXJ A;  1WCM C;  4YUI A;  2XCR B;  4QIW D;  4O2D A;  3H0G A;  2IGV A;  2E2H A;  2R7Z C;  2WLW A;  5IP9 C;  2VUM A;  1CWH A;  3PMP A;  1I6V A;  1CWA A;  2HQJ A;  2P8T A;  2NVX C;  5C4X C;  1W74 A;  3RDD A;  1ISE A;  3AQO A;  4G7H A;  3K7A K;  4G0V A;  1TWA C;  3SZZ A;  2WFI A;  3S2H K;  1NMK A;  1J6W A;  1G51 A;  3CAG A;  4YUM A;  2WFJ A;  5CYH A;  2JA6 A;  1M63 C;  1QOI A;  2X7K A;  4KMU A;  4Y7N C;  1PJ5 A;  4C3J K;  1E8K A;  4A3I K;  3EOV A;  1DYW A;  5DUD A;  3RFY A;  1WIH A;  1Z81 A;  4J5A X;  2YU9 A;  2JH3 A;  5KUU A;  2NUL A;  2Y3P A;  3G4C A;  2JA7 K;  1MF8 C;  1LOP A;  1F7V A;  1CWJ A;  1V9T A;  3AD8 C;  1DCP A;  3GTQ K;  5CCN A;  1QNG A;  4Y52 K;  5EGE A;  3BP3 A;  2RMA A;  2ALF A;  5D4D A;  4ZSD A;  3ODL A;  4FRV A;  2POY A;  2WB1 D;  1TWC K;  2CK1 A;  4A3M C;  4KM8 A;  1TWG A;  3OEP A;  2O5J A;  2KWA A;  3FKI A;  3HOW C;  2X2A A;  1CWL A;  4A3E K;  4WJ4 A;  5CCQ A;  1ZKC A;  1AB4 A;  1F7U A;  2EBB A;  1O2B A;  3R54 A;  5IOQ A;  1GE9 A;  3H0G K;  2E2H K;  2VUM K;  1FGL A;  1XPP A;  4J58 A;  1F9N A;  3GTP K;  4KAR A;  2B63 A;  1IS1 A;  1CWC A;  3K7A C;  1W8L A;  3LAJ A;  3S15 K;  1O27 A;  1M9Y A;  2BE5 A;  4P9S A;  1CWK A;  3FHZ A;  4G0W A;  3RDC A;  1M9D A;  2JA6 K;  4GTD A;  4LOW A;  4AH6 A;  3S1M K;  4YUK A;  4ZSC A;  2W7V A;  2RMB A;  1IIP A;  2BIU X;  4A3I C;  2XCO A;  1AWR A;  4C2M K;  1K83 A;  1RU0 A;  5M3F K;  2YU9 K;  4A3G K;  1I3Q C;  2C3B A;  2A6E A;  2OJU A;  3RZO K;  3PO2 K;  2JA7 C;  3R56 A;  2ZUF A;  5KV7 A;  3N0C A;  1XZP B;  4C45 A;  3R49 A;  1IHG A;  3BO7 A;  4YFN A;  3HOU K;  5FJ8 K;  1AWS A;  2RMC A;  3RD9 X;  3GTQ C;  1XO7 A;  1M9X A;  2NNZ A;  3LPX A;  3RDA X;  1W8V A;  1IE0 A;  5IYD K;  1ZBS A;  1I6H C;  2CW0 A;  2Y0S D;  1TWG K;  1VH2 A;  2PMZ D;  3T01 A;  3FKI K;  5IP7 K;  5KV1 A;  3L4J A;  3QX3 A;  2CYH A;  4KDD A;  4BLB A;  3FOF A;  2R93 C;  2POE A;  4MEY A;  2V6S A;  2R92 A;  1C5F A;  3GTG A;  4GTL A;  4BY7 K;  3H0G C;  3TTG A;  1IW7 A;  2E2H C;  3A8K A;  4RMF A;  2B63 K;  3GTP C;  4A3B K;  3ICH A;  3M3Y C;  4GTB A; 
#chains in the Genus database with same CATH homology
 2X2D B;  5EGH A;  5JFE A;  4J59 A;  1TWF A;  2NVY A;  3ODI A;  4C2M C;  2ZP2 A;  4DGD A;  5CCR A;  5CBW A;  1XXA A;  5KV4 A;  3K0R A;  4E1Q A;  4GFQ A;  3V4G A;  1CWB A;  4YUL A;  5JHE A;  4P5A A;  4G0U A;  3GTJ A;  1O24 A;  1VBT A;  2MS4 A;  3RCL A;  1QNH A;  1B4A A;  2GW2 A;  1M9E A;  3GTO A;  4J5C X;  2HAQ A;  4GT9 A;  4JCP A;  3K0N A;  1Y1W A;  4KAS A;  2E2I A;  4BKW A;  1AWV A;  3K0P A;  4KB2 A;  3GTM A;  1R9T A;  3UCH A;  1CWF A;  1M9C A;  1A58 A;  1H0P A;  5CBV A;  2B71 A;  5KUO A;  4DGB A;  4IPZ A;  5CJ9 A;  4S1E A;  2XGY B;  4XNC A;  1CWO A;  4KMA A;  3RDB A;  3CQZ A;  4GTA A;  1SFO A;  4DGC A;  5CCS X;  1WCM A;  1BJT A;  4J5B A;  3MML B;  1I50 A;  2R7Z A;  3BUE A;  5KUZ A;  2NVX A;  3BKP A;  3FOE A;  2PHC B;  4KAT A;  4C3J C;  1MIK A;  3JB9 d;  5JVO A;  4R3F A;  4LQY A;  1X7F A;  5KUV A;  1MZW A;  3R4G A;  1XQ7 A;  1VAI A;  5KUW A;  2IGW A;  2OK3 A;  4N1P A;  2MZU A;  4N1S A;  3S0X A;  4YUG A;  1VBS A;  2JA5 A;  4YUP A;  4GTC A;  1BGW A;  5CHP A;  2K7N A;  4O8H A;  5KUQ A;  4M1X A;  4KB4 A;  2MVZ A;  3GTK A;  1O2A A;  4J3N A;  1TWH A;  3RCG A;  1OCA A;  4YUO A;  4N1Q A;  3RCI X;  4GTE A;  2CFA A;  1O25 A;  3LAP A;  5KV3 A;  2PLU A;  4EYV A;  3VA7 A;  4YUN A;  5KV2 A;  4N1R A;  5TJ3 A;  4R3E A;  3RCF A;  1ZKF A;  1AWU A;  4BLA A;  1I3Q A;  3N0B A;  1DD5 A;  5CBT A;  4KMD A;  2BIT X;  3GTQ A;  1B4B A;  4FRU A;  4C3I C;  1XYH A;  2P0O A;  3GTL A;  2Z6W A;  2CMT A;  2N0T A;  4DGA A;  3L4K A;  1WQG A;  5KUN A;  2R93 A;  1ZXO A;  3R57 A;  1CWI A;  1XXB A;  2RH6 A;  1XWN A;  5IOS A;  1YND A;  5KUL A;  3GTP A;  4LR2 A;  4J5E X;  3R59 A;  1CWM A;  2GSU A;  1M9F A;  3T1U A;  4P5B A;  2XCQ A;  3AH5 A;  4KC6 A;  2OSE A;  3G4A A;  4GTF A;  3O7T A;  5A0E A;  2MC9 A;  4HY7 A;  4YUH A;  2A2N A;  5CBU A;  2X25 B;  3S6M A;  3RCK X;  2GSO A;  1CYN A;  3OPF A;  4N1O A;  1Y1V A;  2RGR A;  1TWA A;  1EK8 A;  1W8M A;  2CPL A;  4FM9 A;  3BT8 A;  4O8I A;  3ICI A;  3N3Y A;  5KV6 A;  1WQF A;  2X83 B;  1KQ4 A;  3AQP A;  4YUJ A;  2CFE A;  3ERE D;  4I9Y A;  1RMH A;  2CFA B;  4DDQ A;  5IOT A;  4JJM A;  3ORE A;  4FZB A;  4C3H C;  1ZMF A;  2X2C K;  3K0Q A;  5KUS A;  4LQW A;  5KV5 A;  3K2C A;  2R99 A;  1O26 A;  1AWQ A;  5KUR A;  3CYS A;  4N1M A;  3Q3Q A;  2ESL A;  1E3B A;  1AWT A;  3MML A;  1EH1 A;  4CYH A;  2HQ6 A;  1J2A A;  5LUD A;  5F66 A;  2FU0 A;  2QER A;  1AK4 A;  4DGE A;  3NUH A;  3QYU A;  2RS4 A;  1CLH A;  5IOR A;  4J5D X;  4S1J A;  2GSN A;  2HE9 A;  4KM9 A;  4N1N A;  1A33 A;  1ZVU A;  2JA7 A;  4KAW X;  1O28 A;  5KV0 A;  4KMH A;  1WQH A;  3K0M A;  3K0O A;  1XXC A;  4TOT A;  2ZFZ A;  4ILD A;  1TWC A;  1BCK A;  1VDN A;  1O29 A;  3CYH A;  1IST A;  2P5M A;  4YUI A;  2XCR B;  3H0G A;  2IGV A;  2E2H A;  2VUM A;  2WLW A;  1CWH A;  3PMP A;  1CWA A;  2HQJ A;  1W74 A;  3RDD A;  1ISE A;  3AQO A;  4G0V A;  2WFI A;  1NMK A;  3CAG A;  4YUM A;  2WFJ A;  5CYH A;  2JA6 A;  1M63 C;  1QOI A;  2X7K A;  1E8K A;  3EOV A;  1DYW A;  5DUD A;  3RFY A;  1WIH A;  1Z81 A;  4J5A X;  2YU9 A;  2JH3 A;  5KUU A;  2NUL A;  2Y3P A;  3G4C A;  1MF8 C;  1LOP A;  1CWJ A;  1V9T A;  5CCN A;  1QNG A;  5EGE A;  2RMA A;  2ALF A;  4ZSD A;  3ODL A;  4FRV A;  2POY A;  2CK1 A;  4KM8 A;  1TWG A;  3OEP A;  2KWA A;  3FKI A;  2X2A A;  1CWL A;  5CCQ A;  1ZKC A;  1AB4 A;  1O2B A;  3R54 A;  5IOQ A;  1GE9 A;  1FGL A;  4J58 A;  1F9N A;  4KAR A;  2B63 A;  1IS1 A;  1CWC A;  1W8L A;  3LAJ A;  1O27 A;  1M9Y A;  4G0W A;  1CWK A;  3FHZ A;  3RDC A;  1M9D A;  4GTD A;  4YUK A;  4ZSC A;  2RMB A;  1IIP A;  2BIU X;  2XCO A;  1AWR A;  1K83 A;  2C3B A;  2OJU A;  3R56 A;  5KV7 A;  3N0C A;  3R49 A;  1IHG A;  3BO7 A;  1AWS A;  2RMC A;  3RD9 X;  1XO7 A;  1M9X A;  3LPX A;  3RDA X;  1W8V A;  1ZBS A;  3L4J A;  3QX3 A;  5KV1 A;  2CYH A;  4KDD A;  4BLB A;  3FOF A;  2POE A;  2R92 A;  1C5F A;  3GTG A;  4GTL A;  3ICH A;  4GTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...