3OPFA

Crystal structure of ttha0988 in space group p212121
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
493
structure length
490
Chain Sequence
MVRGFYLRFGEGVSEEANRRALALAEALLRAPPPGLLDAVPAYGVLYLEYDPRRLSRGRLLRLLKGLPQERARVVEIPVRYDGEDLPEVASRLGLSLEAVKALHQKPLYRVYALGFTPGFPFLAEVEPALRLPRKPHPRPRVPAHAVAVAGVQTGIYPLPSPGGWNLLGTSLVAVYDPHRETPFLLRPGDRVRFLEAEGPTPPEPRPLELLPEEPRLPALLVEEPGLMDLVVDGGRFLGGHLGLARSGPLDAPSARLANRLVGNGAGAPLLEFAYKGPVLTALRDLVAAFAGYGFVALLEGEEIPPGQSFLWPRGKTLRFRPRGPGVRGYLAVAGGLEVRPFLGSASPDLRGRIGRPLWAGDVLGLEALRPVRPGRAFPQRPLPEAFRLRLLPGPQFAGEAFRALCSGPFRVARADRVGVELLGPEVPGGEGLSEPTPLGGVQVPPSGRPLVLLADKGSLGGYAKPALVDPRDLWLLGQARPGVEIHFTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of TTHA0988 from Thermus thermophilus, a KipI-KipA homologue incorrectly annotated as an allophanate hydrolase
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords Putative uncharacterized protein TTHA0988
total genus 126
structure length 490
sequence length 493
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02626 CT_A_B Carboxyltransferase domain, subdomain A and B
A PF02682 CT_C_D Carboxyltransferase domain, subdomain C and D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3opfA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3opfA04
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3opfA01
3BO7A 1LOPA 5F66A 1WQFA 2BIUX 4J5EX 4J5CX 3UCHA 2A2NA 3BT8A 1CWKA 4DGAA 3ODLA 5CYHA 5KUNA 1VAIA 2X7KA 4JJMA 1BCKA 4O8IA 4YUMA 2WFIA 3T1UA 1AWRA 4J58A 1OCAA 3FOFA 4YUJA 1W8MA 4J5BA 3OEPA 4YUOA 5CCQA 3K0MA 2RMCA 3RCFA 3LAPA 4E1QA 3QX3A 2B71A 2NULA 4G0VA 1CWOA 1IIPA 1IHGA 1W8LA 4N1SA 3R57A 3ERED 1XO7A 1E8KA 3QYUA 1F9NA 4DDQA 3K0RA 3K2CA 2MVZA 2CK1A 2WFJA 1MIKA 3V4GA 5KV5A 2C3BA 4DGBA 2XCQA 3K0QA 2IGWA 1XYHA 4N1NA 1XXCA 4HY7A 2IGVA 1QNGA 5KUUA 2Z6WA 2Y3PA 1M9XA 1VBSA 3CYSA 3RCGA 4FM9A 3K0PA 5CBTA 4N1OA 5KV2A 3RCIX 2KWAA 1AWTA 1ZKCA 3K0NA 3RDCA 1WQHA 1CWBA 3R56A 4R3FA 1EH1A 1WIHA 4KDDA 4J5DX 1X7FA 2ESLA 2X2CK 4YULA 1WQGA 1M9EA 4J3NA 5JVOA 3FHZA 3L4JA 5KV4A 4N1MA 1CWFA 2P0OA 2ALFA 2HAQA 5CBWA 2X25B 5CBVA 1IS1A 2CPLA 5KULA 2GW2A 2RS4A 1DYWA 3R54A 4LQWA 3EOVA 2MC9A 3RCLA 4KC6A 1XQ7A 5KV6A 4EYVA 5LUDA 1CWMA 2WLWA 3R59A 1ZMFA 4YUIA 3O7TA 1M9CA 4IPZA 2FU0A 3OREA 2POEA 5CCSX 1XXAA 1A33A 1VDNA 1EK8A 2X2DB 1AB4A 1YNDA 4N1PA 5KUSA 2X2AA 3ICHA 1M9FA 3R49A 1VBTA 3RDBA 5KUVA 3FOEA 2CFEA 1AWSA 2N0TA 4ZSDA 1M63C 4YUKA 1CWCA 1CWIA 3OPFA 2PLUA 3RDAX 1XXBA 1ZVUA 2P5MA 1A58A 1CWJA 1QOIA 2MS4A 2RMBA 3VA7A 3PMPA 1DD5A 1CYNA 1ZKFA 2XGYB 3LPXA 4KAWX 3JB9d 4YUNA 5CCNA 4J59A 4XNCA 3L4KA 1QNHA 3MMLB 4R3EA 3CYHA 3ODIA 1C5FA 1NMKA 1AWVA 4FRVA 4I9YA 4JCPA 2R99A 2XCRB 2K7NA 2BITX 1CWHA 3BKPA 5KV3A 2ZFZA 4G0UA 5KV0A 4S1JA 5CCRA 1RMHA 1BGWA 3ICIA 3NUHA 1AWUA 1W74A 4KB4A 1FGLA 5JHEA 1ISTA 5KUZA 3RDDA 4TOTA 3RFYA 1CLHA 1AK4A 5CJ9A 1MZWA 1Z81A 4DGDA 2OJUA 4YUHA 2HE9A 4G0WA 3K0OA 3R4GA 4J5AX 4ZSCA 5KUQA 5KV7A 4N1RA 4CYHA 5A0EA 1XWNA 5KURA 5DUDA 1E3BA 3CAGA 2HQ6A 4N1QA 1V9TA 1M9DA 2OSEA 3RD9X 2POYA 2CMTA 2CYHA 3MMLA 4DGCA 1MF8C 2ZP2A 1M9YA 5KUWA 4FRUA 1CWAA 4KB2A 3LAJA 5KUOA 2OK3A 1H0PA 1CWLA 5KV1A 1GE9A 1J2AA 2X83B 1ISEA 2MZUA 1B4AA 2HQJA 1B4BA 2XCOA 3RCKX 4O8HA 2PHCB 4YUPA 1W8VA 4S1EA 4YUGA 1BJTA 4DGEA 1AWQA 3BUEA 2QERA 5CBUA 2RMAA 3S6MA 2RGRA 4GFQA
chains in the Genus database with same CATH superfamily
2BIUX 4J5CX 4A3DC 5M5WK 3HOXC 1I3QK 1JQWA 1WOOA 4A3GK 4A3BC 4Y7NK 4OINA 1F7UA 4J58A 1W8MA 4J5BA 4Q5SA 3OEPA 1IQ0A 4LR2A 2RMCA 3RCFA 3T00A 2R92C 4QIWL 4C2MC 2YU9A 2PMZD 4A3CC 1TWGA 1I6VA 4DDQA 1WSVA 1XPPA 2CK1A 2WFJA 1TWHA 5KV5A 2VUMK 3AD9C 2R7ZC 3S2DC 2JH3A 3AD8C 1QNGA 5FLMC 1USOA 1M9XA 4FM9A 1PJ7A 4GTLA 4AYBL 5KV2A 3AD7C 4BY7C 5IOSA 1ZQ1C 3R56A 4R3FA 1VJEA 2X2CK 3GTPA 4YULA 2A68A 3FHZA 1K83C 5KV4A 2R7ZA 1CWFA 2ALFA 2HAQA 5CBVA 3S2HC 3I4MC 5KULA 3HOWC 3EQLA 2GW2A 4LQWA 2E2HC 4A3CK 3RCLA 3S1NK 4EYVA 5KV6A 5LUDA 2GSOA 4YFKA 3GTOA 3K7AK 2JA7C 3RZDC 1ZMFA 4IPZA 2R93K 1TWGK 4XLNA 1XXAA 2NVQC 1EK8A 1UV7A 3TFHA 1M9FA 3BP3A 1VBTA 3RDBA 3H3VL 5FLMK 2CFEA 4ZSDA 3Q3QA 2O5IA 1CWIA 3OPFA 2P5MA 4M1XA 5C4JK 1J98A 1A58A 2MS4A 2JA5A 4YUNA 4J59A 2BE5A 1QNHA 3MMLB 4WJ3M 2R99A 2K7NA 2BITX 1SMYA 5KV0A 5IYCC 1TWHK 1USMA 5EGHA 4LQYA 2D6FC 3ICIA 2JA6A 1JOEA 1WCMA 3NUHA 4BBSC 1TWCK 4TOTA 4MQ9A 3RFYA 5IP7K 3S1QK 4A3IK 2PMZL 4LLGA 4BBRC 2OJUA 1I6HK 5IP9K 5M3FK 1Y1WA 4J5AX 4ZSCA 1J6WA 1HQMA 1X31C 4CYHA 4GTFA 3S1RK 1XWNA 5KURA 5DUDA 1F7VA 2V6TA 3CAGA 1TWAA 3GTKK 4C3JC 2VUMC 3GTJC 2V6UA 4Y52C 1MF8C 2ZP2A 2JA8K 3LAJA 4FRUA 1CWAA 1H0PA 4C3IC 5KV1A 4AYBD 2MZUA 2CFAA 2XCOA 2Y0SD 3RCKX 2VUMA 4DGEA 1AWQA 2WAQD 3G4CA 5IYCK 3GSIA 4LOWA 5CJ9A 3S6MA 2RGRA 2E2HK 1LOPA 1XZPB 1JVIA 4GTCA 4J5EX 1L0WA 3DXJA 2A2NA 3GTOK 3S2HK 1CWKA 5KUNA 5CYHA 4BBRK 2X7KA 1WCMC 3H3VD 4O8IA 4GZYA 1R9TC 1AWRA 5C4XC 4YUOA 5CCQA 3T02A 1F93A 2A69A 3AH5A 2Y0SL 1TWCA 1IIPA 1IHGA 1W8LA 4N1SA 2A6EA 3JSTA 4KMUA 5TJ3A 3GTJK 2ZUFA 3S15K 2WB1L 1E8KA 4OIOA 2GAGC 4A3EC 1MIKA 3FKIC 2C3BA 2NVXK 3PO2C 3K0QA 1XYHA 4N1NA 3GTMC 2IGVA 3N3YA 2Z6WA 4YFNA 4LK1A 3I4MK 3RCGA 3K0PA 3HOZC 1DCHA 5C3EC 3M4OK 1TWHC 1WQGA 2R93C 3CQZC 2NVQK 2X25B 1IS1A 4PABA 2KA0A 2RS4A 3R54A 4KC6A 1CWMA 4XLPA 1YNJA 1M9CA 2FU0A 3OREA 5CCSX 1A33A 1YNDA 5KUSA 2X2AA 2E2IK 3RZOK 3FOEA 3S1MC 1Y1VA 4GT9A 1ZX8A 1M63C 1TWFC 3PO2K 2PLUA 1BDFA 1ZVUA 5C3EK 2RMBA 3VA7A 4KN7A 1DD5A 1CYNA 1ZKFA 3S0XA 1O2BA 3HOWK 3L4KA 3PO3K 1SFOK 4I9YA 1AWVA 2XCRB 4QJVB 1INNA 1CWHA 3BKPA 1J6VA 4G0UA 1ZBSA 5CCRA 3HOVK 2NVTC 3GTQC 1AWUA 1W74A 1J6XA 3GTPC 5KUZA 2R93A 4P5BA 1WOSA 1Z81A 1O28A 4XSZA 1O25A 2E2IC 3RZOC 3S1MK 4X6AC 3GTGA 3X27A 3R4GA 3A8JA 4PAAA 3M3YC 3KOPA 5KUQA 4XCHA 5KV7A 2NVYK 4N1RA 5C44K 5TMCA 4A93C 4OIQA 5M5YK 4G7OA 2NVXC 5D4DA 3PO3C 4OIPA 4LK0A 3GTMA 2CW0A 4GTEA 2OSEA 4BBSK 2CMTA 4O2DA 4DGCA 5JFEA 3GTGC 5M5XK 5KUOA 3T01A 2OK3A 3GDZA 1TWFK 4KMHA 2NVTK 3GTQK 2X83B 3S1QC 1B4AA 2WAQL 4BY1K 4YUGA 4O8HA 2PHCB 3HKZD 1XZQB 3QX3A 1HI9A 1BJTA 3CQZA 1ZXOA 4GFQA 5IP9C 2GSUA 3BO7A 2W7VA 3N0BA 5F66A 2NVYC 5C44C 4YFXA 4A3FC 3M3YK 1O24A 4FZBA 3UCHA 1SFOA 2JA6C 1VAIA 4JJMA 4YUMA 3FKIA 2WFIA 3GEIA 4A3MK 4BY7K 4MEXA 4QJVA 3K0MA 1ZYRA 2B71A 2NULA 1CWOA 5IOQA 2E2JC 3ERED 5IORA 4G0VA 2B63K 3K2CA 1TWAC 3GIRA 1IL2A 3H0GA 1C0AA 5KUUA 1VBSA 2R92A 3S16K 2V6SA 2E2HA 2YU9C 5E68A 2KWAA 1TWGC 1YX2A 1AWTA 3K0NA 3RDCA 3HOVC 1CWBA 4C45A 2JA7A 3K7AC 1EH1A 5C4XK 2JA7K 4J5DX 5JVOA 4AH6A 4WJ4A 1M9EA 4J3NA 4N1MA 3SZYA 5CBWA 4KMDA 1PJ5A 3S14C 1Y1VC 3EOVA 2MC9A 4A3LC 4KM8A 4A3EK 3GEEA 3S15C 1XZQA 3O7TA 2GSNA 3M4OC 2FQTA 3R49A 3GTGK 5KUVA 4GTAA 3HOZK 1K83K 1AWSA 5FJ8K 2A6HA 1TWCC 1CWCA 3RDAX 1XXBA 4G7HA 1CWJA 1QOIA 3GTQA 3LPXA 3H0GC 3JB9d 4KAWX 5IYDK 1VH2A 2WB1D 2PA8L 2P8TA 3CYHA 4FRVA 1C5FA 1NMKA 4C3JK 4BLBA 4BY1C 2FQOA 4A3LK 2ZFZA 4KM9A 4A3FK 1TWFA 4A3KK 4RMFA 3S17C 1RMHA 3AQOA 3HOYC 5JHEA 5CHPA 4BXXC 5M3MK 1MZWA 4YUHA 4Y52K 4G0WA 4BKWA 4G7ZA 1RU0A 4MEYA 5IYBC 4A3BK 5TMFA 4GTDA 2ZUEA 2PA8D 3HOXK 4KMAA 4C3HK 4N1QA 4ILDA 3H0GK 4BLAA 5IYDC 2E2IA 1M9DA 4DGBA 3RD9X 2POYA 2CYHA 5KUWA 1Y1WC 1G51A 1M9YA 4P9SA 3N0CA 5IP7C 4C2MK 4A3IC 1CWLA 3HOUK 1GE9A 3HOYK 4YG2A 1WOPA 3HKZL 4WILA 4ZH4A 2HQJA 1B4BA 2PPBA 3S17K 4S1EA 3GTPK 3TTGA 1K83A 5L46A 4OIRA 1V5VA 3FKIK 4A3JK 3GTKC 1I50K 2RH6A 1EQRA 4X6AK 1XZPA 3S1RC 1DCOA 1WQFA 1EI6A 4KARA 3BT8A 4DGAA 1Y1VK 3ODLA 3TFIA 4A93K 1BCKA 1O27A 1O29A 3T1UA 4BXXK 1OCAA 4LJZA 3FOFA 4YUJA 1O26A 2JA8C 3GTKA 3LAPA 2EBBA 1O2AA 3ADAC 4E1QA 3S16C 2NVYA 4C3HC 3RZDK 3R57A 1VRQC 1WORA 3A8IA 3A8KA 1XO7A 3TFJA 3QYUA 1F9NA 3K0RA 3V4GA 2MVZA 3WODA 2XCQA 2IGWA 2NNZA 1XXCA 1IBAA 4HY7A 2O5JA 1YCLA 2Y3PA 3G4AA 1KQ4A 3CYSA 4P5AA 5CBTA 5C4JC 4N1OA 4JK1A 3HOUC 1WSRA 3RCIX 1I50A 1ZKCA 1R9TK 1WQHA 4KDDA 1WIHA 1X7FA 2ESLA 4A3MC 3L4JA 4A3KC 5HL8A 2P0OA 1BS2A 2CPLA 1PJ6A 4A3DK 1DYWA 3BP8C 5IYBK 1XQ7A 2WLWA 3R59A 1TWAK 1SFOC 2E2JK 1DCPA 2B63C 4YUIA 3GTLK 4NOIA 3IPJA 4Q4ZA 1R9TA 3GTJA 1I6HC 2POEA 1VDNA 2X2DB 1AB4A 4N1PA 4KASA 3ICHA 1Y1WK 2R92K 3CQZK 2YU9K 4YUKA 2N0TA 1VGXA 3PMPA 1VLOA 2GAHC 2B63A 2XGYB 3I4NK 5CCNA 4KN4A 2R7ZK 3S14K 4XNCA 3S2DK 4R3EA 3ODIA 4JCPA 5KV3A 1O2FB 4S1JA 4C3IK 1I50C 2JA5K 1BGWA 4KB4A 1FGLA 2CFAB 1ISTA 3RDDA 1CLHA 1AK4A 5IOTA 4DGDA 4A3GC 2HE9A 4Y7NC 1YNNA 3K0OA 1I3QC 4GTBA 3GTLC 1IW7A 1WCMK 3SZZA 3S1NC 5A0EA 1E3BA 3GTOC 2HQ6A 3I4NC 1V9TA 4A3JC 3MMLA 5EGEA 4KB2A 1I3QA 3GTLA 1EFWA 1J2AA 3HXAA 3AQPA 4QIWD 2JA6K 1ISEA 1IE0A 2JA5C 2NVXA 4YUPA 1W8VA 3GEHA 3BUEA 4XSXA 4KATA 2QERA 5CBUA 2RMAA 3GTMK
chains in the Genus database with same CATH topology
2BIUX 4J5CX 4J58A 1W8MA 4J5BA 3OEPA 4LR2A 2RMCA 3RCFA 4C2MC 2YU9A 1TWGA 4DDQA 2CK1A 2WFJA 1TWHA 5KV5A 2JH3A 1QNGA 1M9XA 4FM9A 4GTLA 5KV2A 5IOSA 3R56A 4R3FA 2X2CK 3GTPA 4YULA 3FHZA 5KV4A 2R7ZA 1CWFA 2ALFA 2HAQA 5CBVA 5KULA 2GW2A 4LQWA 3RCLA 4EYVA 5KV6A 5LUDA 2GSOA 3GTOA 1ZMFA 4IPZA 1XXAA 1EK8A 1M9FA 1VBTA 3RDBA 2CFEA 4ZSDA 3Q3QA 1CWIA 3OPFA 2P5MA 4M1XA 1A58A 2MS4A 2JA5A 4YUNA 4J59A 1QNHA 3MMLB 2R99A 2K7NA 2BITX 5KV0A 5EGHA 4LQYA 3ICIA 2JA6A 1WCMA 3NUHA 4TOTA 3RFYA 2OJUA 1Y1WA 4J5AX 4ZSCA 4CYHA 4GTFA 1XWNA 5KURA 5DUDA 3CAGA 1TWAA 4C3JC 1MF8C 2ZP2A 3LAJA 4FRUA 1CWAA 1H0PA 4C3IC 5KV1A 2MZUA 2CFAA 2XCOA 3RCKX 2VUMA 4DGEA 1AWQA 3G4CA 5CJ9A 3S6MA 2RGRA 1LOPA 4GTCA 4J5EX 2A2NA 1CWKA 5KUNA 5CYHA 2X7KA 4O8IA 1AWRA 4YUOA 5CCQA 3AH5A 1TWCA 1IIPA 1IHGA 1W8LA 4N1SA 5TJ3A 1E8KA 1MIKA 2C3BA 3K0QA 1XYHA 4N1NA 2IGVA 3N3YA 2Z6WA 3RCGA 3K0PA 1WQGA 2X25B 1IS1A 2RS4A 3R54A 4KC6A 1CWMA 1M9CA 2FU0A 3OREA 5CCSX 1A33A 1YNDA 5KUSA 2X2AA 3FOEA 1Y1VA 4GT9A 1M63C 2PLUA 1ZVUA 2RMBA 3VA7A 1DD5A 1CYNA 1ZKFA 3S0XA 1O2BA 3L4KA 4I9YA 1AWVA 2XCRB 1CWHA 3BKPA 4G0UA 1ZBSA 5CCRA 1AWUA 1W74A 5KUZA 2R93A 4P5BA 1Z81A 1O28A 1O25A 3GTGA 3R4GA 5KUQA 5KV7A 4N1RA 3GTMA 4GTEA 2OSEA 2CMTA 4DGCA 5JFEA 5KUOA 2OK3A 4KMHA 2X83B 1B4AA 4YUGA 4O8HA 2PHCB 3QX3A 1BJTA 3CQZA 1ZXOA 4GFQA 2GSUA 3BO7A 3N0BA 5F66A 1O24A 4FZBA 3UCHA 1SFOA 1VAIA 4JJMA 4YUMA 3FKIA 2WFIA 3K0MA 2B71A 2NULA 1CWOA 5IOQA 3ERED 5IORA 4G0VA 3K2CA 3H0GA 5KUUA 1VBSA 2R92A 2E2HA 2KWAA 1AWTA 3K0NA 3RDCA 1CWBA 2JA7A 1EH1A 4J5DX 5JVOA 1M9EA 4J3NA 4N1MA 5CBWA 4KMDA 3EOVA 2MC9A 4KM8A 3O7TA 2GSNA 3R49A 5KUVA 4GTAA 1AWSA 1CWCA 3RDAX 1XXBA 1CWJA 1QOIA 3GTQA 3LPXA 4KAWX 3JB9d 4BLBA 3CYHA 4FRVA 1C5FA 1NMKA 2ZFZA 4KM9A 1TWFA 1RMHA 3AQOA 5JHEA 5CHPA 1MZWA 4YUHA 4G0WA 4BKWA 4GTDA 4KMAA 4N1QA 4ILDA 4BLAA 2E2IA 1M9DA 4DGBA 3RD9X 2POYA 2CYHA 5KUWA 1M9YA 3N0CA 1CWLA 1GE9A 2HQJA 1B4BA 4S1EA 1K83A 2RH6A 1WQFA 4KARA 3BT8A 4DGAA 3ODLA 1BCKA 1O27A 1O29A 3T1UA 1OCAA 3FOFA 4YUJA 1O26A 3GTKA 3LAPA 1O2AA 4E1QA 2NVYA 4C3HC 3R57A 1XO7A 3QYUA 1F9NA 3K0RA 3V4GA 2MVZA 2XCQA 2IGWA 1XXCA 4HY7A 2Y3PA 3G4AA 1KQ4A 3CYSA 4P5AA 5CBTA 4N1OA 3RCIX 1I50A 1ZKCA 1WQHA 4KDDA 1WIHA 1X7FA 2ESLA 3L4JA 2P0OA 2CPLA 1DYWA 1XQ7A 2WLWA 3R59A 4YUIA 1R9TA 3GTJA 2POEA 1VDNA 2X2DB 1AB4A 4N1PA 4KASA 3ICHA 4YUKA 2N0TA 3PMPA 2B63A 2XGYB 5CCNA 4XNCA 4R3EA 3ODIA 4JCPA 5KV3A 4S1JA 1BGWA 4KB4A 1FGLA 2CFAB 1ISTA 3RDDA 1CLHA 1AK4A 5IOTA 4DGDA 2HE9A 3K0OA 4GTBA 5A0EA 1E3BA 2HQ6A 1V9TA 3MMLA 5EGEA 4KB2A 1I3QA 3GTLA 1J2AA 3AQPA 1ISEA 2NVXA 4YUPA 1W8VA 3BUEA 4KATA 2QERA 5CBUA 2RMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BO7 A;  1LOP A;  5F66 A;  1WQF A;  2BIU X;  4J5E X;  4J5C X;  3UCH A;  2A2N A;  3BT8 A;  1CWK A;  4DGA A;  3ODL A;  5CYH A;  5KUN A;  1VAI A;  2X7K A;  4JJM A;  1BCK A;  4O8I A;  4YUM A;  2WFI A;  3T1U A;  1AWR A;  4J58 A;  1OCA A;  3FOF A;  4YUJ A;  1W8M A;  4J5B A;  3OEP A;  4YUO A;  5CCQ A;  3K0M A;  2RMC A;  3RCF A;  3LAP A;  4E1Q A;  3QX3 A;  2B71 A;  2NUL A;  4G0V A;  1CWO A;  1IIP A;  1IHG A;  1W8L A;  4N1S A;  3R57 A;  3ERE D;  1XO7 A;  1E8K A;  3QYU A;  1F9N A;  4DDQ A;  3K0R A;  3K2C A;  2MVZ A;  2CK1 A;  2WFJ A;  1MIK A;  3V4G A;  5KV5 A;  2C3B A;  4DGB A;  2XCQ A;  3K0Q A;  2IGW A;  1XYH A;  4N1N A;  1XXC A;  4HY7 A;  2IGV A;  1QNG A;  5KUU A;  2Z6W A;  2Y3P A;  1M9X A;  1VBS A;  3CYS A;  3RCG A;  4FM9 A;  3K0P A;  5CBT A;  4N1O A;  5KV2 A;  3RCI X;  2KWA A;  1AWT A;  1ZKC A;  3K0N A;  3RDC A;  1WQH A;  1CWB A;  3R56 A;  4R3F A;  1EH1 A;  1WIH A;  4KDD A;  4J5D X;  1X7F A;  2ESL A;  2X2C K;  4YUL A;  1WQG A;  1M9E A;  4J3N A;  5JVO A;  3FHZ A;  3L4J A;  5KV4 A;  4N1M A;  1CWF A;  2P0O A;  2ALF A;  2HAQ A;  5CBW A;  2X25 B;  5CBV A;  1IS1 A;  2CPL A;  5KUL A;  2GW2 A;  2RS4 A;  1DYW A;  3R54 A;  4LQW A;  3EOV A;  2MC9 A;  3RCL A;  4KC6 A;  1XQ7 A;  5KV6 A;  4EYV A;  5LUD A;  1CWM A;  2WLW A;  3R59 A;  1ZMF A;  4YUI A;  3O7T A;  1M9C A;  4IPZ A;  2FU0 A;  3ORE A;  2POE A;  5CCS X;  1XXA A;  1A33 A;  1VDN A;  1EK8 A;  2X2D B;  1AB4 A;  1YND A;  4N1P A;  5KUS A;  2X2A A;  3ICH A;  1M9F A;  3R49 A;  1VBT A;  3RDB A;  5KUV A;  3FOE A;  2CFE A;  1AWS A;  2N0T A;  4ZSD A;  1M63 C;  4YUK A;  1CWC A;  1CWI A;  3OPF A;  2PLU A;  3RDA X;  1XXB A;  1ZVU A;  2P5M A;  1A58 A;  1CWJ A;  1QOI A;  2MS4 A;  2RMB A;  3VA7 A;  3PMP A;  1DD5 A;  1CYN A;  1ZKF A;  2XGY B;  3LPX A;  4KAW X;  3JB9 d;  4YUN A;  5CCN A;  4J59 A;  4XNC A;  3L4K A;  1QNH A;  3MML B;  4R3E A;  3CYH A;  3ODI A;  1C5F A;  1NMK A;  1AWV A;  4FRV A;  4I9Y A;  4JCP A;  2R99 A;  2XCR B;  2K7N A;  2BIT X;  1CWH A;  3BKP A;  5KV3 A;  2ZFZ A;  4G0U A;  5KV0 A;  4S1J A;  5CCR A;  1RMH A;  1BGW A;  3ICI A;  3NUH A;  1AWU A;  1W74 A;  4KB4 A;  1FGL A;  5JHE A;  1IST A;  5KUZ A;  3RDD A;  4TOT A;  3RFY A;  1CLH A;  1AK4 A;  5CJ9 A;  1MZW A;  1Z81 A;  4DGD A;  2OJU A;  4YUH A;  2HE9 A;  4G0W A;  3K0O A;  3R4G A;  4J5A X;  4ZSC A;  5KUQ A;  5KV7 A;  4N1R A;  4CYH A;  5A0E A;  1XWN A;  5KUR A;  5DUD A;  1E3B A;  3CAG A;  2HQ6 A;  4N1Q A;  1V9T A;  1M9D A;  2OSE A;  3RD9 X;  2POY A;  2CMT A;  2CYH A;  3MML A;  4DGC A;  1MF8 C;  2ZP2 A;  1M9Y A;  5KUW A;  4FRU A;  1CWA A;  4KB2 A;  3LAJ A;  5KUO A;  2OK3 A;  1H0P A;  1CWL A;  5KV1 A;  1GE9 A;  1J2A A;  2X83 B;  1ISE A;  2MZU A;  1B4A A;  2HQJ A;  1B4B A;  2XCO A;  3RCK X;  4O8H A;  2PHC B;  4YUP A;  1W8V A;  4S1E A;  4YUG A;  1BJT A;  4DGE A;  1AWQ A;  3BUE A;  2QER A;  5CBU A;  2RMA A;  3S6M A;  2RGR A;  4GFQ A; 
#chains in the Genus database with same CATH topology
 2BIU X;  4J5C X;  4A3D C;  5M5W K;  3HOX C;  1I3Q K;  1JQW A;  1WOO A;  4A3G K;  4A3B C;  4Y7N K;  4OIN A;  1F7U A;  4J58 A;  1W8M A;  4J5B A;  4Q5S A;  3OEP A;  1IQ0 A;  4LR2 A;  2RMC A;  3RCF A;  3T00 A;  2R92 C;  4QIW L;  4C2M C;  2YU9 A;  2PMZ D;  4A3C C;  1TWG A;  1I6V A;  4DDQ A;  1WSV A;  1XPP A;  2CK1 A;  2WFJ A;  1TWH A;  5KV5 A;  2VUM K;  3AD9 C;  2R7Z C;  3S2D C;  2JH3 A;  3AD8 C;  1QNG A;  5FLM C;  1USO A;  1M9X A;  4FM9 A;  1PJ7 A;  4GTL A;  4AYB L;  5KV2 A;  3AD7 C;  4BY7 C;  5IOS A;  1ZQ1 C;  3R56 A;  4R3F A;  1VJE A;  2X2C K;  3GTP A;  4YUL A;  2A68 A;  3FHZ A;  1K83 C;  5KV4 A;  2R7Z A;  1CWF A;  2ALF A;  2HAQ A;  5CBV A;  3S2H C;  3I4M C;  5KUL A;  3HOW C;  3EQL A;  2GW2 A;  4LQW A;  2E2H C;  4A3C K;  3RCL A;  3S1N K;  4EYV A;  5KV6 A;  5LUD A;  2GSO A;  4YFK A;  3GTO A;  3K7A K;  2JA7 C;  3RZD C;  1ZMF A;  4IPZ A;  2R93 K;  1TWG K;  4XLN A;  1XXA A;  2NVQ C;  1EK8 A;  1UV7 A;  3TFH A;  1M9F A;  3BP3 A;  1VBT A;  3RDB A;  3H3V L;  5FLM K;  2CFE A;  4ZSD A;  3Q3Q A;  2O5I A;  1CWI A;  3OPF A;  2P5M A;  4M1X A;  5C4J K;  1J98 A;  1A58 A;  2MS4 A;  2JA5 A;  4YUN A;  4J59 A;  2BE5 A;  1QNH A;  3MML B;  4WJ3 M;  2R99 A;  2K7N A;  2BIT X;  1SMY A;  5KV0 A;  5IYC C;  1TWH K;  1USM A;  5EGH A;  4LQY A;  2D6F C;  3ICI A;  2JA6 A;  1JOE A;  1WCM A;  3NUH A;  4BBS C;  1TWC K;  4TOT A;  4MQ9 A;  3RFY A;  5IP7 K;  3S1Q K;  4A3I K;  2PMZ L;  4LLG A;  4BBR C;  2OJU A;  1I6H K;  5IP9 K;  5M3F K;  1Y1W A;  4J5A X;  4ZSC A;  1J6W A;  1HQM A;  1X31 C;  4CYH A;  4GTF A;  3S1R K;  1XWN A;  5KUR A;  5DUD A;  1F7V A;  2V6T A;  3CAG A;  1TWA A;  3GTK K;  4C3J C;  2VUM C;  3GTJ C;  2V6U A;  4Y52 C;  1MF8 C;  2ZP2 A;  2JA8 K;  3LAJ A;  4FRU A;  1CWA A;  1H0P A;  4C3I C;  5KV1 A;  4AYB D;  2MZU A;  2CFA A;  2XCO A;  2Y0S D;  3RCK X;  2VUM A;  4DGE A;  1AWQ A;  2WAQ D;  3G4C A;  5IYC K;  3GSI A;  4LOW A;  5CJ9 A;  3S6M A;  2RGR A;  2E2H K;  1LOP A;  1XZP B;  1JVI A;  4GTC A;  4J5E X;  1L0W A;  3DXJ A;  2A2N A;  3GTO K;  3S2H K;  1CWK A;  5KUN A;  5CYH A;  4BBR K;  2X7K A;  1WCM C;  3H3V D;  4O8I A;  4GZY A;  1R9T C;  1AWR A;  5C4X C;  4YUO A;  5CCQ A;  3T02 A;  1F93 A;  2A69 A;  3AH5 A;  2Y0S L;  1TWC A;  1IIP A;  1IHG A;  1W8L A;  4N1S A;  2A6E A;  3JST A;  4KMU A;  5TJ3 A;  3GTJ K;  2ZUF A;  3S15 K;  2WB1 L;  1E8K A;  4OIO A;  2GAG C;  4A3E C;  1MIK A;  3FKI C;  2C3B A;  2NVX K;  3PO2 C;  3K0Q A;  1XYH A;  4N1N A;  3GTM C;  2IGV A;  3N3Y A;  2Z6W A;  4YFN A;  4LK1 A;  3I4M K;  3RCG A;  3K0P A;  3HOZ C;  1DCH A;  5C3E C;  3M4O K;  1TWH C;  1WQG A;  2R93 C;  3CQZ C;  2NVQ K;  2X25 B;  1IS1 A;  4PAB A;  2KA0 A;  2RS4 A;  3R54 A;  4KC6 A;  1CWM A;  4XLP A;  1YNJ A;  1M9C A;  2FU0 A;  3ORE A;  5CCS X;  1A33 A;  1YND A;  5KUS A;  2X2A A;  2E2I K;  3RZO K;  3FOE A;  3S1M C;  1Y1V A;  4GT9 A;  1ZX8 A;  1M63 C;  1TWF C;  3PO2 K;  2PLU A;  1BDF A;  1ZVU A;  5C3E K;  2RMB A;  3VA7 A;  4KN7 A;  1DD5 A;  1CYN A;  1ZKF A;  3S0X A;  1O2B A;  3HOW K;  3L4K A;  3PO3 K;  1SFO K;  4I9Y A;  1AWV A;  2XCR B;  4QJV B;  1INN A;  1CWH A;  3BKP A;  1J6V A;  4G0U A;  1ZBS A;  5CCR A;  3HOV K;  2NVT C;  3GTQ C;  1AWU A;  1W74 A;  1J6X A;  3GTP C;  5KUZ A;  2R93 A;  4P5B A;  1WOS A;  1Z81 A;  1O28 A;  4XSZ A;  1O25 A;  2E2I C;  3RZO C;  3S1M K;  4X6A C;  3GTG A;  3X27 A;  3R4G A;  3A8J A;  4PAA A;  3M3Y C;  3KOP A;  5KUQ A;  4XCH A;  5KV7 A;  2NVY K;  4N1R A;  5C44 K;  5TMC A;  4A93 C;  4OIQ A;  5M5Y K;  4G7O A;  2NVX C;  5D4D A;  3PO3 C;  4OIP A;  4LK0 A;  3GTM A;  2CW0 A;  4GTE A;  2OSE A;  4BBS K;  2CMT A;  4O2D A;  4DGC A;  5JFE A;  3GTG C;  5M5X K;  5KUO A;  3T01 A;  2OK3 A;  3GDZ A;  1TWF K;  4KMH A;  2NVT K;  3GTQ K;  2X83 B;  3S1Q C;  1B4A A;  2WAQ L;  4BY1 K;  4YUG A;  4O8H A;  2PHC B;  3HKZ D;  1XZQ B;  3QX3 A;  1HI9 A;  1BJT A;  3CQZ A;  1ZXO A;  4GFQ A;  5IP9 C;  2GSU A;  3BO7 A;  2W7V A;  3N0B A;  5F66 A;  2NVY C;  5C44 C;  4YFX A;  4A3F C;  3M3Y K;  1O24 A;  4FZB A;  3UCH A;  1SFO A;  2JA6 C;  1VAI A;  4JJM A;  4YUM A;  3FKI A;  2WFI A;  3GEI A;  4A3M K;  4BY7 K;  4MEX A;  4QJV A;  3K0M A;  1ZYR A;  2B71 A;  2NUL A;  1CWO A;  5IOQ A;  2E2J C;  3ERE D;  5IOR A;  4G0V A;  2B63 K;  3K2C A;  1TWA C;  3GIR A;  1IL2 A;  3H0G A;  1C0A A;  5KUU A;  1VBS A;  2R92 A;  3S16 K;  2V6S A;  2E2H A;  2YU9 C;  5E68 A;  2KWA A;  1TWG C;  1YX2 A;  1AWT A;  3K0N A;  3RDC A;  3HOV C;  1CWB A;  4C45 A;  2JA7 A;  3K7A C;  1EH1 A;  5C4X K;  2JA7 K;  4J5D X;  5JVO A;  4AH6 A;  4WJ4 A;  1M9E A;  4J3N A;  4N1M A;  3SZY A;  5CBW A;  4KMD A;  1PJ5 A;  3S14 C;  1Y1V C;  3EOV A;  2MC9 A;  4A3L C;  4KM8 A;  4A3E K;  3GEE A;  3S15 C;  1XZQ A;  3O7T A;  2GSN A;  3M4O C;  2FQT A;  3R49 A;  3GTG K;  5KUV A;  4GTA A;  3HOZ K;  1K83 K;  1AWS A;  5FJ8 K;  2A6H A;  1TWC C;  1CWC A;  3RDA X;  1XXB A;  4G7H A;  1CWJ A;  1QOI A;  3GTQ A;  3LPX A;  3H0G C;  3JB9 d;  4KAW X;  5IYD K;  1VH2 A;  2WB1 D;  2PA8 L;  2P8T A;  3CYH A;  4FRV A;  1C5F A;  1NMK A;  4C3J K;  4BLB A;  4BY1 C;  2FQO A;  4A3L K;  2ZFZ A;  4KM9 A;  4A3F K;  1TWF A;  4A3K K;  4RMF A;  3S17 C;  1RMH A;  3AQO A;  3HOY C;  5JHE A;  5CHP A;  4BXX C;  5M3M K;  1MZW A;  4YUH A;  4Y52 K;  4G0W A;  4BKW A;  4G7Z A;  1RU0 A;  4MEY A;  5IYB C;  4A3B K;  5TMF A;  4GTD A;  2ZUE A;  2PA8 D;  3HOX K;  4KMA A;  4C3H K;  4N1Q A;  4ILD A;  3H0G K;  4BLA A;  5IYD C;  2E2I A;  1M9D A;  4DGB A;  3RD9 X;  2POY A;  2CYH A;  5KUW A;  1Y1W C;  1G51 A;  1M9Y A;  4P9S A;  3N0C A;  5IP7 C;  4C2M K;  4A3I C;  1CWL A;  3HOU K;  1GE9 A;  3HOY K;  4YG2 A;  1WOP A;  3HKZ L;  4WIL A;  4ZH4 A;  2HQJ A;  1B4B A;  2PPB A;  3S17 K;  4S1E A;  3GTP K;  3TTG A;  1K83 A;  5L46 A;  4OIR A;  1V5V A;  3FKI K;  4A3J K;  3GTK C;  1I50 K;  2RH6 A;  1EQR A;  4X6A K;  1XZP A;  3S1R C;  1DCO A;  1WQF A;  1EI6 A;  4KAR A;  3BT8 A;  4DGA A;  1Y1V K;  3ODL A;  3TFI A;  4A93 K;  1BCK A;  1O27 A;  1O29 A;  3T1U A;  4BXX K;  1OCA A;  4LJZ A;  3FOF A;  4YUJ A;  1O26 A;  2JA8 C;  3GTK A;  3LAP A;  2EBB A;  1O2A A;  3ADA C;  4E1Q A;  3S16 C;  2NVY A;  4C3H C;  3RZD K;  3R57 A;  1VRQ C;  1WOR A;  3A8I A;  3A8K A;  1XO7 A;  3TFJ A;  3QYU A;  1F9N A;  3K0R A;  3V4G A;  2MVZ A;  3WOD A;  2XCQ A;  2IGW A;  2NNZ A;  1XXC A;  1IBA A;  4HY7 A;  2O5J A;  1YCL A;  2Y3P A;  3G4A A;  1KQ4 A;  3CYS A;  4P5A A;  5CBT A;  5C4J C;  4N1O A;  4JK1 A;  3HOU C;  1WSR A;  3RCI X;  1I50 A;  1ZKC A;  1R9T K;  1WQH A;  4KDD A;  1WIH A;  1X7F A;  2ESL A;  4A3M C;  3L4J A;  4A3K C;  5HL8 A;  2P0O A;  1BS2 A;  2CPL A;  1PJ6 A;  4A3D K;  1DYW A;  3BP8 C;  5IYB K;  1XQ7 A;  2WLW A;  3R59 A;  1TWA K;  1SFO C;  2E2J K;  1DCP A;  2B63 C;  4YUI A;  3GTL K;  4NOI A;  3IPJ A;  4Q4Z A;  1R9T A;  3GTJ A;  1I6H C;  2POE A;  1VDN A;  2X2D B;  1AB4 A;  4N1P A;  4KAS A;  3ICH A;  1Y1W K;  2R92 K;  3CQZ K;  2YU9 K;  4YUK A;  2N0T A;  1VGX A;  3PMP A;  1VLO A;  2GAH C;  2B63 A;  2XGY B;  3I4N K;  5CCN A;  4KN4 A;  2R7Z K;  3S14 K;  4XNC A;  3S2D K;  4R3E A;  3ODI A;  4JCP A;  5KV3 A;  1O2F B;  4S1J A;  4C3I K;  1I50 C;  2JA5 K;  1BGW A;  4KB4 A;  1FGL A;  2CFA B;  1IST A;  3RDD A;  1CLH A;  1AK4 A;  5IOT A;  4DGD A;  4A3G C;  2HE9 A;  4Y7N C;  1YNN A;  3K0O A;  1I3Q C;  4GTB A;  3GTL C;  1IW7 A;  1WCM K;  3SZZ A;  3S1N C;  5A0E A;  1E3B A;  3GTO C;  2HQ6 A;  3I4N C;  1V9T A;  4A3J C;  3MML A;  5EGE A;  4KB2 A;  1I3Q A;  3GTL A;  1EFW A;  1J2A A;  3HXA A;  3AQP A;  4QIW D;  2JA6 K;  1ISE A;  1IE0 A;  2JA5 C;  2NVX A;  4YUP A;  1W8V A;  3GEH A;  3BUE A;  4XSX A;  4KAT A;  2QER A;  5CBU A;  2RMA A;  3GTM K; 
#chains in the Genus database with same CATH homology
 2BIU X;  4J5C X;  4J58 A;  1W8M A;  4J5B A;  3OEP A;  4LR2 A;  2RMC A;  3RCF A;  4C2M C;  2YU9 A;  1TWG A;  4DDQ A;  2CK1 A;  2WFJ A;  1TWH A;  5KV5 A;  2JH3 A;  1QNG A;  1M9X A;  4FM9 A;  4GTL A;  5KV2 A;  5IOS A;  3R56 A;  4R3F A;  2X2C K;  3GTP A;  4YUL A;  3FHZ A;  5KV4 A;  2R7Z A;  1CWF A;  2ALF A;  2HAQ A;  5CBV A;  5KUL A;  2GW2 A;  4LQW A;  3RCL A;  4EYV A;  5KV6 A;  5LUD A;  2GSO A;  3GTO A;  1ZMF A;  4IPZ A;  1XXA A;  1EK8 A;  1M9F A;  1VBT A;  3RDB A;  2CFE A;  4ZSD A;  3Q3Q A;  1CWI A;  3OPF A;  2P5M A;  4M1X A;  1A58 A;  2MS4 A;  2JA5 A;  4YUN A;  4J59 A;  1QNH A;  3MML B;  2R99 A;  2K7N A;  2BIT X;  5KV0 A;  5EGH A;  4LQY A;  3ICI A;  2JA6 A;  1WCM A;  3NUH A;  4TOT A;  3RFY A;  2OJU A;  1Y1W A;  4J5A X;  4ZSC A;  4CYH A;  4GTF A;  1XWN A;  5KUR A;  5DUD A;  3CAG A;  1TWA A;  4C3J C;  1MF8 C;  2ZP2 A;  3LAJ A;  4FRU A;  1CWA A;  1H0P A;  4C3I C;  5KV1 A;  2MZU A;  2CFA A;  2XCO A;  3RCK X;  2VUM A;  4DGE A;  1AWQ A;  3G4C A;  5CJ9 A;  3S6M A;  2RGR A;  1LOP A;  4GTC A;  4J5E X;  2A2N A;  1CWK A;  5KUN A;  5CYH A;  2X7K A;  4O8I A;  1AWR A;  4YUO A;  5CCQ A;  3AH5 A;  1TWC A;  1IIP A;  1IHG A;  1W8L A;  4N1S A;  5TJ3 A;  1E8K A;  1MIK A;  2C3B A;  3K0Q A;  1XYH A;  4N1N A;  2IGV A;  3N3Y A;  2Z6W A;  3RCG A;  3K0P A;  1WQG A;  2X25 B;  1IS1 A;  2RS4 A;  3R54 A;  4KC6 A;  1CWM A;  1M9C A;  2FU0 A;  3ORE A;  5CCS X;  1A33 A;  1YND A;  5KUS A;  2X2A A;  3FOE A;  1Y1V A;  4GT9 A;  1M63 C;  2PLU A;  1ZVU A;  2RMB A;  3VA7 A;  1DD5 A;  1CYN A;  1ZKF A;  3S0X A;  1O2B A;  3L4K A;  4I9Y A;  1AWV A;  2XCR B;  1CWH A;  3BKP A;  4G0U A;  1ZBS A;  5CCR A;  1AWU A;  1W74 A;  5KUZ A;  2R93 A;  4P5B A;  1Z81 A;  1O28 A;  1O25 A;  3GTG A;  3R4G A;  5KUQ A;  5KV7 A;  4N1R A;  3GTM A;  4GTE A;  2OSE A;  2CMT A;  4DGC A;  5JFE A;  5KUO A;  2OK3 A;  4KMH A;  2X83 B;  1B4A A;  4YUG A;  4O8H A;  2PHC B;  3QX3 A;  1BJT A;  3CQZ A;  1ZXO A;  4GFQ A;  2GSU A;  3BO7 A;  3N0B A;  5F66 A;  1O24 A;  4FZB A;  3UCH A;  1SFO A;  1VAI A;  4JJM A;  4YUM A;  3FKI A;  2WFI A;  3K0M A;  2B71 A;  2NUL A;  1CWO A;  5IOQ A;  3ERE D;  5IOR A;  4G0V A;  3K2C A;  3H0G A;  5KUU A;  1VBS A;  2R92 A;  2E2H A;  2KWA A;  1AWT A;  3K0N A;  3RDC A;  1CWB A;  2JA7 A;  1EH1 A;  4J5D X;  5JVO A;  1M9E A;  4J3N A;  4N1M A;  5CBW A;  4KMD A;  3EOV A;  2MC9 A;  4KM8 A;  3O7T A;  2GSN A;  3R49 A;  5KUV A;  4GTA A;  1AWS A;  1CWC A;  3RDA X;  1XXB A;  1CWJ A;  1QOI A;  3GTQ A;  3LPX A;  4KAW X;  3JB9 d;  4BLB A;  3CYH A;  4FRV A;  1C5F A;  1NMK A;  2ZFZ A;  4KM9 A;  1TWF A;  1RMH A;  3AQO A;  5JHE A;  5CHP A;  1MZW A;  4YUH A;  4G0W A;  4BKW A;  4GTD A;  4KMA A;  4N1Q A;  4ILD A;  4BLA A;  2E2I A;  1M9D A;  4DGB A;  3RD9 X;  2POY A;  2CYH A;  5KUW A;  1M9Y A;  3N0C A;  1CWL A;  1GE9 A;  2HQJ A;  1B4B A;  4S1E A;  1K83 A;  2RH6 A;  1WQF A;  4KAR A;  3BT8 A;  4DGA A;  3ODL A;  1BCK A;  1O27 A;  1O29 A;  3T1U A;  1OCA A;  3FOF A;  4YUJ A;  1O26 A;  3GTK A;  3LAP A;  1O2A A;  4E1Q A;  2NVY A;  4C3H C;  3R57 A;  1XO7 A;  3QYU A;  1F9N A;  3K0R A;  3V4G A;  2MVZ A;  2XCQ A;  2IGW A;  1XXC A;  4HY7 A;  2Y3P A;  3G4A A;  1KQ4 A;  3CYS A;  4P5A A;  5CBT A;  4N1O A;  3RCI X;  1I50 A;  1ZKC A;  1WQH A;  4KDD A;  1WIH A;  1X7F A;  2ESL A;  3L4J A;  2P0O A;  2CPL A;  1DYW A;  1XQ7 A;  2WLW A;  3R59 A;  4YUI A;  1R9T A;  3GTJ A;  2POE A;  1VDN A;  2X2D B;  1AB4 A;  4N1P A;  4KAS A;  3ICH A;  4YUK A;  2N0T A;  3PMP A;  2B63 A;  2XGY B;  5CCN A;  4XNC A;  4R3E A;  3ODI A;  4JCP A;  5KV3 A;  4S1J A;  1BGW A;  4KB4 A;  1FGL A;  2CFA B;  1IST A;  3RDD A;  1CLH A;  1AK4 A;  5IOT A;  4DGD A;  2HE9 A;  3K0O A;  4GTB A;  5A0E A;  1E3B A;  2HQ6 A;  1V9T A;  3MML A;  5EGE A;  4KB2 A;  1I3Q A;  3GTL A;  1J2A A;  3AQP A;  1ISE A;  2NVX A;  4YUP A;  1W8V A;  3BUE A;  4KAT A;  2QER A;  5CBU A;  2RMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...