3OPFA

Crystal structure of ttha0988 in space group p212121
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
493
structure length
490
Chain Sequence
MVRGFYLRFGEGVSEEANRRALALAEALLRAPPPGLLDAVPAYGVLYLEYDPRRLSRGRLLRLLKGLPQERARVVEIPVRYDGEDLPEVASRLGLSLEAVKALHQKPLYRVYALGFTPGFPFLAEVEPALRLPRKPHPRPRVPAHAVAVAGVQTGIYPLPSPGGWNLLGTSLVAVYDPHRETPFLLRPGDRVRFLEAEGPTPPEPRPLELLPEEPRLPALLVEEPGLMDLVVDGGRFLGGHLGLARSGPLDAPSARLANRLVGNGAGAPLLEFAYKGPVLTALRDLVAAFAGYGFVALLEGEEIPPGQSFLWPRGKTLRFRPRGPGVRGYLAVAGGLEVRPFLGSASPDLRGRIGRPLWAGDVLGLEALRPVRPGRAFPQRPLPEAFRLRLLPGPQFAGEAFRALCSGPFRVARADRVGVELLGPEVPGGEGLSEPTPLGGVQVPPSGRPLVLLADKGSLGGYAKPALVDPRDLWLLGQARPGVEIHFTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of TTHA0988 from Thermus thermophilus, a KipI-KipA homologue incorrectly annotated as an allophanate hydrolase
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords Putative uncharacterized protein TTHA0988
total genus 126
structure length 490
sequence length 493
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02626 CT_A_B Carboxyltransferase domain, subdomain A and B
A PF02682 CT_C_D Carboxyltransferase domain, subdomain C and D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3opfA02
2.40.100.10 Mainly Beta Beta Barrel Cyclophilin Cyclophilin-like 3opfA04
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3opfA01
2Z6WA 2PHCB 3FOFA 4FRUA 5F66A 4CYHA 3CYHA 4G0WA 4KAWX 5KV2A 4J5AX 1MF8C 5KV0A 1H0PA 5CCRA 1CWKA 1VBTA 4J5CX 3RDCA 4DGAA 1QOIA 2HE9A 3RCLA 1NMKA 1GE9A 2P0OA 1CWLA 3K0OA 4I9YA 5KV4A 5KV1A 3NUHA 5JVOA 1M9XA 5CCNA 1RMHA 1EK8A 2MZUA 3R59A 3OEPA 1B4AA 3MMLB 3BUEA 3FHZA 4JCPA 4TOTA 2BITX 1VAIA 2HQ6A 5KUOA 4XNCA 4YUNA 1W74A 3RD9X 1WIHA 2C3BA 3RCKX 3LAJA 3L4KA 1WQHA 2RS4A 2HAQA 1CWFA 2X25B 4J59A 3ICHA 4G0VA 2IGWA 4G0UA 1XXCA 2ZP2A 1AWTA 1AWVA 1DD5A 2CPLA 2IGVA 3K0QA 1CWHA 3R54A 4YUHA 1F9NA 3ODLA 4N1PA 4YUGA 5CYHA 4YUIA 2OJUA 3RCGA 1VDNA 1BJTA 1J2AA 1CWOA 3QYUA 1AWQA 3FOEA 1A33A 2Y3PA 3RCFA 5KUSA 1AB4A 1CWIA 1X7FA 4YUPA 5KV3A 3RFYA 4DGDA 3O7TA 1YNDA 3R56A 4DDQA 4N1RA 5DUDA 1E8KA 3UCHA 1M9EA 1XWNA 2CK1A 2XGYB 5CCSX 5KULA 5LUDA 3QX3A 2CYHA 2FU0A 2OK3A 1W8VA 2RMAA 5A0EA 1ZKFA 2WFJA 3K0MA 3RCIX 1M63C 4DGBA 1QNGA 4E1QA 2R99A 3VA7A 4KB2A 3R49A 5KURA 3EOVA 3RDBA 1ISEA 1CWJA 1IIPA 2WFIA 1XQ7A 4YUJA 5KV6A 4R3FA 2POYA 5KV5A 4KB4A 3RDAX 3RDDA 4IPZA 5KUWA 4GFQA 1MZWA 1CYNA 2QERA 5KV7A 1CLHA 4LQWA 2PLUA 4KDDA 2BIUX 3K2CA 1CWBA 1CWMA 2ZFZA 1AWSA 3JB9d 4HY7A 1B4BA 2XCQA 4N1QA 5CBTA 1FGLA 2K7NA 4N1OA 5KUZA 3T1UA 2HQJA 4FM9A 5KUNA 4J5BA 3V4GA 1VBSA 5CCQA 1CWAA 1Z81A 1AWUA 4O8IA 2N0TA 1QNHA 3BO7A 5CJ9A 2CMTA 3S6MA 4YULA 2GW2A 5CBWA 1XXAA 1M9DA 3BT8A 4EYVA 1A58A 2MVZA 1W8MA 1E3BA 3MMLA 2MC9A 1ZKCA 1BGWA 3LAPA 1ZMFA 1XXBA 1IS1A 2ESLA 1BCKA 2B71A 2X2DB 1EH1A 2A2NA 1W8LA 2X2AA 4O8HA 2KWAA 2P5MA 4S1JA 3LPXA 1OCAA 1LOPA 2X83B 1AK4A 2X2CK 4J5DX 5CBUA 4J5EX 1CWCA 3BKPA 4ZSDA 4KC6A 2RMBA 4YUOA 1MIKA 3R4GA 3R57A 1M9YA 4N1SA 3ICIA 4JJMA 3K0NA 1V9TA 3OREA 3ODIA 5CBVA 1M9CA 2POEA 4DGCA 3L4JA 3CYSA 4J3NA 5KUUA 4ZSCA 4YUKA 2XCRB 1DYWA 2OSEA 4DGEA 2CFEA 5JHEA 1ZVUA 3CAGA 2ALFA 2RGRA 2X7KA 4S1EA 3PMPA 4FRVA 4N1NA 1M9FA 3OPFA 4N1MA 4R3EA 2XCOA 1XO7A 3ERED 1WQGA 1AWRA 3K0RA 3K0PA 2MS4A 1XYHA 5KUQA 4YUMA 1IHGA 1WQFA 2NULA 4J58A 1C5FA 2WLWA 2RMCA 1ISTA 5KUVA
chains in the Genus database with same CATH superfamily
2PHCB 4Y7NK 2R92C 3CYHA 3M4OC 1MF8C 1VBTA 4O2DA 1QOIA 3RCLA 1NMKA 1GE9A 5JVOA 3H3VL 1M9XA 3H0GK 5CCNA 1RMHA 1WOSA 1EK8A 3OEPA 4BKWA 4JCPA 1V5VA 5KUOA 2Y0SD 4LOWA 4YUNA 3RD9X 3PO2C 2C3BA 3LAJA 1Y1WC 2RS4A 1CWFA 2IGWA 3AQPA 1TWFK 2R92A 2CPLA 3GTMC 3TFJA 3K0QA 2P8TA 4N1PA 1INNA 3H0GC 1R9TC 1BDFA 1AWQA 1ZYRA 4QJVB 4WILA 1F93A 1AB4A 4XLPA 1CWIA 1X7FA 4YUPA 4C45A 4A3MC 4DGDA 1YNDA 5M5WK 2YU9C 5M5XK 2VUMK 1M9EA 2JH3A 2CK1A 5LUDA 1Y1VC 3AH5A 5M3MK 1TWFC 4LK1A 1X31C 1ISEA 1K83A 3K0MA 1O26A 4BBSK 2R99A 4KB2A 4A3IK 3R49A 1R9TK 1CWJA 4YUJA 3RZDC 3FKIK 1I6VA 5KUWA 4KMDA 4BXXK 4A3FC 4A3EK 3GTKK 4OIQA 2PLUA 5C3EK 3K2CA 1CWMA 1PJ5A 3I4MC 3S2DK 2R93K 1FGLA 5KUZA 2Y0SL 3N0CA 2HQJA 1Y1WA 3V4GA 2NVXA 5CCQA 1CWAA 1Z81A 3DXJA 4P5BA 3M4OK 4YULA 5IYCK 2NVYK 1WSRA 5C3EC 4EYVA 2JA7A 1TWGA 1DCPA 3LAPA 1ZMFA 1XXBA 2B63K 2RH6A 3A8IA 2NNZA 2O5JA 1OCAA 1XPPA 1AK4A 5IYBC 4P9SA 5CBUA 1O2BA 4C3JK 1WCMA 1CWCA 3PO2K 2V6UA 1MIKA 4LR2A 3PO3C 2CFAA 1M9CA 3TFHA 3GTMK 4A3LK 2E2IA 4GT9A 3EQLA 2E2IK 4ZSCA 4YUKA 2OSEA 1PJ6A 4S1EA 5IYBK 5IP9C 2A68A 5L46A 1WCMK 1I6HK 2VUMC 3K0PA 2MS4A 1TWHK 4LLGA 2NULA 4YFKA 3HOUC 1C5FA 3R56A 3S0XA 2O5IA 3GTPC 1O24A 1VLOA 5HL8A 5F66A 2V6SA 3S1NK 2WAQL 4G0WA 4J5AX 5KV0A 1H0PA 4MQ9A 5D4DA 3RDCA 3JSTA 3K0OA 5KV1A 4X6AK 5KV4A 2GSOA 2GAGC 1Y1VA 4P5AA 3MMLB 2WAQD 2NVTC 2HQ6A 3GTQK 4AH6A 3S15C 1PJ7A 5IOQA 3SZYA 1W74A 1WIHA 3RCKX 3L4KA 1WQHA 2HAQA 3ICHA 4G0UA 1DD5A 1RU0A 3HKZL 1CWHA 3ODLA 5IYCC 4YUGA 4YUIA 1I50C 1BJTA 5FLMK 4MEXA 1CWOA 2NVQC 3QYUA 3GTLK 1XZPB 1A33A 3HOWK 4OINA 2PA8L 3RZOC 3RFYA 4DDQA 2WB1D 4A3BK 5FJ8K 3UCHA 3AD9C 1XWNA 2FU0A 1TWAA 4C2MC 2WFJA 4DGBA 4E1QA 1QNGA 3RDBA 4ILDA 4G7OA 1IIPA 3PO3K 1XQ7A 2POYA 3RDDA 4IPZA 3HOVK 2WB1L 4GFQA 3RZOK 1G51A 1SFOC 1DCHA 1CYNA 2QERA 4LQWA 4KDDA 4C2MK 1VRQC 2ZFZA 1ZBSA 3S1RC 3JB9d 1WCMC 4HY7A 1B4BA 4KM8A 1I6HC 3S1QC 2JA8K 3T1UA 4FM9A 3S14K 4O8IA 3HOVC 5CJ9A 1QNHA 1JOEA 3S6MA 4BBRK 2GW2A 1J6WA 4GTAA 2EBBA 4ZH4A 1O29A 1A58A 1W8MA 3GIRA 1O25A 4X6AC 3GEEA 4BLBA 1EH1A 2A2NA 1W8LA 4S1JA 4QIWD 1LOPA 2X83B 3CQZA 2NVTK 3GTQC 5IOTA 1TWHA 4J5DX 4KN4A 4KC6A 2RMBA 1TWGC 3R4GA 1UV7A 4XLNA 4WJ3M 2W7VA 3OREA 1L0WA 3T02A 3RZDK 2POEA 3HOYK 4DGCA 3T01A 3CYSA 3AD7C 4J3NA 1DYWA 2CFEA 3PMPA 4FRVA 1EFWA 4N1NA 4R3EA 2B63A 3GTOC 3ERED 1TWGK 4YG2A 1WQGA 5C4XK 3K0RA 2JA5A 1XYHA 2NVYA 2FQTA 1VJEA 1ISTA 2Z6WA 4MEYA 3FOFA 4CYHA 3TTGA 2R7ZK 3K7AK 4LQYA 5CCRA 2ZUFA 1Y1WK 2JA7K 5IYDK 2HE9A 2R93A 2B63C 2E2JK 1TWAC 4GTCA 2NVXK 3S16K 1XZQA 1B4AA 3GDZA 3BUEA 3FHZA 2BITX 1IQ0A 4PABA 4GTLA 3GTJK 3S14C 1ZQ1C 4G0VA 1XXCA 2ZP2A 2IGVA 1F9NA 1K83K 1YCLA 2E2JC 1VGXA 4KM9A 1TWAK 2OJUA 3RCGA 1VDNA 1J2AA 1I3QK 2E2IC 3FKIA 3FOEA 3RCFA 5KUSA 2CW0A 2ZUEA 4A3GK 4N1RA 4A3FK 3HOZK 2XGYB 5CCSX 3M3YK 4Y52K 3GSIA 2VUMA 2OK3A 1W8VA 5A0EA 3TFIA 4BY7C 1M63C 5EGEA 3VA7A 2A6EA 3N3YA 4KARA 1TWFA 3HOXC 5KURA 5IORA 3S1MC 1SMYA 1F7UA 5KV6A 4KB4A 5KV5A 3RDAX 1MZWA 3GTQA 1CLHA 5KV7A 1Y1VK 4Y52C 2BIUX 1CWBA 4AYBD 1AWSA 1WOOA 2XCQA 4XCHA 4N1QA 1J98A 4N1OA 2K7NA 3S1MK 5IP7C 1USOA 1HI9A 3CQZC 1AWUA 1I50A 1BS2A 2N0TA 3BO7A 3K7AC 4OIOA 5CBWA 1XXAA 2PMZL 3GTLA 5E68A 2MVZA 2MC9A 1ZKCA 1IS1A 2ESLA 2X2DB 5IP7K 4A3JC 4O8HA 4A3DK 4A93C 4GTEA 3GTGK 1YNNA 2X2CK 5IP9K 4J5EX 3GTJC 3BKPA 1YNJA 4ZSDA 4G7ZA 3GTMA 5JFEA 4N1SA 1M9YA 2NVYC 3ICIA 1TWHC 4JJMA 3K0NA 2E2HC 2V6TA 5CBVA 2JA6A 1WOPA 1YX2A 3L4JA 5M3FK 4A3JK 4A3DC 5KUUA 1SFOK 4GZYA 2XCRB 4A93K 2GSUA 3GEHA 3AQOA 5JHEA 3BP8C 2YU9A 3CAGA 2ALFA 1O2FB 2X7KA 2RGRA 2PA8D 1M9FA 2XCOA 4C3JC 3S1RK 4A3GC 1IW7A 3HOZC 4KMUA 4BY1K 1WQFA 3M3YC 1IHGA 2E2HK 3GTGA 4BY7K 2CFAB 2GAHC 4A3LC 4BBSC 5KUVA 4RMFA 4A3IC 4FRUA 2PPBA 4KAWX 5KV2A 4BBRC 5C4JC 3GTPA 4FZBA 3FKIC 1CWKA 1XZQB 5TMFA 4J5CX 4DGAA 3G4AA 3WODA 2P0OA 1CWLA 3NUHA 4I9YA 1I50K 2MZUA 5FLMC 3HOUK 1TWCK 3R59A 3GTKA 4A3CC 3S17C 3I4MK 4TOTA 5IOSA 1VAIA 2PMZD 3A8JA 3S2DC 2R93C 4XNCA 1IE0A 5C4JK 4NOIA 4G7HA 2X25B 4J59A 1R9TA 1AWTA 1AWVA 4YUHA 3R54A 2FQOA 3GTOA 2Y3PA 4YFXA 4KMHA 3IPJA 4XSZA 3S15K 2KA0A 5KV3A 1DCOA 3KOPA 3O7TA 3GTOK 4KASA 5DUDA 1E8KA 5KULA 5C4XC 3QX3A 3GTGC 4QIWL 1VH2A 2CYHA 2RMAA 3RCIX 4BLAA 5CYHA 3GTLC 1ZKFA 3S2HC 4Y7NC 2R92K 5CHPA 3S1QK 3EOVA 1ZXOA 5EGHA 4OIRA 2NVQK 2WFIA 1O28A 4R3FA 3HOWC 1I3QA 1HQMA 3Q3QA 3A8KA 3H3VD 2A69A 3N0BA 3I4NK 1O2AA 1TWCA 1F7VA 1WSVA 1XZPA 3H0GA 4KMAA 2NVXC 3S16C 5M5YK 1C0AA 3GTJA 3HXAA 1KQ4A 5CBTA 4BY1C 4QJVA 3BP3A 5KUNA 4J5BA 1IL2A 3X27A 1VBSA 3GTPK 1O27A 3S1NC 4C3IC 5TMCA 3SZZA 4C3HK 3I4NC 2CMTA 4AYBL 4Q5SA 1K83C 1M9DA 2D6FC 4YFNA 2E2HA 3BT8A 4GTBA 4LJZA 4OIPA 1I3QC 4KATA 1E3BA 3MMLA 1BGWA 1WORA 2GSNA 2BE5A 3HOYC 1BCKA 2B71A 2JA8C 2R7ZA 1USMA 2X2AA 1JVIA 1TWCC 2KWAA 4GTDA 2P5MA 4JK1A 3LPXA 4KN7A 4A3MK 2YU9K 3S17K 3S2HK 4A3CK 3HKZD 3T00A 1SFOA 4A3KC 4C3IK 2JA5K 4C3HC 4M1XA 3ADAC 5C44K 2JA6K 4YUOA 3HOXK 4PAAA 3R57A 2A6HA 1V9TA 3ODIA 4LK0A 3G4CA 1IBAA 2R7ZC 4XSXA 4BXXC 4DGEA 1ZVUA 3AD8C 4A3EC 3GTKC 5IYDC 2JA7C 1EI6A 4A3KK 4Q4ZA 2JA5C 1ZX8A 3GEIA 5C44C 3OPFA 4N1MA 1XO7A 2JA6C 4A3BC 1AWRA 1J6VA 5KUQA 4YUMA 5TJ3A 4WJ4A 1EQRA 4J58A 2WLWA 3CQZK 4GTFA 1JQWA 2RMCA 1J6XA
chains in the Genus database with same CATH topology
2PHCB 3CYHA 1MF8C 1VBTA 1QOIA 3RCLA 1NMKA 1GE9A 5JVOA 1M9XA 5CCNA 1RMHA 1EK8A 3OEPA 4BKWA 4JCPA 5KUOA 4YUNA 3RD9X 2C3BA 3LAJA 2RS4A 1CWFA 2IGWA 3AQPA 2R92A 2CPLA 3K0QA 4N1PA 1AWQA 1AB4A 1CWIA 1X7FA 4YUPA 4DGDA 1YNDA 1M9EA 2JH3A 2CK1A 5LUDA 3AH5A 1ISEA 1K83A 3K0MA 1O26A 2R99A 4KB2A 3R49A 1CWJA 4YUJA 5KUWA 4KMDA 2PLUA 3K2CA 1CWMA 1FGLA 5KUZA 3N0CA 2HQJA 1Y1WA 3V4GA 2NVXA 5CCQA 1CWAA 1Z81A 4P5BA 4YULA 4EYVA 2JA7A 1TWGA 3LAPA 1ZMFA 1XXBA 2RH6A 1OCAA 1AK4A 5CBUA 1O2BA 1WCMA 1CWCA 1MIKA 4LR2A 2CFAA 1M9CA 2E2IA 4GT9A 4ZSCA 4YUKA 2OSEA 4S1EA 3K0PA 2MS4A 2NULA 1C5FA 3R56A 3S0XA 1O24A 5F66A 4G0WA 4J5AX 5KV0A 1H0PA 3RDCA 3K0OA 5KV1A 5KV4A 2GSOA 1Y1VA 4P5AA 3MMLB 2HQ6A 5IOQA 1W74A 1WIHA 3RCKX 3L4KA 1WQHA 2HAQA 3ICHA 4G0UA 1DD5A 1CWHA 3ODLA 4YUGA 4YUIA 1BJTA 1CWOA 3QYUA 1A33A 3RFYA 4DDQA 3UCHA 1XWNA 2FU0A 1TWAA 4C2MC 2WFJA 4DGBA 4E1QA 1QNGA 3RDBA 4ILDA 1IIPA 1XQ7A 2POYA 3RDDA 4IPZA 4GFQA 1CYNA 2QERA 4LQWA 4KDDA 2ZFZA 1ZBSA 3JB9d 4HY7A 1B4BA 4KM8A 3T1UA 4FM9A 4O8IA 5CJ9A 1QNHA 3S6MA 2GW2A 4GTAA 1O29A 1A58A 1W8MA 1O25A 4BLBA 1EH1A 2A2NA 1W8LA 4S1JA 1LOPA 2X83B 3CQZA 5IOTA 1TWHA 4J5DX 4KC6A 2RMBA 3R4GA 3OREA 2POEA 4DGCA 3CYSA 4J3NA 1DYWA 2CFEA 3PMPA 4FRVA 4N1NA 4R3EA 2B63A 3ERED 1WQGA 3K0RA 2JA5A 1XYHA 2NVYA 1ISTA 2Z6WA 3FOFA 4CYHA 4LQYA 5CCRA 2HE9A 2R93A 4GTCA 1B4AA 3BUEA 3FHZA 2BITX 4GTLA 4G0VA 1XXCA 2ZP2A 2IGVA 1F9NA 4KM9A 2OJUA 3RCGA 1VDNA 1J2AA 3FKIA 3FOEA 3RCFA 5KUSA 4N1RA 2XGYB 5CCSX 2VUMA 2OK3A 1W8VA 5A0EA 1M63C 5EGEA 4KARA 3VA7A 3N3YA 1TWFA 5KURA 5IORA 5KV6A 4KB4A 5KV5A 3RDAX 1MZWA 3GTQA 1CLHA 5KV7A 2BIUX 1CWBA 1AWSA 2XCQA 4N1QA 4N1OA 2K7NA 1AWUA 1I50A 2N0TA 3BO7A 5CBWA 1XXAA 3GTLA 2MVZA 2MC9A 1ZKCA 1IS1A 2ESLA 2X2DB 4O8HA 4GTEA 2X2CK 4J5EX 3BKPA 4ZSDA 3GTMA 5JFEA 4N1SA 1M9YA 3ICIA 4JJMA 3K0NA 2JA6A 5CBVA 3L4JA 5KUUA 2XCRB 2GSUA 2YU9A 3AQOA 5JHEA 3CAGA 2ALFA 2RGRA 2X7KA 1M9FA 2XCOA 4C3JC 1WQFA 3GTGA 1IHGA 2CFAB 5KUVA 4FRUA 4KAWX 5KV2A 3GTPA 4FZBA 1CWKA 4J5CX 4DGAA 3G4AA 2P0OA 1CWLA 3NUHA 4I9YA 2MZUA 3R59A 3GTKA 4TOTA 5IOSA 1VAIA 4XNCA 2X25B 4J59A 1R9TA 1AWTA 1AWVA 4YUHA 3R54A 3GTOA 2Y3PA 4KMHA 5KV3A 3O7TA 4KASA 5DUDA 1E8KA 5KULA 3QX3A 2CYHA 2RMAA 3RCIX 4BLAA 5CYHA 1ZKFA 5CHPA 3EOVA 1ZXOA 5EGHA 2WFIA 1O28A 4R3FA 1I3QA 3Q3QA 3N0BA 1O2AA 1TWCA 3H0GA 4KMAA 3GTJA 1KQ4A 5CBTA 5KUNA 4J5BA 1VBSA 1O27A 4C3IC 2CMTA 1M9DA 2E2HA 3BT8A 4GTBA 4KATA 1E3BA 3MMLA 1BGWA 2GSNA 1BCKA 2B71A 2R7ZA 2X2AA 2KWAA 4GTDA 2P5MA 3LPXA 1SFOA 4C3HC 4M1XA 4YUOA 3R57A 1V9TA 3ODIA 3G4CA 4DGEA 1ZVUA 3OPFA 4N1MA 1XO7A 1AWRA 5KUQA 4YUMA 5TJ3A 4J58A 2WLWA 4GTFA 2RMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z6W A;  2PHC B;  3FOF A;  4FRU A;  5F66 A;  4CYH A;  3CYH A;  4G0W A;  4KAW X;  5KV2 A;  4J5A X;  1MF8 C;  5KV0 A;  1H0P A;  5CCR A;  1CWK A;  1VBT A;  4J5C X;  3RDC A;  4DGA A;  1QOI A;  2HE9 A;  3RCL A;  1NMK A;  1GE9 A;  2P0O A;  1CWL A;  3K0O A;  4I9Y A;  5KV4 A;  5KV1 A;  3NUH A;  5JVO A;  1M9X A;  5CCN A;  1RMH A;  1EK8 A;  2MZU A;  3R59 A;  3OEP A;  1B4A A;  3MML B;  3BUE A;  3FHZ A;  4JCP A;  4TOT A;  2BIT X;  1VAI A;  2HQ6 A;  5KUO A;  4XNC A;  4YUN A;  1W74 A;  3RD9 X;  1WIH A;  2C3B A;  3RCK X;  3LAJ A;  3L4K A;  1WQH A;  2RS4 A;  2HAQ A;  1CWF A;  2X25 B;  4J59 A;  3ICH A;  4G0V A;  2IGW A;  4G0U A;  1XXC A;  2ZP2 A;  1AWT A;  1AWV A;  1DD5 A;  2CPL A;  2IGV A;  3K0Q A;  1CWH A;  3R54 A;  4YUH A;  1F9N A;  3ODL A;  4N1P A;  4YUG A;  5CYH A;  4YUI A;  2OJU A;  3RCG A;  1VDN A;  1BJT A;  1J2A A;  1CWO A;  3QYU A;  1AWQ A;  3FOE A;  1A33 A;  2Y3P A;  3RCF A;  5KUS A;  1AB4 A;  1CWI A;  1X7F A;  4YUP A;  5KV3 A;  3RFY A;  4DGD A;  3O7T A;  1YND A;  3R56 A;  4DDQ A;  4N1R A;  5DUD A;  1E8K A;  3UCH A;  1M9E A;  1XWN A;  2CK1 A;  2XGY B;  5CCS X;  5KUL A;  5LUD A;  3QX3 A;  2CYH A;  2FU0 A;  2OK3 A;  1W8V A;  2RMA A;  5A0E A;  1ZKF A;  2WFJ A;  3K0M A;  3RCI X;  1M63 C;  4DGB A;  1QNG A;  4E1Q A;  2R99 A;  3VA7 A;  4KB2 A;  3R49 A;  5KUR A;  3EOV A;  3RDB A;  1ISE A;  1CWJ A;  1IIP A;  2WFI A;  1XQ7 A;  4YUJ A;  5KV6 A;  4R3F A;  2POY A;  5KV5 A;  4KB4 A;  3RDA X;  3RDD A;  4IPZ A;  5KUW A;  4GFQ A;  1MZW A;  1CYN A;  2QER A;  5KV7 A;  1CLH A;  4LQW A;  2PLU A;  4KDD A;  2BIU X;  3K2C A;  1CWB A;  1CWM A;  2ZFZ A;  1AWS A;  3JB9 d;  4HY7 A;  1B4B A;  2XCQ A;  4N1Q A;  5CBT A;  1FGL A;  2K7N A;  4N1O A;  5KUZ A;  3T1U A;  2HQJ A;  4FM9 A;  5KUN A;  4J5B A;  3V4G A;  1VBS A;  5CCQ A;  1CWA A;  1Z81 A;  1AWU A;  4O8I A;  2N0T A;  1QNH A;  3BO7 A;  5CJ9 A;  2CMT A;  3S6M A;  4YUL A;  2GW2 A;  5CBW A;  1XXA A;  1M9D A;  3BT8 A;  4EYV A;  1A58 A;  2MVZ A;  1W8M A;  1E3B A;  3MML A;  2MC9 A;  1ZKC A;  1BGW A;  3LAP A;  1ZMF A;  1XXB A;  1IS1 A;  2ESL A;  1BCK A;  2B71 A;  2X2D B;  1EH1 A;  2A2N A;  1W8L A;  2X2A A;  4O8H A;  2KWA A;  2P5M A;  4S1J A;  3LPX A;  1OCA A;  1LOP A;  2X83 B;  1AK4 A;  2X2C K;  4J5D X;  5CBU A;  4J5E X;  1CWC A;  3BKP A;  4ZSD A;  4KC6 A;  2RMB A;  4YUO A;  1MIK A;  3R4G A;  3R57 A;  1M9Y A;  4N1S A;  3ICI A;  4JJM A;  3K0N A;  1V9T A;  3ORE A;  3ODI A;  5CBV A;  1M9C A;  2POE A;  4DGC A;  3L4J A;  3CYS A;  4J3N A;  5KUU A;  4ZSC A;  4YUK A;  2XCR B;  1DYW A;  2OSE A;  4DGE A;  2CFE A;  5JHE A;  1ZVU A;  3CAG A;  2ALF A;  2RGR A;  2X7K A;  4S1E A;  3PMP A;  4FRV A;  4N1N A;  1M9F A;  3OPF A;  4N1M A;  4R3E A;  2XCO A;  1XO7 A;  3ERE D;  1WQG A;  1AWR A;  3K0R A;  3K0P A;  2MS4 A;  1XYH A;  5KUQ A;  4YUM A;  1IHG A;  1WQF A;  2NUL A;  4J58 A;  1C5F A;  2WLW A;  2RMC A;  1IST A;  5KUV A; 
#chains in the Genus database with same CATH topology
 2PHC B;  4Y7N K;  2R92 C;  3CYH A;  3M4O C;  1MF8 C;  1VBT A;  4O2D A;  1QOI A;  3RCL A;  1NMK A;  1GE9 A;  5JVO A;  3H3V L;  1M9X A;  3H0G K;  5CCN A;  1RMH A;  1WOS A;  1EK8 A;  3OEP A;  4BKW A;  4JCP A;  1V5V A;  5KUO A;  2Y0S D;  4LOW A;  4YUN A;  3RD9 X;  3PO2 C;  2C3B A;  3LAJ A;  1Y1W C;  2RS4 A;  1CWF A;  2IGW A;  3AQP A;  1TWF K;  2R92 A;  2CPL A;  3GTM C;  3TFJ A;  3K0Q A;  2P8T A;  4N1P A;  1INN A;  3H0G C;  1R9T C;  1BDF A;  1AWQ A;  1ZYR A;  4QJV B;  4WIL A;  1F93 A;  1AB4 A;  4XLP A;  1CWI A;  1X7F A;  4YUP A;  4C45 A;  4A3M C;  4DGD A;  1YND A;  5M5W K;  2YU9 C;  5M5X K;  2VUM K;  1M9E A;  2JH3 A;  2CK1 A;  5LUD A;  1Y1V C;  3AH5 A;  5M3M K;  1TWF C;  4LK1 A;  1X31 C;  1ISE A;  1K83 A;  3K0M A;  1O26 A;  4BBS K;  2R99 A;  4KB2 A;  4A3I K;  3R49 A;  1R9T K;  1CWJ A;  4YUJ A;  3RZD C;  3FKI K;  1I6V A;  5KUW A;  4KMD A;  4BXX K;  4A3F C;  4A3E K;  3GTK K;  4OIQ A;  2PLU A;  5C3E K;  3K2C A;  1CWM A;  1PJ5 A;  3I4M C;  3S2D K;  2R93 K;  1FGL A;  5KUZ A;  2Y0S L;  3N0C A;  2HQJ A;  1Y1W A;  3V4G A;  2NVX A;  5CCQ A;  1CWA A;  1Z81 A;  3DXJ A;  4P5B A;  3M4O K;  4YUL A;  5IYC K;  2NVY K;  1WSR A;  5C3E C;  4EYV A;  2JA7 A;  1TWG A;  1DCP A;  3LAP A;  1ZMF A;  1XXB A;  2B63 K;  2RH6 A;  3A8I A;  2NNZ A;  2O5J A;  1OCA A;  1XPP A;  1AK4 A;  5IYB C;  4P9S A;  5CBU A;  1O2B A;  4C3J K;  1WCM A;  1CWC A;  3PO2 K;  2V6U A;  1MIK A;  4LR2 A;  3PO3 C;  2CFA A;  1M9C A;  3TFH A;  3GTM K;  4A3L K;  2E2I A;  4GT9 A;  3EQL A;  2E2I K;  4ZSC A;  4YUK A;  2OSE A;  1PJ6 A;  4S1E A;  5IYB K;  5IP9 C;  2A68 A;  5L46 A;  1WCM K;  1I6H K;  2VUM C;  3K0P A;  2MS4 A;  1TWH K;  4LLG A;  2NUL A;  4YFK A;  3HOU C;  1C5F A;  3R56 A;  3S0X A;  2O5I A;  3GTP C;  1O24 A;  1VLO A;  5HL8 A;  5F66 A;  2V6S A;  3S1N K;  2WAQ L;  4G0W A;  4J5A X;  5KV0 A;  1H0P A;  4MQ9 A;  5D4D A;  3RDC A;  3JST A;  3K0O A;  5KV1 A;  4X6A K;  5KV4 A;  2GSO A;  2GAG C;  1Y1V A;  4P5A A;  3MML B;  2WAQ D;  2NVT C;  2HQ6 A;  3GTQ K;  4AH6 A;  3S15 C;  1PJ7 A;  5IOQ A;  3SZY A;  1W74 A;  1WIH A;  3RCK X;  3L4K A;  1WQH A;  2HAQ A;  3ICH A;  4G0U A;  1DD5 A;  1RU0 A;  3HKZ L;  1CWH A;  3ODL A;  5IYC C;  4YUG A;  4YUI A;  1I50 C;  1BJT A;  5FLM K;  4MEX A;  1CWO A;  2NVQ C;  3QYU A;  3GTL K;  1XZP B;  1A33 A;  3HOW K;  4OIN A;  2PA8 L;  3RZO C;  3RFY A;  4DDQ A;  2WB1 D;  4A3B K;  5FJ8 K;  3UCH A;  3AD9 C;  1XWN A;  2FU0 A;  1TWA A;  4C2M C;  2WFJ A;  4DGB A;  4E1Q A;  1QNG A;  3RDB A;  4ILD A;  4G7O A;  1IIP A;  3PO3 K;  1XQ7 A;  2POY A;  3RDD A;  4IPZ A;  3HOV K;  2WB1 L;  4GFQ A;  3RZO K;  1G51 A;  1SFO C;  1DCH A;  1CYN A;  2QER A;  4LQW A;  4KDD A;  4C2M K;  1VRQ C;  2ZFZ A;  1ZBS A;  3S1R C;  3JB9 d;  1WCM C;  4HY7 A;  1B4B A;  4KM8 A;  1I6H C;  3S1Q C;  2JA8 K;  3T1U A;  4FM9 A;  3S14 K;  4O8I A;  3HOV C;  5CJ9 A;  1QNH A;  1JOE A;  3S6M A;  4BBR K;  2GW2 A;  1J6W A;  4GTA A;  2EBB A;  4ZH4 A;  1O29 A;  1A58 A;  1W8M A;  3GIR A;  1O25 A;  4X6A C;  3GEE A;  4BLB A;  1EH1 A;  2A2N A;  1W8L A;  4S1J A;  4QIW D;  1LOP A;  2X83 B;  3CQZ A;  2NVT K;  3GTQ C;  5IOT A;  1TWH A;  4J5D X;  4KN4 A;  4KC6 A;  2RMB A;  1TWG C;  3R4G A;  1UV7 A;  4XLN A;  4WJ3 M;  2W7V A;  3ORE A;  1L0W A;  3T02 A;  3RZD K;  2POE A;  3HOY K;  4DGC A;  3T01 A;  3CYS A;  3AD7 C;  4J3N A;  1DYW A;  2CFE A;  3PMP A;  4FRV A;  1EFW A;  4N1N A;  4R3E A;  2B63 A;  3GTO C;  3ERE D;  1TWG K;  4YG2 A;  1WQG A;  5C4X K;  3K0R A;  2JA5 A;  1XYH A;  2NVY A;  2FQT A;  1VJE A;  1IST A;  2Z6W A;  4MEY A;  3FOF A;  4CYH A;  3TTG A;  2R7Z K;  3K7A K;  4LQY A;  5CCR A;  2ZUF A;  1Y1W K;  2JA7 K;  5IYD K;  2HE9 A;  2R93 A;  2B63 C;  2E2J K;  1TWA C;  4GTC A;  2NVX K;  3S16 K;  1XZQ A;  1B4A A;  3GDZ A;  3BUE A;  3FHZ A;  2BIT X;  1IQ0 A;  4PAB A;  4GTL A;  3GTJ K;  3S14 C;  1ZQ1 C;  4G0V A;  1XXC A;  2ZP2 A;  2IGV A;  1F9N A;  1K83 K;  1YCL A;  2E2J C;  1VGX A;  4KM9 A;  1TWA K;  2OJU A;  3RCG A;  1VDN A;  1J2A A;  1I3Q K;  2E2I C;  3FKI A;  3FOE A;  3RCF A;  5KUS A;  2CW0 A;  2ZUE A;  4A3G K;  4N1R A;  4A3F K;  3HOZ K;  2XGY B;  5CCS X;  3M3Y K;  4Y52 K;  3GSI A;  2VUM A;  2OK3 A;  1W8V A;  5A0E A;  3TFI A;  4BY7 C;  1M63 C;  5EGE A;  3VA7 A;  2A6E A;  3N3Y A;  4KAR A;  1TWF A;  3HOX C;  5KUR A;  5IOR A;  3S1M C;  1SMY A;  1F7U A;  5KV6 A;  4KB4 A;  5KV5 A;  3RDA X;  1MZW A;  3GTQ A;  1CLH A;  5KV7 A;  1Y1V K;  4Y52 C;  2BIU X;  1CWB A;  4AYB D;  1AWS A;  1WOO A;  2XCQ A;  4XCH A;  4N1Q A;  1J98 A;  4N1O A;  2K7N A;  3S1M K;  5IP7 C;  1USO A;  1HI9 A;  3CQZ C;  1AWU A;  1I50 A;  1BS2 A;  2N0T A;  3BO7 A;  3K7A C;  4OIO A;  5CBW A;  1XXA A;  2PMZ L;  3GTL A;  5E68 A;  2MVZ A;  2MC9 A;  1ZKC A;  1IS1 A;  2ESL A;  2X2D B;  5IP7 K;  4A3J C;  4O8H A;  4A3D K;  4A93 C;  4GTE A;  3GTG K;  1YNN A;  2X2C K;  5IP9 K;  4J5E X;  3GTJ C;  3BKP A;  1YNJ A;  4ZSD A;  4G7Z A;  3GTM A;  5JFE A;  4N1S A;  1M9Y A;  2NVY C;  3ICI A;  1TWH C;  4JJM A;  3K0N A;  2E2H C;  2V6T A;  5CBV A;  2JA6 A;  1WOP A;  1YX2 A;  3L4J A;  5M3F K;  4A3J K;  4A3D C;  5KUU A;  1SFO K;  4GZY A;  2XCR B;  4A93 K;  2GSU A;  3GEH A;  3AQO A;  5JHE A;  3BP8 C;  2YU9 A;  3CAG A;  2ALF A;  1O2F B;  2X7K A;  2RGR A;  2PA8 D;  1M9F A;  2XCO A;  4C3J C;  3S1R K;  4A3G C;  1IW7 A;  3HOZ C;  4KMU A;  4BY1 K;  1WQF A;  3M3Y C;  1IHG A;  2E2H K;  3GTG A;  4BY7 K;  2CFA B;  2GAH C;  4A3L C;  4BBS C;  5KUV A;  4RMF A;  4A3I C;  4FRU A;  2PPB A;  4KAW X;  5KV2 A;  4BBR C;  5C4J C;  3GTP A;  4FZB A;  3FKI C;  1CWK A;  1XZQ B;  5TMF A;  4J5C X;  4DGA A;  3G4A A;  3WOD A;  2P0O A;  1CWL A;  3NUH A;  4I9Y A;  1I50 K;  2MZU A;  5FLM C;  3HOU K;  1TWC K;  3R59 A;  3GTK A;  4A3C C;  3S17 C;  3I4M K;  4TOT A;  5IOS A;  1VAI A;  2PMZ D;  3A8J A;  3S2D C;  2R93 C;  4XNC A;  1IE0 A;  5C4J K;  4NOI A;  4G7H A;  2X25 B;  4J59 A;  1R9T A;  1AWT A;  1AWV A;  4YUH A;  3R54 A;  2FQO A;  3GTO A;  2Y3P A;  4YFX A;  4KMH A;  3IPJ A;  4XSZ A;  3S15 K;  2KA0 A;  5KV3 A;  1DCO A;  3KOP A;  3O7T A;  3GTO K;  4KAS A;  5DUD A;  1E8K A;  5KUL A;  5C4X C;  3QX3 A;  3GTG C;  4QIW L;  1VH2 A;  2CYH A;  2RMA A;  3RCI X;  4BLA A;  5CYH A;  3GTL C;  1ZKF A;  3S2H C;  4Y7N C;  2R92 K;  5CHP A;  3S1Q K;  3EOV A;  1ZXO A;  5EGH A;  4OIR A;  2NVQ K;  2WFI A;  1O28 A;  4R3F A;  3HOW C;  1I3Q A;  1HQM A;  3Q3Q A;  3A8K A;  3H3V D;  2A69 A;  3N0B A;  3I4N K;  1O2A A;  1TWC A;  1F7V A;  1WSV A;  1XZP A;  3H0G A;  4KMA A;  2NVX C;  3S16 C;  5M5Y K;  1C0A A;  3GTJ A;  3HXA A;  1KQ4 A;  5CBT A;  4BY1 C;  4QJV A;  3BP3 A;  5KUN A;  4J5B A;  1IL2 A;  3X27 A;  1VBS A;  3GTP K;  1O27 A;  3S1N C;  4C3I C;  5TMC A;  3SZZ A;  4C3H K;  3I4N C;  2CMT A;  4AYB L;  4Q5S A;  1K83 C;  1M9D A;  2D6F C;  4YFN A;  2E2H A;  3BT8 A;  4GTB A;  4LJZ A;  4OIP A;  1I3Q C;  4KAT A;  1E3B A;  3MML A;  1BGW A;  1WOR A;  2GSN A;  2BE5 A;  3HOY C;  1BCK A;  2B71 A;  2JA8 C;  2R7Z A;  1USM A;  2X2A A;  1JVI A;  1TWC C;  2KWA A;  4GTD A;  2P5M A;  4JK1 A;  3LPX A;  4KN7 A;  4A3M K;  2YU9 K;  3S17 K;  3S2H K;  4A3C K;  3HKZ D;  3T00 A;  1SFO A;  4A3K C;  4C3I K;  2JA5 K;  4C3H C;  4M1X A;  3ADA C;  5C44 K;  2JA6 K;  4YUO A;  3HOX K;  4PAA A;  3R57 A;  2A6H A;  1V9T A;  3ODI A;  4LK0 A;  3G4C A;  1IBA A;  2R7Z C;  4XSX A;  4BXX C;  4DGE A;  1ZVU A;  3AD8 C;  4A3E C;  3GTK C;  5IYD C;  2JA7 C;  1EI6 A;  4A3K K;  4Q4Z A;  2JA5 C;  1ZX8 A;  3GEI A;  5C44 C;  3OPF A;  4N1M A;  1XO7 A;  2JA6 C;  4A3B C;  1AWR A;  1J6V A;  5KUQ A;  4YUM A;  5TJ3 A;  4WJ4 A;  1EQR A;  4J58 A;  2WLW A;  3CQZ K;  4GTF A;  1JQW A;  2RMC A;  1J6X A; 
#chains in the Genus database with same CATH homology
 2PHC B;  3CYH A;  1MF8 C;  1VBT A;  1QOI A;  3RCL A;  1NMK A;  1GE9 A;  5JVO A;  1M9X A;  5CCN A;  1RMH A;  1EK8 A;  3OEP A;  4BKW A;  4JCP A;  5KUO A;  4YUN A;  3RD9 X;  2C3B A;  3LAJ A;  2RS4 A;  1CWF A;  2IGW A;  3AQP A;  2R92 A;  2CPL A;  3K0Q A;  4N1P A;  1AWQ A;  1AB4 A;  1CWI A;  1X7F A;  4YUP A;  4DGD A;  1YND A;  1M9E A;  2JH3 A;  2CK1 A;  5LUD A;  3AH5 A;  1ISE A;  1K83 A;  3K0M A;  1O26 A;  2R99 A;  4KB2 A;  3R49 A;  1CWJ A;  4YUJ A;  5KUW A;  4KMD A;  2PLU A;  3K2C A;  1CWM A;  1FGL A;  5KUZ A;  3N0C A;  2HQJ A;  1Y1W A;  3V4G A;  2NVX A;  5CCQ A;  1CWA A;  1Z81 A;  4P5B A;  4YUL A;  4EYV A;  2JA7 A;  1TWG A;  3LAP A;  1ZMF A;  1XXB A;  2RH6 A;  1OCA A;  1AK4 A;  5CBU A;  1O2B A;  1WCM A;  1CWC A;  1MIK A;  4LR2 A;  2CFA A;  1M9C A;  2E2I A;  4GT9 A;  4ZSC A;  4YUK A;  2OSE A;  4S1E A;  3K0P A;  2MS4 A;  2NUL A;  1C5F A;  3R56 A;  3S0X A;  1O24 A;  5F66 A;  4G0W A;  4J5A X;  5KV0 A;  1H0P A;  3RDC A;  3K0O A;  5KV1 A;  5KV4 A;  2GSO A;  1Y1V A;  4P5A A;  3MML B;  2HQ6 A;  5IOQ A;  1W74 A;  1WIH A;  3RCK X;  3L4K A;  1WQH A;  2HAQ A;  3ICH A;  4G0U A;  1DD5 A;  1CWH A;  3ODL A;  4YUG A;  4YUI A;  1BJT A;  1CWO A;  3QYU A;  1A33 A;  3RFY A;  4DDQ A;  3UCH A;  1XWN A;  2FU0 A;  1TWA A;  4C2M C;  2WFJ A;  4DGB A;  4E1Q A;  1QNG A;  3RDB A;  4ILD A;  1IIP A;  1XQ7 A;  2POY A;  3RDD A;  4IPZ A;  4GFQ A;  1CYN A;  2QER A;  4LQW A;  4KDD A;  2ZFZ A;  1ZBS A;  3JB9 d;  4HY7 A;  1B4B A;  4KM8 A;  3T1U A;  4FM9 A;  4O8I A;  5CJ9 A;  1QNH A;  3S6M A;  2GW2 A;  4GTA A;  1O29 A;  1A58 A;  1W8M A;  1O25 A;  4BLB A;  1EH1 A;  2A2N A;  1W8L A;  4S1J A;  1LOP A;  2X83 B;  3CQZ A;  5IOT A;  1TWH A;  4J5D X;  4KC6 A;  2RMB A;  3R4G A;  3ORE A;  2POE A;  4DGC A;  3CYS A;  4J3N A;  1DYW A;  2CFE A;  3PMP A;  4FRV A;  4N1N A;  4R3E A;  2B63 A;  3ERE D;  1WQG A;  3K0R A;  2JA5 A;  1XYH A;  2NVY A;  1IST A;  2Z6W A;  3FOF A;  4CYH A;  4LQY A;  5CCR A;  2HE9 A;  2R93 A;  4GTC A;  1B4A A;  3BUE A;  3FHZ A;  2BIT X;  4GTL A;  4G0V A;  1XXC A;  2ZP2 A;  2IGV A;  1F9N A;  4KM9 A;  2OJU A;  3RCG A;  1VDN A;  1J2A A;  3FKI A;  3FOE A;  3RCF A;  5KUS A;  4N1R A;  2XGY B;  5CCS X;  2VUM A;  2OK3 A;  1W8V A;  5A0E A;  1M63 C;  5EGE A;  4KAR A;  3VA7 A;  3N3Y A;  1TWF A;  5KUR A;  5IOR A;  5KV6 A;  4KB4 A;  5KV5 A;  3RDA X;  1MZW A;  3GTQ A;  1CLH A;  5KV7 A;  2BIU X;  1CWB A;  1AWS A;  2XCQ A;  4N1Q A;  4N1O A;  2K7N A;  1AWU A;  1I50 A;  2N0T A;  3BO7 A;  5CBW A;  1XXA A;  3GTL A;  2MVZ A;  2MC9 A;  1ZKC A;  1IS1 A;  2ESL A;  2X2D B;  4O8H A;  4GTE A;  2X2C K;  4J5E X;  3BKP A;  4ZSD A;  3GTM A;  5JFE A;  4N1S A;  1M9Y A;  3ICI A;  4JJM A;  3K0N A;  2JA6 A;  5CBV A;  3L4J A;  5KUU A;  2XCR B;  2GSU A;  2YU9 A;  3AQO A;  5JHE A;  3CAG A;  2ALF A;  2RGR A;  2X7K A;  1M9F A;  2XCO A;  4C3J C;  1WQF A;  3GTG A;  1IHG A;  2CFA B;  5KUV A;  4FRU A;  4KAW X;  5KV2 A;  3GTP A;  4FZB A;  1CWK A;  4J5C X;  4DGA A;  3G4A A;  2P0O A;  1CWL A;  3NUH A;  4I9Y A;  2MZU A;  3R59 A;  3GTK A;  4TOT A;  5IOS A;  1VAI A;  4XNC A;  2X25 B;  4J59 A;  1R9T A;  1AWT A;  1AWV A;  4YUH A;  3R54 A;  3GTO A;  2Y3P A;  4KMH A;  5KV3 A;  3O7T A;  4KAS A;  5DUD A;  1E8K A;  5KUL A;  3QX3 A;  2CYH A;  2RMA A;  3RCI X;  4BLA A;  5CYH A;  1ZKF A;  5CHP A;  3EOV A;  1ZXO A;  5EGH A;  2WFI A;  1O28 A;  4R3F A;  1I3Q A;  3Q3Q A;  3N0B A;  1O2A A;  1TWC A;  3H0G A;  4KMA A;  3GTJ A;  1KQ4 A;  5CBT A;  5KUN A;  4J5B A;  1VBS A;  1O27 A;  4C3I C;  2CMT A;  1M9D A;  2E2H A;  3BT8 A;  4GTB A;  4KAT A;  1E3B A;  3MML A;  1BGW A;  2GSN A;  1BCK A;  2B71 A;  2R7Z A;  2X2A A;  2KWA A;  4GTD A;  2P5M A;  3LPX A;  1SFO A;  4C3H C;  4M1X A;  4YUO A;  3R57 A;  1V9T A;  3ODI A;  3G4C A;  4DGE A;  1ZVU A;  3OPF A;  4N1M A;  1XO7 A;  1AWR A;  5KUQ A;  4YUM A;  5TJ3 A;  4J58 A;  2WLW A;  4GTF A;  2RMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...