3OPKA

Crystal structure of divalent-cation tolerance protein cuta from salmonella enterica subsp. enterica serovar typhimurium str. lt2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
104
Chain Sequence
PEAVVVLCTAPDEATAQDLAAKVLAEKLAACATLLPGATSLYYWEGKLEQEYEVQMILKTTVSHQQALIDCLKSHHPYQTPELLVLPVTHGDTDYLSWLNASLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Divalent-cation tolerance protein cutA
publication title Crystal structure of divalent-cation tolerance protein CutA from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Metal binding protein
total genus 25
structure length 104
sequence length 104
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3opkA00
4D3GA 4CO5A 2NS1B 2VD3A 4NYPA 2ZFHA 4RLEA 1KR4A 2GNKA 3NCPA 2O67A 3NCQA 3MHYA 1P1LA 2JJ4D 3NCRA 5DRKA 4NYOA 2ZOMA 3L7PA 2J9CA 4CO3A 4D3HA 2CZ4A 2NUHA 2XG8A 1J2VA 1UMJA 4OZLA 3BZQA 2E66A 1OSCA 4E98A 4YB6A 2J9EA 1V6HA 3AA8A 3LF0A 1PILA 4OZJA 4C3LA 3CE8A 4CO2A 1VFJA 2V5HG 2NUUG 3TA2A 2PIIA 2J9DA 4R25A 1QY7A 1NAQA 4C3KA 4YB7A 3HLUA 1UL3A 3M05A 4RX6A 3X3UA 1UFLA 3AH6A 5D4OA 5L9NA 5D4NA 3OPKA 2O66A 2XZWA 1V9OA 3AA9A 4CNZA 5D4PA 4CO1A 4USJC 2Z0GA 1VHFA 3O5TB 4Y6IA 4CO4A 5DS7A 4ZK7M 1O5JA 4RWXA 4YB5A 4CNYA 1NH7A 1GNKA 4WK1A 4Y65A 1NZAA 4CO0A 2GX8A 2XBPA 1Q1KA 1H3DA 1V3SA 1NH8A 3T9ZA 2XULA 2GW8A 3DFEA 3GSDA 4OZNA 2EG1A 2DCLA 4USHA 1V3RA 3TA1A 4AFFA 5D4LA 2RD5C 4RWWA 2J9DE 4WK3A 3O8WA 2EG2A 1O51A 1HWUA 4USIA 1XK8A 4C3MA 3N5BA 3AHPA 4IYQA 1UKUA 3TA0A
chains in the Genus database with same CATH superfamily
4AL6A 2RMLA 2FZKB 1ZM3A 2WB4A 3KLEB 2D3O1 2FJAB 2SXLA 1Q7YT 3NG8A 1N5YB 3SV3A 4USUA 4K4ZA 1GMWA 1U2RA 1M1GA 3CVKA 3VAGA 1M5SA 2O5DA 2XMWA 3HHLB 1GXLA 2E1MC 3PW7A 4NASA 2V5HG 3W3SA 1P9QC 2ZJRQ 1UFKA 2AYGA 4ELVA 2RUGA 3MMBB 4PR6A 3F73A 3MPVA 3CJKA 3OSNA 1NM2A 3G71S 1D3WA 2G13A 3BH7B 3K89A 3NLCA 3EMTA 4O44A 5HLFB 1S9EA 3POTA 7FD1A 2RKIB 1WG5A 1AZSB 4B3SF 5KG1A 5CXTA 3PIOQ 3NOGA 2CQ0A 2ZZNA 3WQPA 1U1QA 4FYYB 3IC1A 1Q8IA 2UXBF 5GAHU 2C2ZB 4KR0B 4YDDB 3MCNA 3CJTA 1HQ2A 3MHYA 1H38A 5DRKA 4B3OB 2HQ3A 2ADBA 2BJDA 4B9SA 1J2VA 2KB2A 4P7TA 2GGPB 2R2SA 3CO0P 3M9NB 2ZITA 1PILA 3NNHA 1RDRA 3GSIA 2E5LJ 3R3TA 1KEKA 1S5ZA 1VI7A 5DDPC 1RTHB 3H5YA 1AYEA 2DNZA 3CD5A 3LUYA 3EDQB 3JSMB 1D8ZA 1SL1A 2RH3A 4O3QA 3CJ8A 1DARA 5KFYA 3L95X 3M2RB 4PWDB 2ZE2B 1KQFB 3E8OA 2EFVA 2DISA 2VBZA 2ATCB 2CYYA 4L6V3 1Q86T 3OUYB 3FK4A 1BHNA 5AXNA 3MAAA 3C3LA 2WVCA 1N34F 4M5KA 4EFAC 3IBWA 2F1FA 2ZFHA 1YJNS 1HQUA 3W2VA 1Q16B 4ECWA 1M5VC 2VFSA 4NXMJ 3OTDA 2AJ2A 2BM0A 2QIFA 1U0HB 2KXHA 5KG2A 3QIPA 1WG4A 2QV6A 3MM7B 4ZHRB 2DYAA 1SC4B 1TV6A 2HK3A 1JX4A 3A4TA 3K2YA 5I42A 2QFJA 1NDLA 2VG5A 4AT1B 3DC2A 1YWXA 3W8PA 4DQQA 3FZBA 2RDDA 4ZVQB 1MU2A 4FS2A 3OVBA 4JYAF 3W9HA 5D4PA 4U67Q 1GH8A 2DNRA 3Q8VA 2HQFA 3TZXA 4AL7A 4Y65A 2CPIA 1CG2A 2CQ4A 4OZ1A 2E7VA 4TLRA 4CI0B 2YXLA 1R8CA 5HMZA 4QOTA 4KHPF 4ZIWA 5F0UA 4D3GA 1SJ1A 5DO2A 4HLBA 4DX6A 3EX7B 4DPXA 2RHSB 2BDPA 4Y34A 5L1IA 1PYSB 3R27A 1LV5A 4CCHA 2ZD1B 1SH3A 4PWUA 2HPUA 2UUAF 2K1RA 4YUDA 4F4KA 2PI4A 4I0WA 2JL9A 4QIEA 2EK6A 1XMBA 2ZJQQ 3SQGA 2K3KA 1UA0A 2NREA 2CQIA 2R7UA 3VQTA 4XAKA 2EEYA 3UVJA 4WU3A 4DV7J 2E1CA 4EBCA 3FRYA 3NOCA 3DGVA 5IM0A 1FFWB 1UP1A 4QIVA 3N28A 4I6WA 1VRUB 4RNMA 5DM7Q 2J8AA 1OSDA 1WI6A 5FIIA 1JKHB 2HRUA 3ISNC 4O4RA 1RAHB 3AHPA 3W2WB 3ILLA 1SJQA 3VGVA 4ECUA 1E6VA 3RAXA 4OZ5A 4LQ3A 1LK5A 1NCLA 2AJ0A 2DNOA 3HZGA 5CYJA 4YS2A 2EFGA 3DRRB 2AGOA 3OV7A 3D6HB 1IR2A 4MKVA 3SIPB 3K17A 4ECQA 4DSFA 2B5JA 2AU0A 2KRBA 4LF7F 1JLEA 5IT9Y 4J9VA 4F0HA 4BHQA 5F8LA 3CMES 1BMQB 3GIIA 4HR2A 1WKKA 2A2DA 2MGZA 2JFDA 2V8VA 4QIWD 2K7KA 3T1YJ 2BOPA 1X4HA 2U1AA 4ED5A 5DGAA 3OR1B 1NBEB 2OFHX 4F4ZA 5DGBA 2DGSA 3DYAB 5KOXA 5HQ8A 1PIEA 4C8ZA 5LMNJ 3SXLA 3S8SA 3MPDA 2BA9A 2FZGB 2HRTA 5LT5A 3N9UC 2IMOA 2KTQA 4ZCLA 5T41A 5KG7A 4TKTA 2DXFA 2ZZTA 3SCKE 2DVIA 2OO4A 1GMVA 2YPZA 2UXDJ 2PFFB 4DI6A 4AL5A 3PXGa 2G0IA 3MF5A 3GILA 1FJGF 4X64J 5GAHI 4JI0J 4CTAB 3AOBA 2XYHB 3W5XA 2IFXA 3TVKA 4I2PB 1Y5LB 2VL1A 3R5CA 4YB7A 4DV4F 4C6AA 3D4JA 5HP1A 1JLGB 4ZA1A 3SYZA 4JBCA 3FMWA 1PYOB 1QAYA 3TEHB 3I82A 1CQNA 2YNFA 4CO1A 4B17A 2Z56B 1P9YA 1RHKB 4CNYA 2BKNA 4RUCA 1REGX 3DHXA 1R0BG 2IVMA 4PWWA 1BXNA 3EICA 3D5MA 4OYIA 1C0TB 4RNNA 9RUBA 5KFDA 4W90B 3O8WA 4X62F 4DR5F 2LA6A 3DOMB 2PN6A 2K7JA 4ELTA 2VQEJ 3T5KA 5HATA 1ZAVA 1T94A 2BJ8A 2YKPA 3N4WA 1S12A 2ZKUA 3OFHA 2RRNA 3WIUA 2I8EA 2JHEA 3TAQA 3PYFA 1X0FA 1S57A 2HGLA 3DLKB 5F3ZA 4JI6J 3JAMY 1RWOB 5IC4B 1TKTB 3BSOA 2B43A 1PCAA 5E3RA 1LNQA 4P72A 2XSJB 2UUTA 4FNIA 1NSKL 4DF8A 1Q4RA 2XLKA 4CZCA 1YJ7A 3DLGB 5CD4H 4RW4B 3D67A 3K59A 4ZVEA 1IBMJ 3L3CA 3EXCX 4C2MA 5A2QU 2XMMA 3M2UA 2ZHBA 3DOLA 2L9NA 3NS6A 5G0RA 2YX1A 1T05A 3F44A 4RNOA 1RI7A 2LQJA 3JTOA 1RT7A 2AQ4A 4B08A 1FD2A 4P10A 3CTRA 4A48A 3TYTA 4ZLLA 4NLWA 2ZH8A 3Q83A 4NX9A 3NS7B 2R8HA 3NCQA 1P1LA 3JSRA 2UUBF 3SFGA 3MR3A 1IKXB 2XGQA 5FJ4A 1TTHB 4WPAA 5AT1B 2ALYB 1ITPA 2DO0A 1SKWA 3RW6A 5IQQA 2EPIA 5T7LB 2V6AA 4V1Ak 3W8GA 2F8HA 4FXDA 4UW2A 2OIHA 3AXKA 2ZHAA 3MM9B 3EGWB 4I1TA 2C22A 1HI1A 4WE1B 2R7OA 1XNRJ 1HNIB 5EX3A 1JLQB 2P6SA 1XR6A 3LQVA 1EKSA 2H9ZA 1T03B 1CQMA 5KFTA 1K9MT 3KJNB 2OTJS 2XY5A 1VBXA 5CQGA 1RT5A 2HWHA 2C3YA 3IN5A 2HS0A 4LF5J 2DPJA 1YZ6A 4BC7A 1JJ4A 5ETVA 3AD7C 3QLHB 4GO5X 1TL7A 2KO1A 1SH0A 1NHUA 5KT6A 1SI9A 1N48A 4NYPA 1HYSB 4OLOA 4U96A 5FDLB 1EQ0A 3C6TA 2IVFB 3LGMA 3J80U 3PKYA 1S48A 2G2YA 4GKKJ 2Y9HA 4C0HA 2XG8A 1KLMA 2ASDA 3AJ2A 4ECXA 3Q8UA 2EKYA 3D3BJ 3MDFA 4L72B 4DLGA 1F5AA 4DR7J 2OELA 1B7YB 3OTOJ 2WOMA 1SKRA 1CJUB 3SV4A 1V3ZA 1DTQB 3Q8PB 3GG1A 3GYGA 1JLAA 1D8YA 2ERRA 3M8WA 1I94J 1Q5VA 3KKFA 3QFHA 1NH8A 3I56S 4YR2A 3W66A 1DLOA 3V81B 3KDOA 5DLGA 4GVBA 3O3LA 3AJDA 1NPRA 3QJLA 1TFYA 3H25A 2W2PP 5ITHA 3MECA 1TR0A 1BQMB 1N33F 1U48A 3ILOA 1CC8A 2YPYA 3GB0A 2FIUA 1VK3A 3JYTA 2JC1A 5KFRA 3CMAS 5L1KA 2DR5A 4F4WA 2DRAA 4JI1F 2LU1A 2XO6A 5B09A 4RU9A 3OL9A 3QATA 3FKBA 4X66F 3CJKB 3I5AA 1RTZA 2Y1IA 1SQFA 2XZWA 3A3PB 1U1LA 3HJFA 5KT5A 1NJZA 4O44B 3NWRA 2VA2A 4MYTA 4IG3B 1R8AA 2MQPA 1RKIA 1FD8A 2YKMB 4Y2IA 2VICA 4MAKA 4UQTA 1NZAA 1WSVA 3EVWA 3I9V9 4LREA 4JI7J 3ILJA 4DMZA 5F3TA 4NLRA 4F2RA 2UXCF 1HD1A 5KFIA 4C3MA 1UTAA 3QGHA 5KG6A 2BJ3A 2BM1A 5L1JA 2HAIA 1RISA 2V68A 3DI6A 2OD4A 4I56A 3DLBA 1HWJA 3HP6A 2VJVA 5EDWA 2UUCJ 4C8KA 2QSWA 2RRBA 1R7IA 5F0WA 4WJBA 3T41A 1FEEA 2Z2YB 2P9GA 4PQUA 1YJUA 2FGCA 2IVYA 1NLKL 4PXCA 4I64A 4KGKA 3KHHA 2J6UA 3U27A 1P27B 3CDEA 2GJ2A 1KBRA 2CQBA 4EBDA 2QA4G 4JV0A 3MUTP 2M5YA 2D1CA 4W92B 1CJKA 4F36A 1R6YA 2ASYA 1SQEA 2Y8YA 3OHBA 3ZZOA 2J0XA 4CO4A 3HT0A 2F8MA 3EWGA 2CNNB 1SJFA 4HTJA 2IJRA 4KGZB 1H3DA 1ICEB 1SQGA 1X5TA 2W25A 3MAAB 1HLWA 5CABA 2KG1A 3QAUA 3PJWA 4PUOA 4LF8F 2QL7B 1HQUB 2LFVA 3W2VB 2LEPA 4ICLA 2FJDB 3KOAA 1S99A 3CCJS 1FRKA 4CH1A 3QIPB 4CIOA 1VGYA 2VOPA 3BN4A 4P2SA 2F9JA 3KNGA 1CULB 4WFAQ 1TV6B 3QGIA 5I42B 3HMJG 1CPZA 3OXGA 2VG5B 2C3MA 5LMUF 3PRDA 1RAEB 4C11A 1IR1A 2R8GA 3GFZA 3LGHA 4ZPAA 1K73T 3FBFA 3GWCA 1MU2B 1WC0A 1VLYA 3W5ZA 3MD3A 4ZLNA 2W9BA 4J9QA 3KG4A 3Q86A 2CUYA 2QLXA 4CNZA 3TQ1A 2CQCA 4BWMA 4C8NA 2XCPA 1DQ8A 2LLZA 5C25A 4KGXB 1B0TA 5GVQA 2QA4S 4NLYA 4FXWA 3FVYA 2XMKA 1RKJA 1IWGA 2YNGA 5KFVA 1WF2A 3K57A 4DR6J 1NK8A 4KFBA 2ZWPA 3CJQA 1REVA 1U8WA 1NXIA 3MTJA 2W4CA 3C8YA 4YMEA 4MKYA 1C1BB 2PMZD 1F3FA 1UFWA 2F5GA 4KO0A 2K1RB 2KXFA 3MEDA 2QZ8A 2AYMA 2PC6A 4TQRA 3CDBA 4U7UD 2KXNB 3SQGB 2CQGA 1VDHA 2HHVA 5CZXA 2CJ9A 4E98A 2VJUA 4YB6A 3ENWA 3VGSA 3OLAA 1FO1A 2LQ9A 2RE1A 3CJSA 2VPZB 2L9WA 3UVJB 4WFNQ 2FJBB 1U1OA 3BBCA 2BRKA 2HWTA 4WBFA 2LEBA 5DQIA 1JXEA 4DL2A 4IH5A 5IM0B 4OMFG 1T0TV 4M94A 1X60A 2ZBRA 1HIYA 1TUGB 4ZVHA 1WDTA 3R7BB 3PW2A 3V4IA 4IH7A 1OMSA 4DSJA 5CD4A 1J5OB 4USHA 8AT1B 2C3UA 4DV1J 3J7YU 9ATCB 1BD6A 1FWPA 3H40A 1RAJA 2RNEA 5IFMA 1MWZA 3PZPA 4LVOP 1E6VB 2FDNA 4DL5A 3ITHA 4XTTA 4ECZA 2V4JA 2X51A 1QUVA 3BREA 2B6AA 3BEGB 1WC3A 4X2BA 3NCRA 1FFSB 1FE0A 1X4GA 2HZVA 1EX8A 1TK0A 1FKPB 3D0HE 2XNRA 3CE8A 3B82A 1JLEB 2BRLA 2DH7A 2V69A 2HVDA 1Q8KA 3X3UA 2HFSA 3KLFA 1RWNB 4F2SA 1FX4A 4NCBA 3LPYA 2MGZB 3G96A 4LRBA 1RCOB 2ZUGA 1D9FA 3LW5C 3D6MB 5J2MA 4ZCKA 3OJUA 3DM2A 2ZC4A 3DFEA 2Z2LA 4TY9A 4CDIA 1P1TA 2N3LA 5LJ5Y 4WZQA 2UU9F 1RB0A 2KI2A 4CRJA 1RT3A 3P8BB 3Q0AA 2VD3A 3OQ2A 3C6UB 2E5IA 3D6FB 1YHQS 4DHVA 3VAHA 4BBYA 5GADU 4KV8B 4FBTA 4KY3A 2BXJA 1LEOA 3PYDA 3R7SB 2YVSA 4EGLA 5A76A 1SXLA 4IOCQ 1F5CA 1ZBTA 5BYQA 1ULRA 3I96A 5C24A 1UWAA 2J0QD 4QWDA 2WONA 3UE2A 1C1CA 2B0GA 5HP1B 3M7VA 3UDEA 2FVPA 2W9CA 1LWFA 4CLTA 4J9OA 4DF4A 3CT9A 4WYWA 2YKOA 4IRCA 1QUPA 4NA1A 5JVGQ 1R0CB 2B8QA 1C2PA 2DR9A 4O3NA 3JB9k 1FESA 3HZEA 2MMYA 5E3CA 1U1MA 2Q3PA 3G6XA 5ETQA 3V5RA 2Y1LB 3RUBL 1DQAA 1ZAXA 3DNCA 4K4XA 4RUHA 2CPJA 4PPZA 4N76A 4RUAA 1XERA 1UEUA 1VQ9S 1L3TA 1HW9A 3FGVA 4TNOA 3H2VE 3FSXA 4I69A 2HBQB 5DZ6A 1OPZA 4K2XA 2DNPA 1RXOB 3M8PA 1NHKL 2V0NA 2HGMA 5IXUA 3FMBA 2XB2D 2HVEA 1YDLA 3BYRA 4HHHA 4A8QA 3QO9B 4WP9A 3PACA 2H5EA 1S79A 4AE5A 3FQKA 4BWJA 1NPPA 3RG6A 2DTJA 2DY9A 2AX1A 1B7FA 3SBMA 2VQFF 1FKOA 1WACA 1LW2A 4OHWA 4IOAQ 2C2NA 3M2UB 1GTEA 3DOLB 5G0RB 1Y0HA 4Y6IA 1NU4A 3CWJA 1T05B 2UXDF 4ID5B 1RT7B 3KUHA 2PMWA 4LF4J 1VQOS 1QSSA 1KVJA 2LP4A 4K8RA 3MUVP 4X65J 1HHQA 2AEMA 3A8EA 2YH1A 4KGVB 2PI5A 4URSA 4CO5A 3R7NB 2BV3A 2GIFA 3U02A 2YKQA 1BQXA 4YR3A 2OTLS 5H9EK 2UVRA 1B3TA 3LGNA 4WZMA 3G86A 4WTYA 5HROA 1X4EA 3Q23A 4DU8A 4IRDA 2FTRA 3H8YA 1OSCA 1UJ6A 3ZZYA 1HBOA 4OZJA 3H20A 1X9MA 1Y3KA 3WZ0A 4ED3A 5K20B 1F5BA 4HL9A 2WBRA 2XO7A 1QVGR 4CM2A 2G0JA 5D4NA 1RHUB 4FF4A 2X1BA 4NL5A 3BSAA 3JQKA 2V8GA 2G2OA 1HWIA 1GT8A 2XMJA 1RT5B 3BQ2A 2D7SA 4OYPA 4NPOA 4M5HA 2E5JA 4IQXA 4JV5F 1KOOA 4USKA 3QRQA 2O01C 1TL7B 1OQ6A 4LSNB 2C3PA 4CP5A 4B3MF 2VU5A 1NSAA 1QAJA 4OYWA 1RHJB 4NLUA 2F3JA 3HVTA 3C6TB 2I5JA 4B3SJ 2MKJA 4J9SA 3BGOP 2A0FB 1U02A 2G0CA 1S49A 1FKAF 2FUG9 3D1HA 3OBIA 5KFXA 1QTNB 1B70B 1KLMB 3VALA 1Q82T 2CZVC 2A6OA 5F8IA 2UXBJ 4UT4A 1KQKA 2WSFC 1HBMA 2DD8S 2B56A 4CLUA 3Q2SC 4RW6B 3GIKA 2QL5B 3MMAA 3OD2A 3HM9A 4OI3A 2WW8A 2C2MB 1UL3A 3RRHA 3GQCA 3ZO7A 3AH6A 3V4MA 2LXIA 5A0YA 3HX9A 4RKUC 1JLAB 1IBKJ 1FWLA 2JEIA 1U2CA 5KFKA 3OTBA 3JTPA 1XJWB 3D28A 3FCVA 5G4DA 1ZM9A 1DLOB 3N79A 5K5MA 4GVBB 1VIXA 2K8GA 2WHOA 1HHSA 1WEZA 1UVJA 4X4SA 3KLEA 4EO6A 1S7HA 1VQ7S 1FDBA 3MECB 4PEOA 5KT4A 4E2FB 1UPPA 3R5GA 3V2UC 2H5JB 2PD1A 2MEWA 1U24A 2BW7A 5M2PA 3HHLA 2ZH6A 5LSRA 3JYTB 3RJMB 5HJXA 5HQLA 2P6TA 1N34J 3QSIA 1XWLA 2ALZA 3TX8A 2GVZA 2CXEA 3MM5B 4ZJOA 3T5LA 4OJ1A 3RRGA 2OPQA 2VFRA 4DZDA 2IYIA 2ASJA 2MKHA 3CGIA 3R5AA 4H4KC 3OJSA 5E0OA 2C2RA 2VPWB 4Z37A 5AE1A 1RT6A 4IRKA 3IR6B 1RU1A 4NRUA 5E2QA 3EYZA 3IR7B 1V9OA 2R7WA 4IG0A 1DAXA 3MTKA 4OFZA 3MAHA 1XC9A 3O5TB 2ZOFA 4B3RF 3MM8A 4CM0A 1FERA 5KFLA 3FSYA 1TZ0A 4NEYA 3QRPA 1UW9A 2EG1A 3MWBA 4JYAJ 3KK1A 5HQMA 3PVXA 5HVGA 2I38A 1LWXA 2MQOA 3J7A1 2WB1D 1FXLA 3ZNJ1 3GYNA 4PG4A 4B3OA 2IPOB 3PEHA 2JEFA 4FDFA 4QWCA 3TQEA 3L4BC 1PBAA 4OX7A 2QT7A 4LF1A 2N3OA 4JI8F 3W9IA 4PQUB 3TUZC 4KHPJ 4BC9A 3OXFA 4CO3A 4ZVGA 2V4QA 2V4RA 4N8NA 3WDOA 3M30A 2HIYA 3C16A 2BQ3A 4DQSA 2KHCA 3CSKA 3TARA 1X9WA 5GMKa 3CPWR 1CJKB 3PX4A 4OYXA 4IR1A 4WU2A 3NS5A 1RCXB 1FRXA 3T19A 8ATCB 3CMQA 1S0OA 2VZ9A 2HQIA 2VH7A 2JSXA 1TL4A 3KG0A 3LTOA 4QZVB 4WTOB 2NSCA 1DHMA 1MMNA 1HI0P 1IUJA 3CCWA 2G1DA 2DCLA 5DZ7A 4PUOB 3K8VA 1KVKA 2YH0A 4G1PA 2RJZA 2WVDA 4WFZA 1QSLA 3P6YC 5DDOC 3CD0A 2AD9A 1SV5A 2L08A 3S01A 2W4DA 1M0SA 4GMKA 3K5MA 1R89A 3PYEA 3SCLE 2AGPA 3HHNB 1GX5A 3HI9A 4IFYA 3VCDA 3RR8A 1JLBA 2LYVA 5D0RA 4ANCA 1YBUA 5J2QA 1JLFA 3BZQA 2RDJA 3D0IE 4C11B 4KJIA 2P9CA 1ZM4A 2AWZA 4C3LA 2QGFB 2QMUB 2BACA 1KFSA 3I55S 2W9BB 5LOQA 3B8HA 1IBLF 1N0UA 1ELOA 5HANA 3PW0A 3KNAA 4IQMA 4WP8A 3LANA 5DJBA 4EBEA 1VC5A 5C25B 3KHGA 4LF7J 1FEHA 3A1YG 2HGNA 3JS9A 2YNGB 2GHWA 4QR2A 3PDNA 3IBCB 3DLHA 4KFBB 3EJMA 1Q8LA 5D4LA 2HQDA 2J9DE 4B9LA 3DLLQ 1T7PA 1TUVA 2MTLA 1IXKA 2M8HA 4KO0B 3H4DA 1S10A 3MEDB 3ULHA 4KPCA 2J7WA 1JXLA 3TANA 3EZUA 1YLXA 1WELA 2V2KA 2IHR1 3AQOA 3RB0A 3A8IA 4DX5A 3G6ES 1EB0A 1HWLA 3M1VA 2BUNA 1YBAA 2CQ1A 5EWGA 3IBFB 3PNIA 3TUJC 4NLQA 2XZDB 1HNXF 2R7TA 4HHJA 2D74B 3OSPA 4JI4F 1S9FA 1LOUA 4OYZA 1FJGJ 4EUVA 2KJVA 1F9EB 2WZ1A 2X7IA 3IO1A 2C3OA 2VFTA 4TLQA 1O5JA 2LEAA 3IXQA 2HHHF 2HSEB 3V4IB 1FJCA 1RBLA 3N6LA 1I5OB 1OQ3A 3TA1A 4EYIB 5IT9U 1T95A 1QD1A 1NSQA 3DN9A 3ITHB 5KFJA 3TI0A 2BJ7A 1MSWD 2B6AB 4J9PA 4M63A 3OT9A 1RUSA 2VPYB 3TWZA 4OI0A 1T3NA 4O0IA 3PW4A 4X62J 4DR5J 1ZZNA 2NXEA 1RWKB 1HWKA 2FLOA 5C2GA 2B9WA 1T9UA 3NKYA 5GAEI 1K1SA 1HI8A 3ISZA 2Y3YA 4NLGA 4A8FA 3O44A 5C7PA 4M5DA 4F50A 1XBWA 2VC0A 4H4MB 4HH0A 4CYUA 3KLFB 4MK8A 2DNNA 1SKSA 1RT2A 2R2UA 3PJXA 3GJSB 4OZ3A 1G4CA 1ZH5A 2GA7A 1D9DA 2GS8A 2FPHX 1N88A 2XHCA 3DM2B 1M1KT 1ZTTA 2CVIA 4HH1A 2E44A 4F8RA 4PYDA 2OLWA 2E9RX 2LXUA 2JC0A 2R2TA 4XDDA 4DL7A 1RT3B 1S72S 2ZZMA 2RVJA 5JMNA 4F4YA 1IKVA 3NGKA 4O3OA 4JI3F 2CJBA 3VGTA 2ZOMA 2OUGA 5C24B 2IC3B 2MKCA 3HVRA 1YX2A 4OZLA 2WONB 1HPZA 1C1CB 2XMUA 4CT8A 1S97A 1JLGA 2DCUB 2W9CB 1S7IA 1LWFB 2DNKA 4WKRA 1FA0A 4ZPWR 4OZ0A 5DQHA 2UUBJ 1TELA 3M8QA 4CQ1A 3B78A 3MCOA 3LA0A 3ZNUA 1NAQA 3QJJA 3ZZZA 4QW9A 2RQMA 2ZNYA 2IA0A 2E5HA 5B0AA 4ZVUB 4KHRA 2IMWP 2F40A 3JAMU 3TZWA 1G2EA 1BLUA 2J0SD 4OX8A 1ZETA 2OI2A 4QWBA 4YP3A 4J91A 3CDUA 2EG2A 3LH2S 2KM8B 4O3RA 2OPRA 5HK4A 4OJHA 3T1HF 1S59A 4EMDA 3CCSS 3I4PA 1SC6A 2D9OA 2XMVA 1W2IA 1RT4B 4ILLA 2LMIA 1PAEX 2XSFA 4PG7A 4IH6A 4ZJLA 3G4SS 3M8PB 1NNDA 4I2QA 3GCWP 1N36F 3PG9A 4MTPA 3BKFA 5L39A 2CAJA 1R8BA 4RW4A 1RK8A 1VQYA 1S0VA 1LW2B 3PKMA 1YRXA 1K1QA 4HTIA 4ZDNA 2GMJA 3H59A 5L1LA 2ACMA 2LECA 4DDFA 2CNKB 4IO1A 4J9LA 5J2NA 5KG3A 4DZ6A 3R6GB 5SZTA 3UDLA 2C2DA 3HVWA 2YNHB 4BLGA 2CG4A 4CT9A 1S4EA 3VR1A 2P5VA 1A0OB 1U2FA 4G65A 4X4QA 5E41A 2DRBA 3DRSB 5HROB 4MKAA 4NLOA 1K44A 1HBOB 1H98A 1AFIA 1N33J 1S4FA 1B4SA 1L3KA 4JI2F 1RBAA 3D68A 3R1LA 3KHLA 2DNQA 1OYEA 4ES3A 1JLQA 4PABA 1SL2A 4MIWA 4F3MA 1QVFR 4DR2F 1A9NB 3GE9A 4NZ6A 1I1GA 3IGNA 3VGUA 1B0PA 4X66J 3K5LA 3RU0A 1UZHA 1QAXA 3JSBA 2NXJA 5B0GA 1T02A 1TQLA 5B0FA 2HHUA 1V3SA 3UWTA 2XEXA 3ICLA 1TKZA 4U95A 1KLNA 1PO6A 3FRZA 3HVTB 2GC8A 4YY3F 1EJ7L 4M5LA 4NCGA 3TA0A 3BR9A 2Q6CA 3PCOB 1U49A 3I9ZA 4N5SA 1NSPA 2UXCJ 4QR0A 1U6ZA 1TL1A 2ZH7A 4UOFA 5JJBA 3DRPA 4UOCA 4QIGA 3IMQJ 4A8YA 2MKIA 2HZCA 4PAAA 2BQUA 3P3DA 2LA4A 3ETMA 1M5HA 1HBMB 1S76D 4L3NA 3MMAB 3HFKA 5T14A 2B4UA 3LF0A 1WF0A 3I0RB 4CO2A 3I5BA 2JDJA 2A1BA 1DZ5A 3HVAA 1PJ6A 5A0YB 2ILZA 5LXRA 5GMDA 3V6KA 1RYSA 1S0MA 1Q53A 2EBGA 2GIRA 1IM6A 2LDIA 2R9LA 1XNQF 1K0TA 5A2QY 1EQMA 1FRHA 2MDAA 2DH8A 3IA0A 1S1VA 1X4DA 1F1BB 3TVZA 1VS3A 4DPUA 3LP1A 2CPDA 3MURP 1UWBA 5KG4A 4ID8A 1EIYB 1BQMA 2YKNA 1KFDA 1PKUA 2OKQA 3PY8A 5IZHA 4EI2A 3AJ1A 4CLSA 2I2YA 2CJKA 5A6WA 4NLXA 3PR4A 2CFXA 2QFIA 2QJ3A 3G9CA 2GVZB 4MH8A 3BJYA 4LF8J 2L48A 2OPQB 4NLDA 1I6JA 4W4MA 4ZIVA 3A8KA 2FVSA 2P2CB 1RT6B 4K7QA 4F3QA 1LFPA 4EO8A 4WIQA 3KJVA 4AUKA 1JB0C 2XWYA 4IG0B 4UZBA 4CLZA 1GK8A 1F6TA 2XZTB 1U1KA 1XMQJ 4IG3A 1NRKA 4LSLA 2YKMA 3N6NA 4DX8H 5LMUJ 3ZZ0A 3MM8B 1HQEA 1TUWA 5ETOA 3ZTPA 4IO9Q 3ZC4A 4R5PB 2IY5B 1VQPS 4LF6F 5KFGA 3CW2C 2GX8A 4DV5F 3KK1B 1RTDB 1R3NA 3BM7A 4YB1P 2R7XA 4ZP7A 3MCSA 4H54A 2Z58B 4OHYA 1FT8A 3LOUA 2G2ZA 4USTA 4RR5A 4QU7A 2XGPA 4LUBA 2FY1A 2XY6A 4FYXB 4HACA 3J80Y 3WBZA 4KE5A 1IBKF 3CJ0A 1U26A 2RQKA 5KG0A 2FHJA 3UNGC 3M30B 1VRTA 4USWA 5KT2A 3C16B 2AIRB 2EFQA 2CPHA 4NMLA 3ENAA 5ETKA 3HCXA 2IM1A 3UCGA 4DR1F 1WEXA 4K50A 4U7CA 3KMSA 1Y11A 3VAFA 3CJRA 3U1NA 1ZA2B 2RF2B 3R2CJ 4ZP9A 1KD1T 2ZH9A 1UPMB 2GVDA 3IR5B 4N7TA 1HKAA 4ED4A 4JV1A 3W1YC 3MGJA 1XN9A 1SV5B 4F7VA 4LIRA 4GC7A 3FBCA 3I4HX 3GONA 1GQEA 3H98A 2JLFA 3MMCA 1CULA 4IFYB 2YKAA 2V34A 1JLBB 1PJ7A 5J2QB 3BGRA 3KTQA 1JLFB 4KGMA 1W7WA 4LBPA 2GAGC 3P96A 3U7JA 2ATLA 2NSBA 2VV5A 4A8OA 4X84A 3GV8B 2DEIA 2B4VA 4M5NA 2CPEA 3UD5A 3UQSA 4ZN3A 1YJVA 2J0WA 3CDWA 3BN7A 4R0EA 4C0BA 3H42A 3UNYA 3DRYA 3NBPA 5IC6B 3CNQP 4XPCA 1BQNA 4MK9A 4F3OA 1ZPWX 4IFVA 2GO8A 4YDXA 2RIJA 1X7VA 4A8XA 2N82B 1O8BA 3TJAA 4ALZA 4ANDA 4FF2A 3HK2A 4IUFA 3CJ4A 4DUZF 4GKJF 2XMTA 4EZ9A 2M4MA 1AW0A 2RD5C 1C1BA 3LO3A 1H72C 2QN6B 2JEJA 1Z2LA 3M32A 3Q8RB 2Z2ZA 3D7SB 2GO9A 2V8PA 3J81j 1L3VA 2HW3A 4ZPBA 1KTVA 1Y5IB 3IWNC 4MFBB 4ZCMA 2WVFA 3U1LA 2BR0A 4FF1A 4Y0FA 2QRRA 4O4GA 2UU9J 1DFDA 2B4PA 3M1VB 5HO4A 3TR5A 3RAQA 2DGVA 4URGA 2UZAA 2HS4A 2MHNA 2BJ1A 4HDHA 4WKYA 1FCAA 4CLYA 4OJ3A 1CSJA 3H2LA 3SZ2A 5I3UB 3K5PA 3N01A 2IRUA 1AB8A 3DOKA 3V6HA 2UVVA 4YHHF 3VV2B 3SFUA 8RUCA 3ZZUA 1FVSA 3DLJA 4M1KA 5AXKA 4FYVB 3H7HB 1N6QA 4KKOA 2VG6A 3CF5Q 1J5OA 1RU2A 1DRZA 4LIWA 4O0NA 4DV6F 2DR6A 1F0XA 2V2ZA 3HHEA 5D6GA 4C9DA 1EKRA 2V67A 1LWCA 1JNRB 4KRWA 2BKOA 3SDEA 1XK8A 2M2BA 2DB1A 1UEVA 3C19A 5ETSA 4ZITA 5AXLA 3A12A 3TOQA 3NCPA 3TX0A 1FKPA 6FDRA 4ECYA 1S1WA 3A8JA 2MB0B 3D1OA 2QX0A 3R9LA 4M5DB 4K0KF 2XS7A 4CYUB 4X4PA 5HMXA 2BBEA 2W8KA 2NUUG 1RT2B 1RACB 3THTA 4DEZA 2BQRA 1F2HA 5KOWA 3LPEA 4WF9Q 5H9EJ 2EI5A 2V50A 1NK4A 4ZVRB 4L75A 2VQFJ 3G8SA 4ENOA 3IS9A 1FE4A 1GNKA 2IM0A 3EXYA 2Y8WA 1RSCA 4NA2A 3R5JB 1AFJA 1IKVB 4IOBA 3C15B 3C6UA 2RHQB 4PXDA 3C2PA 2MQMA 2Q79A 3DKDA 3GPAA 4KV8A 3NGDA 3EPIA 3BGFA 1VCTA 1PBUA 5K8OA 4YQWA 1PJ5A 3DCAA 4I6YA 1HPZB 5KFWA 1YK9A 4ED0A 1S6QA 4FPRA 5E3QA 4EZ6A 2MZJA 4KQZA 2ZM6F 2V2QA 3M8QB 4ILMA 4O3SA 5MAOA 4JB8B 4R25A 2DNGA 3EGVA 4MT1A 5CCMA 1NMEB 1AA1B 3KXDA 4AD6A 1B99A 1RAAB 2ZH5A 5K8NA 3B54A 3MR6A 2AYEA 4J9NA 5HBMB 4LFCF 4MYUA 2HMIA 2HVZA 2OPRB 3ZTQA 4AFFA 4RPFA 2NPFA 1TL5A 4RWWA 3CCZA 3TEGA 1PAUB 2E1AA 3N6MA 1QLNA 3VQSA 4JV5J 1Q8BA 3BPDA 1J5EF 3I5CA 1Z1ZA 4OV6A 2B9EA 2W1BA 2VG7A 3VWSA 3IAS9 1YBTA 3RYLA 3I0SA 4I2QB 4TQSA 2NCKL 3CD6S 3QO9A 3I87A 2C2KB 4B3MJ 4P7VA 5H1SV 1N8RT 5HMYA 4PPDA 1SC1B 2GIQA 1MNEA 1FRJA 5EWFA 1IWAA 1WTFA 1OO0B 4J90A 4GRSA 1OY6A 3S1TA 2J9DA 5KG5A 2FZCB 2X1GA 4RX6A 4OX9F 2ZOGA 5J1EA 1N32F 2D3UA 5J2NB 3SSSA 4HT5A 3BPSP 3R1HA 4ID5A 4NLPA 4HT7A 1T9XA 1F3VA 2KVIA 4C8YA 4WP3A 1C4CA 1NK5A 4CO0A 4EU0A 2QLJB 2NR0A 3PV8A 1IKWB 2KT3A 2LVWA 4CLWA 2AJ4A 3GCXP 2QLWA 3GP9A 2N7CA 4NXNJ 3HULA 5K14A 3RB3A 1B64A 2OEMA 2KL8A 3QIDA 2PT0A 2PFDA 4V19X 3WX4A 3L7PA 4DSLA 4Y00A 5D78A 2IDLA 3B6BA 5H9FJ 2BANA 3H5UA 4C97A 3AT1B 2B9YA 4B3TF 4U8VA 4P52A 2LU2A 1D9AA 2CKWA 3BGUA 4BCAA 1UA1A 1IQZA 3CC7S 2W4PA 2WK4A 2ZDPA 4A8SA 3EM1A 4I4BA 5D8HB 4R8UA 3RW7A 4H4OA 5F8JA 2HHTA 3TVYA 4LSNA 1TKZB 5FLXY 3W65A 3HXMA 3B4DA 3KG1A 4DR4F 1SJ4P 4NCGB 3F41A 3VZHA 1DBDA 4X4OA 1HWUA 5KFFA 2WSEC 4B3RJ 3BH6B 1NJIT 2KYXA 2F7VA 4ZPDA 1NEEA 1TL1B 4K4VA 2MHEA 3DRPB 4DU7A 5GAGI 2Q43A 4FVMA 4CLFA 1SKUB 3MOJB 1KTQA 1SVDA 4B9NA 4PG5A 4DSIA 2W01A 4RW6A 3ET6A 1Y5NB 3AB2B 1FDNA 3UI3A 2KDOA 4LF9F 1GMWD 2I9SA 4TN2A 2J9EA 3K7RA 4JI8J 4QU6A 3MPUB 2QO3A 3TJ8A 1YJRA 2GCFA 2YNIB 3NNAA 4A47A 2OH2A 1RT1A 5BJRA 3KK3A 1X0PA 4ZMMA 4UQGA 2E29A 4RW7A 1S1VB 2GQ2A 3LP1B 3SSRA 5J2PA 5K8PA 1JK9B 3WIVA 1AT1B 2MYFA 1UWBB 3GJQB 2FLNA 1E6YB 1EARA 3UO0A 4ZKAA 2QL9B 2ZH1A 1UW4A 3CD7A 3TNVA 5AXMA 1CLFA 2B7CB 4OZNA 3TJ9A 2YKNB 4UZCA 3CJ3A 1TAQA 2IM3A 4LFAF 2AP6A 1BUXA 2L9DA 5THWA 1FXDA 5IOLA 1X4AA 4I67A 4OJGA 5JUMA 3M4XA 1WC5A 3MM5A 2KRRA 1HNWF 3M6WA 4F67A 2JJ4D 2HRYA 5SUHA 3E3XA 1RE1B 4ETXA 4C4WA 2H4WB 2E66A 3OL7A 1NKCA 3VZIA 2GQQA 3KJVB 1V5IB 2DRDA 3ZXWA 1WJ9A 2J76E 2ZH3A 4DQRA 2MZRA 5AE2A 4V19J 3M2VA 4LSLB 3E01B 2PA8D 5C42B 2GV1A 1B0VA 1HQEB 2JH3A 4KPYA 1BC6A 5K9FA 3HHLC 3HSGA 1AXQA 4DFPA 2OGUA 3EZOA 4DR3F 1X9SA 3K8WA 1HFEL 3H90A 4MIBA 5HJYA 1IBLJ 1KC8T 4YFUA 4LR7A 3R5BA 4TVAB 2PDAA 3DMJA 1K47A 1WOPA 5E5NA 4KB7A 5BYSA 1RLCL 1WORA 1X5PA 2YQ3A 3OHAA 2E1PA 3K0JA 4ATNA 2J6TA 3QNWB 2OSRA 5KFEA 2F4VJ 4HACB 2Y0SD 1I3OB 2BW2A 3HHKA 4TU9A 3CDAA 2EWHA 1RTJA 2YWWA 1VRTB 5EHHA 4Y2MA 1HARA 4OI1A 1IJFB 1FRMA 4BDPA 4H4KA 4K4YA 4QYZJ 2KU7A 5C5JA 3MUMP 1NZ8A 1X5OA 3R97A 2DBBA 2IJFA 4J37A 1Z2ZA 2W7PA 2X1FA 4ZPCA 3J81Y 1YTYA 1VC0A 2OEJA 2J6SA 5L9XA 2F8EX 3UFCX 3NEKA 5U47A 3NGUA 3MEEA 3RBDA 4JOUA 5KFAA 3EUNA 2EC0A 1U25A 2G9OA 2DXEA 4ZLPA 2Z0GA 2GVDB 4RBUA 1F9FA 1CJVA 1HNXJ 2DR7A 1H73A 3TAMA 3DGPA 5F9LA 2YTCA 4I7FB 4JI4J 3W61A 3QT5A 1RWUA 1JMTA 4GC6A 4N41A 2FB0A 1RAFB 2HVHA 4QYRA 1WSRA 2GJFA 2XWXA 1M5OC 2HHHJ 1Q81T 1DTTA 3MMCB 5D3GB 3Q22A 1XMQF 1C4AA 4DOZA 3RZAA 2MKSA 3DLEA 3BGRB 2BE9B 2O67A 2EFOA 3BR8A 2J9CA 2CJQA 1OPIA 1RQ0A 2W7OA 3MXHP 1BE4A 2HNZA 3FDSA 4FBUA 3J7ZT 2PGCA 4USMA 2FGOA 4RW8A 4KSEB 2HHSA 2MJNA 1H74A 5B0CA 4TU7A 2ROPA 2L41A 2R42A 1H2TZ 3NBPB 4B9TA 1BQNB 2DR8A 4IFVB 4UF4A 3QJPA 5L38A 4W98A 2HVIA 4LR8A 5F8MA 2Z30B 2YWHA 2D3ZA 4DPTA 2XI2A 4ZVSB 4EWTA 3IWLA 3MCMA 3Q8YA 1NPKA 1C0UB 4I6AA 1CC7A 1LQ9A 1Z4UA 3M32B 4DS5A 1HHTP 1JIHA 2M0GB 3RTVA 4J9RA 4KYZA 3AD9C 1U6FA 2DY1A 1S9GA 2BYCA 2NS1B 3WHIA 2P8IA 2OPSB 3KLVA 2Q66A 2YQ0A 2YX7A 1GMUA 5IT0A 1QE1B 1RLDA 1MROA 1T9TA 2GNKA 2W2NP 4O4GB 1VQLS 1FHTA 4RO0A 2DGWA 5LSOA 5L46A 2RS8A 4RUBA 3EPGA 1NUEA 2B51A 3PFEA 1G7CB 4JI3J 1WOSA 3D3CJ 3PTWA 1KOHA 2XS2A 1H0HB 3DOKB 2DGXA 1HBNB 4PQAA 4NI2A 2CRLA 3GFHA 2R2RA 1U47A 2GHVC 1FTCA 3QGPA 3P5TL 3CB4A 1N6QB 4KKOB 2HHQA 3RBXA 2VG6B 4DQPA 1PC4A 2ASLA 1PSDA 2B3TB 2JVOA 4OYAA 1XQIA 2VB6A 4LJMA 1Q95G 4TY8B 2DJWA 2M8DB 4DN0A 3MZIA 5B08A 2N7YA 1LWCB 4Q2MA 2XBPA 3FQLA 3I32A 2WVBA 4O23A 2POKA 2QA2A 3SDEB 1WEYA 2AF6A 3NMAA 1QM9A 2Z57B 2O3DA 4F26A 1FI4A 3O6QA 2GFFA 4RW9A 4DG1A 4TXSA 3FJ2A 1ACMB 3N0VA 4DBQA 1KR4A 3C66A 5D0HA 1S1WB 4FYWB 2DGOA 3T1HJ 2HYIB 2CWKA 2ZBPA 4H4MA 1RZMA 3MMJA 2ZH2A 4ZLJA 2CPZA 2NXCA 2A18A 4NWBA 1CVJA 4MKBA 3CO9A 4PXBA 1ZYQA 4F02A 2RU3A 4MK7A 4C3KA 3CC2S 1N36J 5DG8A 1VHIA 1N52B 2YWGA 5DDQC 3GU0A 2NYIA 1KWMA 4C8MA 5I3QA 2WBMA 3IRWP 3IS9B 2Q6BA 3T1AA 2ILYA 5HN0A 4NLSA 1S0NA 5I4MA 5CYMB 1WWHA 2V94A 1NB7A 2RRAA 1S1UA 2DHHA 5B0BA 3NMRA 1EP4A 3N5BA 3UR3C 1U45A 4FZVA 1UEKA 4B9VA 1FJEB 1HR0F 1TU0B 4ED8A 2IC3A 2V8DA 3FNNA 4ERDA 2W24A 2XTJP 2BJEA 3KMQA 4UY85 1FFGB 4YR0A 2VDIA 2DNLA 1S6QB 2GHPA 4C8OA 5HVFA 3LWMA 3G82A 1UMJA 1KQSR 4YN3B 1YKWA 1VBKA 4DV2F 4KC5A 4ZVOB 4JI5F 4DPYA 5KFCA 2EFNA 3G2XA 4DPOA 1SIZA 1TKDA 3HJVA 2ADCA 3D6TB 4Y3CA 3D1QA 5E33A 3OL6A 3KLHB 2C1EB 4M5GA 3RRKA 2Y0BB 4LFBF 5KT3A 4DUYF 2K2PA 4DV3F 5CHCB 3FSIA 4XPEA 2XM3A 4JI2J 2RSQA 1EETA 1KDNA 1OY8A 1X4FA 2HMIB 3FCHA 1VQ5S 4WK1A 2Y1JA 4DR2J 1TVRA 2YBVA 4KH1B 2EK1A 4ECTA 5B7WA 5D0GA 2JEGA 3UD3P 3GIRA 1JXVA 2NXNA 4HVZA 1RT4A 2VG7B 1LK7A 3AAWB 3F56A 3I0SB 1YSJA 4M5JA 2RDIA 1YRTA 4URQU 3CCLS 3OTCA 1U1NA 1K0VA 4YY3J 4QBUA 3W9JA 1QTMA 1VQ4S 1A6LA 1URNA 5ETTA 3HO1A 3ZTOA 2HFOA 4LRDA 1ZS6A 3VAJA 5IS2A 4UOHA 5A6PA 2MY7A 1FVQA 3A13A 5J1EB 4WFYA 3H5XA 3DDNA 2D3OR 3GR0A 1GXTA 2VONA 4ITSA 2HFVA 1IVZA 2YNHA 2E9TA 4NZ0A 3KLGA 5DM6Q 4LQ9A 2MLYA 1UVKA 3FEYB 4ZK7M 5CZVA 4HYKA 2AYBA 2FD2A 2MLXA 2RT3A 1XNQJ 4RBTA 2B7BB 3KLIB 3AODA 4WK3A 5K14B 3DRSA 4HHUA 2XLJA 4DSKA 3ILIA 4F25A 4Q0BA 2IRYA 4KT0C 4TYBA 1IBCB 1WF1A 5EX0A 1JJHA 3RBZA 1T11A 2CG8A 2BANB 4OL8A 2ZUAA 4ER8A 2VF3A 4LRAA 3OFGA 3VAIA 2GMLA 2OAUA 4QPTA 4HI2A 1RTIA 3HD1A 4CLKA 3ZZRA 3R8YA 4QWEA 4FKYA 1JQGA 3WC2A 2BE2B 1A7GE 1MG7A 4X4TA 2R7RA 1MN9A 4WIIA 1QY7A 2PSZA 2HS3A 1YI2S 3PX0A 2J8SA 4HI1A 4R8UB 1Q5YA 4H4OB 3AQPA 2H4YB 4N47A 3V6JA 2DO4A 5DQGA 2V9KA 1RAOA 2DKOB 2VIHA 1SC3B 4P2FA 2DGTA 2RU9A 1LXNA 4PKDB 5KFZA 4P74A 2QG9B 3MR5A 2DHGA 3SI8A 4LF6J 1UKUA 4NRTA 4K5SA 4DV5J 3PR5B 3QSYB 3IGVA 3NWGA 2UV8A 1GEHA 3R5DA 2VDHA 3ET6B 4ZVFA 3QMQA 3MR7A 2GZOA 2WTFA 2HAFA 5KFHA 3I0RA 1R27B 1TK8A 1MWYA 2OPPA 1S1TB 1SL0A 3S7RA 1L3UA 4AQYF 3CJ5A 3MPYA 1JLCA 3NY0A 3OFFA 3O2IA 2PMHA 2R7SA 3DU6A 1RT1B 3KJQB 3KK3B 2IRXA 4FS1A 3RB6A 2AV5A 1XMOF 4NXNF 2C2EA 4RW7B 5E3AA 3QYYA 4U9RA 4Y28C 1SIWB 4DR1J 3IFEA 4MJKA 2E7WA 4WYLA 4ZOSA 3CCMS 2V9WA 1UVIA 2H48B 5J2PB 2E5GA 3M6XA 2F65A 3HFVA 1TAUA 2JOQA 4PG8A 3N5FA 3ZZPA 1QDUB 3S6EA 5GAEU 1ZPVA 3BBFA 2CJAA 1CBKA 1HMVA 4Z2XA 5JVHQ 3EZ5A 2XULA 5KAKA 3PIPQ 3P4UB 4X4RA 1SH2A 2HHXA 1DQ9A 1WC4A 1H2VZ 3UR0A 1FRIA 1H2UX 2MQQA 3L7UA 3T5HA 3D0GE 3HT3A 4FXVA 4WWSA 4XK8C 3KDNA 5GMEA 1Q0NA 3LP0A 2FC9A 1VQ6S 3T6JA 3EGZA 4J9MA 2MSSA 2KJWA 1NK9A 1HBUB 3UN3A 2GMHA 2QMWA 1UVMA 5A8WB 1FNXH 2HG4A 2FVCA 1HW8A 3CXCR 4PYAA 2D9PA 4A8KA 1Q7LB 3M2VB 5E7OB 4AYBD 1RJJA 3UCUP 3LP2A 1Q79A 1U09A 1SCJB 2I1RA 4R5PA 1F2GA 2A3JA 4A8WA 3R2DJ 4X4VA 1MW7A 3O1LA 5H9FK 2VBWA 2DIVA 1RTDA 4DSEA 3QZ7A 3DDKA 3P5BP 3WC0A 4RNHA 5DS7A 3DMJB 1MN7A 4DV0J 1NH7A 2VKRA 2A10A 3VVTA 1TL3A 1S1XA 3HPOA 3V6DA 2UV8G 1V3RA 1M90T 1HNZF 1RWMB 3M6VA 3THPA 5DG9A 2QEXS 3W5YA 2ACYA 1RTJB 3ADAC 4DUZJ 4GKJJ 4Q5VA 2XS5A 1WG1A 2CIMA 2KHDA 1PC5A 4DWIA 2BE7D 2ZBIA 1DURA 2CZ4A 3UDVA 2VBXA 3K5OA 2EBEA 4K59A 4ETZA 2W2MP 3MEEB 2HNDA 2G1HA 1LWEA 3BB5A 4P2XA 2RF2A 4EEYA 1WHYA 4PZVA 1CJVB 1HL6A 1N0VC 3TAMB 3CCTA 1WHVA 3DGPB 1OJ4A 4WFXA 1NK0A 1FNOA 4YHHJ 1D09B 3GSDA 2F4FA 1DY3A 2GAHC 1DTTB 2KZMA 1S9EB 3POTB 5IQ6A 4DV6J 1VLOA 7AT1B 3DLEB 1OWXA 2CJXB 3VTIA 2DH9A 4NYOA 1ZOTA 3SSQA 1F60B 2CPXA 5J1PA 4OHXA 2HNZB 4Z7YA 4Q8EA 4RW8B 2IBOA 1OS5A 1U0SA 3P45B 1N5TA 1YJTA 3TZZA 4KTQA 5DG7A 3PO5A 5HAOA 2UVUA 4UOGA 3JQJA 2F4VF 3LAMA 5L9NA 5DLFA 3E2EA 4ZS6A 1UVLA 3JTNA 2FLPA 4K0KJ 1NJWA 2BJ9A 3X1LB 1TKXA 3TO8A 5BXIA 2A6MA 1TFWA 1PYTA 2FVRA 2FJXA 3TRGA 5IWAJ 4DL4A 4U6PA 1Q1KA 4DN9A 1LXJA 2M9KA 2VFUA 4UTGA 3NNCA 1CS4A 1S9GB 2HNYA 4MFBA 1MROB 4LRCA 1JJ2R 4ZP8A 1W25A 2KZZA 1S6PA 3QQCD 1H7XA 4EYHB 4PXEA 2WRMA 2FLLA 4RL1A 5I3UA 2IM2A 4OQJA 1M1HA 2DNMA 2DK2A 2IAJA 3MM6A 3CUNA 2M3DA 1GXUA 4NI2B 1L5UA 2R7VA 1WKLA 2NZ4A 1VJQA 5I3PA 3UDCA 3BO3A 4DFMA 2KFNA 2ZM6J 4FN5A 1WDDA 4QYZK 5L8RC 1Y10A 2AJ1A 2W2OP 3GR1A 3DRXA 1GTHA 3AA9A 1FXRA 2VHGA 6AT1B 1VHFA 1U6BA 1OYDA 1KRPA 4RWXA 2HZAA 1NJYA 3OXLA 2YQ1A 6FD1A 2AGQA 3GV7B 5LJ3Y 4DXLA 1FNMA 4IDKA 1RGVA 4RW9B 2H1YA 4DG1B 3GJTB 4C8LA 1NB2A 3CJ2A 1YVFA 1DJ0A 2A2CA 5M2RA 3BSCA 4IYQA 4C48A 2M70A 4LFCJ 4X4UA 2HQCA 2Z8QA 2ZC3A 4LRFA 2OP5A 2E5LF 4FPIA 1KONA 2WSCC 2DIUA 4D3HA 4C98A 1J5EJ 1H7WA 3B4MA 3FEXB 1CJTA 2CPFA 4OHVA 2FJEB 3BSNA 2VODA 1RA6A 3FEZA 2R7QA 2HQGA 4NLTA 3BDPA 3NRBA 1X5SA 1VQSA 1IN0A 2M88A 5CAAA 1V5VA 4ED6A 4DL6A 3VHQA 4PCQA 2APOA 3HKWA 1SPBP 1SUQA 4N77A 4O3PA 3C15A 2DNHA 4QPXA 1S1UB 2EW9A 4OX9J 1N32J 1IJEB 2LKZA 4L73A 4Q43A 1EP4B 3GJRB 1N4LA 3SCIE 3RR7A 4NXMF 4ECSA 3HDSA 4DCJB 3LWLA 5ETMA 4M8LA 3G82B 1CEZA 3IWXA 4CLPA 4LBHA 5A8KA 1SJRA 3J7Z5 1T3OA 1VR6A 5D15A 1SBRA 3IP0A 4ES1A 5IV4A 5EUHA 4U7UK 1YJ9S 3QT8A 4Y2CA 3CIZA 4QWAA 2W7AA 4DFJA 1KKHA 1T9WA 1RWWB 3MEGA 3HLUA 4YEAA 2CQ2A 1EETB 2YWFA 2XMAA 3FZ2A 4B3TJ 5HBMA 2B5JB 4DX7A 2FY8A 2IYGA 3H0PA 2BMBA 2FQQB 1TVRB 5LSLA 3IG1A 2CDRB 3NGTA 5HI7A 4KIAA 2JLGA 5HL7Q 4S0MA 1FK9A 2E9ZA 4K4SA 3LAKA 4Q45A 3K58A 3CCUS 1VC6A 2DXDA 4WCEQ 4B9MA 1U8SA 1XR7A 3PRBA 3OR2A 3NP5A 4ZVTB 4NE9C 3ELHA 4DR4J 2FHOB 3KUEA 4OZ2A 3KK2A 5F8GA 4M5IA 2W9AA 5F8NA 1L3SA 2ZKTA 3T3FA 3ZFVA 4DV7F 4AXIA 3H5SA 1UVNA 2NPIA 1VYAA 3TZYA 1N5SA 2AJQA 4QJVA 2CNOB 3TUIC 3M05A 4LF9J 4MIAA 2HFZA 3I31A 3KLGB 3BDEA 4IKAA 3IRXA 1VK8A 2EXUA 2XC9A 3M8SA 1IKWA 3QPIA 1R0AA 1S77D 5KFBA 3ZZTA 2HHWA 3PHTA 5F9NA 2YNFB 2MZSA 3AD8C 4DL0C 5KFPA 2CVEA 2R3VA 2OD6A 4MMOA 1R31A 1TMMA 4ED1A 2VPXB 2LQ5A 2MZ1A 5LM7E 1SB6A 1XTZA 4Q0BB 1LW0A 1MLAA 1FRLA 4RU2A 7FDRA 2XHWA 1YIJS 1YRUA 1YQHA 1U1PA 2KKHA 3H2UB 2QYGA 5CYQA 5BR8J 5FLXU 4DCPB 3C14A 4LFAJ 3M8RA 1W26A 1I51B 4ANEA 3MI7X 3M8ZA 3M6UA 2NQPA 4Q8FA 2VUGA 1QSYA 2V2VA 2NXUA 1RTIB 2DITA 2E7XA 4G6VB 3EVMA 2QMXA 4DLEA 1IKYA 1HNWJ 2HBZB 2EC2A 5F41A 3Q8QB 2CQDA 5IT4A 3TA2A 1R6VA 3BQ0A 4P6QA 2PEHA 1ZM2A 4Y2KA 5AJ3J 3T1YF 5B0EA 1ZA1B 2RILA 3M9MB 1UAWA 2FHKA 3L09A 2XCAA 2QE5A 4UUXA 2QLFB 2JX2A 2RB7A 4G1QA 5LMNF 4ELUA 1MWQA 3THVA 4ED2A 2BVZA 1WOOA 2XYGB 1NKEA 4DR3J 2LDYA 1WI8A 1PG5B 5HSPA 1WC6A 1RYRA 1JJCB 2MPUA 2H5IB 3GFXA 3DXBA 2KYZA 2M52A 3D54A 4NEZA 1WNEA 3QWUA 1BWVA 3T5JA 4L76A 2ZEJA 3BKUA 1VJWA 4X64F 2HBYB 3NAHA 1VQNS 4JI0F 1EZZB 2OPPB 4XIUA 3GTYX 2YX4A 3HHLD 4ZN1A 1JLCB 2X1AA 5DETA 5KFOA 2YNIA 3H4BA 4F4AA 5ETRA 4OI6A 3W60A 1XEZA 3T6BA 4GVLA 4TYAA 2LCWA 1N56A 4DJBA 2KVQE 1RWVB 2BZ2A 1E6YA 3RBEA 1KHWA 4RNFA 4IR9A 1NK6A 2CWXA 4DQIA 2AHOB 2OFGX 4KAIA 3CCQS 1HMVB 3TUPA 5A8RA 2H65B 3SCJE 2VQEF 3T9ZA 3EVOA 2N4CA 2L3MA 3Q8SB 2HLUA 2KG0A 1OY9A 2NLWA 3UCZP 1KN6A 3QBCA 2CZ9A 3CCES 4RBVA 3PFOA 3KJFB 3BO4A 3GYXB 1X4BA 4JI6F 3G6VA 3Q89A 3LP0B 4J7CA 1AUSL 3W7BA 1RA7A 3D66A 4F0KA 3BO2A 3HSZA 2V8HA 2R8KA 2CQHA 4ZPVR 3E01A 3RAMA 5C42A 5B0DA 3FFIA 3LP2B 1IBMF 1AUDA 1O6XA 1M5KC 4DL3A 2B4OA 3J7YI 4Y2AA 4AXJA 3GMGA 1YZ7A 2HWIA 2FVQA 4NLVA 2WVEA 1FDAA 1WUUA 2UP1A 1T9VA 4J9UE 2MQNA 2XQCA 1TL3B 3J81U 1S1XB 2D69A 3V6DB 2WOMB 4P75A 1URRA 1Q78A 5ETLA 1HNVA 2H3EB 1UETA 1EAYC 2QLBB 4CH0S 3W64A 3AOAA 1JWWA 2LXFA 5CH7B 1NHVA 2ZH4A 1VQ8S 2AZ1A 3PM9A 3A3OB 4PRFA 2YWKA 2BABA 1RWXB 2PA3A 1ZZFA 3NL0A 3G87A 4OYOA 2OEKA 4B9UA 2QYCA 1BWEA 3TP2A 4DUTA 1N5YA 2NUHA 2DNYA 4OV1A 2HNDB 1LWEB 4QCLA 2UUWA 1NO8A 3PEJA 5HMWA 1XNRF 2O1PA 2YWEA 2H51B 3MR2A 2B9XA 2AZ3A 4UUWA 2BKPA 1HD0A 4A8MP 5KFSA 3MMBA 1G1XA 4Q2LA 1IQTA 2JFKA 4KHMA 4I7FA 1UCNA 3AFGA 1VQKS 4LF5F 1VIOA 5FD1A 2ZVSA 4P2MA 1U1RA 5GADI 2FJWA 2F63A 2Z2MA 4OX6A 2KFYA 3QWPA 4ZCIA 1KVIA 1NKBA 2BEFA 2MKKA 3GV5B 2AX0A 1NDCA 5HLFA 5D3GA 2RKIA 4HKQA 1AZSA 3OFEA 4UY8T 2Y1RI 5CA5A 2OSQA 3W62A 3HSJA 4GKKF 2DGQA 2WW4A 3Q2TC 2DGUA 4M5MA 4K4TA 1EHWA 3QT6A 2GQCA 5LXYA 2K3IA 3MPWA 1KNZA 3DI6B 3NXZA 3U1MA 1WD6A 4DV0F 3GZ7A 4DR7F 3OTOF 4P73A 1S6UA 1V6HA 5ETPA 2GGPA 1J27A 1K8AT 3C46A 2OMLA 4OI4A 3HD2A 1NJXA 5BYRA 3IM8A 1I94F 1TKXB 2MY8A 3UD4P 3MD1A 1RHQB 1Y4ZB 1FDDA 4ECVA 3GG0A 1RTHA 3L7OA 3QRRA 3GIJA 1WHXA 4DFKA 4LBIA 1C0UA 3JSMA 1X31C 4M95A 3ZTRA 1NDPA 3FBBA 3DDIA 1CS4B 2UUAJ 4ZP6A 3M2RA 3CIMA 4PWDA 2HNYB 2YY3A 2ZE2A 2AJFE 3I6PA 2OPSA 2ZNZA 3M9OB 1QE1A 4USIA 4L74A 4CLLA 5JXSA 3OTEA 1N5QA 4A4JA 2JLEA 3OUYA 1S6PB 2R4FA 2K06A 3AB4B 1KHVA 3D2WA 2JNJA 2AEJA 3CEDA 1VBYA 4ICLB 4JP8A 3PJ9A 4WXWA 2IAJB 2WCXA 3MM6B 1HR0J 1FTRA 3NGRA 1HBNA 3HKZD 3ZTSA 1U0HA 1ZTWA 1G6BA 3P49B 1VRQC 3MM7A 4ZHRA 5K8MA 3BF4A 5GAGU 2KT5A 4NA3A 4TY8A 4LR9A 2MJUA 4ZVPB 3QZ8A 4DV2J 1TP7A 1VBZA 4JI5J 2BOAA 4F04B 4JI7F 4NOHA 2CA9A 3ENQA 4K4UA 2MLZA 3MFIA 3BV8A 4OLPA 3OVSA 2MQ8A 3R6LB 1YGYA 4CH7A 3LALA 2DT9A 1RP5A 4IDKB 3HF5A 3ISND 3PHEA 4LFBJ 4DUYJ 4DV3J 3SQOP 2UUCF 4L3KA 3KFWX 5C2CA 2RS2A 3GLJA 2MXYA 2VFVA 3MEKA 1UJ4A 2AW0A 1REVB 2X3GA 1G3OA 5IWAF 4WXOA 1KP6A 2HIQA 1N54B 1CJTB 2J7UA 2RAQA 2DPIA 1BY9A 1WTBA 3HSDA 2HKEA 2CPYA 2ZD1A 2MZQA 2J5AA 1WHWA 4ILRA 2X3DA 3PW5A 1ROFA 3MFHA 2KFZA 4YOEA 1RHRB 2EFPA 3F0NA 4FVCA 5RUBA 3FBEA 1UFLA 2VASA 2O66A 1SUQB 2UVWA 3L9ZA 1X8DA 5E3PA 2MQLA 2J7KA 3DHWC 5CYMA 2CJYB 3VF0B 1RADB 1VMBA 3ENVA 1NDKA 4ZPTR 2R8IA 2CADA 2GW8A 4NYZA 1U7LA 2KN4A 1VRUA 3BKTA 3VVUA 4X4NA 1JKHA 3PO4A 4OYBA 4RZRA 1GFWB 4DV4J 4P71A 3A3NB 3GIMA 3SEOA 2I0XA 4RLEA 2DHXA 4Q7AA 3W2WA 5A8KB 4JV2A 1RHMB 2QA1A 2VKZG 2R8JA 1LFWA 3IM9A 1AROP 1PGZA 2V4JB 2FYXA 1WKJA 3DRRA 4DPWA 2XI3A 3KLHA 3HFZB 2HFUA 1VFJA 3MEGB 1W2BR 2B8PA 2PIIA 3IAM9 1Y7PA 1NK7A 4C0OC 5M2UA 2KH9A 3VAKA 5ETNA 2IA6A 2C2OB 3OL8A 4Q44A 3OPKA 1GX6A 2Z4PA 1OIAA 4GO7X 2VOOA 3ONQA 2ZVIA 2GJIA 2XYPB 5IV3A 4FP9A 5KFMA 3IG1B 3AOCA 1P6TA 1RABB 4JUZA 3OLBA 3HHDA 2AT1B 4DR6F 1FWKA 1FK9B 4QW8A 4BS2A 4NZ7A 3J7AN 2MSTA 4NCAA 4U8YA 2AEFA 5F8HA 3JSYA 4E0DA 2U2FA 5J2MB 3MOZA 3EGNA 3VAMA 1QJHA 3OR2B 3OR1A 3KWMA 2QC3A 1UZDA 3DYAA 3PX6A 3KK2B 5J1NA 1SJ3P 3JQMA 3UW1A 3QFWA 2MKYA 1KS2A 5CCLA 4WFBQ 2KM8C 2QTWA 3US5A 3T9NA 2JVRA 1T9YA 3AY0A 1FF2A 5LL6d 3AA8A 1F9HA 3KYLA 2CDQA 4A46A 1IM4A 4FF3A 3UN2A 4OHZA 4B02A 4CTAA 3IRXB 3FC9A 4LSZB 4C7QA 4I2PA 4AQYJ 2EVZA 3BS9A 4G1IA 1R0AB 1H6KX 3AXMA 4FYDA 2HURA 3KHRA 5KTQA 2P9EA 4DV1F 3KLIA 4QQBA 3EE3A 1XMOJ 4K2JA 2FC8A 4XDCA 2OHDA 2OMOA 1LW0B 2EKNA 2XNQA 2KT2A 2XY7A 3TAPA 2ZJPQ 1C0TA 3CULA 4KBIA 5EGYA 5CYQB 3QAEA 3C14B 2LQ8A 2HEKA 4K4WA 3DOMA 4R0JA 2HFNA 1D0EA 2JZ5A 3UPFA 2H54B 1RBOB 4KH0B 1Y9OA 4PG6A 2ROEA 3Q24A 3RB4A 2V63A 2BE2A 2NZCA 2RQCA 1YJWS 2VC1A 1RWPB 4NMXA 1IKYB 2QSFA 2HHPA 4G3IA 3GFYA 4I68A 4F4XA 3G6YA 5KT7A 2FHMA 2M7SA 3JXOA 4OIXA 3DLKA 4ES2A 1TK5A 2HK2A 2IDEA 2I6WA 1TKTA 1FJ7A 1VQMS 3FUYA 4OYMA 4N8OA 1APSA 1Y3JA 2XSJA 2IIHA 5ADZA 3FCWA 2IJNA 1RAIB 4ED7A 5HVHA 2N4DA 3DLGA 1WC1A 2E1RA 4OI2A 2DEJA 4G1QB 1FKOB 1HA1A 1VOMA 4YB5A 1MMLA 1O0PA 3MAQA 1T8EA 1D1UA 4EK2A 1BGXT 3W63A 4XO0A 3QGGA 2VA3A 2JWNA 1R8PA 2RQ4A 5AE3A 2XLIA 4USVA 4HDGA 2LQBA 2IBKA 1R43A 1S1TA 2OJ3A 1HNZJ 1UJ5A 3DXSX 1FX2A 1U4BA 2WAQD 4F0MA 2RUSA 5D77A 2FJVA 3NGSA 2AMCB 3D9BA 1IKXA 2PEBA 4J5OA 1RAGB 3M8YA 5EWEA 3EDRB 3KUGA 3CCRS 5T7LA 2ZHOA 2PE8A 2BX6A 5D4OA 3BBBA 2D41A 4QR1A 2CNLB 2C28A 5BR8F 2COLA 3MM9A 2ABYA 1ZAWA 4P9SA 4USJC 1QAIA 4WE1A 3RGIA 5A8RB 2DHSA 2ZBQA 1S6OA 3TW0A 1HNIA 1Y00A 2AKWB 4K5RA 2NYHA 3WX8A 1T03A 4JI1J 3E51A 5KFUA 2W8LA 4TU8A 2PO4A 1LKZA 2W2QP 2JRSA 5D0EA 1GAOA 5EN1A 1O51A 2G4BA 3G8TA 1VISA 4CWBA 1R8HA 2ROGA 4LF2A 4DCOB 3QLHA 1YG0A 3K5NA 1HBUA 3BYPA 1YITS 1P8GA 5A8WA 5AJ3F 1JNZB 4LMZA 2ZDOA 4DS4A 4LT6A 1HYSA 4N56A 2ZWOA 3BQ1A 2DHAA 5FDLA 3CC4S 2HLTA 2I5JB 5KFQA 1KSPA 2MZTA 3FFIB 3PRVA 3SMZA 2FHJD 4J9KA 3PYGA 3OW2R 2HBRB 2Q1LA 1TMJA 4HEA9 3ETOA 1KQGB 3G8QA 4ZJQA 1XIQA 4FNHA 3CCVS 2F9DA 4Z7CA 1MMDA 4E8UA 3UN5A 4FKXA 4LF4F 5KFNA 3QT7A 4X65F 1XR5A 2ZBCA 3OVAA 1CJUA 2VBYA 1HNVB 1DTQA 1X4CA 4LVNP 3NAIA 4QIFA 5DDRC 5MLCV 1M5PC 4ECRA 2CQ3A 2CQPA 2C42A 1N5VA 1IR0A 3DU5A 3BGLA 4RJVA 3V81A
chains in the Genus database with same CATH topology
1MROB 2PI5A 4AL6A 4URSA 4CO5A 3NGDA 2RMLA 2BV3A 1ZM3A 2WB4A 3EPIA 3BGFA 3U02A 1JJ2R 4ZP8A 3KLEB 2FJAB 1W25A 2SXLA 2KZZA 1S6PA 1H7XA 1BQXA 2YKQA 4YR3A 4EYHB 5K8OA 3NG8A 1Q7YT 4YQWA 2OTLS 1N5YB 2UVRA 3SV3A 3DCAA 4I6YA 3LGNA 4WZMA 4PXEA 2WRMA 1HPZB 3G86A 4WTYA 5KFWA 2FLLA 4K4ZA 5HROA 1X4EA 4ED0A 5I3UA 1S6QA 3Q23A 2IM2A 4IRDA 4FPRA 1U2RA 2FTRA 5E3QA 3H8YA 4EZ6A 3CVKA 2MZJA 4OQJA 3VAGA 4KQZA 2ZM6F 1M5SA 2DNMA 2O5DA 2XMWA 3HHLB 1GXLA 2DK2A 1OSCA 2IAJA 1UJ6A 3MM6A 3M8QB 3ZZYA 1HBOA 3CUNA 2M3DA 4OZJA 1GXUA 2E1MC 3PW7A 3H20A 1L5UA 2V5HG 4ILMA 1X9MA 4O3SA 5MAOA 3W3SA 1P9QC 2R7VA 1Y3KA 3WZ0A 2ZJRQ 2NZ4A 5I3PA 4ED3A 3UDCA 1F5BA 4R25A 2AYGA 4ELVA 4HL9A 2RUGA 3MMBB 4PR6A 3F73A 2WBRA 3BO3A 2DNGA 3MPVA 2XO7A 4DFMA 1QVGR 2KFNA 3CJKA 4FN5A 5D4NA 3OSNA 5L8RC 4FF4A 5CCMA 3G71S 2AJ1A 1D3WA 2G13A 2X1BA 3GR1A 3BSAA 3DRXA 4NL5A 1GTHA 3AA9A 2V8GA 1FXRA 1HWIA 1GT8A 2XMJA 1VHFA 2ZH5A 1U6BA 3NLCA 1KRPA 5K8NA 1RT5B 3BQ2A 2D7SA 4RWXA 4NPOA 2E5JA 3MR6A 4IQXA 1NJYA 4JV5F 2AYEA 4J9NA 1KOOA 3OXLA 4O44A 5HLFB 5HBMB 1S9EA 3POTA 6FD1A 4LFCF 4MYUA 7FD1A 2RKIB 2AGQA 3GV7B 2O01C 2HMIA 1WG5A 5LJ3Y 4B3SF 2HVZA 5KG1A 2OPRB 1FNMA 4IDKA 5CXTA 1RGVA 4RW9B 4DG1B 4AFFA 4C8LA 2NPFA 3PIOQ 1TL5A 4RWWA 3CCZA 3CJ2A 1OQ6A 1DJ0A 1YVFA 2A2CA 2CQ0A 5M2RA 2ZZNA 2E1AA 4LSNB 2C3PA 4B3MF 3BSCA 1QAJA 4IYQA 3N6MA 1QLNA 4NLUA 3VQSA 2F3JA 1U1QA 1Q8BA 3HVTA 2M70A 3IC1A 1Q8IA 4X4UA 2UXBF 3C6TB 2I5JA 1J5EF 3I5CA 2MKJA 1Z1ZA 4J9SA 5GAHU 4KR0B 4YDDB 2Z8QA 2VG7A 3VWSA 2G0CA 1S49A 3IAS9 1FKAF 2FUG9 3RYLA 3D1HA 3I0SA 2ZC3A 3OBIA 4I2QB 4TQSA 3CD6S 3QO9A 5KFXA 2OP5A 3I87A 3MHYA 1H38A 4P7VA 2E5LF 5DRKA 1KLMB 4B3OB 5H1SV 1KONA 3VALA 5HMYA 1N8RT 1Q82T 2WSCC 4PPDA 2CZVC 2DIUA 2HQ3A 2ADBA 2BJDA 4D3HA 4B9SA 5F8IA 2GIQA 4C98A 1MNEA 1J2VA 1FRJA 2KB2A 4P7TA 1KQKA 2GGPB 1H7WA 3B4MA 2R2SA 2WSFC 3FEXB 5EWFA 1HBMA 3M9NB 2DD8S 2ZITA 2B56A 2CPFA 4OHVA 1WTFA 1OO0B 2FJEB 1PILA 3Q2SC 4RW6B 3GIKA 3NNHA 3BSNA 1RDRA 3MMAA 3R3TA 1KEKA 3HM9A 2VODA 1RA6A 3FEZA 1VI7A 4OI3A 2R7QA 2WW8A 4NLTA 3S1TA 2J9DA 5KG5A 5DDPC 3BDPA 3NRBA 1X5SA 1VQSA 1IN0A 1RTHB 1UL3A 2X1GA 3H5YA 4RX6A 3RRHA 3GQCA 2M88A 3AH6A 3V4MA 2LXIA 4OX9F 2ZOGA 5J1EA 5A0YA 2D3UA 2DNZA 3CD5A 3HX9A 4HT5A 5J2NB 3SSSA 3R1HA 3LUYA 4RKUC 4ID5A 3JSMB 4ED6A 4DL6A 1D8ZA 4PCQA 2APOA 3HKWA 4NLPA 1SL1A 1JLAB 4HT7A 2RH3A 4O3QA 2KVIA 1SUQA 4N77A 4O3PA 1DARA 2JEIA 5KFYA 4C8YA 5KFKA 3L95X 3OTBA 2DNHA 1C4CA 3JTPA 3M2RB 3D28A 4QPXA 5G4DA 1S1UB 2ZE2B 4PWDB 1NK5A 2EW9A 4CO0A 1KQFB 1IJEB 1ZM9A 2LKZA 1DLOB 4EU0A 3E8OA 4Q43A 3N79A 5K5MA 2EFVA 2NR0A 2DISA 1EP4B 1N4LA 3PV8A 3SCIE 1IKWB 2VBZA 2KT3A 1VIXA 2LVWA 3RR7A 2K8GA 2CYYA 2WHOA 1HHSA 2AJ4A 1WEZA 4L6V3 1Q86T 1UVJA 2QLWA 4X4SA 3KLEA 4EO6A 4NXMF 3OUYB 5AXNA 1S7HA 1VQ7S 1FDBA 3C3LA 4ECSA 2N7CA 1N34F 3HDSA 3MECB 4EFAC 3IBWA 3LWLA 2F1FA 5KT4A 5K14A 3RB3A 2ZFHA 1B64A 1YJNS 1HQUA 3V2UC 2PD1A 3QIDA 3W2VA 1Q16B 1U24A 4ECWA 4M8LA 5M2PA 1M5VC 1CEZA 3IWXA 3HHLA 2ZH6A 5LSRA 3JYTB 2VFSA 2PT0A 3OTDA 2P6TA 4V19X 3WX4A 2BM0A 3L7PA 4DSLA 2QIFA 4Y00A 5D78A 5A8KA 5KG2A 2KXHA 1SJRA 1XWLA 3QIPA 2ALZA 1WG4A 3TX8A 2QV6A 5H9FJ 3J7Z5 3MM5B 1T3OA 2BANA 3MM7B 3H5UA 4C97A 3T5LA 4OJ1A 4ZHRB 1SBRA 4ES1A 5EUHA 4U7UK 1YJ9S 3RRGA 2B9YA 2OPQA 2VFRA 4B3TF 4Y2CA 2IYIA 3CIZA 2ASJA 4QWAA 2MKHA 2W7AA 3CGIA 1TV6A 3R5AA 4DFJA 4H4KC 1JX4A 3OJSA 5I42A 3K2YA 5E0OA 2QFJA 2C2RA 2VPWB 4Z37A 2VG5A 2LU2A 5AE1A 1D9AA 2CKWA 3DC2A 1RT6A 3MEGA 3HLUA 1YWXA 4IRKA 4YEAA 4DQQA 3BGUA 4BCAA 2CQ2A 3IR6B 1UA1A 4NRUA 5E2QA 1IQZA 1EETB 2YWFA 3EYZA 3IR7B 3CC7S 2W4PA 3FZBA 2WK4A 2ZDPA 1V9OA 2R7WA 3FZ2A 4IG0A 5HBMA 2B5JB 4A8SA 1DAXA 1MU2A 4FS2A 3MTKA 4OFZA 3OVBA 4I4BA 4JYAF 5D8HB 4R8UA 5D4PA 4U67Q 1GH8A 3MAHA 1XC9A 2DNRA 3O5TB 3RW7A 2ZOFA 2IYGA 4H4OA 5F8JA 2HHTA 1TVRB 5LSLA 4B3RF 3MM8A 4AL7A 1FERA 3IG1A 3TVYA 4Y65A 5KFLA 4LSNA 1TKZB 3FSYA 1TZ0A 2CPIA 5FLXY 5HI7A 4KIAA 3HXMA 3B4DA 2JLGA 5HL7Q 1FK9A 2E9ZA 1CG2A 3KG1A 2EG1A 3MWBA 4DR4F 1SJ4P 3KK1A 4NCGB 2CQ4A 3F41A 3VZHA 4OZ1A 3PVXA 4TLRA 1DBDA 2VA2A 4CI0B 2I38A 4X4OA 4K4SA 1HWUA 5KFFA 2MQOA 2WSEC 3J7A1 3LAKA 2WB1D 4Q45A 3K58A 1R8CA 5HMZA 1FXLA 4QOTA 3CCUS 1VC6A 1NJIT 4KHPF 2KYXA 2F7VA 4WCEQ 4ZPDA 5F0UA 1U8SA 4B9MA 1NEEA 3GYNA 4D3GA 1SJ1A 1TL1B 5DO2A 4K4VA 2MHEA 1XR7A 4PG4A 4B3OA 3DRPB 3PEHA 3PRBA 5GAGI 2Q43A 2JEFA 4FVMA 3OR2A 3NP5A 4HLBA 3EX7B 3MOJB 4QWCA 1KTQA 2FHOB 3KK2A 4OX7A 2BDPA 2QT7A 4Y34A 4B9NA 4PG5A 2N3OA 4JI8F 4DSIA 5L1IA 4PQUB 3TUZC 5F8GA 2W9AA 3R27A 1LV5A 4RW6A 4BC9A 4CCHA 1Y5NB 3AB2B 1FDNA 3OXFA 4CO3A 2ZD1B 5F8NA 3UI3A 2KDOA 1SH3A 4LF9F 4ZVGA 2V4QA 1L3SA 4PWUA 2V4RA 2HPUA 4N8NA 3WDOA 2UUAF 2K1RA 2ZKTA 4YUDA 4F4KA 2PI4A 4I0WA 3M30A 3T3FA 2JL9A 3ZFVA 2I9SA 2EK6A 4QIEA 4TN2A 2J9EA 4DV7F 4AXIA 2BQ3A 3H5SA 1UVNA 4DQSA 1XMBA 2NPIA 2KHCA 3K7RA 2ZJQQ 4QU6A 3SQGA 2QO3A 2K3KA 3CSKA 1N5SA 1UA0A 2NREA 3TARA 2AJQA 4QJVA 1X9WA 3TUIC 1YJRA 2GCFA 5GMKa 3CPWR 2CQIA 2R7UA 3VQTA 3M05A 2YNIB 4XAKA 3PX4A 4MIAA 3NNAA 2HFZA 4IR1A 4A47A 2OH2A 1RT1A 3I31A 5BJRA 3KLGB 1X0PA 3BDEA 4WU2A 3NS5A 3KK3A 4IKAA 4WU3A 4ZMMA 3IRXA 1FRXA 3T19A 4UQGA 2E29A 1VK8A 2E1CA 4RW7A 1S1VB 2GQ2A 2XC9A 3M8SA 1S0OA 4EBCA 2VZ9A 3LP1B 1IKWA 3QPIA 1R0AA 1S77D 2HQIA 2VH7A 3SSRA 3FRYA 5KFBA 3ZZTA 5J2PA 5K8PA 1JK9B 2JSXA 2MYFA 1TL4A 3KG0A 1UWBB 4ZKAA 5IM0A 1E6YB 2FLNA 1UP1A 4QIVA 4QZVB 2HHWA 3N28A 4I6WA 5F9NA 1UW4A 2NSCA 2ZH1A 2YNFB 1DHMA 2MZSA 3CD7A 1VRUB 3TNVA 4RNMA 5AXMA 1MMNA 4DL0C 2J8AA 5DM7Q 1OSDA 1WI6A 5KFPA 1HI0P 1CLFA 2B7CB 2CVEA 4OZNA 5FIIA 1IUJA 3CCWA 2G1DA 2DCLA 2OD6A 2YKNB 4MMOA 1JKHB 2HRUA 3ISNC 4O4RA 3CJ3A 1TAQA 4PUOB 1R31A 2IM3A 2VPXB 4ED1A 2AP6A 4LFAF 3K8VA 2LQ5A 2MZ1A 2L9DA 3AHPA 1SB6A 2YH0A 4G1PA 1XTZA 5THWA 1LW0A 4Q0BB 1FRLA 4RU2A 7FDRA 2RJZA 1FXDA 1X4AA 2XHWA 4I67A 1YIJS 4OJGA 4WFZA 1QSLA 3W2WB 1YRUA 3P6YC 1SJQA 5DDOC 1YQHA 3CD0A 2AD9A 1U1PA 1SV5A 2KKHA 2L08A 5JUMA 3S01A 4ECUA 1E6VA 3H2UB 3M4XA 2W4DA 5CYQA 1M0SA 3RAXA 4OZ5A 3MM5A 2KRRA 3M8RA 1HNWF 4GMKA 4LQ3A 3M6WA 3K5MA 4F67A 1LK5A 1R89A 2JJ4D 3MI7X 3SCLE 2AGPA 2AJ0A 2HRYA 3M6UA 2DNOA 3HHNB 3HZGA 5CYJA 1GX5A 5SUHA 2EFGA 4Q8FA 2VUGA 3HI9A 2NQPA 3DRRB 1QSYA 3E3XA 2NXUA 1RTIB 2DITA 4IFYA 3VCDA 2AGOA 1JLBA 3RR8A 2LYVA 3OV7A 4ETXA 5J2QA 2E7XA 4C4WA 4G6VB 1JLFA 3BZQA 2RDJA 2E66A 3D0IE 4C11B 2QMXA 4DLEA 3OL7A 1NKCA 4KJIA 2P9CA 3VZIA 1IKYA 1ZM4A 2GQQA 3KJVB 2AWZA 4C3LA 4ECQA 5F41A 3Q8QB 2J76E 4DSFA 2CQDA 2ZH3A 4DQRA 2BACA 2MZRA 1KFSA 5IT4A 2B5JA 3TA2A 2AU0A 3I55S 5AE2A 4V19J 2KRBA 3M2VA 4LSLB 2W9BB 3BQ0A 3E01B 2PA8D 4LF7F 5C42B 1JLEA 3B8HA 1IBLF 1N0UA 4P6QA 2GV1A 2PEHA 1B0VA 1ELOA 1HQEB 5IT9Y 2JH3A 1ZM2A 4KPYA 1BC6A 5K9FA 3HHLC 4Y2KA 3T1YF 5B0EA 3PW0A 2RILA 4BHQA 4IQMA 3KNAA 3M9MB 1UAWA 3LANA 5DJBA 5F8LA 1AXQA 3CMES 4EBEA 4DFPA 2FHKA 3L09A 5C25B 1VC5A 2XCAA 3GIIA 2QE5A 3KHGA 4DR3F 2A2DA 1X9SA 3K8WA 1HFEL 4MIBA 4UUXA 2MGZA 1KC8T 2JX2A 2RB7A 2JFDA 4G1QA 4YFUA 5LMNF 4ELUA 1FEHA 3R5BA 2V8VA 4QIWD 3A1YG 2HGNA 2K7KA 2PDAA 2YNGB 3DMJA 2GHWA 3THVA 4QR2A 4ED2A 2BVZA 5E5NA 2BOPA 4KB7A 1X4HA 3PDNA 5BYSA 2U1AA 4ED5A 3DLHA 4KFBB 5DGAA 1Q8LA 3OR1B 5D4LA 1X5PA 2J9DE 2OFHX 4F4ZA 5DGBA 1NKEA 2DGSA 3DYAB 5KOXA 4B9LA 2LDYA 3DLLQ 1WI8A 2YQ3A 5HQ8A 3OHAA 3K0JA 1T7PA 1TUVA 4C8ZA 4ATNA 2J6TA 2OSRA 5KFEA 3SXLA 3S8SA 2Y0SD 1IXKA 1RYRA 2MPUA 3GFXA 3DXBA 2KYZA 2BW2A 2M52A 3D54A 2M8HA 3HHKA 3QWUA 4TU9A 3CDAA 1WNEA 4KO0B 2BA9A 2EWHA 3H4DA 3T5JA 1S10A 3MEDB 3ULHA 5LT5A 1VJWA 1RTJA 4X64F 2J7WA 3NAHA 1VQNS 1JXLA 3N9UC 2IMOA 4JI0F 1VRTB 3TANA 3EZUA 2OPPB 4Y2MA 4ZCLA 5EHHA 2KTQA 4XIUA 1HARA 1WELA 5T41A 2V2KA 5KG7A 2IHR1 4TKTA 3SCKE 2OO4A 2YX4A 1IJFB 1FRMA 3AQOA 3HHLD 4OI1A 2DVIA 4BDPA 2PFFB 4H4KA 3RB0A 4K4YA 4QYZJ 2KU7A 4AL5A 5C5JA 3PXGa 3MUMP 1JLCB 3G6ES 2X1AA 3MF5A 1HWLA 1X5OA 2DBBA 5DETA 2IJFA 5KFOA 3GILA 3M1VA 4J37A 2BUNA 2YNIA 1Z2ZA 1FJGF 2W7PA 2X1FA 1YBAA 4ZPCA 3J81Y 2CQ1A 5GAHI 5EWGA 1YTYA 3PNIA 4CTAB 3H4BA 1VC0A 2J6SA 3TUJC 4NLQA 5L9XA 2IFXA 2F8EX 4OI6A 3UFCX 1XEZA 3TVKA 3T6BA 5U47A 4I2PB