3OPQA

Phosphoribosylaminoimidazole carboxylase with fructose-6-phosphate bound to the central channel of the octameric protein structure.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
160
structure length
160
Chain Sequence
b'SVQVGVIMGSKSDWSTMKECCDILDNLGIGYECEVVSAHRTPDKMFDYAETAKERGLKVIIAGAGGAAHLPGMVAAKTTLPVLGVPVKSSTLNGQDSLLSIVQMPAGIPVATFAIGMAGAKNAALFAASILQHTDINIAKALAEFRAEQTRFVLENPDPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosylaminoimidazole carboxylase,catalytic subunit
publication title Phosphoribosylaminoimidazole carboxylase with fructose-6-phosphate bound to the central channel of the octameric protein structure.
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
total genus 49
structure length 160
sequence length 160
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 4.1.1.21: Phosphoribosylaminoimidazole carboxylase.
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00731 AIRC AIR carboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.7700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold PurE domain 3opqA00
2FW1A 5CLJA 1O4VA 4ZK2A 4AY4A 2FW7A 4ZJYA 3OOWA 4ZC8A 2H31A 4ZMBA 5BOSA 3TRHA 4YCBA 3KUUA 3RGGA 4YCCA 1U11A 4GRDA 5BOSB 5CLFA 2FW8A 2NSHA 2NSJA 2YWXA 5C5DA 2FWJA 3ORSA 3LP6A 5CTJA 5BORA 2ATEA 2NSLA 1XMPA 2FW9A 5CLHA 1QCZA 3OPQA 4Z7JA 2FWBA 2FWPA 4B4KA 5CVTA 3RG8A 4AY3A 2FWIA 5CLIA 4YCDA 4JA0A 2FW6A 1D7AA 5CLGA 4YCJA 2FWAA
chains in the Genus database with same CATH superfamily
2Q50A 3DL0A 5L6MB 4DMKA 4MW2A 3WIVA 1RLUA 2VSXA 1GFZA 4P4NA 1L5RA 3WLOA 3HBMA 2KHZA 3LUHA 4OD0A 2B2NA 4KCGA 4NMWA 2O48X 4ZT6A 2JIMA 4O33A 5SYMA 3A37A 2EIHA 1W36D 2PGIA 4D46A 1XKXA 4IX1A 3EVZA 2HNAA 1SR8A 2EQ5A 2PS1A 1GEEA 3EY4A 3A9TA 1UT6A 2XWQA 1B0AA 3BILA 3A6GA 3GA5A 5CEJA 2LD4A 1W581 2YOGA 1IY9A 2IXGA 1P45A 2LVBA 3CH5A 2PGJA 3D8RA 3OQPA 3RIYA 1AKYA 1XD8A 3R6GA 4IKOA 1QOZA 4R5HA 1X42A 2IYAA 3R3SA 4MTLA 3STHA 1EMDA 1CR6A 1ULTA 2IPOA 3MUFA 4IQGA 3TEMA 1KEEB 2J08A 1FPMA 2E4XA 1SC9A 3H42B 4AK9A 3STVA 4MI9A 3P27A 1CFZA 2PH5A 4RY0A 5GZ6A 3W8NA 4B7CA 3Q2OA 1KO1A 1DOAA 3NATA 1W34A 5IH3A 3RVKA 1KPGA 2LV8A 2O8NA 4EHDA 1BVYF 3N2KB 1CEEA 1FS5A 2FKNA 1UJBA 3ETCA 1ZLYA 1AQUA 1ZP6A 2JVIA 5TMDA 2IZ1A 3JQ6A 3J81A 2HI0A 2VAVA 3AWIA 1ONBA 3OM0A 5E1DA 1XTQA 4EMTA 3PPIA 1DUVG 2QPAA 3AEQA 3UM9A 1R50A 4UEJA 5THQA 2IUTA 4IJ5A 2PK3A 2G40A 4TMYA 1K3TA 4NL4H 2HMSA 5F3WB 2IF2A 2J3HA 3CFYA 2KQUA 1XZAA 4HLNA 1V8DA 3AL0C 4MHTA 1WXWA 2QF7A 1Y1TA 2XYHA 1SXJD 1RBZA 4EB6A 1ZUWA 3MINA 4CM3A 2OD7A 4H7JA 3VNVA 3HACA 3NLLA 4AYWA 4ZYTA 2GAOA 3FDZB 3K20A 3R7WB 1S9DA 3IDFA 3NDIA 5TPWB 3FBTA 5IJXA 1VMAA 1P73A 1ORHA 2VDRB 3IHKA 4GNRA 1UC9A 3H18A 3F9IA 4GYJA 3T9DA 3ZHZA 1Q1GA 1XAJA 1PNTA 1U8TA 1YR3A 2C9YA 4EHNA 4Y98A 4YT2A 2DPMA 1WG8A 3OPQA 1RKQA 3DAOA 3K6SB 5HZKA 3O03A 3AEUB 2QZJA 4NNPA 4OHWA 1P4GA 3IE0A 2AJDA 4DR1B 2E18A 1OLOA 2NYRA 4YO7A 5I7VA 1NLMA 1R00A 2GWRA 3KTOA 1QHYA 4EJ0A 1DQNA 4ZOQI 5EP2A 1GZVA 5B53A 3TTSA 7ADHA 4E12A 2Y2VA 1M5TA 3DMPA 4BN4A 3OZTA 3CMCO 1FF9A 4UXIA 1S1MA 2XECA 4DYHA 3GGCA 4BATA 5JMWA 4MPTA 1G3RA 4ALIA 2Y0DA 4HRYA 4Y7DA 1KH1A 4Z7QB 1KQGA 2WF6A 1YR8A 4RC9A 3UGJA 4B76A 1IBLB 1QHSA 4HDOB 1SA0A 2ZRPA 4MUIA 2FWNA 2NT3A 3W0LB 4EQZA 2VCHA 2RGUA 3OU2A 3NBMA 1CUWA 1PGOA 1DLIA 1Q1ZA 4J7XA 4K5QA 3TLBA 1MG0A 1RC0A 3B53X 4WX2B 3U9TA 4XARA 2Q9AA 4ARAA 4EUKA 3PP8A 1ZBDA 3DZKA 4MJXA 3MGAA 2VK2A 1EXDA 3IYLW 1N6HA 1VCHA 3I92A 1B00A 2OYRA 3K5HA 4RM3A 3WGLA 1T0PA 4FGLA 1U0OC 1PR0A 3H9BA 1KZ4A 3M2PA 4FD3A 3L9XA 4M1OA 3TCXB 2ONJA 4ARBA 2FW7A 5IAGA 3WLFA 3OLZA 1UMBB 1GQOA 1PGQA 5EKDA 4RZIA 4S1NA 2M1ZA 3F0TA 1I6WA 4XGRA 1YE3A 2H00A 2VK4A 3LPCA 2OCGA 5A7GA 3UTCA 2UUCB 1BFDA 1SG0A 2RB4A 4K6CA 2WV9A 2ZBQA 3OX3A 1M2OA 1RVV1 5K3FA 3SY8A 1TMYA 1LEHA 4JEIA 4ZT2A 3HQ4O 1JMKC 1EFVB 2PBLA 5AVOA 4F60A 4OXQA 1EDEA 1FDTA 2XUZA 1Y1KE 1XTUA 4P9NA 3K09A 3PUWA 3P1JA 4Q4JA 5FWYA 4KN6A 2R65A 1JPVA 1C7FA 4QGHA 1SKYE 1QQTA 3U80A 1KSHA 4IGKA 1R0YA 3M1IA 3H4IA 1N78A 2G9QA 1I0IA 1B0UA 1Q7RA 621PA 3UAZA 2O2DA 4ZK6A 2JNWA 4DV7B 4OX9B 1G63A 4EGQA 1QH9A 1PV1A 2JGFA 2B7CA 2Z2JA 3M3HA 5DCWA 4ENRA 3ZDBA 4N4AA 3JD2A 4DTIA 1EQUA 1JBQA 1T15A 3F9RA 3FBGA 4QODA 1HY3A 1K7FB 1Y9AA 1A96A 2OVFA 2UDPA 1E3QA 2VLIA 1F1JA 2WTAA 2LCIA 3GT0A 3KZCA 4HL6A 3TSZA 5CA0F 4CEHB 1NM5C 3LMKA 1BC5A 1KDTA 3AI7A 4DA7A 1H05A 3F5FA 3LUCA 3TAHA 2QZSA 1S8OA 1E99A 1KK3A 1QKJA 4KHZA 3TTTA 1PQYA 5K0TA 3FZNA 1LLQA 3I42A 1WXFA 4DMUB 1Q20A 1VLMA 4EKNB 3MWDB 2ZYTX 1Q1QA 4IOMA 3O83A 3EMDA 1W2GA 3I8OA 2VNJA 2L42A 3RARA 5ES4B 1VCNA 1XLWA 3GPLA 4YALA 1SBCA 1BDMA 5HQ3B 1W8DA 4UC0A 1SD5A 1WCIB 4ZAXA 2V7UA 1WCYA 3DLPX 3LPAA 4O02B 2NLOA 1YZQA 2FF5A 4GFDA 4MKXA 3W5UA 4YLYA 1XMJA 1NW4A 1W49A 2DUWA 1XLVA 3LG2A 3W79A 4D9EA 3HJTA 3OC0A 4R8LA 3C0KA 1N77A 3ELWA 1V8PA 4KRXA 3TE7A 4DLAA 4JIMA 3FPBA 3NYQA 1TCBA 1UPTA 1ZD5A 1RNLA 4DM7A 4DUYB 1UCFA 1JHMA 2M32A 4O2BF 2VJCA 4G63A 3A26A 5F77A 5CFLA 1ZGBA 2QQ5A 2C2GA 1DIGA 2IITA 1VP3A 6NULA 4G01B 1E2JA 2FCRA 3AI2A 3VPXA 3TDNA 1ADJA 3ONFA 1OLSA 5EE1A 2Q9UA 2DG2A 4DDTA 9LDBA 1EVZA 2R6HA 5KKAA 4TRRA 5EIBC 1SCBA 1PSZA 2CD9A 3GUVA 4N54A 3NHJA 4ZV7A 1XKQA 2V7EA 3KR2A 5CCDA 3WGZA 4NSNA 3T5CA 2E4AA 3HZHA 2EAUA 2B69A 3COSA 3NI2A 1PL0A 3STXA 2F3UA 4OFWA 1VKRA 1NUQA 1E3WB 4O1IA 3S1LA 3RS8A 3IUEA 4DEYA 4W9NA 1OSNA 1Z2AA 2G06A 4KVGA 2HJSA 3LYAA 5A0TA 2QUJA 3FNEA 3RYCB 4AULA 1KS9A 4Z8YA 1NNEA 4KIUA 1M33A 1Y9JA 1Z18A 5JNRA 2H4JA 3UV3A 3H2JA 1F06A 3GFGA 1Q7CA 3C1TA 2EQBA 1ONPA 2GXQA 3SHOA 5JXIA 3IMGA 2NIPA 3NGLA 4U1RA 2VDWA 1SQSA 1U2GC 3AG5A 4UUQA 5M7EA 4IX9A 1X94A 3HBLA 2VXOA 4WN3A 2QL5A 1C5KA 3L43A 4V0KA 3U81A 1AGYA 1KMMA 3GN1A 4LRQA 1MB3A 2PL3A 2C8KA 3K1YA 4DV3B 4P08A 5JSZA 4V1CA 4M76B 2NP6A 5T5QA 3EW7A 4RENA 2CHGA 4LYEA 5FBWB 3GEBA 5K6TA 3LRTA 1FTYA 3A1EA 1P18A 2ZRHA 4I66A 2O2HA 4JBYA 3ETGA 1SZJG 1RJ9B 2GI4A 1TI7A 4X7BA 1H65A 4X0EA 2XVXA 4OPMA 3I2IA 4MRNA 4L27A 2FW6A 4JCCA 4AVYA 6GPBA 1R8XA 4GIBA 4GVPA 5BSGA 1BHQ1 3LPMA 2BR5A 4FR0A 2WYWA 1HEYA 4JLVA 1YUNA 1B2LA 3L84A 2YZKA 3CEAA 4CMEC 2MSEB 1EWKA 2ZJBA 2GZ1A 2HWKA 2QTVB 1UBUS 1IY1A 2G8NA 3EGXA 1GUZA 4P84A 1E58A 1MO6A 1S0UA 1LZKA 2OUIA 1XGKA 3V8PA 2DH5A 5CBKA 2JFPA 1OYWA 3B8EA 4L7QA 3I9JA 4MUBA 2V6IA 2RGDA 3OEWA 4TN5A 3K9BA 5TQ2A 3O4VA 3BCHA 4MRMA 3EWNA 4MKZA 1W1IA 2ETXA 4R9VA 1G8KA 3A1FA 3COWA 2XSZA 4W1SA 1V96A 2G77B 2W6ZA 5IKXA 1XFDA 4MYSA 5ICSA 2C59A 1GTMA 3B38A 4GVLA 4MS3A 1TYZA 5CLGA 3DXXA 5CXXA 1VJ1A 1PFVA 4M7OA 3QE3A 3SZ3A 1XPJA 3ENNA 3I53A 4JVLA 3KC2A 1MGPA 3KUCA 4IFTA 2C1EA 3EXEB 2F62A 3P2EA 1SIUA 1V11B 2XB8A 1YIDA 1QHHB 1RADA 3OHPA 1G8JA 4BX3A 2YV5A 3V34A 2F8MA 1TAGA 5ALJA 4OAOA 1EUQA 4FHFA 3PFHA 3PHHA 3FHCB 5AKKA 2AI1A 4K0RA 5IZCA 4L0QA 4YRTA 4WW0A 1OBVA 1WV1A 3OEEA 2WHXA 4TLDA 4DV0B 4XWTA 5LDDC 3KQTA 2W2OA 1NN3A 2WF8A 2JHAA 4R5MA 2B30A 3OIUA 4BNHA 5MFZA 2X5XA 4D8UA 3HJBA 4JMPA 4KH1A 3L6OO 4UW9A 1VZ3A 2JJ1A 3HR7A 4KXMA 4S1OA 3EPRA 1W0JA 4RVUA 2FCAA 4UATA 3ZWKA 4UTXA 3O8LA 4Y2TA 5AJTA 4EYOA 5ICGA 3QVLA 1SBNE 2O07A 3VH2A 1V9CA 2B9EA 2NYVA 3CYFA 4EGSA 1XWIA 2O8CB 4V0MA 3TQTA 4ZC1A 3QV1A 3OETA 3PZBA 1N4DA 3WLEA 3GNQA 1NP6A 3FYUB 1ZAKA 3T7RA 2OGTA 2WMNB 3O91A 4I3FA 2D8MA 4INZA 2VJLA 4N3GA 4P81A 3PXCX 3IUMA 3IR7A 4WI1A 4DV4B 4DABA 1J2TA 3L8ZA 3MYYA 5EJFA 2AR9A 2PRYA 1ISFA 3BWXA 1UBFA 3OHMA 1IHOA 4NCJA 4OHXA 1RAIA 4M99A 2CV2A 1BA2A 2GK6A 3RSGA 2IYVA 1COWA 2DZDA 3DW1X 5LLSA 1QHEA 5AMXA 4BNLA 4ZYWA 5LB4A 1R6DA 2GEUA 1PG5A 2YIMA 3GD7A 4TZKA 3GP3A 4GGPA 2P90A 2OK7A 3KYCB 2O8VA 2O5CA 1T0JB 3DAGA 4IWXA 2HHJA 3PNSA 5F35A 5CB4A 1RAEA 3IQWA 4CYMA 3S55A 3QUQA 3LHIA 3D6HA 4NENA 4U3JB 2V1UA 1FTWA 5G0UA 1E5DA 5KNLA 1YNSA 3V1TC 1C1YA 1CX9B 2C5LA 1XI2A 3BKWA 3O8OA 4XSVA 1IJFA 2EFJA 4KLZA 5GTDA 3G5MA 3MD9A 1U3DA 4YRFA 1YGPA 2OILA 2D1RA 5IM4F 1QGZA 4LRYA 4AJEA 3ANSA 3AVUA 4KMOA 4WXPA 1W85B 1GV0A 4KQ6A 1RMTA 4HGZA 3U13A 1L7NA 3VGJA 1VE3A 5CXQA 1ESDA 4ETMA 3QKUA 4WJZA 3OJWA 1N75A 5FYQA 2R00A 3DEIA 2QROA 2W93A 1BZYA 4YRCA 4XGKA 2O0JA 3G2OA 3OPNA 4PZ0A 3JQ8A 4R2IA 3WWYA 1XTPA 2OV1A 3DDCA 4ZXPA 1LDYA 1WXXA 3TSOA 2R5NA 1O5OA 1YIAA 3N86A 1E2FA 2XD4A 1Z29A 2WD8A 1B6TA 2C94A 3BD8A 1C0LA 3PXBA 1QBGA 4BGEA 1HNXB 3GNTA 3CWCA 5C8YF 2ZJZA 3AEKA 5DXFA 5ALEA 2WUEA 4LI3X 4RJIA 1KSJA 3VNSA 1D2AA 3B6MA 2HTFA 3OJFA 3WLMA 5I9IA 1HM5A 1V3UA 2FN8A 1BCSB 1JNYA 2HJ9A 3EIOA 3JQGB 1PT7A 1SCIA 4QIHA 1WZCA 4PIPA 1OIXA 2OZLB 4YRDA 3B1ZA 4D9IA 2IDJA 1NQUA 2VH1A 3KU1A 4KMRA 3RQIA 3FFWA 3RRBA 3UPDA 2EL7A 3IB3A 4B5KA 3KYDA 1CQIA 4KLCA 4HJXA 2G1AA 1XZIA 4BO2A 2G82A 4P4GA 2AMVA 4YBZA 4IDDA 1SQFA 2YN2A 3T1YB 3W5JA 2J33A 1KU0A 4KNVA 2FNAA 3ILHA 3T61A 5HM8A 2QM0A 3P4YA 1JH9A 1T8YA 2JARA 1UOQA 4E51A 3H16A 3ZV5A 5AK5A 1ODIA 5J2UF 2XWBF 4AI6A 1QYIA 3LUBA 3VZPA 5LN1A 3JYOA 2YJ6A 3KLPX 1XTBA 4I9GA 1T3GA 2PH7A 4NF2A 4G4SO 3IKJA 3B1JA 1LWNA 3HVIA 3WSTA 3VMFA 1YVPA 1PS0A 3P9KA 2QTZA 3DB2A 2J9YB 2JKYA 4FMBB 3KETA 1G9SA 4XEUA 4G23A 4CM5A 5G4KA 1N8SA 1NLUA 3OLYA 1SU8A 2YYSA 5DULA 5FNVF 1C50A 1N2HA 1S7GA 3ZGVA 1PFUA 2NADA 3KBBA 2UUPA 4O1HA 4TRMA 2HSWA 4BJ3A 2EX1A 3HXPA 4ZVKA 1X1SA 2WE8A 2NU6B 4P4TA 1F5SA 3D2CA 3X1WA 2FSIA 3ZTTA 3DXZA 5BUQA 4KACA 2FB9A 1T4MA 5DCYA 3VU0A 1K5PA 3IAAA 2EJCA 3A1SA 1L5SA 5FO0A 2PLWA 3EHEA 1JLHA 2ZBUA 4EB8A 2VNIA 2QNBA 4JOBA 3FPCA 4AY3A 2HU5A 2BZGA 1O6GA 1EG2A 1K66A 3B9QA 4KP7A 5JDIC 1FSZA 3WL8A 4KKVA 2HRDA 3OZDA 2R8EA 2K5UA 1CTQA 2A9FA 2DRIA 3DL4A 4PG8A 3IL2A 3B3GA 1RYBA 4XCVA 3ZWBA 3FTCA 5GOTA 2H9AA 2XCSB 4CL0A 2CV0A 1R10A 4LXQA 3DEFA 2Z4SA 5U4XA 2OBNA 1J21A 1E5XA 3MFQA 1LPAB 1P81A 2FGKA 3IGFA 3OCUA 4G5RA 3TLZA 5F76A 2JHPA 3MTIA 1XTTA 5LU8A 5FI0B 3V00A 1S3GA 3SF8B 4E5KA 2DLNA 2G25A 1F8YA 2PCJA 1X13A 2G1PA 3IURA 1KJYA 4XQGA 1FX0B 1Z26A 3DHVA 4HSEA 4L8YA 8ADHA 2BBOA 4NC9A 5FJJA 1IWBB 2FQXA 2O2CA 1I14A 2V0CA 4JJ8A 5DLEA 5HE9A 1HE4A 1L5WA 2DQKA 2WHQA 2AKYA 2ZS8A 3PGA1 4HFMA 1QFMA 2X7XA 4PSUA 3X43A 5JHHB 1MENA 2VRCD 3CW8X 4Y2GA 1BQ3A 1F3LA 5DRTA 3DW3X 1OI2A 5EMHA 1DRKA 3A05A 5KUTA 1NJ8A 1EK6A 3HR8A 4QLOA 3K2BA 2KLHA 1YQDA 3GPIA 1GVHA 4QDZA 1FFCA 2HIGA 4RTRA 3E8MA 5LZ4A 3G82C 1G8AA 2XGSA 3EBLA 4WGGA 2HTEA 2P9EA 5ANRB 3UN1A 3WL4A 3WKBA 4AQ7A 4BPRA 4CQMA 2FFHA 5CDFE 3IXMA 4XSGA 5LYJB 2I9KA 3DFKA 2B4RO 5HMMA 4Z4EA 1ICEA 1MBZA 2GEFA 3KT3A 2C77A 3K15A 4LBZA 4E88A 5CT6A 2GESA 4UTPA 1UK9A 5LIPA 3NIGB 3G2HA 3IAEA 4I46A 4JP1A 3AILA 5HE8A 4TTIA 3SHWA 3NJRA 2B6NA 2OCXA 5JDIA 3ZC3A 3M3PA 1KR2A 5E3JA 3LKBA 4M7WA 3D1JA 1G16A 1YJCA 2GPAA 2P6UA 3DR3A 1EJ0A 4GPTA 5DEOA 4ZPXA 5BN3A 3GLFB 3NQ41 4N0MA 5LCXA 5ALGA 3UF0A 3EF3A 3G0DA 2CXHA 5HRCA 3I5UA 1R9GA 2UZ1A 3VO8A 4ZYLA 2P6RA 4QSHA 4GBJA 1W1WA 3N87A 2NG1A 1PFWA 1K86A 3MOIA 2J9FA 1Y7IA 3PHLA 1U0SY 1YL6A 1E79D 3UWDA 3NKFA 3R7LA 2C29D 4L4XA 4ZO9A 1M0WA 5KQSA 4LHYA 2EYUA 4MOWA 5CXSA 3U7QA 5IVDA 1V9SA 4O0LA 3GRPA 2Y1WA 3IP3A 1V1RA 3MFYA 3VDMA 5CA1F 1AUQA 2QUHA 2YY5A 4BO7A 3NC1C 4NH0A 4WZAB 1KTIA 4KC0A 4OQQA 1E2MA 3TIVA 1WE2A 4QXMA 5F2OA 1A9YA 4UZFA 1HDXA 1Q77A 3PQ7A 4E14A 1VPVA 3P0EA 2R1TB 4MLDA 1N8NA 5J47A 5KKCA 2FRDA 4UEOA 4CR7A 1ZL0A 3GJ8A 3MJCA 4J0EA 2XT0A 2HCRA 2H1SA 4OQLA 3E3OA 1H9BA 3L1UA 4IKEA 1Y6JA 4B2YA 5PGMA 4YXWD 1M2VB 5KQRA 3FJOA 3DEHA 2VLBA 1DWUA 2PZMA 1XEWY 1EQAA 4BGVA 3WBJA 4PRLA 3TOVA 1KRXA 1EE9A 1MP0A 3W6UA 5JYEA 1QGUB 1CZLA 2EU8A 4KGXA 4NCKA 4W7HA 1EVEA 1XCJA 1TLLA 3LZDA 1M6VA 2HPHA 3R0ZA 3NVAA 2R96A 2OBYA 4IL5A 3SHVA 4C5AA 1H85A 2IUFA 3GWZA 2PL5A 1R8JA 3AFMA 4QDUA 1EH5A 1ZNWA 3FGPA 4REMA 4X63A 2WFAA 5C34B 4DNXA 2YOHA 3MCVA 3OLCX 1RM3A 5JAQA 3P26A 1JWBB 2Q0XA 4C3OB 2DVMA 4LVCA 3QE9Y 4MX8A 1ZXBA 4GVXA 3FOCA 5H9VA 2WMDA 4EEZA 3NH9A 1Z3CA 2H0AA 4GI2A 4OQMA 2C03A 3DKVA 4MGYR 3UT6A 1I80A 3BULA 3HEAA 1YBAA 4JC5A 4C3ZA 4LXHA 2W6IA 5IDVA 1OF1A 1P74A 5JO9A 4RHCA 3HL4A 4JLMA 1NN5A 3CT4A 4G1EB 4IS2A 2JL1A 4Y6PA 5EIAA 2A92A 2DTDA 1LV8A 1GDTA 4NU5A 1RZRD 2E37A 3QMVA 5EMKA 4CG0A 5EHZA 7REQB 5K0NA 2VTBA 1X38A 2RAFA 2FUG6 4YP6A 3L1IA 1DIRA 1DXYA 1GPBA 3E58A 4CFSA 2C5GA 4KODA 5LQKA 3U4IA 1JSCA 2WHPB 2JI9A 3AQ4A 4URFA 4JH0A 3O3MB 5IEBA 3AHIA 1U0EA 2QN3A 1JZTA 2ST1A 4K03A 4MEJA 5AM3A 2H3EA 4OCZA 2R7KA 4WK4B 4GOJA 1TA9A 2YHSA 3K6KA 4KUGA 5TMEA 1EK5A 4Y1GA 3V2IA 3CNBA 2XVZA 3T12A 1GUBA 3PEEA 2NZXA 5G53C 4CT5A 2LIPA 5B3JA 2Z30A 4GMKA 1JEOA 4P3OA 1UBSB 2BCGY 1WQ4A 2B1QA 2RHRA 2FR8C 3E3NA 3O2SB 3ZDRA 4EL0A 5EMJA 3EBPA 4KW7A 4MVJD 3EH2A 4L4SA 2REOA 4PAMA 1JIUA 4JOQA 5K3SA 5LA6F 3HLKA 1FC0A 2JI8A 3UY4A 4HNUA 5IULC 5LNK6 3ITNA 1EE2A 1YS4A 4UUPA 1Z4IA 5H16A 5CH3A 4Q0MA 1DOZA 1WSAA 4UU1A 1QVRA 1VB3A 1W0KA 4NH4A 5FUVA 1DTWA 3S81A 4M9UA 5DO9A 2I4LA 3G8CA 4X45A 1DEHA 2PT5A 2EJWA 1KZ9A 2XUIA 3IDAA 2WOOA 2ZRCA 2Z0MA 2IWRA 3RO7A 1QP8A 1JV2B 1KVUA 3ZWPA 2ZBEA 1XL0A 4EITA 1JKMA 1P2VA 4NHOA 2OENG 3TGLA 1HI9A 2A5FA 1T4BA 4WCFB 5JVDB 2VATA 4JUAA 5B30A 4G1UC 5K0GA 3U7GA 3GO4A 2GCPA 4FXPA 3U2QA 5WRFA 3LGXA 4GRAA 3MRSA 3D6FA 2CSUA 3RI3A 4CF3A 4PGAA 2H06A 4AZ3B 5BNFA 5DNAA 1KH3A 5LOVB 1KEZA 4K9RA 5KPDA 3ZD7A 1SB9A 3JARA 1NVBA 3M9LA 4ZEWA 5L8VA 1D2RA 2GZ2A 4IICA 2Q1YA 3WHIA 1JA0A 2YRXA 1Y4AE 1AB6A 2NZYA 3G2MA 3FWKA 2MMGA 3CLTD 4G4SP 4IYRA 4YMHA 5EESA 1NVWQ 2P30A 2QM3A 4HWSA 4X1IB 2EBFX 3CKKA 3ZDDA 2PY6A 2J3LA 3PE3A 1GDDA 1UP7A 1U7WA 1A5ZA 3P5BA 3EZ7A 4IJ6A 2GCGA 3H5RA 5HQTA 3JYPA 2XZPA 3ZY4A 3TRFA 4QRIA 3QFSA 2CJFA 1C8VB 1QUFA 4B48A 5AVQA 3ZV7A 4X3OA 5AKIA 1U7OA 2W6OA 5L7YA 2X9QA 4MVJF 3SJBA 2FR8A 4MV4A 3SR0A 1ZHHA 4IIXA 1L3BA 4NLLA 3AERA 4ON9A 1O03A 2REQB 3GJYA 3P8ZA 4PTZA 3SLKA 3EEQA 3EE6A 5COQA 1CUUA 1OI3A 1TIKA 1U1EA 2D5CA 2ZIUB 3TDKA 3W06A 1XVIA 2RGNC 3L49A 2DSTA 3ANNA 5C31A 1QF7A 2QMYA 2QTCA 4PFQA 4ENWA 3PPYA 4FEAA 1WW2A 3A28A 2VQDA 3IKLA 1S2LA 5ADWA 4R1SA 2JIQA 5IBQA 1NKVA 2B98A 3NUZA 5KYYA 2A2ZA 1AKVA 1GOTA 4AP9A 1JLLB 1KOFA 2RGBA 1ISRA 1A9PA 3FMIA 4ENPA 5A3QA 1QRTA 4XYEA 4QDKA 1C0KA 1VJ5A 2XJ9A 3JQPA 5H7XA 4D6PA 4FFDA 4PGMA 4EHAA 4O4LB 2C4WA 3KPWA 3B5EA 5LQAA 1K3UB 3EG5A 3FNGA 1UQTA 3HXTA 4FDVA 2BR4A 2O52A 3WISA 4X7MA 4L2IA 2HCJB 4D3FA 2CVHA 5KHOC 5JZ9A 1ZSVA 4UHEA 4B3GA 3KEQA 1OGYA 2D54A 5KREA 2DFPA 5D6OA 5J5AA 3WGOA 1PWZA 4EFDA 4GM4A 4IDOA 1T2CA 4FR5A 4KYUA 3BMQB 1Q1AA 4P4SA 4WOJA 4C88A 3GU3A 4UHJA 1OHHD 2DMRA 4XFDA 3GCDA 3QU7A 4CMJA 2Q8NA 4NEQA 3G0BA 3OESA 3CY6A 3OSUA 4H27A 4CWAA 1XNQB 4FI3F 4PG6A 3BFXA 3NM4A 4PCUA 4CJXA 1P6XA 3TOZA 3A4YA 3OM8A 3ANMA 4OREX 5K05A 1QGAA 3JD0A 2G36A 3WLAA 3N5CA 1GL3A 2V8BA 1GGNA 2W58A 3H9CA 1LXCA 1WNTA 1RQLA 1RQ7A 4LFBB 3O2JA 1VA5A 2BMVA 2AF3C 1RMQA 2DBZA 2GJ8A 2QV0A 3N28A 4N3CA 4PO3X 4C4TA 4XJXA 1CLEA 1MFZA 3TI7A 4N5NA 4DCUA 2RH9B 2IV7A 3VHXB 1Y1PA 1V95A 3E35A 4LCBA 4L8GA 1JHYA 2JLRA 3RU7A 2P75A 3LT2A 1QGOA 3I6BA 3C15C 2VZEA 4PC1A 5BMVA 2PSHA 4EPYA 4ZEVA 4B73A 3ADOA 5B64A 1DRWA 1PWHA 3CLUD 3DS8A 3ZNPA 5D5HA 2R6AA 3WHKA 3EJWA 1FNBA 1BRTA 4OOFA 1J0CA 2RONA 3C1OA 1JAIA 2YYZA 1YBMA 4O4HF 4JS0A 5IARA 3W5BA 1RRGA 4MV5A 4ZVRA 1CZNA 3BBLA 3RJZA 5P8WA 1WUJS 3G9QA 4DQXA 1YTLA 3SM3A 3V4FA 2GEVA 1VA4A 2PYZA 1SU6A 3OTGA 2H1RA 1OROA 4MW0A 3D6AA 2GA9A 1DWPA 1KAMA 3BH0A 3L0OA 3OOJA 5DYYA 5NULA 1AXEA 2Q6LA 3T5GA 2JLAA 2GERA 4N5LA 4UE6A 1L9XA 4YPVA 3W5CA 3V8VA 4L8VA 5CDGA 1BX1A 2WP8J 5DLQC 2G9NA 3NRJA 4GXTA 3JR7A 1VE5A 1FOEB 4R0MA 1XDZA 1BHO1 1WMDA 4CTKA 1D6MA 5CVDA 5K0FA 1N0UA 4DT1A 4KI7A 3C8DA 1Z22A 5D1HA 1U7DA 1UP4A 1IBRA 4ILKA 3I5XA 3TAXA 3C8MA 4FIZA 4F2PA 5JFOA 1ZCJA 1OXSC 1ZVQA 3WK6A 5CB8A 2N47A 3TW4A 1JKJB 3ET4A 4JZYA 1GLGA 1X9HA 3D6TB 4XIIA 4ZHSA 3KT8A 4W1QA 3F8SA 3P9YA 3T7JA 2FEXA 2ZIXB 3NWBA 4NFYA 2BKLA 4R2MA 4EG6A 3BERA 1GAWA 3RC9A 2ZOSA 2PUFA 3IEVA 1V35A 2GWHA 2ZJ3A 2YZGA 1QV7A 1E9AA 2FI1A 5K45A 4F4IA 5FWAA 3D59A 3ZJVA 3D4NA 4QECA 4NZYA 1N9GB 1AGXA 2XQFA 3JQAD 2XVAA 5ESXA 4BGUA 2WD7A 4F3KA 2BTEA 1T3LA 4AQDA 1E8DA 3Q3EA 3G2LA 4KSCA 4EZBA 3EOAI 1IAQA 3DE6X 1SVWA 1X7HA 3JYLA 4F2GA 5IDWA 4NDAA 4YAEA 5KJCA 4ND2A 2VVTA 4GYYA 1V7CA 1EKXA 4GUDA 4Z9FA 2RI1A 5BUCA 3WHLA 5EY5B 1KO4A 2PWBA 2XZOA 4WNYA 3RCBA 1DINA 1CD5A 3C3PA 3BMOB 3G0CA 3VVBA 1P1BA 2DC1A 3OCJA 4IUCS 3O31A 3L0YA 4H0NA 2LCQA 1VJ0A 3VR0A 3ZGZA 3MTDA 4CF6A 1H2RS 1ESNA 2AFHA 2Y77A 3AUTA 5K20A 3ZK9A 3ZHOA 4Q4HA 2VXYA 1U8AA 3R9KA 1FFSA 3N75A 2B1GA 3P0JA 3DOOA 1NYLA 4KV9A 2IK8A 2I67A 4DSNA 4KU4A 3UIEA 3UWPA 4KJZA 4MHOA 5JAMA 2QP3A 4WDQA 2BWJA 1MIOA 1Q11A 3OT4A 3DT6A 3ZDFA 4A5SA 4EGJA 1ZGAA 2VSYA 2H1OA 1A7UA 1X9IA 1NVDA 2YXBA 5HWSA 3RAJA 2UYQA 3IEMA 1PT9A 3LK6A 2QX6A 1OBCA 3MMNA 1GZDA 4TWRA 5DI9A 4FC7A 4BFCA 5JTTA 1KI9A 1GNSA 3KIPA 1Z17A 4EIWA 5C7OO 4TLEA 2J6HA 4LE2A 3CVOA 4U6NA 1VPLA 2L0XA 4CM8A 3LVRE 1EUDB 4F4HA 3ZK7A 3PLNA 5E4YA 5IK2A 5I5EA 3DBHA 4AWAA 5E7IA 1R0ZA 2E87A 2PZKA 5LP6C 1YS7A 3I32A 5JRJA 1CUAA 1WMAA 1PW5A 3HB1A 1ISMA 1PVDA 5AKJA 3RS0A 4F71A 3Q98A 4RTKA 4FT2A 3WRVA 4PLCA 4XIJA 5BOVA 1U28C 2DCMA 1S8NA 4CIVA 2CMFA 1IG0A 2P77A 2BRUA 5DOVA 2I7TA 4MYCA 1Q92A 3B52X 4XJVA 1Q1NA 2YWJA 3P2OA 2CK3D 2BTQA 4Z5XA 4BX9A 2XTAA 1ZXLA 1BDHA 4IGIA 2WIFA 1RP7A 2JKVA 3DWFA 1ZINA 3N74A 4LF6B 1W8IA 1IZZA 1NQAO 4BRWA 1F6DA 5DM70 5GP1A 3SZUA 4WJLA 3QYAA 3RF7A 3HXOA 5EE0A 4PCAA 3SVLA 3PGVA 4FS3A 1YHZA 1NRIA 4QPJC 5ICFA 2AN1A 5JAUA 4NI5A 1H23A 3RVDA 1JSZA 4JI5B 1XLUA 2QRJA 4HZUB 2VEOA 1LRJA 3H5AA 2E1PA 3HGQA 1EG7A 4AIRA 4RTPA 3GLVA 4IRXA 3LX8A 1Y8RA 2BDUA 2KX7A 4E1BA 5IFLA 2P0AA 3FW1A 4QU5A 2QAGC 5FYDA 3BA6A 4BNYA 1GA1A 2XMQA 3UUGA 3RTCA 4FE4A 4XB6B 2FPUA 5HRUA 2YVLA 1UXHA 3VVMA 1L1EA 4TVSA 1U2EA 3WKEA 3E18A 1P9NA 4HK4A 4JFAA 1LLFA 3AUYA 4II3A 1YL5A 4CLHA 5ITVA 3DJYA 1KBOA 2E55A 3C4QA 3CNEA 1GTL1 4QUJA 1XAIA 1E60A 2ZT8A 5JAIA 4O4IF 4DSZA 2AFIB 3OT5A 3OD1A 4KV7A 3E6AA 3H3XA 4A91A 2R9VA 2GK4A 2BEKA 5TDHA 4EHKA 1S2GA 3G1UA 2HZ7A 3OIDA 4MUEA 4XKJA 4YONB 3V8NA 4D4LA 3DBOB 4XYGA 2X8LA 3T3HA 4ESEA 1F3OA 2XV1A 2NP7A 1T5OA 1VDMA 4Q7KA 2J9GA 3QBTA 3ORFA 3C6KA 3CJQA 4GZMA 4XIGS 5KX5B 3EEYA 3A3YA 4W7SA 3O92A 4YA6A 4DILA 3TQCA 3P9QA 4EABA 1FU8A 2IHYA 5AM1A 2HGSA 5K0LA 1ZI8A 1N3IA 5EUMA 1DAOA 2I3GA 2J41A 4QYIB 1G6KA 1PNOA 3V97A 4UJ3A 3LW8A 1HPLA 2B1JA 2YHIB 1Z6PA 3NV7A 4RHUA 4B8YA 3IP5A 3QJ5A 4ZAGA 1YQGA 1SXIA 3WADA 3LW7A 4QQFA 4XM1A 5JJLA 4O4JA 1UMKA 1Z8DA 4Q1BA 1WXIA 1M6YA 4DN6A 2XCIA 4NPCA 2WICA 4R2KA 4DRXA 2FDXA 1PO7A 2DUUA 4PLVA 1JU9A 4HQOA 1G2OA 3ZOZA 5DT2A 4UMEA 1KIMA 4PINA 4WKGA 2K2QB 3LH5A 3ECSA 3PUXA 3TVTA 1QXSA 2CMHA 2HRRA 3Q9UA 4LC0A 2CNLA 4M1KA 3AIOA 4EARA 1UZUA 3WIBA 1IMJA 1ZKDA 2FUKA 4N39A 1RYEA 5JQGF 3W4KA 4QUDA 5FV4A 1E7WA 2Y2UA 2ZE7A 3JAWA 3DVLA 4QE3A 5IS2A 1UJ4A 2VJQA 2X14A 5DWQA 4ZIRA 5BW5A 3EN0A 4HAZA 5IJ9B 2FLKA 1QMPA 1NG1A 3CO5A 4GPD1 3ZGOA 2X5OA 3BD7A 4DV2B 5FPTA 1CUGA 2XMRA 4P92A 4Y2HA 4JX8A 4WCDA 4KQHA 4AKGA 2J3KA 1NOIA 4R7TA 1X1BA 3CBQA 5DB4A 1B8UA 2L18A 2N75A 2ZRLA 5JSKA 4LAFA 4IJVA 1O57A 2OFWA 4PRYA 5C32A 3U4QA 4YH1A 2IYYA 3E7DA 3CZPA 1EWRA 2EKQA 2FUEA 4N6GA 5CFPA 4WINA 4Q7LA 2Q62A 1T1RA 4CQLB 5KNBD 1X1TA 2C04A 2PZGA 3IUPA 4J4HA 1P4HA 1I7QB 3NXKA 1L4EA 1SG6A 3AHCA 1VKJA 2CKDA 3GGDA 4G6ZA 4QAJA 1RYHA 4D1YA 3LQRA 2FLVA 5EL0A 3BT7A 4ZP1A 1X86B 3NC0C 1TQ6A 2BGTA 4DAOA 4L8FA 1USUA 2DUMA 2IXBA 1W1UA 3VDNB 4AL4A 2YJTD 2BKAA 1B43A 1ESZA 1EVLA 4QVKA 4ZN6A 2ZSIA 4RIEA 4ZEOA 4LK2A 4KR2A 1IOWA 4P3NA 5AW7A 3U39A 4E7OA 3VYWA 4O3MA 4BLUA 3IDQA 4YRKA 1FFGA 3DOJA 2I80A 1N2OA 4N8SA 1CRLA 3EGVA 3JVDA 2FJ0A 4AJLA 4CL8A 2P0EA 1Q0RA 3AJDA 1KFCB 1I2MA 5HFJA 2EP7A 2D1FA 5AOVA 1QRAA 2ES4A 1Z7EA 1IN5A 3WYAA 1M6EX 3F47A 2AN4A 4OL0A 3SIWA 3E9NA 1X7XA 3LTEA 4IDHA 4D8WA 3WLSA 2PUCA 3F5QA 3GCWA 3OOEA 2A1TS 4MQUA 1QR6A 3GH1A 5AJZA 1E9RA 1X7YA 1E3IA 1TZCA 4ZV4A 2WU1A 1NVMB 3GMTA 4OI4A 4AW9A 4AD8A 1L5HB 1LPPA 1RMYA 3F6YA 2WR8A 3LS2A 4JC0A 5LUBA 5B2FA 5FWXB 1ARZA 1MTZA 2P35A 3HYCA 3PGMA 2AOUB 2JHFA 1VHLA 1PE0A 3L7CA 1THMA 2V6GA 3NETA 1RHJA 4HDKA 3FROA 4B35A 5DHUA 4F12A 1GTRA 4FB4A 3OLXA 3OEHD 4Q3OA 4XXHA 1E8NA 2FKAA 4B87A 2QRNA 5K8JB 3VKUA 2IU3A 4AY6A 3RFVA 3HS3A 1GD1O 4J0KA 2JDID 3ZXSA 3F6RA 3GFOA 2QUKA 1MB9A 3UB4A 4EY4A 4F38A 3KXIA 1II0A 5FFFA 4RV5A 3TRKA 1ZVVA 1K3FA 1KOJA 2VUUA 4JX9A 5DNEA 2PQ6A 2RH8A 2D5BA 3BWBA 4NBUA 4MCAA 3PBKA 5HCNA 1XEXA 3I58A 4KWTA 3RE1A 5AVYA 4W5JA 1Z8HA 1SXJE 5LFAA 1X2EA 4RHYA 2J85A 4MDYA 5HHTA 5C1OA 2YIJA 5DBIA 2GCIA 1DQRA 1U65A 2WHEA 4L5IA 4TQAA 1R9JA 3FCXA 4TV8A 5SY6A 5LDGA 3RODA 3ZY2A 1RZUA 1UFKA 2NTYC 2RH4A 4P3XA 4QICA 4X6YA 4A27A 3N58A 3RSOA 3V2GA 3KT0A 5E1MA 5AVZA 5JD5A 1DUIA 3SD7A 4W5RA 1YS2X 2VJKA 4IHJB 5ALXA 4JJFA 4B8ZA 1CNEA 3AJ8A 2MSNA 1E1DA 2HT6A 2Q2VA 1ZK3A 3BXGA 5BSRA 4AN0A 4X97A 2OV6A 2YN4A 2IS6A 1URPA 1XYGA 1W87A 4Y6LA 2ADFA 5FTJA 1GYRA 1N36B 3KUXA 2FWAA 1TA4A 4OLFA 2V45A 4YAGA 1HE3A 1KYVA 2A1IA 4QL3A 3M34A 1I3MA 5FBZA 1MVLA 3V4SA 3DTNA 4LDRA 4PICA 1GTVA 5KO2A 1HETA 4CCAA 4LJ7A 2GRAA 1GRRA 1YI8A 2ON6A 3GNLA 3WL6A 4Z4CA 4BNVA 4URXR 4LY6A 2EF0A 2X2EA 3OQVA 3GVHA 1R6AA 2WPNA 4R7ZA 4ERXA 4NBNA 5AVXA 1J2YA 1BE0A 5FJIA 2WF5A 4N49A 4BEVA 1K0FA 1FZTA 4G5QA 3AETB 4RYLA 4B17A 4W8OA 2MTBA 2R66A 1J33A 1HL3A 1UAYA 4OSOA 1IXKA 4RQAA 5IVHA 2P4EA 1R27A 1GYQA 2YN0A 1I0LA 5KJEA 4MQLA 2HQRA 3SQNA 4BTLA 4CKEA 4ZRMA 5F98A 2V7XA 3AUKA 1CJVC 4I4TA 4ESHA 1QYDA 1SHJA 1ZOIA 1QK5A 2AWNA 2N9UA 4OFBA 5EKXA 4YUZA 5KVCA 4TYQA 1DEAA 2O2YA 1IXRC 4LX0A 1ULBA 3P4XA 5IUKC 2O6LA 5FBLB 3CPJB 3MXOA 2R62A 4FFMA 4YJ2B 3U40A 4IIEA 5BWBA 3HVUA 3AXTA 1K8ZB 3T1TA 1NUTA 4FWBA 1BCRB 1JDBB 1JG2A 3AF3A 3P94A 1PBTA 3KPJA 3P4UA 2WTNA 4E03A 3ZCUA 4DBZA 4HAYA 3EULA 2FPWA 4K6MA 3UANA 1KO7A 3C5WP 4LCEA 5TIIA 2WRZA 5IFKA 5JWHA 4WMLA 4PLTA 1YDMA 1I2ZA 1TXGA 4ZO8A 2OT3B 5E9QA 3C3DA 1L5LA 3ONWA 4YQZA 2ZYRA 3ZYCA 2RHLA 3UPUA 4BWGA 2IT1A 3VSBA 2A9PA 2CLHB 2ZJ8A 3G89A 2XLBA 5J5VA 4RK5A 2BFCB 3BUSA 1FYVA 3DDOA 1K8RA 3RUEA 2IP1A 4LNUA 4X62B 2AHOA 5I7OA 2FETA 2H8GA 3T9CA 2AXEA 4C2TA 1EX1A 4QGAA 4CLOA 3FWYA 2O2XA 1ZH4A 5K3BA 2AR0A 1Y4ZA 5D5QA 1DWQA 4C6HA 3O73A 5I3ZA 4FOOA 1MB2A 3QPUA 1I1QB 1SRRA 3AF1A 3R5XA 4CFYA 2BH2A 2RHOA 3AW8A 1AKWA 3M6XA 2ZJ7A 4R1QA 3BTOA 5BUZA 2QKYA 1P1CA 4L07A 1IY2A 4H77A 3AY3A 3GVXA 1SBIA 4NZZA 3R9IA 4J03A 3PE4A 4HH3C 1C2YA 1GSOA 1NUUA 2KWIA 3QG5A 4J9UE 2NU7B 3MRXA 1E1RA 1ZUIA 3LWBA 3PL1A 2V59A 4YRMA 2EJUA 2DJ5A 3USZA 4R1LA 5AHOA 1F2DA 2JFOA 1YK0A 2HIAA 3ROEA 5C3UA 4MDFA 1TUEA 4M6WA 2BUBA 3AU8A 3KFLA 3GD5A 1HH4A 1XMIA 5AW8A 3TMKA 2ZULA 3KZKA 3SEFA 4CM9A 3NYWA 4HGOA 4DCJA 2UXBB 2DF8A 3EA0A 1D6JA 4ZV9A 2Z9BA 3KHKA 5ILQA 4MCIA 3U3OA 5A4DA 1K7CA 2B99A 5JCXA 1VL1A 1OI4A 4WKOA 2QRLA 2VO1A 1BSVA 4CL2A 2Z2KA 3RM3A 3WO0A 1SHUX 1U0TA 3NTXA 1G5QA 2HKIA 1KMHB 4O3FA 1ZQ1A 1XOIA 4C87A 3B1FA 5IG2A 2QN6A 3E03A 3SICE 2AJCA 5L7TA 1FP4A 2CDNA 4OHYA 3MQ2A 4LMRA 1F8XA 3STYA 4Z53A 5ALRA 2D2XA 5EEGA 1U04A 1QJCA 3WYFA 3TS1A 1E2UA 2YFHA 4IDPA 4QDOA 4WKCA 1WA5A 2FZKA 4Z6KA 1UM8A 4ZZ1A 1C1XA 3OQBA 4M2LA 3LO5A 2YWRA 1XSEA 2H57A 2BJHA 1TKBA 4UMVA 2DQ4A 2BEUA 4MVJM 2UKDA 3D0OA 1HKUA 4RCZA 1CE8B 2W37A 2XTNA 4NOLA 2FWMX 5F7XA 1OH7A 4IQ0A 5KHLB 2XOXA 2X22A 4J2OA 2VEDA 2YWCA 1XR3A 3LQYA 4RA6B 1EX7A 2Q07A 1QFZA 4KPUA 1FEZA 1KEUA 3DTTA 2F1RA 4HXGA 1YQQA 2H63A 4ZOEA 1NR7A 5F4ZA 2I6FA 1TEVA 1ZIDA 5EWJB 1QE0A 4KQ9A 3UMGA 1JEYB 3F7NA 5BR4A 2YVQA 1V8FA 5IUJC 3USES 1GNLA 3OZVA 3NBAA 5DLDA 4JJKA 3QF4B 1ZCFA 2C8LA 2CDAA 1TW2A 1FFBA 3ACCA 3MINB 1C3XA 5E95A 1ANKA 5LZ5A 1SUWA 3DJFA 3TUZC 4R2WA 2EATA 1OX4B 4X66B 3HN6A 1J07A 3LLUA 4XASA 4CKZA 3I6IA 5F7ZA 3UCEA 2PDAA 4CV0A 2PAFA 1ECCA 4EMSA 1LX6A 2A1UB 4TL9A 1OILA 2WIAA 3ROPA 1G2PA 4RKFA 2TECE 3ZWMA 2AZTA 1NJ1A 3HEMA 3B1WA 4N47A 1BS9A 1E5LA 4QPPA 3QOXA 5U4QA 3M49A 5ADHA 5JH7F 4G1BA 2R6ZA 3T35A 4KVZA 1Z5GA 4UE2A 1ND6A 2BBTA 1CNFA 3AIMA 5HK8A 2PFKA 2AB0A 3C24A 1OLUA 1GQQA 3I8XA 2NU9A 4A1FA 1QG4A 4PU0A 4XCQA 1CU1A 4I50A 4I3HA 5HOQA 4RKYA 4NBSA 4JI0B 2FEPA 2ZYHA 2ZRJA 3OJOA 2MR5A 3UAGA 3VAYA 4AMZA 4RADA 2ZDHA 6CHYA 5DCUA 3DMDA 4ZZ3A 5HKLA 5ICCA 2HU7A 3DLBA 1Z82A 2G9VA 2YINC 2YJ3A 6Q21A 1AOXA 1JR3E 1V39A 3EYAA 1PK9A 5HIIA 4LPKA 1BHSA 2R8ZA 3OTQA 4X6XA 1SBTA 1TNDA 1XRQA 3BXOA 4KIWA 1Z63A 3PJEA 5AKLA 1KIFA 5KSPA 4COOA 4CUJA 3DP7A 4MMXB 1QO0D 3S2YA 3BC1A 3V6LA 3DV0B 3LRXA 4HNAA 1XZNA 1RQ2A 1QR2A 3QVGA 1LSJA 4UNNA 2XHZA 2PSDA 1AUXA 4NAVA 5CCEA 4RXTA 3M6UA 3E9DA 4E5DA 1ILWA 4MW5A 2OAP1 3HHEA 2PXHA 2QA5A 3OZEA 3AI1A 4RIFA 1NAIA 2ABWA 4DLVA 3FOEC 4YCCA 1XBTA 2GM9A 4KEAA 4M1WA 4P5EA 3WZ2A 4P32A 3ERCA 1VMKA 1HDYA 2GS9A 4MVJH 2F67A 1G8FA 4EY7A 4A2QA 2BH9A 2OCPA 1U0GA 1BYUA 3FTPA 4HEQA 4QD3A 2EKBA 1JHRA 1J06A 4D4MA 5AW6A 2GM5A 3BK1A 4ASUD 2Z5VA 5C1BA 3FGOA 1EDOA 4XLLA 2W0SA 1NBMD 4Q4JB 3ZQ4A 4CUZA 1P9WA 2AUTA 5KPJA 1I6MA 4QJBA 3T7SA 4F11A 5JBIA 4X61A 1Z5OA 4D4GA 5JO0A 3BEOA 5FTMA 1VIYA 4P5DA 5DHRA 3T9EA 4C43A 4CEHA 3ICPA 3ON5A 3OZIA 3VU8A 5JWOA 3GQVA 3MBKA 3VJLA 2AMFA 3NC4A 4LKRA 4K8RB 4R40A 4HS9A 5CAEA 3L4JA 3ZI4A 2Q5CA 4H7IA 2EZTA 3FKSA 5G2OA 1N2XA 1XDGA 3BREA 3FI0A 3R9WA 1QMGA 5DSZA 3HCCA 5DNCA 1NF8A 3JW8A 4ZALA 2QD1A 2RG7A 1V43A 2J5XA 2VYCA 3QVXA 3V8MA 3GP8A 4CMGA 3KOMA 5FEUA 2HXGA 2H4WA 1Y4DE 2J46A 4WY8A 3ENKA 1NXXA 4X9XA 1OU4A 4W1PA 3BWYA 4QAQA 3TQIA 1KDVA 3GFVA 4HNQA 4OYLA 3LA6A 2YJNA 2WG2A 3RFCA 3UMCA 4D74A 5F12A 1T6YA 1M1YA 1P3DA 2DWCA 1TQHA 1YCHA 3EPPA 3LBFA 1M8JA 2G5PA 2ZUEA 2OECA 3O5AA 3AUAA 4PY2A 3OT1A 2C5FA 1FJ2A 3O9VA 1BXKA 1ISHA 1JJBA 2EXXA 2J31A 1L5QA 1T0UA 3HBFA 3KKOA 1OFIA 3NNDA 1V8OA 1WPXA 4B4OA 3SIXA 4XE5A 5DTMA 2XDQA 2A0UA 1DFIA 3N2YA 5HUJA 1ZNZA 5ITZB 3R40A 1UMCB 2NZVG 1YZTA 5EN4A 2EBWA 4PFJA 1L7EA 2FZVA 3K6RA 2FPGA 1P5HA 4DQLA 3QPAA 5GWXA 3VO9A 3QFHA 4MAFA 5E7QA 5AWFC 3UCXA 3MJEA 3ENVA 3GJ4A 3K1ZA 4LOAA 5IJ0B 5KJ6A 2RK4A 3EIWA 1D6NA 4HMOA 2ZJ1A 4L85A 2GTHA 2PZAA 1NDHA 1FDOA 3FFTA 3CB4A 3D4IA 3C7CB 2G1KA 2YCLA 4CMIA 2FOLA 3AHJA 5JLAA 5DP2A 3AU9A 2CUZA 2W11A 4I99A 5SV2A 4BLRA 4D0SA 1X7ZB 3IVCA 2WT9A 1FSFA 2QL6A 5LSAA 3M70A 3F9CA 1SUIA 1UDBA 3AH8A 4FZ5A 4RFLA 3HXQA 1L3IA 1U6IA 2OORC 4L9SA 4BBZA 5JCOC 4A8JB 3HCRA 4GC9A 1LLCA 2GEBA 4DIEA 1Y89A 3FB1A 4UBNA 3GLGA 4KH0A 4YIHA 2NPFA 3ONEA 1QH1B 4PV7A 4LJ6A 2LXNA 1U3CA 4BFVA 4IQ4A 2QX4A 3PENA 2W2MA 2OHXA 4KX3A 3R20A 1KEKA 3N6XA 4HPXB 4IIJA 4ZO7A 4RVFA 4NRDA 1ENZA 3LK7A 5C18A 2HXYA 3CLHA 4Z86A 5LNK1 1NKTA 2GVDC 4G0ZA 3GRRA 2F1OA 4MQ4A 4OG2A 5FIUA 3N7UA 3QM1A 1YQUA 2CNNA 5IP5A 1ZK4A 2P2NA 2FXIA 4P0QB 5JS1A 5ALHA 1VE6A 4PZDA 3PLRA 1HL7A 4JT2A 1WXQA 4TUYF 1RQRA 5AHWA 5KYWA 2PS9A 5G41A 3S70A 5CT8A 2QM8A 3IJRA 2I6UA 1UC8A 4MQ5A 5JATA 1UBLS 1SB8A 3I9NA 1NASA 5JDCA 2XXBA 1XMSA 3BG5A 4QUIA 5HW0A 2X5KO 3PGLA 5C8XA 4F21A 3FUXA 1T8UA 1W5SA 1GKYA 1JHQA 3TZEA 5KZMB 3NAMA 2IQIA 5EZYA 2JI7A 3PEYA 3EGXB 2XUPA 1PI3A 1Z6GA 4J9VA 4UVEA 1A50B 4OHFA 1FUEA 1RP1A 2QGNA 4A0GA 4CKXA 2RHTA 5G40A 4BYGA 1Z06A 5D6NA 4P82A 2XUGA 5TQ2B 1JB9A 4OA5A 2QP4A 3DZBA 3LQQA 4IWNA 3JX9A 3ZI7A 4MRMB 2XZLA 2GEKA 4ITRC 1T5BA 2NYUA 3AXSA 1J2JA 4FDMA 4YREA 4ZCQA 3FB4A 1VRWA 2BFMA 2QYTA 3DVSX 2ET6A 2W8BB 3GRUA 3L0IB 4C4OA 1FVXA 2IY8A 1XMXA 1AUVA 3B6IA 4MS3B 2GB4A 4RJ2A 4GXNA 3VR6A 1G291 4M7RA 1Z3IX 2ZROA 4QGFA 2JFNA 4YJKA 4DWJA 3DEAA 1AQJA 2IC5A 4FONA 4WOPA 4WEQA 1NX9A 3QLVC 1XMVA 3SQOA 4B3IA 1TQ8A 1X70A 2E4YA 4MB2A 3PFFA 3VZQA 3WSWA 3ZCVA 3P0FA 4UMFA 4KE9A 3G1TA 3H3FA 5E6UA 3U16A 1JE0A 1E8MA 4BAZA 3FF4A 4RVOA 2Z04A 3V2UA 1XHLA 2W2PA 3F3SA 4BL5A 3TJMA 3RFUA 1L5FA 2YHAA 1A3CA 3HY4A 3VSAA 4YB8A 1A7KA 4QU9A 3INGA 3NDPA 4BVJA 3BE8A 3QBVA 2IYSA 3IV7A 4EM6A 4M38A 2DWQA 4D9KA 1LDBA 3I2JA 4B34A 1Q7GA 1ZXXA 2XUDA 4HAIA 3IO5A 2V9CA 1TYEB 3AM4A 1KAGA 4CM7A 4MKRA 5TRTA 2OBLA 4EWLA 4MS1B 1FVFA 3KOOA 4B8WA 3Q3JB 1K92A 4KR3A 2D6FA 4RL4A 4N18A 4JGGA 1D07A 4FGZA 1H8EA 4HKTA 4IG9A 5EPUA 3MBOA 4RV9A 1J22A 1P5ZB 2W4QA 1R5BA 5EXDA 2RGYA 2QBYB 2DAPA 3W9YA 3O9ZA 1DFHA 3OZSA 3GH3A 3WRWA 4QPCA 1QAOA 2JIOA 3FA2A 3H0KA 5BW6B 5DFAA 5JMTA 3TKYA 2PKQO 6AT1A 1JMVA 4DMRA 3EGOA 4BNGA 4WLUA 4BNUA 4XH9B 5G0WA 1XDWA 5ARDA 3WYDA 5CD9A 2PGOA 3UJHA 2H2GA 3LFUA 5HTKA 1EFCA 3CLUC 5BR1A 4I81A 5FDFA 8GPBA 3OF2A 1ZIOA 3TIGA 2XITA 3CLSC 3HLTA 1N5IA 1GJRA 1E1QD 2C84A 2WYUA 1NZJA 4BNMA 1Z73A 1D2NA 3OFVA 4JLWA 4P7FA 3KEGA 1B15A 1G8GA 2X0RA 4AUNA 1CVLA 2PGAA 1GXSB 3A4TA 1ZKMA 4GDMA 3RSHA 3ZHYA 5J58A 1Z5VA 1IJKA 4N1AA 4CE6A 2QDXA 3CJRA 2NPOA 2ZPAA 3M89A 4XQ0A 3O4RA 3A31A 5DXAA 3MS7A 3VDXA 2OGWA 1OVMA 2CVQA 4CIWA 3K9WA 1VBFA 4RY9A 3IAM6 1FRQA 4UQPA 4R1UA 3O4HA 3W04A 2C42A 3CRZA 1C14A 4R6XA 1DTSA 5D84A 1E4OA 1PHRA 4YUAA 1GR0A 1HUQA 4LZZA 3ITKA 2BGGA 8MHTA 3ZLJA 3F3KA 5D1NA 4BQIA 2ATCA 3QWBA 4ZHQF 1PZHA 1V7QA 3FH0A 1AG9A 3T1VA 4C0AC 5HFNA 1XAGA 1B8OA 4ARSA 3HJUA 3SE7A 3VVLA 2LCFA 3MT7A 4ES6A 2HC9A 3VTZA 2YWEA 5HF5A 3X0DA 1IMOA 3V9AA 3GVPA 1A7JA 2IVZA 3AFNA 1FP7A 4YRJA 1MB4A 3A9CA 3G9UA 3COZA 4CEIB 1C3LA 3OQ6A 4MPPA 2QTAA 1ZVMA 3KDSE 4JR2A 1PWEA 2WABA 4FOPA 5K8LA 2VF5X 2FW1A 1T9BA 1LVGA 2I3DA 4HLQB 3KYDB 1CQIB 4RCYA 3SYNA 1H5NA 1SKBA 2ID9A 2Z2IA 3HDQA 2UVQA 3KT6A 3DLHA 2C1XA 2ZS9A 4N65A 4JV5B 2CNDA 1GU1A 1LVHA 3LVBA 1W44A 2PKRA 1OOEA 2HIMA 4G81A 2ATIA 5EXEA 2II6A 3TW6A 4BMZA 5JRZA 4DADA 5B4VA 3Q72A 1E0JA 4U2GA 4QUGA 3L7JA 5ENVA 1MRNA 2R6GA 3EVEA 4CCSA 1G21E 4G4IA 2PFGA 2PKEA 4RKWA 4PRKA 4LRTB 5EI5A 4TM7A 3BRWD 3S27A 3BMXA 3CWQA 3K8QA 1W5AA 3MJ4A 4CODB 4KE8A 2G6BA 3PCTA 3UXYA 2BJWA 5D85A 1YU6A 1AT1A 4IEFB 4KO3S 4Q03A 2G4VA 1ZH8A 3P9ZA 3ZKWA 2VHYA 3M6AA 3MAAC 5I48A 1SKQA 4JP5A 4XVRA 5T57A 4DCPA 3LQFA 3WGVA 2XQJA 1ODFA 1P1HA 1KDRA 4U2KA 1TRHA 4HUQA 2NSLA 5A4KA 3EG9A 2GKGA 5B57C 1MD9A 1UBKS 4PQFA 1YI0A 3VNQA 4X8OA 2GPWA 3FMOB 1HOXA 5F78A 4Q24A 1CJSA 1UDXA 4JBWA 2NAPA 2ZK7A 1CY7A 1X39A 3OWOA 1SJ9A 4YCDA 2IYNA 5E9JA 1A5SB 5CP8A 4CG2A 2DLCX 1JU3A 5K5EA 4WERA 2GN6A 4D99A 3B9PA 4HNVA 1F7UA 3ORYA 3P9PA 3FTEA 2FOIA 3ECAA 3A27A 1Z07A 3UJDA 4Z2AA 4DMHA 3QVJA 4MVJE 4CIBA 1BXGB 1NBAA 2YIVX 3WR5A 4BWVA 4C6SA 1D2EA 3N2LA 2VHQA 5EWLB 3S5UA 4MKFA 2VJMA 3TW8A 4UTNA 3LNTA 5CG1A 2KE5A 4IIDA 4ZTBA 3UHOA 5FLEX 3INRA 5FI5A 2P3LA 5DM60 1IPHA 3F6SA 3UV7A 1NXTA 2PU7A 4RORA 1H1DA 4JUBA 1DKLA 1GKLA 1L1QA 1T4CB 4NFHA 3C8ZA 5CEEA 3HV2A 1EUYA 4U6SA 1Q2XA 2HGZA 4MZDA 3HDHA 1M2NA 2A78A 1KOGA 4B3CA 4NCIA 1IUNA 3R5FA 4TKUB 4CNQA 4DQ0A 2P9HA 1GKUB 4Q3EA 4XUEA 4A2WA 4H7HA 5T8KC 3Q3CA 4KNWA 1TOAA 2A94A 4YRNA 1FFXB 5DX1A 1LBEA 1RABA 3ZCSA 1CW2B 2HLDA 3O84A 2F43A 1J9ZA 1E94E 1LF0A 1OGIA 2RBKA 4TS9A 5TGTA 2UUAB 1TJPB 1LI4A 3DZJA 3TCKA 3WTBA 4OXXA 1LX7A 4FLFA 1DCTA 2CLIB 3DTVD 3SEQA 1PLKA 3RVJA 4FZVA 1U8CB 2JJQA 4L74A 2FMXA 1C0IA 3LCJA 2GMWA 1J5PA 4O25A 4RVGA 2QM7A 2OZKA 4Q3CA 1Q0HA 1IH8A 4EKIA 5KNBH 4GOND 5A06A 5M5BA 3AC0A 1VHTA 3K31A 2Q7OE 1FYXA 2QSJA 3L8EA 2BFEA 3BE6A 3J7TA 3OZ7A 3ZD8A 3HY3A 4DBVO 3I64A 5I51A 2XNKA 3WXBA 1O0SA 2VHUA 2YV3A 2Q5QA 4WZBB 2O8BA 2EZ8A 3ZU5A 1KJJA 4QDTA 4BZPA 3TTUA 1YH3A 1GTSA 2Z43A 3WNBA 3OCXA 3WKDA 1V5WA 3N53A 1V16B 3G7SA 1G2QA 4IVRA 1SEVA 5BN3B 5CBPA 2OC4A 1HLGA 2Y6UA 3DUFA 2CXPA 2V98A 4KSBA 5EQJB 5BOSB 1ULAA 5HBGA 2UAGA 1VHQA 3L18A 5AHKA 1R8YA 3RS3A 1YZKA 3WK5A 2H59A 1BS2A 2YMPA 4DIBA 3TD6A 5ALOA 4BXOA 1H0RA 1B3RA 3NHRA 1GLVA 2Q5JA 4OGKA 4Q7JB 5JE8A 3WNZA 4DIUA 3D7SA 4FJ0A 4PZ9A 3UH1A 3CVVA 3QBEA 3R4VA 4L3WA 4FZJA 3WNVA 5DN6D 2JFYA 3I1FA 3Q88A 2DP4E 4EJFA 3K1JA 2IX3A 1YB4A 1ECPA 5SYAA 2PT6A 1E61A 3VOTA 5K9ZA 2P4HX 4DANA 3KSDO 1CJMA 3I01M 1P4RA 2CMKA 2GASA 1I0ZA 3EXHB 1P9RA 1XK7A 2WIKA 1NULA 2FRVA 1NQWA 5CT5A 5FPKA 2JANA 3MGGA 2YKGA 1GPKA 3B3AA 1DHRA 2NXEA 5EPEA 4QQ8A 2ZR0A 4A23A 4RIIA 4JOCA 5DRYA 2CV1A 5C0OE 2L2QA 4ZXFA 2ZLBA 4E5NA 2YNMD 4EEKA 2NV6A 3BHNA 2ALJA 1YZNA 2PWYA 2HJGA 3QXJA 3LFHA 4JLKA 2H4HA 4ZI7F 3O2QB 5H68A 5JY6A 4WXYB 2QUAA 5FHRA 1Y6GA 2EL9A 2Q6TA 5TPZA 3ZWOA 5HVNA 2EFYA 3QKTA 1LBTA 1PJBA 1N4AA 4CNBA 3MILA 3SR3A 3D7RA 4Z1MA 1C4XA 1DKNA 1KU6A 1GKKA 4K9QA 4RW0A 1WEHA 2EJVA 5C37A 4MRAA 1E2LA 4CPDA 2UVPA 3IALA 4MQEA 3OFKA 3S44A 3TRHA 3V7FA 1I13A 3THWB 4PYIA 2E9SA 1N5RA 2FX3A 3DO8A 3UMRA 3DHYA 3LSTA 1SCNE 1Y6FA 3B6KA 5JNUA 4FT4A 4LOJA 2BUCA 3BJMA 3SYRA 3RABA 3EDOA 1U2DA 2G63A 2ISSD 3JQBA 3W5HA 3K0BA 3Q4GA 4RELA 4BNIA 2ZQZA 4DC0A 2CJWA 3DEZA 2DERA 2AOWA 2GKSA 2PKQP 3L7OA 1R7RA 2NSYA 4KRFA 3WOHA 4FQ8A 4Y2RA 3I52A 1E3JA 3ZGNA 2CL0X 4M0UA 5EUCA 3DLIA 4LZNA 1QO7A 4IINA 1PJTA 4H6XA 4PS0A 4C06A 2CFTA 2A84A 4AKTA 2QE7A 1W30A 5A3RA 4MJLA 4Q4AA 2IDZA 3E3AA 5B3KA 4ADSG 1Q19A 4QT0A 1I6LA 4MKHA 4XLZA 1TD1A 1ZH0A 2OV2A 4OF4A 2HB6A 1KARA 4RTSA 2QYHA 3CRMA 3N9IA 2PX3A 4M8IA 5FFNA 1OFGA 3TLEA 3M9WA 2WWWA 4M4SA 2REXB 2CW5A 4JB8A 1LSOA 2R6DA 3Q40A 1N6LA 3L6DA 3KTAA 2H4FA 2JJ2D 2YV2A 3R5JA 4F9FA 2OGSA 3QK7A 5KQPA 1OZHA 1JT2A 1GAQA 4XGNA 1SVOA 1DMSA 1POXA 1Q3TA 1XIVA 3DA8A 3TRIA 2XB4A 4DQVA 4D96A 1P6QA 2OD2A 3NWOA 5EQDA 1ZUNA 1XDSA 2WKWA 3RANA 4ML3A 4RNCA 4EBBA 4HRVA 4YVFA 4F2HA 1H69A 1QDLB 1E64A 1LNSA 3NHZA 3PNYA 4F5YA 2AKAB 4CKBA 3VKGA 2OHHA 4PG7A 4LE1A 2IZ7A 4J0CA 4XYLA 3AVXA 1JZSA 1AK9A 2HA2A 3AM1A 1R0WA 5EJ8A 3A6EA 3FHJA 2NW6A 4K28A 3SPXA 3VSCA 5B7PA 5CIQA 3MHTA 3RC1A 3PFBA 4OMCA 1FIUA 2V7PA 4BHTA 1LPOA 5DTQA 3BZUA 2G0AA 3VOSA 5EHNA 1KGSA 3TIIA 2VSNA 4I5EA 1EINA 1G5IA 2F2TA 4NS4A 2PUGA 4QUHA 3A1TA 4U2BA 3EBOA 4UBJA 1F51E 4GLJA 4LE0A 5KKNB 1R3UA 5EXPA 2OHVA 1RWOA 1JFSA 4OJNA 3E7WA 3NM6B 5CNJA 3TZLA 2PAAA 3NHPA 2TMKA 1NQVA 4H3HB 2PBZA 4NCAA 5GM1A 3BJZA 2BEJA 4U2EA 4JL6A 2QRPA 2IBMA 3ROXA 5FPSA 4FGUA 4BGDA 1G60A 1CZKA 1BH2A 3WGQA 1LC3A 1ORRA 2WJGA 3TNDA 4JAVC 3SE0A 4LFAB 4L0DA 4KBYA 3VYUB 1OPRA 1NLZA 4FINA 1RHUA 3P2YA 1A88A 1VQ1A 1CQXA 3B8HA 3R3XA 1I1HA 4PXSA 1JXOA 5EJAA 2OLEA 5BT9A 3ILXA 2XCTB 1D1PA 3U7RA 3GLIE 2C99A 5AQEA 3NUGA 4BAGA 2GSDA 5C5EA 1ZJWA 4ZCIA 2CHEA 2PR7A 3GRVA 4IP0A 1SOAA 5B58T 1XPOA 1HG1A 3GLHE 1DAIA 5CFOA 3ASUA 1TVKA 3PVCA 2Q4BA 4GRDA 4JYMA 1MVOA 3T3DA 3P2MA 4OA8A 1SMKA 1U7HA 2IXTA 2EW2A 1FJHA 2O50A 3AERB 3Q11A 4OLHA 3I28A 5DYGA 2ODQA 4BLTA 5BV0A 5H81A 4GYKA 3LP6A 1CIPA 3KAQA 4Q21A 1UQRA 5BSMA 4BUCA 3H11B 4Z51A 3KZVA 5JFTA 2BGKA 2XNDD 3VR3D 2IEZA 4RDIA 5J2TA 1OXXK 3MWJA 4XDHA 3RVLA 5FOXA 4NTZA 4QPDA 4X1OA 3ZXIA 4IM7A 5BSHA 3OICA 3HJNA 3WGNA 2OQRA 4K9PA 3W4JA 4LHXA 1R1DA 5KWEA 3GZ4A 2VP0A 4GX0A 4L3VA 3T0FA 5JW6A 5I9SA 5JSQA 1U5CA 3Q9SA 2VPTA 1QRDA 3FVQA 3ML1A 1UMDB 3QX8A 3KJZA 3G2PA 3P2JA 3VUEA 4DWOA 4RJTA 2VP9A 3FDZA 3MZ0A 4PZUA 1NJGA 1RLTA 1B16A 1H93A 4ANFA 3K5WA 1U0FA 3LC0A 1L5MA 4EG3A 3QENA 2LBPA 4DL9A 3H4VA 3KOXA 1W76A 3K6SA 3WWOA 1EI9A 2QWXA 2IS2A 5A05A 4EDFA 1BW9B 3WNDA 3GT7A 4DOMA 1CS4C 3UMYA 2WWHA 4EKEA 1C1HA 1RXCA 1RYZA 2D2EA 2G9UA 3A3PA 1J5XA 1KRHA 4GWGA 1Q12A 1D2MA 2H2AA 4FWTA 3O0DA 2BD0A 1V9LA 5LMZA 2C92A 2GZMA 3IIKA 3LWDA 3HFGA 3OKCA 5DTRA 4Q9AA 3NMUF 1CRQA 1GCUA 5JU6A 2PZ8A 1PD0A 3EZ6A 4I55B 2E89A 4D98A 1VBKA 3H99A 3IR5A 1JBEA 4PPNA 1ZJZA 3VPAA 2GYWA 1NUPA 3TSCA 3RWOA 3G6WA 3Q6NA 3T5PA 4B43A 1RBMA 4PQRA 1N6RA 2AZDA 4ATNA 3FUWA 1QH8B 4FHZA 2IYOA 3X2FA 1E2BA 1E32A 4CU5A 2GFQA 1G7SA 3VUFA 2ECQA 3M83A 3Q87B 3IJPA 1CSEE 4JP8A 4GE0A 4BVKA 2FPKA 1WHSB 1USVA 4HGNA 4BIIA 3T52A 3KCNA 4O08A 3EXIB 4ND8B 4FM9A 4YCMA 1J2RA 3JRNA 4NAUA 2E5FA 1UMBA 2O0MA 3E8SA 4PTYA 4FN5A 3THYB 4BQEA 4QREA 3HUUA 2JLXA 3H75A 5CU7A 5HNKA 1MX3A 4QHYA 1UKVY 4N41A 1B26A 3I01A 3R0IA 4G0PA 1N57A 4DVJA 1H4VB 2R85A 4KX5A 4Q9LA 1V6SA 3NJ8A 1EFVA 3IAUA 4OXNA 4RNDB 1KDZA 3GMDA 5EUBA 5H8WA 2PUHA 2RDMA 2VC2B 2ZIFA 2X3YA 1IEQA 5FORA 4GXRA 2D0PB 3PC2A 1ZHOA 4RZUA 3HDVA 4IZ6A 4X93A 4C4RA 4YNBA 3WICA 1UC5B 2Y99A 4EGFA 5K0SA 1JWLA 3TL2A 5IVKA 3IP8A 1UDAA 2JEZA 4JVOA 3TJRA 5A2QA 4DT1B 2HWUA 2IDKA 4AZSA 1TFRA 1CHNA 3RK1A 2O5RA 1D4ZA 1IJEA 4L3OA 5LXTF 1PS8A 1QIEA 1WVMA 1RAHA 3QX3A 1UM9B 2ZRBA 3GL9A 1P1JA 2XZTA 3A6FA 2CDBA 5JPIA 3OTWA 3T54A 1IRXA 3GVCA 4BDSA 4BGIA 4HVCA 2IJGX 3WMRA 2JGAA 2VHZA 4RJLA 2WU4A 3WY9A 3IB6A 4CU2A 3IT1A 3WNQA 4HTFB 1RHKA 2GSWA 4AF8A 4B7ZA 5LMCA 2FZGA 2HPVA 5LL6P 4MPJA 3D8TA 3QX9A 3VQTA 2JASA 3ZV6A 4BKUA 3JVVA 5ALNA 4ND6A 3LUPA 1U7XA 3IULA 1O3YA 1NL3A 3MWDA 3OCVA 4OGFA 4EI7A 9GPBA 4RSMA 4ENUA 2DOKA 3EF1A 1N34B 3KQVA 3GEGA 2F59A 3IQDB 3REFA 3TFWA 1JYFA 2X3FA 4LSGA 1MRZA 3LHFA 5F1OA 3S68A 3VR4D 1WCIA 4E5MA 3OLQA 4L08A 3K0CC 2PO7A 3OQIB 1P91A 1RZ3A 4B7AA 1P3Y1 2Z8XA 2FFQA 1F8FA 2ZI3A 3FF1A 2GCNA 1FLNA 4KXYA 1VHJA 4U8HA 2I4MA 1MDBA 3EZNA 4XWYA 3TGWA 2YVKA 3PQDA 2A67A 2XQKA 3KFXA 1PZNA 4PHFA 2FEAA 4BB9A 2FSHA 3PUHA 5E9AA 3AP2A 4P80A 3ZWYA 3ADDA 3ZLBA 4I4LA 1COZA 4MSUA 1OV4A 2DPXA 2OGUA 3BXXA 3H83A 3MEQA 2WPDD 4V2UA 5F52A 4YMVA 8ABPA 5H1YA 1ZN2A 3G2NA 1KKUA 3CX4A 3OTIA 2BISA 3R3WA 2PKCA 2Y76A 4E2XA 5KYVA 3OTHA 4S24A 4EGCB 1Q95A 3QFTA 1QAMA 3P5SA 2RI6A 1TU3A 5ENZA 3U3KA 2P6MA 4EHHA 4KHPB 1E3WA 3RVQA 2QT1A 2HMVA 1T8WA 1X9GA 1IHUA 2CJYA 4LOLA 3Q7RA 4KLAA 4Q6WA 3RFFA 2EZ9A 4EW6A 2B34A 2EF1A 3FVRA 4B6SA 3DTYA 2H16A 3VTAA 5KTYA 2FPRA 3RYCA 1DAHA 2LTAA 4X3CA 5DHPA 1GFSA 2XTMA 3WVNA 3PICA 1IHDA 5IRCD 1DPGA 4RE6A 2AYYA 3NB0A 4JLPA 1K75A 3VYTB 3TTVA 1NXQA 4M9SA 2BE7A 5B3LA 1V45E 2VHXA 1JG4A 4OGWA 3DWIA 4WUVA 2JLWA 2GXAA 2QN7A 1XJ0A 2EX4A 1JEDA 4C20A 1K89A 1QVAA 3A14A 3TFQA 4UPEA 5KTPA 5C51B 2ZSJA 1RPNA 2EG9A 4FFSA 4A10A 3QFCA 2ZREA 1OPXA 5BQOA 3SBEA 4EI2A 3HU3A 4PQYA 3Q2KA 3QKRB 3TVYA 4OBXA 2FSGA 2I8CA 3G2JA 2ZRIA 2G9ZA 4DMGA 2CFIA 2ZM5A 3UOWA 4RLSA 3JYNA 1AV6A 2OLJA 1XRRA 3BIOA 1E1KA 3NBUA 2YWFA 3VC3A 3C3YA 2FN4A 5BRJA 2BI8A 1FLAA 3QVKA 1CCWA 3B70A 4FYPA 3EZ2A 4I4NA 1JDPA 1GZUA 1KMCA 2XE8A 4QYSA 2IYZA 4D8YA 2SHKA 3R3ZA 2B8WA 1XCBA 1JXAA 1W9MA 4ZWNA 4F3NA 2LPMA 5KDLA 2VDPB 3KKQA 4J3JA 5J43A 1KK2A 3UGQA 4U02A 4Q4CA 2JD2A 1V25A 3FYUC 3NAGA 1P5RA 3VH1A 4HB0A 1Y8ZA 1G8YA 5E2IA 3WX0A 1QPZA 4HHEA 2FPXA 1YB6A 2WG0A 5MN6A 1J42A 3OA0A 4MVWA 4ZOCA 3T7TA 3W4IA 5C5IA 5CLHA 4US0R 2GZDA 5T4EA 4BWFB 4UJ5A 4DQDA 4CIAA 1GU7A 2A57A 1OT5A 2AT1A 3Q3IA 5EE9A 3PVZA 3VV3A 3ZIAA 3K0FB 2ZAOA 3A9SA 4JDUA 3MB8A 4CF5A 5DASA 1XRLA 1N6KA 3ZZMA 3EXEA 2YOFA 1BE6A 2WFMA 2OGZA 3NRBA 1L9KA 1V11A 3WOVA 3IV9A 4BEBA 4EY6A 1WY7A 1QHHA 1Y6RA 4O8CA 1P1RA 3SKXA 5EMMA 2ZKIA 5IYZF 5CA0A 3VXKA 3ZE8A 3G9XA 4B5LA 4J7CA 4CRWB 1PDOA 4E2WA 5BNWA 1Y8QB 2GFIA 4BMOB 4ZTUB 4C6RA 3IHTA 1DJQA 5EUQB 1YJ5A 3FWPA 4KL8S 3T06B 5F9MA 1BJTA 1ZL2A 4D3YA 5DN9A 3BGVA 5L6LB 4W7IA 2XJ4A 2YL2A 4FFVA 2ZTVA 3RHTA 1D8AA 3GGOA 2ZB3A 3ZIDA 3HP4A 4M8KA 3B1KA 1LFAA 1TCAA 5BWMA 2IL1A 3BXZA 1K4YA 2BV3A 2P6OA 3P9SA 4MQMA 1CUHA 4Z7JA 3KKMA 4ZYZA 2DKNA 3VJRA 1P31A 3NJ4A 3TL6A 3AEYA 2WM8A 5C1DA 1YDWA 4OP3A 1MW8X 5GGXA 1PK7A 2DQZA 3PITA 4P36A 2V7VA 4H2DA 4D9GA 4EUHA 4RVDA 4G9BA 3EEOA 4F4JA 3P0RA 4B6JA 1H6DA 1D0SA 4M53A 2Q46A 2O8CA 3DLTA 1CUYA 1FCJA 4XA8A 1VL6A 10MHA 3JAWB 4O2BA 3IO3A 1QRSA 2O8DB 4GXQA 4H6VA 1WDKA 1N2CE 2WINI 2GN2A 3FYUA 3JVUA 3QYJA 2HMUA 2F7SA 4G41A 4ZIRB 4TWAA 1WQ1R 1M34B 4UNSA 1U3WA 1W52X 3EGCA 2D1TA 3CH7A 4I9UA 4QJ5A 4WKBA 3RG8A 1WM1A 3H9GA 3AESB 3E9CA 4II7A 3LSYA 3MERA 5CCXA 2R7MA 3QOYA 2VBCA 1Z2PX 2H1WA 2Q5FA 4OHRA 4B6QA 5C5CA 1PNQA 4UHKA 3SJUA 1SO8A 4Q34A 4ECAA 4Z7OB 1QX3A 3NO4A 3PV0A 1M8FA 3KYCA 2E4WA 3PX2A 3T7CA 3ZU2A 4Z54A 3D4OA 3GJ6A 4WH0A 1BMTA 2VL7A 2VA9A 2OCKA 1O97C 4B33A 2EWVA 3CF6R 4U3JA 3UWOA 3AR9A 1G20B 1JW9B 1YAHA 1L2TA 3F8TA 3GCZA 3KSUA 1I7LA 2Y1KA 3CT6A 2G5CA 3EC7A 1JVBA 1F14A 3AGPA 3IBYA 3OE1A 1W85A 1ZPDA 3OFSA 1E2EA 4R1MA 1IB6A 1YSCA 5L3QB 2P1ZA 1ZD1A 2QXYA 5DBHX 3GFTA 4IUDS 1DBSA 3NTRA 4WTOA 4FNOA 5IU6A 3HWRA 1W2WB 3A1UA 1YO6A 1MH1A 3PK0A 3CUKA 2OCDA 3VI4B 4PQEA 3TBFA 3OCZA 4LYDA 5LU9A 3SDBA 4HBGA 4YP9A 2AI2A 1Y3CE 1QP4A 4B09A 2AE1A 1E9CA 3ZK8A 2Q21A 1YAJA 4LNHA 4F9GA 3DZCA 3S40A 2I3ZA 2B8NA 1N2ZA 2DR3A 1I3LA 3L93A 4NS1A 3O3OB 1FVOA 3TZKA 1PLLA 2WSSA 5H0IA 5SY4A 1O9BA 3Q2IA 3Q3GE 1YE8A 5EGNA 1MJNA 2FXVA 1N5MA 2QTHA 3NALA 3A1CA 2WJ4A 1TPZA 3JQGA 1BCSA 3L8YA 3R09A 4Y2PA 1A8QA 1T2FA 3RROA 4DLTA 1QS0B 3DDNA 2NV0A 1Y7PA 2OZLA 4A03A 1QH0A 3T15A 4EY5A 1X7YB 3N70A 5FAKA 1AGNA 4I5IA 4DNQA 2GF0A 4ZVPA 1GVNB 3A4LA 4LGYA 3RHSA 4OHZA 4ZTZB 3FNQA 3HI6A 2BW0A 5AUQA 5T4HA 1K9VF 1MT0A 2HU8A 2ZB4A 4MYUA 1GILA 1A9ZA 4Q00A 1AZSC 4XM0A 3L4SO 4B80A 4LV6A 5ESWA 1EUCB 4MYDA 5H3LA 1X0VA 1N2SA 1N3BA 4OGLA 4HN2A 5HCIA 4HWGA 4DA6A 2OM2A 2NACA 2Q27A 3K96A 4Q05A 3IH5A 3FOFC 2AI3A 3BD6A 4H16A 5GONF 2N0SA 1AKQA 1Y6QA 2WBLC 1F0KA 1QKKA 3NCTA 3GXBA 3IT2A 1EXWA 2AQKA 3BL6A 3KWMA 3L40A 2WVGA 2ZYVX 1XZMA 2PT7A 2A5LA 4P4LA 1AKUA 2OYSA 3KTDA 4L9WA 3VU9B 1SQ0A 3LQ2A 4JJIA 4ZAFA 3IVAA 1SUBA 2NU6A 3DOCA 1ZCZA 2CHUA 1PS9A 3BRSA 1V1MA 4KWCA 5KTNA 5UKDA 3GGSA 3PNKA 4U9UA 3REOA 2GBGA 3VU3A 2DT8A 5DM1A 3QSGA 2Q5OA 1DX6A 1JKIA 5FR1A 3ZZTA 3VV2A 4E3ZA 4N5MA 1C1DB 1Z33A 4EW3A 2LNDA 3OPVA 4EFKA 4ENTA 1S1CA 4Q9HA 3VM6A 3OC6A 2H9YA 2P2DA 3E23A 3H87A 1YJAA 4DLLA 4D9JA 4LC1A 3PR2B 1KSGA 2H08A 4H3SA 1E4VA 1L7RA 1IONA 3KOUA 2JVKA 4KYVA 5IT5A 4BQRA 2C57A 3RYHA 3IUYA 1LQ2A 2F9MA 1VSBA 3C7DB 1JQKA 3KYBA 4KBGA 4LHSA 1AX9A 1GIAA 1FFHA 3LUGA 5HF8A 5GIPE 1N33B 4LA4A 3S0JA 1Y1QA 3AB8A 1LJ8A 3ONNA 3BXPA 4OYRA 1B6RA 1BX3A 1DAKA 4ZT5A 1EJ6A 4LKOA 2DFLA 3AEZA 3SF8A 5DNWA 5EJ4A 3T1HB 1N5KA 2WI8A 2Z8ZA 2RHJA 1ZRMA 1HFEL 2WFZA 3TZCA 1JFFB 2O9JA 3DSRA 4YRGA 1HURA 4RETA 4FMDB 3INTA 3SOZA 1VL2A 2YFKA 3W77A 4CQNA 3W5SA 5KCMA 3H9UA 4MLPA 2XE6A 1FQKA 3KQSA 1T9GS 3DONA 2X9NA 3AM5A 4US2R 4I4TB 3KR1A 1R4NA 4G1FA 4YGYA 4LZJA 2Q0SA 3LDUA 2Q3MA 2PD3A 2BCEA 2WLSA 1PJSA 4FYHA 1VI2A 2GD0A 1PKXA 3FCYA 4GHWA 3V7NA 5B1EA 1W4ZA 5LQDA 5BT8A 2J0SA 3OU6A 2O2SA 4HDCA 1YACA 5LYJA 2IS1A 4PHTA 2DE0X 2FTKE 1IN6A 5F2NA 1SKYB 2PIAA 1CDEA 4XVQA 4C1BA 2WUVA 4ZJZA 1ONSA 2C4NA 1NBME 4IGFA 4REOA 4YIKA 1B14A 1F5NA 3GCXA 4AO8A 1ZJ5A 1VPDA 1A9RA 2ZBRA 1YKSA 4PZYA 1C8LA 3IAM1 4CEJB 1QZZA 1P4JA 5DCLA 2QJRA 2XMZA 3UENA 2X5NA 1C9DB 3CONA 3RIXA 4GL2A 5CX4A 3GLFA 1BVUA 2VDMB 3K7EA 3T3MB 4EY8A 5C8YA 1NC1A 3L77A 3LVQE 3SC6A 2DKFA 3AR3A 1E6KA 1HTBA 3EXFB 3MS2A 4I6JA 1KH2A 3EF0A 2WWFA 3NFYA 4NJOA 4D2IA 3U4AA 4XWOA 1AN0A 2AOVA 3FYCA 4LMPA 1M9NA 4MYTA 4IVNA 4R1PA 1W88B 3DFIA 4XM2A 5LM3A 2BVNA 1CERA 3GRYA 4S1PA 2G7ZA 4B85A 2Y1GA 3W6ZA 2VBGA 4J07A 4AJ9A 4PM4A