3OPRA

Esbl r164h mutant of shv-1 beta-lactamase complexed to sa2-13
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
265
structure length
258
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDHALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Ligand-dependent disorder of the Omega loop observed in extended-spectrum SHV-type beta-lactamase.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 92
structure length 258
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3oprA00
3V39A 3LCEA 1SCWA 4DE2A 1DJCA 4EBLA 3FKWA 3HLFA 5DTTA 5F1GA 4PM5A 1SDEA 4K0WA 5CTNA 5A93A 3MKEA 1MY8A 4K0XA 3NC8A 4OQ0A 4WEKA 3OCLA 4FCFA 1YMSA 5FQMA 1HZOA 2OLUA 1PW8A 3PAEA 3IF6A 4FH2A 4WZ5C 2WUQA 5M1AA 1PWGA 4ZJ1A 1BLPA 2WGVA 4WEJA 1FR1A 4R0QA 5HL1A 4OOMA 2XEPA 2H10A 5U47A 3ZG5A 1PWDA 3G32A 4PM6A 3GVBA 3GMWA 4WMCD 4N92A 1TEMA 5FQKA 5GHXA 3RJUA 4KZ5A 5HFOA 3TOIA 1VQQA 3C7VA 1KE4A 4N9KA 3PBOA 5TGFA 1MBLA 3UN7A 3UPOA 4Y7PA 1MXOA 4WYYA 1M40A 2XFSA 1E3UD 5EOEA 4LCLA 1FQGA 2DRWA 1XP4A 5DF7A 5GHZA 3ZG8B 1XX2A 3ITBA 3IT9A 1L0GA 1L2SA 4S2IA 2ZM2A 1LLBA 4HBTA 5DF8A 3HL9A 3MXSA 1LL9A 1YLWA 3UPNA 3M6HA 2ZQAA 4H8RA 4OQGA 2ZC4B 2EXBA 2J9OA 2X71A 2ZQ7A 2HPBA 3MXRA 4JPMA 2Q9MA 3IH8A 1JVJA 3N4IA 3HLBA 4X69A 4HEFA 4KQQA 2VGJA 3WS2A 4ZTKA 4U0XA 1CI8A 5J8XA 1DY6A 1Y54A 1YT4A 5GHYA 4X68A 1K56D 5CHJA 4WBGA 1JWPA 3HLDA 3Q7VB 1NZUA 3GRJA 1GHIA 4OH0A 5FASA 1FCNA 5AQAA 3P09A 4GD8A 1SKFA 3UY6A 1I2WA 3V5MA 4KZ6A 5D3OA 4DE0A 3HLWA 3IF6C 3RXXA 1SHVA 4BD0A 3IXGA 2VGKA 3ZNYA 3GTCA 4E6WA 5F1FA 3A3DA 3UE0A 4LENA 2QPNA 3VSKA 3HUNA 4KG2A 1LHYA 4JXGA 2V1ZA 4KZ8A 2WKEA 2BG1A 3CG5A 2OV5A 3Q1FA 5EVIA 3N7WA 2JE5A 4FSFA 4PM9A 5BOHA 2V2FF 4E3JA 3HLEA 4R3BA 2EX2A 2WADA 2Y2NA 3LY3A 5E2EA 4R3JA 4BJPA 4OP5A 5E2FA 4RA7A 4R23A 3ZHHA 4ZBEA 3ISGA 4EUZA 2H0TA 4BQMA 3W4PA 4P85A 2P9VB 3DW0A 5CERA 3VOYA 1BT5A 5A92A 3HUMA 3B3XA 3PBNA 1BUEA 3A3EA 5FA7A 3VFHA 1S0WA 4BD1A 4JF5A 4UHUA 2ZC6B 1BULA 3C4OA 4EQIA 5AQ7A 4FD8A 1K4FA 2Y55A 1DJBA 1KVMA 2JBFA 4X6TA 4BENA 5DTKA 2EFUA 5EE8A 4B88A 5CEDA 4YFMA 2DCFA 2ZM8A 3HLGA 1J9MA 3VFFA 2HP5A 3IF6B 4RYEA 4OP8A 2B5RA 4OOLA 2X02A 3C7UA 3FKVA 4XUXA 5G18A 2XGNA 3IXHA 1YM1A 4B4ZA 2ZC5B 1KE3A 4KG5A 4O7DA 5L2FA 3BM6A 4S2PA 4WELA 2EFXA 4EWFA 5GLDA 3OZHA 3BLMA 4K91A 1YLTA 4OQIA 4ZJ2A 4LV3A 1VM1A 5M18A 1ES3A 1ZG4A 3EQUA 3NY4A 1NYMA 1FCMA 2OSUA 5GL9A 4GKUA 3WS4A 1FSWA 1O7EA 1K6RA 4QU3A 5E2GA 4ID4A 2UWXA 2EX6A 4KZ4A 5EUAA 1ES4A 2WKHA 5EVIC 3BRMA 3OPRA 1G68A 2ZQ8A 3UE3A 2JC7A 3A3IA 1BLSA 4U3TA 3WS1A 1NRFA 1PZPA 3TG9A 2XD1A 5TR7A 5CGXA 4L0LA 4C3QA 5CECA 3IQAA 4IEDA 3OPPA 5TFQA 4IBRA 3UPPA 1RP5A 2Y59A 2XD5A 1BTLA 1K55A 4S2KA 3BYDA 3UDIA 3ZDJA 3Q81A 2GDNA 2ZMAA 2Y2GA 3GQZA 3LY4A 4NK3A 4OLDA 4PM7A 3ZVWA 4D2OA 1IYQA 5HAPA 5EOOA 1BSGA 1YLPA 2V20A 3DWKA 4JXVA 3ZGAB 3V50A 1KVLA 3A3FA 3FWLA 4DKIA 1ONHA 2FFFB 4Y0UA 1Q2PA 2ZQCA 1K25A 4UA6A 3M6BA 5CGWA 1HVBA 3GV9A 4U0TA 2Y2MA 3VP4A 3QNCA 4BL2A 1FSYA 2Y4AA 5AQ9A 3S22A 3SS4A 4C6YA 3O87A 4QHCA 4R4SA 3SH7A 4E3NA 2XDMA 4ZAMA 5IHVA 3RXWA 3N8SA 1U60A 3I7JA 3HUOA 4MNRA 5E2HA 1MPLA 5EVIB 3JYIA 3SS5A 3DWZA 2IWBA 1EROA 4FH4A 5HAIA 1W79A 2X01A 1ALQA 1PI4A 2WGWA 1YMXA 2Z2LB 3O86A 3E2KA 5CHUA 5F83A 5FI6A 3M2KA 1ZC2A 3N6IA 4OOYA 1O07A 4QJGA 1H5XA 3S1YA 4DE3A 3A3JA 5JYOA 2ZM0A 1PW1A 1I5QA 4OKPA 5FI2A 4KENB 5EVID 5DTSA 2A3UA 2XK1A 2C5WB 4JF6A 2RL3A 3NDEA 1GA9A 5KSHA 3Q7ZA 4GN2A 4LV1A 3ZVTA 3HREA 1LI9A 4EV4A 3N8RA 4LCMA 5A91A 2PU2A 2Y2JA 3DTMA 3MZFA 4XXRA 3AGDA 2FFYA 5CXWA 4JLFA 1LI0A 4S2LA 1FCOA 2XQZA 2QMIA 3G4PA 4DE1A 5GLAA 5FAPA 4CPKA 3LO7A 2HP6A 1E4DA 4OLGA 3NDGA 5FI7A 3VP3A 4OPRA 5JYPA 1ONGA 1K55C 4X53A 4OQHA 3G31A 1C3BA 4S2OA 3PTEA 4RVAA 1JTDA 2XFTA 4KQRA 1WE4A 3IWOA 3SH8A 5FDHA 4F94A 1QMEA 2Y91A 3ZFZA 2WKIA 4P6BA 2R9XA 3IWQA 5KMWA 1TDLA 5HAQA 1ZKJA 3GR2A 1IYOA 1CEGA 2HDRA 1W5DA 4DRTA 1H8YA 2RCXA 4EBPA 3UDFA 5F82A 1LL5A 1Q2QA 2ZQDA 4KZ7A 1XGIA 3PBTA 2WZXA 4QY6A 3ZCZA 1TVFA 2WGIA 1NXYA 2DNSA 2Y2HA 4RX3A 1L0FA 1RGYA 3UO9A 1FR6A 2WAFA 4JBFA 3O88A 2OLVA 3WRTA 3D4FA 3VSLA 4MLLA 1N9BA 4P87A 4X56A 4GD6A 2CC1A 5CGSA 1PZOA 3MZDA 3NCKA 5FQJA 5FSRA 2XR0A 5EECA 2EX8A 4RX2A 3SH9A 1XGJA 3PBSA 1MWUA 3VMAA 1W7FA 2HDQA 1XXMA 2J9PA 3PBRA 4E6XA 2IWDA 2HDUA 3G2YA 2WAEA 4N9LA 3MBZA 1K4EA 4WZ4A 4N1HA 3TSGA 2Y2IA 5AQBA 1SDNA 3V3SA 3NI9A 3WRZA 3OPHA 1IYSA 1M6KA 3HBRA 4JKTA 1JWVA 4Y0OA 3BFEA 3IHAA 3ZG9B 1JWZA 2Y2KA 3BEBA 1ESIA 3BLSA 1IELA 2WZZA 2Y2LA 1YLJA 2ZQ9A 1K6SA 5FAQA 4DXBA 2P74A 2H5SA 5FQIA 2E8IA 3W4OA 4A5RA 1RGZA 2BLSA 2IWCA 5EPHA 5FQQA 1YLZA 2EXAA 4DDYA 3FYZA 3LEZA 4R1GA 3E2LA 4DF6A 3WS5A 3BFGA 2Z2MB 3NIAA 1G6AA 3UNWA 1E25A 5CRFA 1S6RA 2XF3A 3BFCA 5FAOA 3IXBA 3S4XA 3VP1A 1IKGA 3FZCA 4GOGA 3SOIA 4MBHA 3BFDA 1ERQA 2HDSA 3G30A 5CHMA 3NBLA 5EVLA 3SS3A 1PI5A 2ZLYA 1KDSA 2Y2PA 5DF9A 3QNBA 1PWCA 4LV2A 3OPLA 2WGWB 5FATA 3HLCA 2I72A 2EX9A 5E43A 1K57A 3W4QA 1N4OA 2WYXA 3OCNA 4S2NA 1KGFA 2G2WA 3Q82A 1K54A 4HESA 4BLMA 4PM8A 4WMCA 2J8YA 2J7VA 3Q07A 3EQVA 4S2JA 1HD8A 1YQSA 4CJNA 2PBYA 4PMAA 1ZG6A 1WYCA 1FOFA 5HARA 4OPYA 1W8YA 3C5AA 4MBFA 3M2JA 3VOZA 1E3UA 1GA0A 3QHYA 4Y0TA 1ES2A 1BLHA 3UE1A 2G2UA 4OPQA 1JTGA 1IYPA 3O3VA 4GDBA 4IVKA 3G34A 4GB7A 4QD4A 4DXCA 3FV7A 4KG6A 2Y2QA 3ZG0A 3V3RA 4ZDXA 3MKFA 3AGFA 4E3OA 2ZD8A 1ES5A 2PU4A 1MKIA 1MWSA 3OC2A 1I2SA 5GLCA 2Y2OA 1DJAA 5M19A 3BFFA 3BECA 2XH9A 4GDNA 4XUZA 2H0YA 4GZBA 3WS0A 5A90A 3WWXA 1CI9A 1CEFA 4Z9QA 3GSGA 4IBXA 3PBQA 4PPRA 3VP0A 1Z6FA 3HVFA 1GHMA 1K56A 4IVIA 1KDWA 2A49A 2ZC7A 4OONA 5KSCA 3CMZA 4P0MA 1KE0A 5KZHA 4X55A 1XA1A 1MWTA 1NY0A 4ZJ3A 2XLNA 1K38A 4JF4A 4QB8A 3IXDA 1NYYA 3C4PA 5CEBA 3IF5A 4KZAA 1CK3A 1NJ4A 1QMFA 4WZ5A 4BL3A 4YINA 1RCJA 4GNUA 4R4RA 1EWZA 1NZOA 5HX9A 3ZNTA 1XKZA 4E3KA 4KZ3A 3Q7VA 1GCEA 4JXWA 3IHBA 2Q9NA 4C75A 1IEMA 4UA7A 5CTMA 3P98A 4JXSA 2HP9A 1K57C 3AGEA 4S2NC 3VP2A 1L0DA 4MEZA 3ITAA 4B4XA 2WK0A 1K54C 3PAGA 1OMEA 3G2ZA 4E3MA 3CZDA 1KGEA 4DDSA 4KZBA 1WYBA 1BLCA 2QZ6A 4Q8IA 1XA7A 1YLYA 3N8LA 5HW3A 1H8ZA 2JCHA 2ZC3B 1MWRA 3G35A 4OPZA 4UAAA 3CJMA 5DVAA 5FQ9A 3ZG7B 5I94A 3UDXA 1TDGA 4LV0A 3IH9A 1KGGA 3IWIA 1HTZA 1L0EA 1AXBA 1ESUA 3W8KA 1XPBA 2ZJ9A 1EI5A 3MZEA 4QY5A 4WM9A 2R9WA 4NETA 4E3LA 4N1XA 4UA9A 1PYYA 5GLBA 4M3KA 1BZAA 2P9VA 4EBNA 1W8QA 4MBKA 1IKIA 4E3IA 4HBUA 1GHPA 2C6WB 3MFDA 4S2MA 4KQOA 4OVDA 1PIOA 1ERMA 4KZ9A
chains in the Genus database with same CATH superfamily
1F2KA 4MCWA 5A93A 4K0XA 4OQ0A 1YMSA 3EGDC 5FQMA 1HZOA 3PAEA 3IF6A 4FH2A 1K0KA 5DJTA 1LSXA 3E98A 2R78A 5U47A 4BWIA 1PWDA 2Z6DA 4DJ3A 3C2WA 3RJUA 4KZ5A 3UPOA 1M40A 1VEUB 1E3UD 5EOEA 1NWZA 4LCLA 5GHZA 1XX2A 3ITBA 4S2IA 2D02A 1YLWA 3IBJA 1P97A 3M6HA 4OQGA 1Z09A 3A0SA 1JVJA 2OOLA 3HLBA 1PNEA 1TS6A 3F1NB 4KQQA 4EQ1A 4U0XA 3R4KA 1DY6A 3LR3A 3QP8A 2PHYA 1FCNA 2V8CA 4ARZB 1DRMA 4DE0A 3F1OA 3TW8A 4BD0A 3CWFA 4XT2A 3UE0A 4LENA 4KG2A 3UB8A 1VHMA 4KZ8A 3PHYA 5FDSA 4PM9A 3HLEA 2EX2A 4BJPA 1XJ6A 3IS2A 4BQMA 3W4PA 5CERA 3VOYA 1OJ5A 5FA7A 3A3EA 3VFHA 4AFIA 1D06A 4EEPA 2ZC6B 1BULA 1J3WA 3QP5A 4CLCB 5CEDA 4B88A 2DCFA 4L9FA 1FIKA 2B5RA 5G18A 4CLCD 2Z6CA 4B4ZA 1LSVA 2P08A 3OZHA 4IUKA 5DJUA 1VM1A 4MN7A 5GL9A 1FSWA 4QU3A 4ID4A 2UWXA 5EUAA 3BWLA 5EVIC 3BRMA 1T18A 2O99A 3S7OA 5IS1A 5HPIA 4U3TA 3WS1A 1NRFA 1PZPA 3TG9A 2XD1A 2JN7A 3LICA 5TJJA 2VA0A 3BYDA 3ZDJA 3Q81A 4PM7A 5HAPA 2VV7A 3DWKA 3CPTB 1ONHA 2FFFB 4BBUA 2LB9A 2ZQCA 1HVBA 4U0TA 5AQ9A 3SS4A 1G28A 4PKYA 4ZAMA 5IHVA 2VGLM 1H8MA 1U60A 3I7JA 1MPLA 3A0VA 1EROA 3K3CA 1W79A 1ALQA 2Z2LB 5F83A 1YMXA 2PR6A 5HW3A 3CUEA 1ZC2A 2QWSA 3N6IA 4DE3A 5JYOA 5FI2A 5DTSA 2RL3A 3D3OA 4RQ9A 1LI9A 5A91A 2PU2A 3DTMA 4XXRA 1LI0A 4S2LA 4DJ2A 3MF0A 4IHQA 1E4DA 4WN5A 4RVAA 5TBMB 3TRCA 1QMEA 4P6BA 2R9XA 5AJGA 5HAQA 1ZKJA 1CEGA 3SZTA 1W5DA 2VEAA 5F82A 1Q2QA 1TVFA 2WGIA 1YAXA 4RX3A 3O88A 3D4FA 2W1TB 3MZDA 5EECA 2EX8A 2HDQA 1XXMA 4E6XA 2ZMFA 1P9WA 5HZHA 2HDUA 3G2YA 2HZ5A 1K4EA 3L7HA 3TSGA 5AQBA 5HWVA 1JWVA 3BFEA 3BEBA 3BLSA 1IELA 2WZZA 4NEED 4DXBA 5FQIA 2E8IA 3KSGA 5FQQA 5EPHA 3UB9A 4DDYA 3LEZA 2PRFA 3NIAA 1E25A 2ZL1B 5FAOA 1IKGA 4K08A 4GS9B 2HDSA 5CHMA 3U4LP 3F1PB 3NOTC 4LV2A 2WGWB 4P6ZM 2I72A 5F6AA 5L07A 1KGFA 4BLMA 4PM8A 2J8YA 2VV8A 1YQSA 4MN6A 2HJ9C 5L10A 5HARA 4JGPA 1D7EA 1E3UA 1GA0A 4Y0TA 1Y28A 3UE1A 3LIFA 4OPQA 4GDBA 4GB7A 1NLZA 3DAVA 4KG6A 2JKTI 2VLGA 4E3OA 1VEUA 1ES5A 3OC2A 3BFFA 3BECA 4ETXA 2W1RA 2J3WA 3GSGA 2J3TC 3VP0A 1YSPA 1Z6FA 3HVFA 1KDWA 4OONA 4UQIS 3A0RA 3CMZA 3F1NA 5CX7A 1NYYA 3IF5A 4KZAA 1CK3A 1QMFA 1RCJA 3BW6A 1NZOA 3ZNTA 5FEGA 4E3KA 3S7PA 4KZ3A 1N9LA 3LIBA 4ARZA 4BBTA 4UA7A 4S2NC 1K54C 4Y13A 3PAGA 1WYBA 1BLCA 3UB6A 3UB7A 1YLYA 4HQAA 2IA2A 5DVAA 2PYPA 3IH9A 2V8FA 3ICYA 2ZJ9A 1EI5A 4WM9A 5GLBA 1BZAA 4EBNA 1IKIA 4D60A 5AVFA 2K2NA 1H3QA 2PR5A 3MFDA 1PIOA 4E04A 3GDIA 4DE2A 1X0OA 4CLCA 5DTTA 5F1GA 4PM5A 2MJ6A 4X1LA 3NC8A 3QP4A 4WEKA 1GSVA 3OCLA 5HPFA 1PW8A 4WZ5C 2WUQA 1PWGA 2Q0OA 4ZJ1A 1BLPA 3MXQA 4WEJA 5HL1A 3FC7A 4LGWA 3EEHA 4JGRA 3G32A 3GVBA 3GMWA 4WMCD 4ZRRA 3T1XA 5GHXA 1VQQA 3H7WB 1KE4A 4N9KA 3UN7A 1HLUP 4Y7PA 4WYYA 4KUOA 2XFSA 4NG2A 3IT9A 1L2SA 5IU1A 2ZM2A 1ACFA 3E4QA 4IJGA 1BYWA 4BBVA 5DF8A 3MXSA 1MZUA 1TD5A 3KX0X 2EXBA 2K7SA 5J4EA 1S4RA 1XJ3A 3IH8A 3N4IA 2Y8HA 4MMNA 3WS2A 1N9OA 5J8XA 1W63Q 1OT9A 1T1BA 1JWPA 1NZUA 1UWNX 3CPTA 5FASA 3LR0A 3P09A 4GD8A 1I2WA 4KZ6A 3MQOA 3IF6C 2VKSA 2QKPA 2VGKA 3VV4A 3ZNYA 2G7UA 2CMNA 4E6WA 5F1FA 3A3DA 2GNXA 3HUNA 3VSKA 4EW7A 4JXGA 2WKEA 4LLOB 4FSFA 2V2FF 4EETB 2WADA 1P0ZA 4R3JA 5E2FA 3CHWP 4R23A 3G6OA 4EUZA 2YKHA 1OPXA 4H6JB 3LYXA 2V1BA 3H9WA 4JF5A 1T1CA 1V9ZA 2JKFA 3LI9A 4UHUA 1K4FA 4X6TA 4BENA 2WKQA 1SZVA 3RTYA 5TBMA 4XUXA 5HWWA 1YM1A 1OTAA 2ZC5B 3BM6A 4S2PA 5GLDA 3BLMA 1YLTA 1ZG4A 2QJ7A 3NY4A 1P9RA 4GKUA 2INWA 1K6RA 5DFYA 5E2GA 3SW1A 4KZ4A 2EX6A 3U2AA 4R6LA 1YPRA 2W0NA 2W1TA 3LGOA 3A3IA 2XRNA 1STZA 4L0LA 3UB5P 3IQAA 4IEDA 3OPPA 1VB6A 2Y59A 1BTLA 5K5BA 2GDNA 4D2OA 2Y2GA 2HV1A 2ZOIA 2B18A 1YLPA 2L0WA 1DP9A 3ZGAB 4GHIB 3LR4A 3T1RA 3A3FA 3FWLA 1XFQA 4Y0UA 3M6BA 2UV0E 5CGWA 3T50A 2ZL1A 3QNCA 4I3IA 4R4SA 3SH7A 2XDMA 4GS9A 4HJ4A 3DTKA 3RXWA 3F1PA 4MNRA 5E2HA 3JYIA 4FH4A 4KUKA 2X01A 2WGWA 3O86A 5FI6A 3WS5A 4BMWA 3E2KA 3M2KA 4OOYA 4B9OA 4KENB 2C5WB 5KSHA 1GA9A 4GN2A 4HHDA 3N8RA 2Y2JA 3MZFA 2FFYA 4JGQA 2OWHA 1OTDA 2XQZA 3G4PA 4CPKA 3LO7A 2HP6A 2YKFA 2ZMVA 4OLGA 3NDGA 3VP3A 3IBRA 4OQHA 1YKDA 3NULA 1JTDA 2XFTA 2JKRM 3E4OA 5FDHA 3SH8A 5J3WA 1IYOA 2RCXA 4EBPA 3UDFA 5HWTA 1LL5A 1WA9A 3B33A 4Q0JA 2WZXA 4QY6A 1NXYA 3OBFA 2Y2HA 1RGYA 3WRTA 4MLLA 1N9BA 3FPWA 4X56A 5CGSA 1S4SA 3NCKA 5FSRA 4RX2A 3CUEC 5FL3A 5DKKA 2JHEA 3VMAA 1G5UA 5IT5A 4N9LA 4WZ4A 2FH5A 2V9AA 3WRZA 3OPHA 1M6KA 3ZG9B 2Y2LA 1YLJA 1K6SA 2KX6A 4Q0IA 1W63M 3O5YA 2EXAA 3FYZA 4R1GA 4R70A 2Z2MB 3UNWA 1G6AA 2XF3A 3S4XA 2XA7S 3FZCA 4MBHA 3MR0A 1ERQA 2PDRA 3MQ0A 3NBLA 4M4XA 5DF9A 4G3KA 5HDSA 4Y17A 5E43A 3UMEA 3OCNA 1Y4OA 2FZ0A 3Q82A 3RFBA 4WMCA 2J7VA 3EQVA 4CJNA 4HP4A 4DMZA 2O9BA 4PMAA 1ZG6A 1WYCA 3T1QB 3B42A 1LT0A 3C5AA 3EGXC 3M2JA 4R38A 2G2UA 1SKOB 3BQ8A 4NXGA 3O3VA 1IYPA 4QD4A 2A24B 3H7WA 3ZG0A 3MKFA 5EFWA 2ZD8A 5GLCA 1MWSA 2Y2OA 5M19A 2H0YA 4GZBA 5A90A 3WWXA 4NKPA 4Z9QA 3HJKA 1GHMA 3P7NA 2A49A 2ZC7A 4F3LB 1MWTA 1NY0A 4JF4A 4QB8A 3IXDA 1MC0A 4BL3A 5G4YA 2AVXA 2W3DA 1XKZA 2HGVA 1IEMA 3DBAA 3AGEA 4Y2FA 3ITAA 3HCYA 1OMEA 4Q8IA 1XA7A 1NLYA 3G35A 2EWVA 4OPZA 3CJMA 3GECA 1KGGA 4Z1WA 2M1CA 2WKPA 3IWIA 2BASA 1ESUA 3EWKA 3TE8A 1ZHHB 3JVUA 4UA9A 3LUQA 4H6JA 3RH8B 5HL6A 4E3IA 5F5YA 4HBUA 4KQOA 4Y0OA 4KZ9A 4ME4A 1SCWA 1DJCA 1IFQA 2W3HA 2W3GA 4HIAA 3MKEA 4FCFA 4QWOA 3CAXA 3LIAA 4P6ZS 1FR1A 4NXFA 4HOIA 4R0QA 1JNUA 4PM6A 4HJ6A 2HJEA 1T19A 1OT6A 3C7VA 2EWWA 2OAP1 5DF7A 1XP4A 3ZG8B 2E8JA 1LLBA 3HL9A 1LL9A 3UPNA 2ZC4B 2J9OA 4JPMA 4X69A 3LI8A 2VGJA 2LB5A 1Y54A 4GHIA 4HP9A 4B93A 4WBGA 3Q7VB 5LBRA 4CLCC 2KLIA 4OH0A 2VK3A 3V5MA 3UY6A 1OTEA 5D3OA 3UE6A 3RXXA 1SHVA 3IXGA 2QPNA 2V1ZA 3PXPA 4I5SA 3CG5A 4E3JA 4R3BA 2Y2NA 1F5MA 4RA7A 3PR6A 4ZBEA 3ZHHA 1G6OA 2J80A 3LFVA 4P85A 2P9VB 2OWJA 3B3XA 3BQAA 3K2NA 1S0WA 4BD1A 2VJWA 4PKYG 5L09A 4MN5A 3C4OA 4EQIA 4WLAA 4FD8A 5AQ7A 2JBFA 3KYEA 5KIZA 5EE8A 1H0MA 2WKRA 3CI6A 3HLGA 1J9MA 1OTIA 3KSHA 3FKVA 3C7UA 3FG8A 2XGNA 3IXHA 5L2FA 1S66L 2EFXA 4HNBA 5EV0A 5L8MA 3H82B 2XROA 4OQIA 4ZJ2A 4II7A 4O01A 3EQUA 1FCMA 4L9GA 2VX8A 1ES4A 2WKHA 3OPRA 4EEUA 3T4SA 2JC7A 1BLSA 3PYPA 2B02A 4ETZA 4C3QA 5CECA 1ZTUA 4IBRA 1RP5A 2XD5A 1K55A 4S2KA 3GQZA 2ZMAA 4EUVA 5EOOA 1BSGA 4JXVA 3V50A 1K25A 3KSIA 4UA6A 3S7QA 1OJGA 4EU0A 4BL2A 1FSYA 4C6YA 4E3NA 4LPZA 2W3EA 3N8SA 4Y5FA 3HUOA 5EVIB 3SS5A 4IUHA 2IWBA 5HAIA 1PI4A 5CHUA 2V0UA 2ZOHA 3MFXA 3S1YA 3T4OA 1PW1A 4OKPA 5EVID 2A3UA 2XK1A 4JF6A 3NDEA 3CITA 3ZVTA 4Y15A 5AVEA 4LRXC 3AGDA 2XSSA 4JLFA 4L9EA 2ZBBA 1FCOA 3D9YA 4DE1A 1SKOA 5JYPA 5FI7A 4OPRA 2A24A 4X53A 3BJNA 3R7WB 1C3BA 4S2OA 4DN0A 5F68A 1TS0A 2Y91A 3ZFZA 2WKIA 3K3DA 5KMWA 3GR2A 4DRTA 4CLCE 2OAQ1 3BY9A 4KZ7A 4I3JA 3ZCZA 3CLOA 4F3LA 2DNSA 2GX5A 2WAFA 4JBFA 1XJ2A 2P7JA 3VSLA 4P87A 3KYQA 1PZOA 5FQJA 2XR0A 1XGJA 1UGUA 3PBSA 1W7FA 2J9PA 2IWDA 2WAEA 4N1HA 2Y2IA 2PT7A 3IHAA 1JWZA 2Y2KA 1ESIA 4G3VA 1LSWA 3W4OA 4A5RA 2IWCA 2QYBA 1YLZA 2O9CA 4DF6A 3BFGA 5F69A 5CRFA 1S6RA 3VP1A 3SOIA 1XFNA 3BFDA 1PFLA 4YOFA 3G30A 3SS3A 2ZLYA 4JGOA 3OPLA 4FOFA 3HLCA 1DP6A 2EX9A 1K57A 2JKTM 2WYXA 4YWZA 4HESA 5FEFA 1TF1A 3NECA 4S2JA 4OPYA 4MBFA 1BLHA 1JTGA 4IVKA 3G34A 4DXCA 3FV7A 4WL9A 3B47A 2Y2QA 3V3RA 4ZDXA 2VV6A 1MKIA 1I2SA 1GSWA 1FILA 1DJAA 4LRZE 2D01A 2XH9A 5C5KA 3IX8A 4EESA 1CI9A 3OLOA 4IBXA 5J7EA 4PPRA 1TS7A 5KSCA 1KE0A 4FTXA 5KZHA 3LEQA 5CEBA 1GSXA 1NJ4A 1LL8A 4GNUA 1EWZA 5HX9A 4QPRA 3Q7VA 4JXWA 3IHBA 2Q9NA 4JXSA 1NRJA 3VP2A 1L0DA 2QHKA 4MEZA 2WK0A 3VE4A 4DDSA 3ULFA 1S1ZA 4LRYC 3N8LA 3QP2A 5HDDA 2ZC3B 5FQ9A 3UDXA 4LV0A 2NUTC 4MDZA 1L0EA 3W8KA 3KO6A 3MZEA 4QY5A 4NETA 4N1XA 2PD8A 2P9VA 4MBKA 4G3WA 3TJZC 1L3LA 5EM1A 2L4RA 3S7NA 4OVDA 2J3TD 5I94A 4UEYA 3V39A 3LCEA 4EBLA 3FKWA 3HLFA 1SDEA 4K0WA 5CTNA 3EEAA 1MY8A 2GZAA 4I39A 2I9VA 2OLUA 3LR5A 5M1AA 3MSHA 4GLQA 1CQAA 2WGVA 1F9IA 2O0YA 4OOMA 2XEPA 2H10A 2V0WA 4PAUA 3ZG5A 3ZYTA 3H82A 5HDCA 2A2LA 4N92A 1TEMA 2H28A 5FQKA 5HFOA 3TOIA 2VGLS 4NXBA 5DFXA 3IX4A 3PBOA 5TGFA 1MBLA 5I5LA 1MXOA 2BTFP 3L9KA 1FQGA 2DRWA 1L0GA 2XA7M 4HBTA 3EOIA 2ZQAA 4H8RA 4HH2A 3MXRA 2X71A 3MJQA 2ZQ7A 2HPBA 4EXOA 2Q9MA 2PBDP 2PYRA 4HEFA 4GW9A 4ZTKA 1CI8A 1YT4A 5GHYA 4X68A 3T4TA 1K56D 5CHJA 4YNRA 3HLDA 1TS8A 3GRJA 1GHIA 5AQAA 1SKFA 3HLWA 3FPVA 3GTCA 1LHYA 2BG1A 2OV5A 3Q1FA 5EVIA 3N7WA 2JE5A 5BOHA 5HD3A 3LY3A 5E2EA 4OP5A 1VETB 3W2ZA 3ISGA 2H0TA 3T1SA 5A92A 3DW0A 2VZWA 1BT5A 3HUMA 3PBNA 1BUEA 1MKMA 2Y55A 3QP1A 1DJBA 1KVMA 5DTKA 2EFUA 4YFMA 1T1AA 2ZM8A 3R7WA 3D72A 2HP5A 2K31A 3IF6B 4RYEA 1PRQA 4OP8A 4OOLA 2X02A 1S1YA 2EA9A 1KE3A 4KG5A 4O7DA 4WELA 4CQHA 4EWFA 3VOLA 5HSQA 4K91A 5M18A 3HJIA 4LV3A 3V67A 1ES3A 1NYMA 2OSUA 4EERA 2W27A 3WS4A 1O7EA 2KDKA 1OTBA 3C38A 1CF0A 4HJ3A 1F98A 2B95A 4NXEA 1ODVA 1G68A 2DMWA 2ZQ8A 3UE3A 1DP8A 4R3AA 3DTEA 5TR7A 3DTIA 5CGXA 4O0PA 3T12B 3JVVA 1UWPX 5TFQA 3UPPA 3NJAA 3UDIA 4OLDA 3LY4A 4NK3A 3ZVWA 1IYQA 2V20A 1KVLA 4DKIA 3NOPC 1N9NA 1Q2PA 3F1OB 3GV9A 1AWIA 2Y2MA 3VP4A 2Y4AA 3S22A 4XT2B 3O87A 4QHCA 4HI4A 3DWZA 3C30A 3VFFA 4QJGA 1O07A 1H5XA 4Q0HA 3A3JA 2ZM0A 3E4PA 1YSQA 1I5QA 3IS2B 3OOVA 2NUPC 2GJ3A 3KSFA 4WUJA 3Q7ZA 4LV1A 3HREA 4EV4A 4LCMA 3P01A 5CXWA 4X1MA 2QMIA 5GLAA 5FAPA 3JPUA 1ONGA 1K55C 4O8GA 3G31A 5EVEA 3MQQA 3PTEA 4KQRA 1WE4A 3IWOA 4LFUA 3IX3A 4F94A 3IWQA 2PAVP 1KOUA 1TDLA 4UQIM 2HDRA 2M7UA 3ZQ5A 1H8YA 2Y79A 2ZQDA 1XGIA 4I38A 3PBTA 1CJFA 3QP6A 1L0FA 3UO9A 1FR6A 2OLVA 2M7VA 2JKRI 2L1MA 4GD6A 2CC1A 4HY8A 3SH9A 2V1AA 2W3FA 5EM0A 1MWUA 3PBRA 3MBZA 3LIEA 1SDNA 3V3SA 3NI9A 4Y3IA 1IYSA 3HBRA 4JKTA 2O9AA 4GCZA 2ZQ9A 5FAQA 3UMDA 2ACGA 2P74A 2H5SA 4HH3A 1RGZA 2BLSA 3E2LA 3NHQA 3BFCA 3IXBA 3T4LA 4GOGA 5HD5A 5EVLA 3BY8A 1PI5A 1KDSA 2Y2PA 3T4QA 3QNBA 1PWCA 5FATA 3W4QA 1N4OA 4S2NA 2QJ5A 2G2WA 1K54A 3Q07A 1HD8A 2PBYA 1FOFA 1A0KA 1W8YA 3VOZA 5A8BA 3QHYA 1ES2A 3T4KA 1EW0A 3VE3A 3AGFA 2PU4A 2JKGA 1XJ4A 4XUZA 4GDNA 3WS0A 1CEFA 3MMHA 3PBQA 1K56A 4IVIA 4P0MA 4X55A 1XA1A 4ZJ3A 2XLNA 1K38A 3C4PA 1D1JA 4WZ5A 3E0YA 4YINA 4R4RA 1GCEA 4PHTA 4C75A 5CTMA 3P98A 2HP9A 1K57C 3NOUC 4KQDA 3MS6A 4B4XA 1V9YA 3G2ZA 4FUWA 4E3MA 3CZDA 1KGEA 1S67L 4KZBA 4GJ4A 4WF0A 2QZ6A 3LIDA 3T4JA 1H8ZA 2JCHA 1MWRA 4UAAA 3ZG7B 3C8CA 1TDGA 4ESPA 1HTZA 1VETA 1AXBA 3KYZA 1XPBA 1IOUA 2R9WA 4E3LA 1PYYA 5DKLA 4I3AA 4M3KA 5MC7A 4X25A 1W8QA 2PD7A 5G4ZA 2KOIA 1GHPA 2C6WB 4S2MA 2HF6A 1ERMA 2P04A
chains in the Genus database with same CATH topology
3V39A 3LCEA 1SCWA 4DE2A 1DJCA 4EBLA 3FKWA 3HLFA 5DTTA 5F1GA 4PM5A 1SDEA 4K0WA 5CTNA 5A93A 3MKEA 1MY8A 4K0XA 3NC8A 4OQ0A 4WEKA 3OCLA 4FCFA 1YMSA 5FQMA 1HZOA 2OLUA 1PW8A 3PAEA 3IF6A 4FH2A 4WZ5C 2WUQA 5M1AA 1PWGA 4ZJ1A 1BLPA 2WGVA 4WEJA 1FR1A 4R0QA 5HL1A 4OOMA 2XEPA 2H10A 5U47A 3ZG5A 1PWDA 3G32A 4PM6A 3GVBA 3GMWA 4WMCD 4N92A 1TEMA 5FQKA 5GHXA 3RJUA 4KZ5A 5HFOA 3TOIA 1VQQA 3C7VA 1KE4A 4N9KA 3PBOA 5TGFA 1MBLA 3UN7A 3UPOA 4Y7PA 1MXOA 4WYYA 1M40A 2XFSA 1E3UD 5EOEA 4LCLA 1FQGA 2DRWA 1XP4A 5DF7A 5GHZA 3ZG8B 1XX2A 3ITBA 3IT9A 1L0GA 1L2SA 4S2IA 2ZM2A 1LLBA 4HBTA 5DF8A 3HL9A 3MXSA 1LL9A 1YLWA 3UPNA 3M6HA 2ZQAA 4H8RA 4OQGA 2ZC4B 2EXBA 2J9OA 2X71A 2ZQ7A 2HPBA 3MXRA 4JPMA 2Q9MA 3IH8A 1JVJA 3N4IA 3HLBA 4X69A 4HEFA 4KQQA 2VGJA 3WS2A 4ZTKA 4U0XA 1CI8A 5J8XA 1DY6A 1Y54A 1YT4A 5GHYA 4X68A 1K56D 5CHJA 4WBGA 1JWPA 3HLDA 3Q7VB 1NZUA 3GRJA 1GHIA 4OH0A 5FASA 1FCNA 5AQAA 3P09A 4GD8A 1SKFA 3UY6A 1I2WA 3V5MA 4KZ6A 5D3OA 4DE0A 3HLWA 3IF6C 3RXXA 1SHVA 4BD0A 3IXGA 2VGKA 3ZNYA 3GTCA 4E6WA 5F1FA 3A3DA 3UE0A 4LENA 2QPNA 3VSKA 3HUNA 4KG2A 1LHYA 4JXGA 2V1ZA 4KZ8A 2WKEA 2BG1A 3CG5A 2OV5A 3Q1FA 5EVIA 3N7WA 2JE5A 4FSFA 4PM9A 5BOHA 2V2FF 4E3JA 3HLEA 4R3BA 2EX2A 2WADA 2Y2NA 3LY3A 5E2EA 4R3JA 4BJPA 4OP5A 5E2FA 4RA7A 4R23A 3ZHHA 4ZBEA 3ISGA 4EUZA 2H0TA 4BQMA 3W4PA 4P85A 2P9VB 3DW0A 5CERA 3VOYA 1BT5A 5A92A 3HUMA 3B3XA 3PBNA 1BUEA 3A3EA 5FA7A 3VFHA 1S0WA 4BD1A 4JF5A 4UHUA 2ZC6B 1BULA 3C4OA 4EQIA 5AQ7A 4FD8A 1K4FA 2Y55A 1DJBA 1KVMA 2JBFA 4X6TA 4BENA 5DTKA 2EFUA 5EE8A 4B88A 5CEDA 4YFMA 2DCFA 2ZM8A 3HLGA 1J9MA 3VFFA 2HP5A 3IF6B 4RYEA 4OP8A 2B5RA 4OOLA 2X02A 3C7UA 3FKVA 4XUXA 5G18A 2XGNA 3IXHA 1YM1A 4B4ZA 2ZC5B 1KE3A 4KG5A 4O7DA 5L2FA 3BM6A 4S2PA 4WELA 2EFXA 4EWFA 5GLDA 3OZHA 3BLMA 4K91A 1YLTA 4OQIA 4ZJ2A 4LV3A 1VM1A 5M18A 1ES3A 1ZG4A 3EQUA 3NY4A 1NYMA 1FCMA 2OSUA 5GL9A 4GKUA 3WS4A 1FSWA 1O7EA 1K6RA 4QU3A 5E2GA 4ID4A 2UWXA 2EX6A 4KZ4A 5EUAA 1ES4A 2WKHA 5EVIC 3BRMA 3OPRA 1G68A 2ZQ8A 3UE3A 2JC7A 3A3IA 1BLSA 4U3TA 3WS1A 1NRFA 1PZPA 3TG9A 2XD1A 5TR7A 5CGXA 4L0LA 4C3QA 5CECA 3IQAA 4IEDA 3OPPA 5TFQA 4IBRA 3UPPA 1RP5A 2Y59A 2XD5A 1BTLA 1K55A 4S2KA 3BYDA 3UDIA 3ZDJA 3Q81A 2GDNA 2ZMAA 2Y2GA 3GQZA 3LY4A 4NK3A 4OLDA 4PM7A 3ZVWA 4D2OA 1IYQA 5HAPA 5EOOA 1BSGA 1YLPA 2V20A 3DWKA 4JXVA 3ZGAB 3V50A 1KVLA 3A3FA 3FWLA 4DKIA 1ONHA 2FFFB 4Y0UA 1Q2PA 2ZQCA 1K25A 4UA6A 3M6BA 5CGWA 1HVBA 3GV9A 4U0TA 2Y2MA 3VP4A 3QNCA 4BL2A 1FSYA 2Y4AA 5AQ9A 3S22A 3SS4A 4C6YA 3O87A 4QHCA 4R4SA 3SH7A 4E3NA 2XDMA 4ZAMA 5IHVA 3RXWA 3N8SA 1U60A 3I7JA 3HUOA 4MNRA 5E2HA 1MPLA 5EVIB 3JYIA 3SS5A 3DWZA 2IWBA 1EROA 4FH4A 5HAIA 1W79A 2X01A 1ALQA 1PI4A 2WGWA 1YMXA 2Z2LB 3O86A 3E2KA 5CHUA 5F83A 5FI6A 3M2KA 1ZC2A 3N6IA 4OOYA 1O07A 4QJGA 1H5XA 3S1YA 4DE3A 3A3JA 5JYOA 2ZM0A 1PW1A 1I5QA 4OKPA 5FI2A 4KENB 5EVID 5DTSA 2A3UA 2XK1A 2C5WB 4JF6A 2RL3A 3NDEA 1GA9A 5KSHA 3Q7ZA 4GN2A 4LV1A 3ZVTA 3HREA 1LI9A 4EV4A 3N8RA 4LCMA 5A91A 2PU2A 2Y2JA 3DTMA 3MZFA 4XXRA 3AGDA 2FFYA 5CXWA 4JLFA 1LI0A 4S2LA 1FCOA 2XQZA 2QMIA 3G4PA 4DE1A 5GLAA 5FAPA 4CPKA 3LO7A 2HP6A 1E4DA 4OLGA 3NDGA 5FI7A 3VP3A 4OPRA 5JYPA 1ONGA 1K55C 4X53A 4OQHA 3G31A 1C3BA 4S2OA 3PTEA 4RVAA 1JTDA 2XFTA 4KQRA 1WE4A 3IWOA 3SH8A 5FDHA 4F94A 1QMEA 2Y91A 3ZFZA 2WKIA 4P6BA 2R9XA 3IWQA 5KMWA 1TDLA 5HAQA 1ZKJA 3GR2A 1IYOA 1CEGA 2HDRA 1W5DA 4DRTA 1H8YA 2RCXA 4EBPA 3UDFA 5F82A 1LL5A 1Q2QA 2ZQDA 4KZ7A 1XGIA 3PBTA 2WZXA 4QY6A 3ZCZA 1TVFA 2WGIA 1NXYA 2DNSA 2Y2HA 4RX3A 1L0FA 1RGYA 3UO9A 1FR6A 2WAFA 4JBFA 3O88A 2OLVA 3WRTA 3D4FA 3VSLA 4MLLA 1N9BA 4P87A 4X56A 4GD6A 2CC1A 5CGSA 1PZOA 3MZDA 3NCKA 5FQJA 5FSRA 2XR0A 5EECA 2EX8A 4RX2A 3SH9A 1XGJA 3PBSA 1MWUA 3VMAA 1W7FA 2HDQA 1XXMA 2J9PA 3PBRA 4E6XA 2IWDA 2HDUA 3G2YA 2WAEA 4N9LA 3MBZA 1K4EA 4WZ4A 4N1HA 3TSGA 2Y2IA 5AQBA 1SDNA 3V3SA 3NI9A 3WRZA 3OPHA 1IYSA 1M6KA 3HBRA 4JKTA 1JWVA 4Y0OA 3BFEA 3IHAA 3ZG9B 1JWZA 2Y2KA 3BEBA 1ESIA 3BLSA 1IELA 2WZZA 2Y2LA 1YLJA 2ZQ9A 1K6SA 5FAQA 4DXBA 2P74A 2H5SA 5FQIA 2E8IA 3W4OA 4A5RA 1RGZA 2BLSA 2IWCA 5EPHA 5FQQA 1YLZA 2EXAA 4DDYA 3FYZA 3LEZA 4R1GA 3E2LA 4DF6A 3WS5A 3BFGA 2Z2MB 3NIAA 1G6AA 3UNWA 1E25A 5CRFA 1S6RA 2XF3A 3BFCA 5FAOA 3IXBA 3S4XA 3VP1A 1IKGA 3FZCA 4GOGA 3SOIA 4MBHA 3BFDA 1ERQA 2HDSA 3G30A 5CHMA 3NBLA 5EVLA 3SS3A 1PI5A 2ZLYA 1KDSA 2Y2PA 5DF9A 3QNBA 1PWCA 4LV2A 3OPLA 2WGWB 5FATA 3HLCA 2I72A 2EX9A 5E43A 1K57A 3W4QA 1N4OA 2WYXA 3OCNA 4S2NA 1KGFA 2G2WA 3Q82A 1K54A 4HESA 4BLMA 4PM8A 4WMCA 2J8YA 2J7VA 3Q07A 3EQVA 4S2JA 1HD8A 1YQSA 4CJNA 2PBYA 4PMAA 1ZG6A 1WYCA 1FOFA 5HARA 4OPYA 1W8YA 3C5AA 4MBFA 3M2JA 3VOZA 1E3UA 1GA0A 3QHYA 4Y0TA 1ES2A 1BLHA 3UE1A 2G2UA 4OPQA 1JTGA 1IYPA 3O3VA 4GDBA 4IVKA 3G34A 4GB7A 4QD4A 4DXCA 3FV7A 4KG6A 2Y2QA 3ZG0A 3V3RA 4ZDXA 3MKFA 3AGFA 4E3OA 2ZD8A 1ES5A 2PU4A 1MKIA 1MWSA 3OC2A 1I2SA 5GLCA 2Y2OA 1DJAA 5M19A 3BFFA 3BECA 2XH9A 4GDNA 4XUZA 2H0YA 4GZBA 3WS0A 5A90A 3WWXA 1CI9A 1CEFA 4Z9QA 3GSGA 4IBXA 3PBQA 4PPRA 3VP0A 1Z6FA 3HVFA 1GHMA 1K56A 4IVIA 1KDWA 2A49A 2ZC7A 4OONA 5KSCA 3CMZA 4P0MA 1KE0A 5KZHA 4X55A 1XA1A 1MWTA 1NY0A 4ZJ3A 2XLNA 1K38A 4JF4A 4QB8A 3IXDA 1NYYA 3C4PA 5CEBA 3IF5A 4KZAA 1CK3A 1NJ4A 1QMFA 4WZ5A 4BL3A 4YINA 1RCJA 4GNUA 4R4RA 1EWZA 1NZOA 5HX9A 3ZNTA 1XKZA 4E3KA 4KZ3A 3Q7VA 1GCEA 4JXWA 3IHBA 2Q9NA 4C75A 1IEMA 4UA7A 5CTMA 3P98A 4JXSA 2HP9A 1K57C 3AGEA 4S2NC 3VP2A 1L0DA 4MEZA 3ITAA 4B4XA 2WK0A 1K54C 3PAGA 1OMEA 3G2ZA 4E3MA 3CZDA 1KGEA 4DDSA 4KZBA 1WYBA 1BLCA 2QZ6A 4Q8IA 1XA7A 1YLYA 3N8LA 5HW3A 1H8ZA 2JCHA 2ZC3B 1MWRA 3G35A 4OPZA 4UAAA 3CJMA 5DVAA 5FQ9A 3ZG7B 5I94A 3UDXA 1TDGA 4LV0A 3IH9A 1KGGA 3IWIA 1HTZA 1L0EA 1AXBA 1ESUA 3W8KA 1XPBA 2ZJ9A 1EI5A 3MZEA 4QY5A 4WM9A 2R9WA 4NETA 4E3LA 4N1XA 4UA9A 1PYYA 5GLBA 4M3KA 1BZAA 2P9VA 4EBNA 1W8QA 4MBKA 1IKIA 4E3IA 4HBUA 1GHPA 2C6WB 3MFDA 4S2MA 4KQOA 4OVDA 1PIOA 1ERMA 4KZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V39 A;  3LCE A;  1SCW A;  4DE2 A;  1DJC A;  4EBL A;  3FKW A;  3HLF A;  5DTT A;  5F1G A;  4PM5 A;  1SDE A;  4K0W A;  5CTN A;  5A93 A;  3MKE A;  1MY8 A;  4K0X A;  3NC8 A;  4OQ0 A;  4WEK A;  3OCL A;  4FCF A;  1YMS A;  5FQM A;  1HZO A;  2OLU A;  1PW8 A;  3PAE A;  3IF6 A;  4FH2 A;  4WZ5 C;  2WUQ A;  5M1A A;  1PWG A;  4ZJ1 A;  1BLP A;  2WGV A;  4WEJ A;  1FR1 A;  4R0Q A;  5HL1 A;  4OOM A;  2XEP A;  2H10 A;  5U47 A;  3ZG5 A;  1PWD A;  3G32 A;  4PM6 A;  3GVB A;  3GMW A;  4WMC D;  4N92 A;  1TEM A;  5FQK A;  5GHX A;  3RJU A;  4KZ5 A;  5HFO A;  3TOI A;  1VQQ A;  3C7V A;  1KE4 A;  4N9K A;  3PBO A;  5TGF A;  1MBL A;  3UN7 A;  3UPO A;  4Y7P A;  1MXO A;  4WYY A;  1M40 A;  2XFS A;  1E3U D;  5EOE A;  4LCL A;  1FQG A;  2DRW A;  1XP4 A;  5DF7 A;  5GHZ A;  3ZG8 B;  1XX2 A;  3ITB A;  3IT9 A;  1L0G A;  1L2S A;  4S2I A;  2ZM2 A;  1LLB A;  4HBT A;  5DF8 A;  3HL9 A;  3MXS A;  1LL9 A;  1YLW A;  3UPN A;  3M6H A;  2ZQA A;  4H8R A;  4OQG A;  2ZC4 B;  2EXB A;  2J9O A;  2X71 A;  2ZQ7 A;  2HPB A;  3MXR A;  4JPM A;  2Q9M A;  3IH8 A;  1JVJ A;  3N4I A;  3HLB A;  4X69 A;  4HEF A;  4KQQ A;  2VGJ A;  3WS2 A;  4ZTK A;  4U0X A;  1CI8 A;  5J8X A;  1DY6 A;  1Y54 A;  1YT4 A;  5GHY A;  4X68 A;  1K56 D;  5CHJ A;  4WBG A;  1JWP A;  3HLD A;  3Q7V B;  1NZU A;  3GRJ A;  1GHI A;  4OH0 A;  5FAS A;  1FCN A;  5AQA A;  3P09 A;  4GD8 A;  1SKF A;  3UY6 A;  1I2W A;  3V5M A;  4KZ6 A;  5D3O A;  4DE0 A;  3HLW A;  3IF6 C;  3RXX A;  1SHV A;  4BD0 A;  3IXG A;  2VGK A;  3ZNY A;  3GTC A;  4E6W A;  5F1F A;  3A3D A;  3UE0 A;  4LEN A;  2QPN A;  3VSK A;  3HUN A;  4KG2 A;  1LHY A;  4JXG A;  2V1Z A;  4KZ8 A;  2WKE A;  2BG1 A;  3CG5 A;  2OV5 A;  3Q1F A;  5EVI A;  3N7W A;  2JE5 A;  4FSF A;  4PM9 A;  5BOH A;  2V2F F;  4E3J A;  3HLE A;  4R3B A;  2EX2 A;  2WAD A;  2Y2N A;  3LY3 A;  5E2E A;  4R3J A;  4BJP A;  4OP5 A;  5E2F A;  4RA7 A;  4R23 A;  3ZHH A;  4ZBE A;  3ISG A;  4EUZ A;  2H0T A;  4BQM A;  3W4P A;  4P85 A;  2P9V B;  3DW0 A;  5CER A;  3VOY A;  1BT5 A;  5A92 A;  3HUM A;  3B3X A;  3PBN A;  1BUE A;  3A3E A;  5FA7 A;  3VFH A;  1S0W A;  4BD1 A;  4JF5 A;  4UHU A;  2ZC6 B;  1BUL A;  3C4O A;  4EQI A;  5AQ7 A;  4FD8 A;  1K4F A;  2Y55 A;  1DJB A;  1KVM A;  2JBF A;  4X6T A;  4BEN A;  5DTK A;  2EFU A;  5EE8 A;  4B88 A;  5CED A;  4YFM A;  2DCF A;  2ZM8 A;  3HLG A;  1J9M A;  3VFF A;  2HP5 A;  3IF6 B;  4RYE A;  4OP8 A;  2B5R A;  4OOL A;  2X02 A;  3C7U A;  3FKV A;  4XUX A;  5G18 A;  2XGN A;  3IXH A;  1YM1 A;  4B4Z A;  2ZC5 B;  1KE3 A;  4KG5 A;  4O7D A;  5L2F A;  3BM6 A;  4S2P A;  4WEL A;  2EFX A;  4EWF A;  5GLD A;  3OZH A;  3BLM A;  4K91 A;  1YLT A;  4OQI A;  4ZJ2 A;  4LV3 A;  1VM1 A;  5M18 A;  1ES3 A;  1ZG4 A;  3EQU A;  3NY4 A;  1NYM A;  1FCM A;  2OSU A;  5GL9 A;  4GKU A;  3WS4 A;  1FSW A;  1O7E A;  1K6R A;  4QU3 A;  5E2G A;  4ID4 A;  2UWX A;  2EX6 A;  4KZ4 A;  5EUA A;  1ES4 A;  2WKH A;  5EVI C;  3BRM A;  3OPR A;  1G68 A;  2ZQ8 A;  3UE3 A;  2JC7 A;  3A3I A;  1BLS A;  4U3T A;  3WS1 A;  1NRF A;  1PZP A;  3TG9 A;  2XD1 A;  5TR7 A;  5CGX A;  4L0L A;  4C3Q A;  5CEC A;  3IQA A;  4IED A;  3OPP A;  5TFQ A;  4IBR A;  3UPP A;  1RP5 A;  2Y59 A;  2XD5 A;  1BTL A;  1K55 A;  4S2K A;  3BYD A;  3UDI A;  3ZDJ A;  3Q81 A;  2GDN A;  2ZMA A;  2Y2G A;  3GQZ A;  3LY4 A;  4NK3 A;  4OLD A;  4PM7 A;  3ZVW A;  4D2O A;  1IYQ A;  5HAP A;  5EOO A;  1BSG A;  1YLP A;  2V20 A;  3DWK A;  4JXV A;  3ZGA B;  3V50 A;  1KVL A;  3A3F A;  3FWL A;  4DKI A;  1ONH A;  2FFF B;  4Y0U A;  1Q2P A;  2ZQC A;  1K25 A;  4UA6 A;  3M6B A;  5CGW A;  1HVB A;  3GV9 A;  4U0T A;  2Y2M A;  3VP4 A;  3QNC A;  4BL2 A;  1FSY A;  2Y4A A;  5AQ9 A;  3S22 A;  3SS4 A;  4C6Y A;  3O87 A;  4QHC A;  4R4S A;  3SH7 A;  4E3N A;  2XDM A;  4ZAM A;  5IHV A;  3RXW A;  3N8S A;  1U60 A;  3I7J A;  3HUO A;  4MNR A;  5E2H A;  1MPL A;  5EVI B;  3JYI A;  3SS5 A;  3DWZ A;  2IWB A;  1ERO A;  4FH4 A;  5HAI A;  1W79 A;  2X01 A;  1ALQ A;  1PI4 A;  2WGW A;  1YMX A;  2Z2L B;  3O86 A;  3E2K A;  5CHU A;  5F83 A;  5FI6 A;  3M2K A;  1ZC2 A;  3N6I A;  4OOY A;  1O07 A;  4QJG A;  1H5X A;  3S1Y A;  4DE3 A;  3A3J A;  5JYO A;  2ZM0 A;  1PW1 A;  1I5Q A;  4OKP A;  5FI2 A;  4KEN B;  5EVI D;  5DTS A;  2A3U A;  2XK1 A;  2C5W B;  4JF6 A;  2RL3 A;  3NDE A;  1GA9 A;  5KSH A;  3Q7Z A;  4GN2 A;  4LV1 A;  3ZVT A;  3HRE A;  1LI9 A;  4EV4 A;  3N8R A;  4LCM A;  5A91 A;  2PU2 A;  2Y2J A;  3DTM A;  3MZF A;  4XXR A;  3AGD A;  2FFY A;  5CXW A;  4JLF A;  1LI0 A;  4S2L A;  1FCO A;  2XQZ A;  2QMI A;  3G4P A;  4DE1 A;  5GLA A;  5FAP A;  4CPK A;  3LO7 A;  2HP6 A;  1E4D A;  4OLG A;  3NDG A;  5FI7 A;  3VP3 A;  4OPR A;  5JYP A;  1ONG A;  1K55 C;  4X53 A;  4OQH A;  3G31 A;  1C3B A;  4S2O A;  3PTE A;  4RVA A;  1JTD A;  2XFT A;  4KQR A;  1WE4 A;  3IWO A;  3SH8 A;  5FDH A;  4F94 A;  1QME A;  2Y91 A;  3ZFZ A;  2WKI A;  4P6B A;  2R9X A;  3IWQ A;  5KMW A;  1TDL A;  5HAQ A;  1ZKJ A;  3GR2 A;  1IYO A;  1CEG A;  2HDR A;  1W5D A;  4DRT A;  1H8Y A;  2RCX A;  4EBP A;  3UDF A;  5F82 A;  1LL5 A;  1Q2Q A;  2ZQD A;  4KZ7 A;  1XGI A;  3PBT A;  2WZX A;  4QY6 A;  3ZCZ A;  1TVF A;  2WGI A;  1NXY A;  2DNS A;  2Y2H A;  4RX3 A;  1L0F A;  1RGY A;  3UO9 A;  1FR6 A;  2WAF A;  4JBF A;  3O88 A;  2OLV A;  3WRT A;  3D4F A;  3VSL A;  4MLL A;  1N9B A;  4P87 A;  4X56 A;  4GD6 A;  2CC1 A;  5CGS A;  1PZO A;  3MZD A;  3NCK A;  5FQJ A;  5FSR A;  2XR0 A;  5EEC A;  2EX8 A;  4RX2 A;  3SH9 A;  1XGJ A;  3PBS A;  1MWU A;  3VMA A;  1W7F A;  2HDQ A;  1XXM A;  2J9P A;  3PBR A;  4E6X A;  2IWD A;  2HDU A;  3G2Y A;  2WAE A;  4N9L A;  3MBZ A;  1K4E A;  4WZ4 A;  4N1H A;  3TSG A;  2Y2I A;  5AQB A;  1SDN A;  3V3S A;  3NI9 A;  3WRZ A;  3OPH A;  1IYS A;  1M6K A;  3HBR A;  4JKT A;  1JWV A;  4Y0O A;  3BFE A;  3IHA A;  3ZG9 B;  1JWZ A;  2Y2K A;  3BEB A;  1ESI A;  3BLS A;  1IEL A;  2WZZ A;  2Y2L A;  1YLJ A;  2ZQ9 A;  1K6S A;  5FAQ A;  4DXB A;  2P74 A;  2H5S A;  5FQI A;  2E8I A;  3W4O A;  4A5R A;  1RGZ A;  2BLS A;  2IWC A;  5EPH A;  5FQQ A;  1YLZ A;  2EXA A;  4DDY A;  3FYZ A;  3LEZ A;  4R1G A;  3E2L A;  4DF6 A;  3WS5 A;  3BFG A;  2Z2M B;  3NIA A;  1G6A A;  3UNW A;  1E25 A;  5CRF A;  1S6R A;  2XF3 A;  3BFC A;  5FAO A;  3IXB A;  3S4X A;  3VP1 A;  1IKG A;  3FZC A;  4GOG A;  3SOI A;  4MBH A;  3BFD A;  1ERQ A;  2HDS A;  3G30 A;  5CHM A;  3NBL A;  5EVL A;  3SS3 A;  1PI5 A;  2ZLY A;  1KDS A;  2Y2P A;  5DF9 A;  3QNB A;  1PWC A;  4LV2 A;  3OPL A;  2WGW B;  5FAT A;  3HLC A;  2I72 A;  2EX9 A;  5E43 A;  1K57 A;  3W4Q A;  1N4O A;  2WYX A;  3OCN A;  4S2N A;  1KGF A;  2G2W A;  3Q82 A;  1K54 A;  4HES A;  4BLM A;  4PM8 A;  4WMC A;  2J8Y A;  2J7V A;  3Q07 A;  3EQV A;  4S2J A;  1HD8 A;  1YQS A;  4CJN A;  2PBY A;  4PMA A;  1ZG6 A;  1WYC A;  1FOF A;  5HAR A;  4OPY A;  1W8Y A;  3C5A A;  4MBF A;  3M2J A;  3VOZ A;  1E3U A;  1GA0 A;  3QHY A;  4Y0T A;  1ES2 A;  1BLH A;  3UE1 A;  2G2U A;  4OPQ A;  1JTG A;  1IYP A;  3O3V A;  4GDB A;  4IVK A;  3G34 A;  4GB7 A;  4QD4 A;  4DXC A;  3FV7 A;  4KG6 A;  2Y2Q A;  3ZG0 A;  3V3R A;  4ZDX A;  3MKF A;  3AGF A;  4E3O A;  2ZD8 A;  1ES5 A;  2PU4 A;  1MKI A;  1MWS A;  3OC2 A;  1I2S A;  5GLC A;  2Y2O A;  1DJA A;  5M19 A;  3BFF A;  3BEC A;  2XH9 A;  4GDN A;  4XUZ A;  2H0Y A;  4GZB A;  3WS0 A;  5A90 A;  3WWX A;  1CI9 A;  1CEF A;  4Z9Q A;  3GSG A;  4IBX A;  3PBQ A;  4PPR A;  3VP0 A;  1Z6F A;  3HVF A;  1GHM A;  1K56 A;  4IVI A;  1KDW A;  2A49 A;  2ZC7 A;  4OON A;  5KSC A;  3CMZ A;  4P0M A;  1KE0 A;  5KZH A;  4X55 A;  1XA1 A;  1MWT A;  1NY0 A;  4ZJ3 A;  2XLN A;  1K38 A;  4JF4 A;  4QB8 A;  3IXD A;  1NYY A;  3C4P A;  5CEB A;  3IF5 A;  4KZA A;  1CK3 A;  1NJ4 A;  1QMF A;  4WZ5 A;  4BL3 A;  4YIN A;  1RCJ A;  4GNU A;  4R4R A;  1EWZ A;  1NZO A;  5HX9 A;  3ZNT A;  1XKZ A;  4E3K A;  4KZ3 A;  3Q7V A;  1GCE A;  4JXW A;  3IHB A;  2Q9N A;  4C75 A;  1IEM A;  4UA7 A;  5CTM A;  3P98 A;  4JXS A;  2HP9 A;  1K57 C;  3AGE A;  4S2N C;  3VP2 A;  1L0D A;  4MEZ A;  3ITA A;  4B4X A;  2WK0 A;  1K54 C;  3PAG A;  1OME A;  3G2Z A;  4E3M A;  3CZD A;  1KGE A;  4DDS A;  4KZB A;  1WYB A;  1BLC A;  2QZ6 A;  4Q8I A;  1XA7 A;  1YLY A;  3N8L A;  5HW3 A;  1H8Z A;  2JCH A;  2ZC3 B;  1MWR A;  3G35 A;  4OPZ A;  4UAA A;  3CJM A;  5DVA A;  5FQ9 A;  3ZG7 B;  5I94 A;  3UDX A;  1TDG A;  4LV0 A;  3IH9 A;  1KGG A;  3IWI A;  1HTZ A;  1L0E A;  1AXB A;  1ESU A;  3W8K A;  1XPB A;  2ZJ9 A;  1EI5 A;  3MZE A;  4QY5 A;  4WM9 A;  2R9W A;  4NET A;  4E3L A;  4N1X A;  4UA9 A;  1PYY A;  5GLB A;  4M3K A;  1BZA A;  2P9V A;  4EBN A;  1W8Q A;  4MBK A;  1IKI A;  4E3I A;  4HBU A;  1GHP A;  2C6W B;  3MFD A;  4S2M A;  4KQO A;  4OVD A;  1PIO A;  1ERM A;  4KZ9 A; 
#chains in the Genus database with same CATH topology
 1F2K A;  4MCW A;  5A93 A;  4K0X A;  4OQ0 A;  1YMS A;  3EGD C;  5FQM A;  1HZO A;  3PAE A;  3IF6 A;  4FH2 A;  1K0K A;  5DJT A;  1LSX A;  3E98 A;  2R78 A;  5U47 A;  4BWI A;  1PWD A;  2Z6D A;  4DJ3 A;  3C2W A;  3RJU A;  4KZ5 A;  3UPO A;  1M40 A;  1VEU B;  1E3U D;  5EOE A;  1NWZ A;  4LCL A;  5GHZ A;  1XX2 A;  3ITB A;  4S2I A;  2D02 A;  1YLW A;  3IBJ A;  1P97 A;  3M6H A;  4OQG A;  1Z09 A;  3A0S A;  1JVJ A;  2OOL A;  3HLB A;  1PNE A;  1TS6 A;  3F1N B;  4KQQ A;  4EQ1 A;  4U0X A;  3R4K A;  1DY6 A;  3LR3 A;  3QP8 A;  2PHY A;  1FCN A;  2V8C A;  4ARZ B;  1DRM A;  4DE0 A;  3F1O A;  3TW8 A;  4BD0 A;  3CWF A;  4XT2 A;  3UE0 A;  4LEN A;  4KG2 A;  3UB8 A;  1VHM A;  4KZ8 A;  3PHY A;  5FDS A;  4PM9 A;  3HLE A;  2EX2 A;  4BJP A;  1XJ6 A;  3IS2 A;  4BQM A;  3W4P A;  5CER A;  3VOY A;  1OJ5 A;  5FA7 A;  3A3E A;  3VFH A;  4AFI A;  1D06 A;  4EEP A;  2ZC6 B;  1BUL A;  1J3W A;  3QP5 A;  4CLC B;  5CED A;  4B88 A;  2DCF A;  4L9F A;  1FIK A;  2B5R A;  5G18 A;  4CLC D;  2Z6C A;  4B4Z A;  1LSV A;  2P08 A;  3OZH A;  4IUK A;  5DJU A;  1VM1 A;  4MN7 A;  5GL9 A;  1FSW A;  4QU3 A;  4ID4 A;  2UWX A;  5EUA A;  3BWL A;  5EVI C;  3BRM A;  1T18 A;  2O99 A;  3S7O A;  5IS1 A;  5HPI A;  4U3T A;  3WS1 A;  1NRF A;  1PZP A;  3TG9 A;  2XD1 A;  2JN7 A;  3LIC A;  5TJJ A;  2VA0 A;  3BYD A;  3ZDJ A;  3Q81 A;  4PM7 A;  5HAP A;  2VV7 A;  3DWK A;  3CPT B;  1ONH A;  2FFF B;  4BBU A;  2LB9 A;  2ZQC A;  1HVB A;  4U0T A;  5AQ9 A;  3SS4 A;  1G28 A;  4PKY A;  4ZAM A;  5IHV A;  2VGL M;  1H8M A;  1U60 A;  3I7J A;  1MPL A;  3A0V A;  1ERO A;  3K3C A;  1W79 A;  1ALQ A;  2Z2L B;  5F83 A;  1YMX A;  2PR6 A;  5HW3 A;  3CUE A;  1ZC2 A;  2QWS A;  3N6I A;  4DE3 A;  5JYO A;  5FI2 A;  5DTS A;  2RL3 A;  3D3O A;  4RQ9 A;  1LI9 A;  5A91 A;  2PU2 A;  3DTM A;  4XXR A;  1LI0 A;  4S2L A;  4DJ2 A;  3MF0 A;  4IHQ A;  1E4D A;  4WN5 A;  4RVA A;  5TBM B;  3TRC A;  1QME A;  4P6B A;  2R9X A;  5AJG A;  5HAQ A;  1ZKJ A;  1CEG A;  3SZT A;  1W5D A;  2VEA A;  5F82 A;  1Q2Q A;  1TVF A;  2WGI A;  1YAX A;  4RX3 A;  3O88 A;  3D4F A;  2W1T B;  3MZD A;  5EEC A;  2EX8 A;  2HDQ A;  1XXM A;  4E6X A;  2ZMF A;  1P9W A;  5HZH A;  2HDU A;  3G2Y A;  2HZ5 A;  1K4E A;  3L7H A;  3TSG A;  5AQB A;  5HWV A;  1JWV A;  3BFE A;  3BEB A;  3BLS A;  1IEL A;  2WZZ A;  4NEE D;  4DXB A;  5FQI A;  2E8I A;  3KSG A;  5FQQ A;  5EPH A;  3UB9 A;  4DDY A;  3LEZ A;  2PRF A;  3NIA A;  1E25 A;  2ZL1 B;  5FAO A;  1IKG A;  4K08 A;  4GS9 B;  2HDS A;  5CHM A;  3U4L P;  3F1P B;  3NOT C;  4LV2 A;  2WGW B;  4P6Z M;  2I72 A;  5F6A A;  5L07 A;  1KGF A;  4BLM A;  4PM8 A;  2J8Y A;  2VV8 A;  1YQS A;  4MN6 A;  2HJ9 C;  5L10 A;  5HAR A;  4JGP A;  1D7E A;  1E3U A;  1GA0 A;  4Y0T A;  1Y28 A;  3UE1 A;  3LIF A;  4OPQ A;  4GDB A;  4GB7 A;  1NLZ A;  3DAV A;  4KG6 A;  2JKT I;  2VLG A;  4E3O A;  1VEU A;  1ES5 A;  3OC2 A;  3BFF A;  3BEC A;  4ETX A;  2W1R A;  2J3W A;  3GSG A;  2J3T C;  3VP0 A;  1YSP A;  1Z6F A;  3HVF A;  1KDW A;  4OON A;  4UQI S;  3A0R A;  3CMZ A;  3F1N A;  5CX7 A;  1NYY A;  3IF5 A;  4KZA A;  1CK3 A;  1QMF A;  1RCJ A;  3BW6 A;  1NZO A;  3ZNT A;  5FEG A;  4E3K A;  3S7P A;  4KZ3 A;  1N9L A;  3LIB A;  4ARZ A;  4BBT A;  4UA7 A;  4S2N C;  1K54 C;  4Y13 A;  3PAG A;  1WYB A;  1BLC A;  3UB6 A;  3UB7 A;  1YLY A;  4HQA A;  2IA2 A;  5DVA A;  2PYP A;  3IH9 A;  2V8F A;  3ICY A;  2ZJ9 A;  1EI5 A;  4WM9 A;  5GLB A;  1BZA A;  4EBN A;  1IKI A;  4D60 A;  5AVF A;  2K2N A;  1H3Q A;  2PR5 A;  3MFD A;  1PIO A;  4E04 A;  3GDI A;  4DE2 A;  1X0O A;  4CLC A;  5DTT A;  5F1G A;  4PM5 A;  2MJ6 A;  4X1L A;  3NC8 A;  3QP4 A;  4WEK A;  1GSV A;  3OCL A;  5HPF A;  1PW8 A;  4WZ5 C;  2WUQ A;  1PWG A;  2Q0O A;  4ZJ1 A;  1BLP A;  3MXQ A;  4WEJ A;  5HL1 A;  3FC7 A;  4LGW A;  3EEH A;  4JGR A;  3G32 A;  3GVB A;  3GMW A;  4WMC D;  4ZRR A;  3T1X A;  5GHX A;  1VQQ A;  3H7W B;  1KE4 A;  4N9K A;  3UN7 A;  1HLU P;  4Y7P A;  4WYY A;  4KUO A;  2XFS A;  4NG2 A;  3IT9 A;  1L2S A;  5IU1 A;  2ZM2 A;  1ACF A;  3E4Q A;  4IJG A;  1BYW A;  4BBV A;  5DF8 A;  3MXS A;  1MZU A;  1TD5 A;  3KX0 X;  2EXB A;  2K7S A;  5J4E A;  1S4R A;  1XJ3 A;  3IH8 A;  3N4I A;  2Y8H A;  4MMN A;  3WS2 A;  1N9O A;  5J8X A;  1W63 Q;  1OT9 A;  1T1B A;  1JWP A;  1NZU A;  1UWN X;  3CPT A;  5FAS A;  3LR0 A;  3P09 A;  4GD8 A;  1I2W A;  4KZ6 A;  3MQO A;  3IF6 C;  2VKS A;  2QKP A;  2VGK A;  3VV4 A;  3ZNY A;  2G7U A;  2CMN A;  4E6W A;  5F1F A;  3A3D A;  2GNX A;  3HUN A;  3VSK A;  4EW7 A;  4JXG A;  2WKE A;  4LLO B;  4FSF A;  2V2F F;  4EET B;  2WAD A;  1P0Z A;  4R3J A;  5E2F A;  3CHW P;  4R23 A;  3G6O A;  4EUZ A;  2YKH A;  1OPX A;  4H6J B;  3LYX A;  2V1B A;  3H9W A;  4JF5 A;  1T1C A;  1V9Z A;  2JKF A;  3LI9 A;  4UHU A;  1K4F A;  4X6T A;  4BEN A;  2WKQ A;  1SZV A;  3RTY A;  5TBM A;  4XUX A;  5HWW A;  1YM1 A;  1OTA A;  2ZC5 B;  3BM6 A;  4S2P A;  5GLD A;  3BLM A;  1YLT A;  1ZG4 A;  2QJ7 A;  3NY4 A;  1P9R A;  4GKU A;  2INW A;  1K6R A;  5DFY A;  5E2G A;  3SW1 A;  4KZ4 A;  2EX6 A;  3U2A A;  4R6L A;  1YPR A;  2W0N A;  2W1T A;  3LGO A;  3A3I A;  2XRN A;  1STZ A;  4L0L A;  3UB5 P;  3IQA A;  4IED A;  3OPP A;  1VB6 A;  2Y59 A;  1BTL A;  5K5B A;  2GDN A;  4D2O A;  2Y2G A;  2HV1 A;  2ZOI A;  2B18 A;  1YLP A;  2L0W A;  1DP9 A;  3ZGA B;  4GHI B;  3LR4 A;  3T1R A;  3A3F A;  3FWL A;  1XFQ A;  4Y0U A;  3M6B A;  2UV0 E;  5CGW A;  3T50 A;  2ZL1 A;  3QNC A;  4I3I A;  4R4S A;  3SH7 A;  2XDM A;  4GS9 A;  4HJ4 A;  3DTK A;  3RXW A;  3F1P A;  4MNR A;  5E2H A;  3JYI A;  4FH4 A;  4KUK A;  2X01 A;  2WGW A;  3O86 A;  5FI6 A;  3WS5 A;  4BMW A;  3E2K A;  3M2K A;  4OOY A;  4B9O A;  4KEN B;  2C5W B;  5KSH A;  1GA9 A;  4GN2 A;  4HHD A;  3N8R A;  2Y2J A;  3MZF A;  2FFY A;  4JGQ A;  2OWH A;  1OTD A;  2XQZ A;  3G4P A;  4CPK A;  3LO7 A;  2HP6 A;  2YKF A;  2ZMV A;  4OLG A;  3NDG A;  3VP3 A;  3IBR A;  4OQH A;  1YKD A;  3NUL A;  1JTD A;  2XFT A;  2JKR M;  3E4O A;  5FDH A;  3SH8 A;  5J3W A;  1IYO A;  2RCX A;  4EBP A;  3UDF A;  5HWT A;  1LL5 A;  1WA9 A;  3B33 A;  4Q0J A;  2WZX A;  4QY6 A;  1NXY A;  3OBF A;  2Y2H A;  1RGY A;  3WRT A;  4MLL A;  1N9B A;  3FPW A;  4X56 A;  5CGS A;  1S4S A;  3NCK A;  5FSR A;  4RX2 A;  3CUE C;  5FL3 A;  5DKK A;  2JHE A;  3VMA A;  1G5U A;  5IT5 A;  4N9L A;  4WZ4 A;  2FH5 A;  2V9A A;  3WRZ A;  3OPH A;  1M6K A;  3ZG9 B;  2Y2L A;  1YLJ A;  1K6S A;  2KX6 A;  4Q0I A;  1W63 M;  3O5Y A;  2EXA A;  3FYZ A;  4R1G A;  4R70 A;  2Z2M B;  3UNW A;  1G6A A;  2XF3 A;  3S4X A;  2XA7 S;  3FZC A;  4MBH A;  3MR0 A;  1ERQ A;  2PDR A;  3MQ0 A;  3NBL A;  4M4X A;  5DF9 A;  4G3K A;  5HDS A;  4Y17 A;  5E43 A;  3UME A;  3OCN A;  1Y4O A;  2FZ0 A;  3Q82 A;  3RFB A;  4WMC A;  2J7V A;  3EQV A;  4CJN A;  4HP4 A;  4DMZ A;  2O9B A;  4PMA A;  1ZG6 A;  1WYC A;  3T1Q B;  3B42 A;  1LT0 A;  3C5A A;  3EGX C;  3M2J A;  4R38 A;  2G2U A;  1SKO B;  3BQ8 A;  4NXG A;  3O3V A;  1IYP A;  4QD4 A;  2A24 B;  3H7W A;  3ZG0 A;  3MKF A;  5EFW A;  2ZD8 A;  5GLC A;  1MWS A;  2Y2O A;  5M19 A;  2H0Y A;  4GZB A;  5A90 A;  3WWX A;  4NKP A;  4Z9Q A;  3HJK A;  1GHM A;  3P7N A;  2A49 A;  2ZC7 A;  4F3L B;  1MWT A;  1NY0 A;  4JF4 A;  4QB8 A;  3IXD A;  1MC0 A;  4BL3 A;  5G4Y A;  2AVX A;  2W3D A;  1XKZ A;  2HGV A;  1IEM A;  3DBA A;  3AGE A;  4Y2F A;  3ITA A;  3HCY A;  1OME A;  4Q8I A;  1XA7 A;  1NLY A;  3G35 A;  2EWV A;  4OPZ A;  3CJM A;  3GEC A;  1KGG A;  4Z1W A;  2M1C A;  2WKP A;  3IWI A;  2BAS A;  1ESU A;  3EWK A;  3TE8 A;  1ZHH B;  3JVU A;  4UA9 A;  3LUQ A;  4H6J A;  3RH8 B;  5HL6 A;  4E3I A;  5F5Y A;  4HBU A;  4KQO A;  4Y0O A;  4KZ9 A;  4ME4 A;  1SCW A;  1DJC A;  1IFQ A;  2W3H A;  2W3G A;  4HIA A;  3MKE A;  4FCF A;  4QWO A;  3CAX A;  3LIA A;  4P6Z S;  1FR1 A;  4NXF A;  4HOI A;  4R0Q A;  1JNU A;  4PM6 A;  4HJ6 A;  2HJE A;  1T19 A;  1OT6 A;  3C7V A;  2EWW A;  2OAP 1;  5DF7 A;  1XP4 A;  3ZG8 B;  2E8J A;  1LLB A;  3HL9 A;  1LL9 A;  3UPN A;  2ZC4 B;  2J9O A;  4JPM A;  4X69 A;  3LI8 A;  2VGJ A;  2LB5 A;  1Y54 A;  4GHI A;  4HP9 A;  4B93 A;  4WBG A;  3Q7V B;  5LBR A;  4CLC C;  2KLI A;  4OH0 A;  2VK3 A;  3V5M A;  3UY6 A;  1OTE A;  5D3O A;  3UE6 A;  3RXX A;  1SHV A;  3IXG A;  2QPN A;  2V1Z A;  3PXP A;  4I5S A;  3CG5 A;  4E3J A;  4R3B A;  2Y2N A;  1F5M A;  4RA7 A;  3PR6 A;  4ZBE A;  3ZHH A;  1G6O A;  2J80 A;  3LFV A;  4P85 A;  2P9V B;  2OWJ A;  3B3X A;  3BQA A;  3K2N A;  1S0W A;  4BD1 A;  2VJW A;  4PKY G;  5L09 A;  4MN5 A;  3C4O A;  4EQI A;  4WLA A;  4FD8 A;  5AQ7 A;  2JBF A;  3KYE A;  5KIZ A;  5EE8 A;  1H0M A;  2WKR A;  3CI6 A;  3HLG A;  1J9M A;  1OTI A;  3KSH A;  3FKV A;  3C7U A;  3FG8 A;  2XGN A;  3IXH A;  5L2F A;  1S66 L;  2EFX A;  4HNB A;  5EV0 A;  5L8M A;  3H82 B;  2XRO A;  4OQI A;  4ZJ2 A;  4II7 A;  4O01 A;  3EQU A;  1FCM A;  4L9G A;  2VX8 A;  1ES4 A;  2WKH A;  3OPR A;  4EEU A;  3T4S A;  2JC7 A;  1BLS A;  3PYP A;  2B02 A;  4ETZ A;  4C3Q A;  5CEC A;  1ZTU A;  4IBR A;  1RP5 A;  2XD5 A;  1K55 A;  4S2K A;  3GQZ A;  2ZMA A;  4EUV A;  5EOO A;  1BSG A;  4JXV A;  3V50 A;  1K25 A;  3KSI A;  4UA6 A;  3S7Q A;  1OJG A;  4EU0 A;  4BL2 A;  1FSY A;  4C6Y A;  4E3N A;  4LPZ A;  2W3E A;  3N8S A;  4Y5F A;  3HUO A;  5EVI B;  3SS5 A;  4IUH A;  2IWB A;  5HAI A;  1PI4 A;  5CHU A;  2V0U A;  2ZOH A;  3MFX A;  3S1Y A;  3T4O A;  1PW1 A;  4OKP A;  5EVI D;  2A3U A;  2XK1 A;  4JF6 A;  3NDE A;  3CIT A;  3ZVT A;  4Y15 A;  5AVE A;  4LRX C;  3AGD A;  2XSS A;  4JLF A;  4L9E A;  2ZBB A;  1FCO A;  3D9Y A;  4DE1 A;  1SKO A;  5JYP A;  5FI7 A;  4OPR A;  2A24 A;  4X53 A;  3BJN A;  3R7W B;  1C3B A;  4S2O A;  4DN0 A;  5F68 A;  1TS0 A;  2Y91 A;  3ZFZ A;  2WKI A;  3K3D A;  5KMW A;  3GR2 A;  4DRT A;  4CLC E;  2OAQ 1;  3BY9 A;  4KZ7 A;  4I3J A;  3ZCZ A;  3CLO A;  4F3L A;  2DNS A;  2GX5 A;  2WAF A;  4JBF A;  1XJ2 A;  2P7J A;  3VSL A;  4P87 A;  3KYQ A;  1PZO A;  5FQJ A;  2XR0 A;  1XGJ A;  1UGU A;  3PBS A;  1W7F A;  2J9P A;  2IWD A;  2WAE A;  4N1H A;  2Y2I A;  2PT7 A;  3IHA A;  1JWZ A;  2Y2K A;  1ESI A;  4G3V A;  1LSW A;  3W4O A;  4A5R A;  2IWC A;  2QYB A;  1YLZ A;  2O9C A;  4DF6 A;  3BFG A;  5F69 A;  5CRF A;  1S6R A;  3VP1 A;  3SOI A;  1XFN A;  3BFD A;  1PFL A;  4YOF A;  3G30 A;  3SS3 A;  2ZLY A;  4JGO A;  3OPL A;  4FOF A;  3HLC A;  1DP6 A;  2EX9 A;  1K57 A;  2JKT M;  2WYX A;  4YWZ A;  4HES A;  5FEF A;  1TF1 A;  3NEC A;  4S2J A;  4OPY A;  4MBF A;  1BLH A;  1JTG A;  4IVK A;  3G34 A;  4DXC A;  3FV7 A;  4WL9 A;  3B47 A;  2Y2Q A;  3V3R A;  4ZDX A;  2VV6 A;  1MKI A;  1I2S A;  1GSW A;  1FIL A;  1DJA A;  4LRZ E;  2D01 A;  2XH9 A;  5C5K A;  3IX8 A;  4EES A;  1CI9 A;  3OLO A;  4IBX A;  5J7E A;  4PPR A;  1TS7 A;  5KSC A;  1KE0 A;  4FTX A;  5KZH A;  3LEQ A;  5CEB A;  1GSX A;  1NJ4 A;  1LL8 A;  4GNU A;  1EWZ A;  5HX9 A;  4QPR A;  3Q7V A;  4JXW A;  3IHB A;  2Q9N A;  4JXS A;  1NRJ A;  3VP2 A;  1L0D A;  2QHK A;  4MEZ A;  2WK0 A;  3VE4 A;  4DDS A;  3ULF A;  1S1Z A;  4LRY C;  3N8L A;  3QP2 A;  5HDD A;  2ZC3 B;  5FQ9 A;  3UDX A;  4LV0 A;  2NUT C;  4MDZ A;  1L0E A;  3W8K A;  3KO6 A;  3MZE A;  4QY5 A;  4NET A;  4N1X A;  2PD8 A;  2P9V A;  4MBK A;  4G3W A;  3TJZ C;  1L3L A;  5EM1 A;  2L4R A;  3S7N A;  4OVD A;  2J3T D;  5I94 A;  4UEY A;  3V39 A;  3LCE A;  4EBL A;  3FKW A;  3HLF A;  1SDE A;  4K0W A;  5CTN A;  3EEA A;  1MY8 A;  2GZA A;  4I39 A;  2I9V A;  2OLU A;  3LR5 A;  5M1A A;  3MSH A;  4GLQ A;  1CQA A;  2WGV A;  1F9I A;  2O0Y A;  4OOM A;  2XEP A;  2H10 A;  2V0W A;  4PAU A;  3ZG5 A;  3ZYT A;  3H82 A;  5HDC A;  2A2L A;  4N92 A;  1TEM A;  2H28 A;  5FQK A;  5HFO A;  3TOI A;  2VGL S;  4NXB A;  5DFX A;  3IX4 A;  3PBO A;  5TGF A;  1MBL A;  5I5L A;  1MXO A;  2BTF P;  3L9K A;  1FQG A;  2DRW A;  1L0G A;  2XA7 M;  4HBT A;  3EOI A;  2ZQA A;  4H8R A;  4HH2 A;  3MXR A;  2X71 A;  3MJQ A;  2ZQ7 A;  2HPB A;  4EXO A;  2Q9M A;  2PBD P;  2PYR A;  4HEF A;  4GW9 A;  4ZTK A;  1CI8 A;  1YT4 A;  5GHY A;  4X68 A;  3T4T A;  1K56 D;  5CHJ A;  4YNR A;  3HLD A;  1TS8 A;  3GRJ A;  1GHI A;  5AQA A;  1SKF A;  3HLW A;  3FPV A;  3GTC A;  1LHY A;  2BG1 A;  2OV5 A;  3Q1F A;  5EVI A;  3N7W A;  2JE5 A;  5BOH A;  5HD3 A;  3LY3 A;  5E2E A;  4OP5 A;  1VET B;  3W2Z A;  3ISG A;  2H0T A;  3T1S A;  5A92 A;  3DW0 A;  2VZW A;  1BT5 A;  3HUM A;  3PBN A;  1BUE A;  1MKM A;  2Y55 A;  3QP1 A;  1DJB A;  1KVM A;  5DTK A;  2EFU A;  4YFM A;  1T1A A;  2ZM8 A;  3R7W A;  3D72 A;  2HP5 A;  2K31 A;  3IF6 B;  4RYE A;  1PRQ A;  4OP8 A;  4OOL A;  2X02 A;  1S1Y A;  2EA9 A;  1KE3 A;  4KG5 A;  4O7D A;  4WEL A;  4CQH A;  4EWF A;  3VOL A;  5HSQ A;  4K91 A;  5M18 A;  3HJI A;  4LV3 A;  3V67 A;  1ES3 A;  1NYM A;  2OSU A;  4EER A;  2W27 A;  3WS4 A;  1O7E A;  2KDK A;  1OTB A;  3C38 A;  1CF0 A;  4HJ3 A;  1F98 A;  2B95 A;  4NXE A;  1ODV A;  1G68 A;  2DMW A;  2ZQ8 A;  3UE3 A;  1DP8 A;  4R3A A;  3DTE A;  5TR7 A;  3DTI A;  5CGX A;  4O0P A;  3T12 B;  3JVV A;  1UWP X;  5TFQ A;  3UPP A;  3NJA A;  3UDI A;  4OLD A;  3LY4 A;  4NK3 A;  3ZVW A;  1IYQ A;  2V20 A;  1KVL A;  4DKI A;  3NOP C;  1N9N A;  1Q2P A;  3F1O B;  3GV9 A;  1AWI A;  2Y2M A;  3VP4 A;  2Y4A A;  3S22 A;  4XT2 B;  3O87 A;  4QHC A;  4HI4 A;  3DWZ A;  3C30 A;  3VFF A;  4QJG A;  1O07 A;  1H5X A;  4Q0H A;  3A3J A;  2ZM0 A;  3E4P A;  1YSQ A;  1I5Q A;  3IS2 B;  3OOV A;  2NUP C;  2GJ3 A;  3KSF A;  4WUJ A;  3Q7Z A;  4LV1 A;  3HRE A;  4EV4 A;  4LCM A;  3P01 A;  5CXW A;  4X1M A;  2QMI A;  5GLA A;  5FAP A;  3JPU A;  1ONG A;  1K55 C;  4O8G A;  3G31 A;  5EVE A;  3MQQ A;  3PTE A;  4KQR A;  1WE4 A;  3IWO A;  4LFU A;  3IX3 A;  4F94 A;  3IWQ A;  2PAV P;  1KOU A;  1TDL A;  4UQI M;  2HDR A;  2M7U A;  3ZQ5 A;  1H8Y A;  2Y79 A;  2ZQD A;  1XGI A;  4I38 A;  3PBT A;  1CJF A;  3QP6 A;  1L0F A;  3UO9 A;  1FR6 A;  2OLV A;  2M7V A;  2JKR I;  2L1M A;  4GD6 A;  2CC1 A;  4HY8 A;  3SH9 A;  2V1A A;  2W3F A;  5EM0 A;  1MWU A;  3PBR A;  3MBZ A;  3LIE A;  1SDN A;  3V3S A;  3NI9 A;  4Y3I A;  1IYS A;  3HBR A;  4JKT A;  2O9A A;  4GCZ A;  2ZQ9 A;  5FAQ A;  3UMD A;  2ACG A;  2P74 A;  2H5S A;  4HH3 A;  1RGZ A;  2BLS A;  3E2L A;  3NHQ A;  3BFC A;  3IXB A;  3T4L A;  4GOG A;  5HD5 A;  5EVL A;  3BY8 A;  1PI5 A;  1KDS A;  2Y2P A;  3T4Q A;  3QNB A;  1PWC A;  5FAT A;  3W4Q A;  1N4O A;  4S2N A;  2QJ5 A;  2G2W A;  1K54 A;  3Q07 A;  1HD8 A;  2PBY A;  1FOF A;  1A0K A;  1W8Y A;  3VOZ A;  5A8B A;  3QHY A;  1ES2 A;  3T4K A;  1EW0 A;  3VE3 A;  3AGF A;  2PU4 A;  2JKG A;  1XJ4 A;  4XUZ A;  4GDN A;  3WS0 A;  1CEF A;  3MMH A;  3PBQ A;  1K56 A;  4IVI A;  4P0M A;  4X55 A;  1XA1 A;  4ZJ3 A;  2XLN A;  1K38 A;  3C4P A;  1D1J A;  4WZ5 A;  3E0Y A;  4YIN A;  4R4R A;  1GCE A;  4PHT A;  4C75 A;  5CTM A;  3P98 A;  2HP9 A;  1K57 C;  3NOU C;  4KQD A;  3MS6 A;  4B4X A;  1V9Y A;  3G2Z A;  4FUW A;  4E3M A;  3CZD A;  1KGE A;  1S67 L;  4KZB A;  4GJ4 A;  4WF0 A;  2QZ6 A;  3LID A;  3T4J A;  1H8Z A;  2JCH A;  1MWR A;  4UAA A;  3ZG7 B;  3C8C A;  1TDG A;  4ESP A;  1HTZ A;  1VET A;  1AXB A;  3KYZ A;  1XPB A;  1IOU A;  2R9W A;  4E3L A;  1PYY A;  5DKL A;  4I3A A;  4M3K A;  5MC7 A;  4X25 A;  1W8Q A;  2PD7 A;  5G4Z A;  2KOI A;  1GHP A;  2C6W B;  4S2M A;  2HF6 A;  1ERM A;  2P04 A; 
#chains in the Genus database with same CATH homology
 3V39 A;  3LCE A;  1SCW A;  4DE2 A;  1DJC A;  4EBL A;  3FKW A;  3HLF A;  5DTT A;  5F1G A;  4PM5 A;  1SDE A;  4K0W A;  5CTN A;  5A93 A;  3MKE A;  1MY8 A;  4K0X A;  3NC8 A;  4OQ0 A;  4WEK A;  3OCL A;  4FCF A;  1YMS A;  5FQM A;  1HZO A;  2OLU A;  1PW8 A;  3PAE A;  3IF6 A;  4FH2 A;  4WZ5 C;  2WUQ A;  5M1A A;  1PWG A;  4ZJ1 A;  1BLP A;  2WGV A;  4WEJ A;  1FR1 A;  4R0Q A;  5HL1 A;  4OOM A;  2XEP A;  2H10 A;  5U47 A;  3ZG5 A;  1PWD A;  3G32 A;  4PM6 A;  3GVB A;  3GMW A;  4WMC D;  4N92 A;  1TEM A;  5FQK A;  5GHX A;  3RJU A;  4KZ5 A;  5HFO A;  3TOI A;  1VQQ A;  3C7V A;  1KE4 A;  4N9K A;  3PBO A;  5TGF A;  1MBL A;  3UN7 A;  3UPO A;  4Y7P A;  1MXO A;  4WYY A;  1M40 A;  2XFS A;  1E3U D;  5EOE A;  4LCL A;  1FQG A;  2DRW A;  1XP4 A;  5DF7 A;  5GHZ A;  3ZG8 B;  1XX2 A;  3ITB A;  3IT9 A;  1L0G A;  1L2S A;  4S2I A;  2ZM2 A;  1LLB A;  4HBT A;  5DF8 A;  3HL9 A;  3MXS A;  1LL9 A;  1YLW A;  3UPN A;  3M6H A;  2ZQA A;  4H8R A;  4OQG A;  2ZC4 B;  2EXB A;  2J9O A;  2X71 A;  2ZQ7 A;  2HPB A;  3MXR A;  4JPM A;  2Q9M A;  3IH8 A;  1JVJ A;  3N4I A;  3HLB A;  4X69 A;  4HEF A;  4KQQ A;  2VGJ A;  3WS2 A;  4ZTK A;  4U0X A;  1CI8 A;  5J8X A;  1DY6 A;  1Y54 A;  1YT4 A;  5GHY A;  4X68 A;  1K56 D;  5CHJ A;  4WBG A;  1JWP A;  3HLD A;  3Q7V B;  1NZU A;  3GRJ A;  1GHI A;  4OH0 A;  5FAS A;  1FCN A;  5AQA A;  3P09 A;  4GD8 A;  1SKF A;  3UY6 A;  1I2W A;  3V5M A;  4KZ6 A;  5D3O A;  4DE0 A;  3HLW A;  3IF6 C;  3RXX A;  1SHV A;  4BD0 A;  3IXG A;  2VGK A;  3ZNY A;  3GTC A;  4E6W A;  5F1F A;  3A3D A;  3UE0 A;  4LEN A;  2QPN A;  3VSK A;  3HUN A;  4KG2 A;  1LHY A;  4JXG A;  2V1Z A;  4KZ8 A;  2WKE A;  2BG1 A;  3CG5 A;  2OV5 A;  3Q1F A;  5EVI A;  3N7W A;  2JE5 A;  4FSF A;  4PM9 A;  5BOH A;  2V2F F;  4E3J A;  3HLE A;  4R3B A;  2EX2 A;  2WAD A;  2Y2N A;  3LY3 A;  5E2E A;  4R3J A;  4BJP A;  4OP5 A;  5E2F A;  4RA7 A;  4R23 A;  3ZHH A;  4ZBE A;  3ISG A;  4EUZ A;  2H0T A;  4BQM A;  3W4P A;  4P85 A;  2P9V B;  3DW0 A;  5CER A;  3VOY A;  1BT5 A;  5A92 A;  3HUM A;  3B3X A;  3PBN A;  1BUE A;  3A3E A;  5FA7 A;  3VFH A;  1S0W A;  4BD1 A;  4JF5 A;  4UHU A;  2ZC6 B;  1BUL A;  3C4O A;  4EQI A;  5AQ7 A;  4FD8 A;  1K4F A;  2Y55 A;  1DJB A;  1KVM A;  2JBF A;  4X6T A;  4BEN A;  5DTK A;  2EFU A;  5EE8 A;  4B88 A;  5CED A;  4YFM A;  2DCF A;  2ZM8 A;  3HLG A;  1J9M A;  3VFF A;  2HP5 A;  3IF6 B;  4RYE A;  4OP8 A;  2B5R A;  4OOL A;  2X02 A;  3C7U A;  3FKV A;  4XUX A;  5G18 A;  2XGN A;  3IXH A;  1YM1 A;  4B4Z A;  2ZC5 B;  1KE3 A;  4KG5 A;  4O7D A;  5L2F A;  3BM6 A;  4S2P A;  4WEL A;  2EFX A;  4EWF A;  5GLD A;  3OZH A;  3BLM A;  4K91 A;  1YLT A;  4OQI A;  4ZJ2 A;  4LV3 A;  1VM1 A;  5M18 A;  1ES3 A;  1ZG4 A;  3EQU A;  3NY4 A;  1NYM A;  1FCM A;  2OSU A;  5GL9 A;  4GKU A;  3WS4 A;  1FSW A;  1O7E A;  1K6R A;  4QU3 A;  5E2G A;  4ID4 A;  2UWX A;  2EX6 A;  4KZ4 A;  5EUA A;  1ES4 A;  2WKH A;  5EVI C;  3BRM A;  3OPR A;  1G68 A;  2ZQ8 A;  3UE3 A;  2JC7 A;  3A3I A;  1BLS A;  4U3T A;  3WS1 A;  1NRF A;  1PZP A;  3TG9 A;  2XD1 A;  5TR7 A;  5CGX A;  4L0L A;  4C3Q A;  5CEC A;  3IQA A;  4IED A;  3OPP A;  5TFQ A;  4IBR A;  3UPP A;  1RP5 A;  2Y59 A;  2XD5 A;  1BTL A;  1K55 A;  4S2K A;  3BYD A;  3UDI A;  3ZDJ A;  3Q81 A;  2GDN A;  2ZMA A;  2Y2G A;  3GQZ A;  3LY4 A;  4NK3 A;  4OLD A;  4PM7 A;  3ZVW A;  4D2O A;  1IYQ A;  5HAP A;  5EOO A;  1BSG A;  1YLP A;  2V20 A;  3DWK A;  4JXV A;  3ZGA B;  3V50 A;  1KVL A;  3A3F A;  3FWL A;  4DKI A;  1ONH A;  2FFF B;  4Y0U A;  1Q2P A;  2ZQC A;  1K25 A;  4UA6 A;  3M6B A;  5CGW A;  1HVB A;  3GV9 A;  4U0T A;  2Y2M A;  3VP4 A;  3QNC A;  4BL2 A;  1FSY A;  2Y4A A;  5AQ9 A;  3S22 A;  3SS4 A;  4C6Y A;  3O87 A;  4QHC A;  4R4S A;  3SH7 A;  4E3N A;  2XDM A;  4ZAM A;  5IHV A;  3RXW A;  3N8S A;  1U60 A;  3I7J A;  3HUO A;  4MNR A;  5E2H A;  1MPL A;  5EVI B;  3JYI A;  3SS5 A;  3DWZ A;  2IWB A;  1ERO A;  4FH4 A;  5HAI A;  1W79 A;  2X01 A;  1ALQ A;  1PI4 A;  2WGW A;  1YMX A;  2Z2L B;  3O86 A;  3E2K A;  5CHU A;  5F83 A;  5FI6 A;  3M2K A;  1ZC2 A;  3N6I A;  4OOY A;  1O07 A;  4QJG A;  1H5X A;  3S1Y A;  4DE3 A;  3A3J A;  5JYO A;  2ZM0 A;  1PW1 A;  1I5Q A;  4OKP A;  5FI2 A;  4KEN B;  5EVI D;  5DTS A;  2A3U A;  2XK1 A;  2C5W B;  4JF6 A;  2RL3 A;  3NDE A;  1GA9 A;  5KSH A;  3Q7Z A;  4GN2 A;  4LV1 A;  3ZVT A;  3HRE A;  1LI9 A;  4EV4 A;  3N8R A;  4LCM A;  5A91 A;  2PU2 A;  2Y2J A;  3DTM A;  3MZF A;  4XXR A;  3AGD A;  2FFY A;  5CXW A;  4JLF A;  1LI0 A;  4S2L A;  1FCO A;  2XQZ A;  2QMI A;  3G4P A;  4DE1 A;  5GLA A;  5FAP A;  4CPK A;  3LO7 A;  2HP6 A;  1E4D A;  4OLG A;  3NDG A;  5FI7 A;  3VP3 A;  4OPR A;  5JYP A;  1ONG A;  1K55 C;  4X53 A;  4OQH A;  3G31 A;  1C3B A;  4S2O A;  3PTE A;  4RVA A;  1JTD A;  2XFT A;  4KQR A;  1WE4 A;  3IWO A;  3SH8 A;  5FDH A;  4F94 A;  1QME A;  2Y91 A;  3ZFZ A;  2WKI A;  4P6B A;  2R9X A;  3IWQ A;  5KMW A;  1TDL A;  5HAQ A;  1ZKJ A;  3GR2 A;  1IYO A;  1CEG A;  2HDR A;  1W5D A;  4DRT A;  1H8Y A;  2RCX A;  4EBP A;  3UDF A;  5F82 A;  1LL5 A;  1Q2Q A;  2ZQD A;  4KZ7 A;  1XGI A;  3PBT A;  2WZX A;  4QY6 A;  3ZCZ A;  1TVF A;  2WGI A;  1NXY A;  2DNS A;  2Y2H A;  4RX3 A;  1L0F A;  1RGY A;  3UO9 A;  1FR6 A;  2WAF A;  4JBF A;  3O88 A;  2OLV A;  3WRT A;  3D4F A;  3VSL A;  4MLL A;  1N9B A;  4P87 A;  4X56 A;  4GD6 A;  2CC1 A;  5CGS A;  1PZO A;  3MZD A;  3NCK A;  5FQJ A;  5FSR A;  2XR0 A;  5EEC A;  2EX8 A;  4RX2 A;  3SH9 A;  1XGJ A;  3PBS A;  1MWU A;  3VMA A;  1W7F A;  2HDQ A;  1XXM A;  2J9P A;  3PBR A;  4E6X A;  2IWD A;  2HDU A;  3G2Y A;  2WAE A;  4N9L A;  3MBZ A;  1K4E A;  4WZ4 A;  4N1H A;  3TSG A;  2Y2I A;  5AQB A;  1SDN A;  3V3S A;  3NI9 A;  3WRZ A;  3OPH A;  1IYS A;  1M6K A;  3HBR A;  4JKT A;  1JWV A;  4Y0O A;  3BFE A;  3IHA A;  3ZG9 B;  1JWZ A;  2Y2K A;  3BEB A;  1ESI A;  3BLS A;  1IEL A;  2WZZ A;  2Y2L A;  1YLJ A;  2ZQ9 A;  1K6S A;  5FAQ A;  4DXB A;  2P74 A;  2H5S A;  5FQI A;  2E8I A;  3W4O A;  4A5R A;  1RGZ A;  2BLS A;  2IWC A;  5EPH A;  5FQQ A;  1YLZ A;  2EXA A;  4DDY A;  3FYZ A;  3LEZ A;  4R1G A;  3E2L A;  4DF6 A;  3WS5 A;  3BFG A;  2Z2M B;  3NIA A;  1G6A A;  3UNW A;  1E25 A;  5CRF A;  1S6R A;  2XF3 A;  3BFC A;  5FAO A;  3IXB A;  3S4X A;  3VP1 A;  1IKG A;  3FZC A;  4GOG A;  3SOI A;  4MBH A;  3BFD A;  1ERQ A;  2HDS A;  3G30 A;  5CHM A;  3NBL A;  5EVL A;  3SS3 A;  1PI5 A;  2ZLY A;  1KDS A;  2Y2P A;  5DF9 A;  3QNB A;  1PWC A;  4LV2 A;  3OPL A;  2WGW B;  5FAT A;  3HLC A;  2I72 A;  2EX9 A;  5E43 A;  1K57 A;  3W4Q A;  1N4O A;  2WYX A;  3OCN A;  4S2N A;  1KGF A;  2G2W A;  3Q82 A;  1K54 A;  4HES A;  4BLM A;  4PM8 A;  4WMC A;  2J8Y A;  2J7V A;  3Q07 A;  3EQV A;  4S2J A;  1HD8 A;  1YQS A;  4CJN A;  2PBY A;  4PMA A;  1ZG6 A;  1WYC A;  1FOF A;  5HAR A;  4OPY A;  1W8Y A;  3C5A A;  4MBF A;  3M2J A;  3VOZ A;  1E3U A;  1GA0 A;  3QHY A;  4Y0T A;  1ES2 A;  1BLH A;  3UE1 A;  2G2U A;  4OPQ A;  1JTG A;  1IYP A;  3O3V A;  4GDB A;  4IVK A;  3G34 A;  4GB7 A;  4QD4 A;  4DXC A;  3FV7 A;  4KG6 A;  2Y2Q A;  3ZG0 A;  3V3R A;  4ZDX A;  3MKF A;  3AGF A;  4E3O A;  2ZD8 A;  1ES5 A;  2PU4 A;  1MKI A;  1MWS A;  3OC2 A;  1I2S A;  5GLC A;  2Y2O A;  1DJA A;  5M19 A;  3BFF A;  3BEC A;  2XH9 A;  4GDN A;  4XUZ A;  2H0Y A;  4GZB A;  3WS0 A;  5A90 A;  3WWX A;  1CI9 A;  1CEF A;  4Z9Q A;  3GSG A;  4IBX A;  3PBQ A;  4PPR A;  3VP0 A;  1Z6F A;  3HVF A;  1GHM A;  1K56 A;  4IVI A;  1KDW A;  2A49 A;  2ZC7 A;  4OON A;  5KSC A;  3CMZ A;  4P0M A;  1KE0 A;  5KZH A;  4X55 A;  1XA1 A;  1MWT A;  1NY0 A;  4ZJ3 A;  2XLN A;  1K38 A;  4JF4 A;  4QB8 A;  3IXD A;  1NYY A;  3C4P A;  5CEB A;  3IF5 A;  4KZA A;  1CK3 A;  1NJ4 A;  1QMF A;  4WZ5 A;  4BL3 A;  4YIN A;  1RCJ A;  4GNU A;  4R4R A;  1EWZ A;  1NZO A;  5HX9 A;  3ZNT A;  1XKZ A;  4E3K A;  4KZ3 A;  3Q7V A;  1GCE A;  4JXW A;  3IHB A;  2Q9N A;  4C75 A;  1IEM A;  4UA7 A;  5CTM A;  3P98 A;  4JXS A;  2HP9 A;  1K57 C;  3AGE A;  4S2N C;  3VP2 A;  1L0D A;  4MEZ A;  3ITA A;  4B4X A;  2WK0 A;  1K54 C;  3PAG A;  1OME A;  3G2Z A;  4E3M A;  3CZD A;  1KGE A;  4DDS A;  4KZB A;  1WYB A;  1BLC A;  2QZ6 A;  4Q8I A;  1XA7 A;  1YLY A;  3N8L A;  5HW3 A;  1H8Z A;  2JCH A;  2ZC3 B;  1MWR A;  3G35 A;  4OPZ A;  4UAA A;  3CJM A;  5DVA A;  5FQ9 A;  3ZG7 B;  5I94 A;  3UDX A;  1TDG A;  4LV0 A;  3IH9 A;  1KGG A;  3IWI A;  1HTZ A;  1L0E A;  1AXB A;  1ESU A;  3W8K A;  1XPB A;  2ZJ9 A;  1EI5 A;  3MZE A;  4QY5 A;  4WM9 A;  2R9W A;  4NET A;  4E3L A;  4N1X A;  4UA9 A;  1PYY A;  5GLB A;  4M3K A;  1BZA A;  2P9V A;  4EBN A;  1W8Q A;  4MBK A;  1IKI A;  4E3I A;  4HBU A;  1GHP A;  2C6W B;  3MFD A;  4S2M A;  4KQO A;  4OVD A;  1PIO A;  1ERM A;  4KZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...