3OPRA

Esbl r164h mutant of shv-1 beta-lactamase complexed to sa2-13
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
265
structure length
258
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDHALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Ligand-dependent disorder of the Omega loop observed in extended-spectrum SHV-type beta-lactamase.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 92
structure length 258
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3oprA00
1ALQA 1KE3A 1Q2QA 2V2FF 1PIOA 4PM7A 1TDGA 4N1XA 3C4OA 3IXGA 3A3FA 2Y2KA 4Z9QA 2HP9A 3ZVTA 1L0DA 3UE1A 1I2SA 5KMWA 3FZCA 5GLBA 4X55A 3FWLA 5CGWA 3N7WA 5FSRA 3Q7ZA 5JYOA 4ZJ1A 2HP6A 4LCLA 3ZGAB 4GZBA 1FCOA 1NY0A 1AXBA 4PM6A 4Y7PA 3UN7A 4QB8A 1IELA 2H5SA 2ZMAA 3GSGA 3HUOA 1LLBA 3G31A 3V3RA 3E2LA 4PPRA 3IF5A 5HL1A 3O88A 3A3IA 1L0EA 3SS3A 2XH9A 1JWZA 2Y2HA 3IXDA 1IKIA 4HEFA 3GV9A 5FI6A 3HLGA 2QMIA 3NY4A 3IT9A 2XR0A 2XDMA 4OPRA 4BENA 4E6WA 4OQHA 4UA6A 3MXSA 2Y91A 5F1GA 2Y4AA 1GHIA 5DF9A 1PI5A 2B5RA 5GLDA 5DVAA 5FA7A 2ZQ8A 5TGFA 1H8YA 2FFYA 2Q9MA 1NZOA 5FAQA 4OOMA 1WYCA 5DF8A 2WKEA 2ZC4B 3ZG0A 1J9MA 4NETA 1FOFA 1W5DA 3HLCA 3OC2A 1FR1A 5A90A 5I94A 1FSWA 3LY3A 1SDEA 2WAEA 3NDGA 4HESA 3DW0A 2XGNA 3GVBA 3O86A 4OP8A 4E3LA 3S1YA 2H0TA 4R23A 5L2FA 1XXMA 1PYYA 5CRFA 1JTDA 2EFXA 1FR6A 5A92A 2A49A 3VP3A 2OSUA 2Y2IA 1ESUA 4FH2A 4RX2A 4DE3A 5CECA 3O3VA 5FQMA 4E3MA 1HZOA 4XXRA 3V50A 2WKHA 3UPOA 3IHAA 3Q81A 5HAQA 1NJ4A 3IHBA 4JXVA 3WRZA 1EROA 2DCFA 5EOOA 1VM1A 3VMAA 4ZJ2A 1ZG4A 1SHVA 5HARA 3ZVWA 3QNCA 4GKUA 1N4OA 3MZFA 3ITAA 2J8YA 1H8ZA 1LL5A 1RP5A 3M2KA 1BZAA 1YLJA 3OCLA 1MWRA 2QZ6A 4K0XA 4RX3A 5FDHA 1YT4A 2DRWA 4KZBA 5F83A 4KZ6A 3HL9A 3WS2A 5FAPA 4L0LA 3C7VA 1K4FA 5D3OA 3BFEA 4S2KA 1K55C 4DKIA 4WBGA 3DWKA 2V20A 4OLDA 2JE5A 3RXWA 4OQ0A 1YMSA 5BOHA 4K0WA 4KQOA 2XLNA 1BLCA 3ISGA 1E25A 2E8IA 1KE0A 1S6RA 1MPLA 1RGYA 1NYYA 4JLFA 5CXWA 4BLMA 4PM9A 5CTNA 3W4PA 2BLSA 4EQIA 5EVIB 3UE0A 4EWFA 3OCNA 2VGJA 4X6TA 5HW3A 1XGIA 4R3BA 5DTSA 3G30A 3PTEA 2EFUA 5J8XA 3N8LA 5FQIA 2WZZA 4GD8A 2GDNA 5CHMA 3SH9A 3SS4A 4DE2A 4Y0TA 3V39A 3SOIA 1ONGA 3QNBA 2WZXA 3HLBA 2ZC6B 3OPPA 4KG5A 4N9LA 3DWZA 1NRFA 3LEZA 1PW1A 4S2MA 4IEDA 4KZ5A 1MY8A 4XUZA 5F82A 3NBLA 3IWOA 3BLMA 5EECA 4QJGA 5CTMA 3M6BA 1PZOA 3LY4A 4OKPA 3W4OA 3UDFA 4RVAA 4EBNA 4EV4A 2XEPA 5E43A 1PI4A 4KZ7A 5E2FA 3NIAA 4E3KA 2PU4A 1PW8A 4FD8A 1GHMA 2ZQDA 3NCKA 4MBKA 4ZBEA 5GHYA 4GB7A 1YLTA 4U3TA 4OH0A 1K4EA 1XA7A 2WGWA 4KZAA 2JC7A 1W79A 3UDIA 4P0MA 5TFQA 3WRTA 3ZNTA 3PBOA 2Y2MA 4PM8A 4MBFA 5EUAA 3HUNA 4YINA 4OLGA 1XPBA 1ERQA 3G35A 3FKWA 1W8YA 4LCMA 4U0TA 1BULA 4HBUA 3FV7A 4R0QA 5AQ7A 4JKTA 1MWSA 3IXBA 4JF4A 3C7UA 4WM9A 4X56A 3BECA 1KDSA 1K25A 2QPNA 1G68A 3LO7A 4OP5A 4C3QA 4X69A 1WYBA 4JPMA 3TOIA 2WYXA 4LENA 5CGXA 3G2ZA 5DTKA 3V5MA 5EPHA 4ZJ3A 3Q82A 4EUZA 4LV1A 5KZHA 3UDXA 2ZC3B 2HDUA 3HVFA 5M1AA 1QMEA 2WKIA 1FCMA 1LHYA 1N9BA 3HUMA 5E2EA 4F94A 3Q7VA 3A3JA 2Y55A 3EQVA 3IH9A 4E6XA 3EQUA 4Q8IA 3BRMA 5GLCA 4IVKA 1CI9A 1BLSA 1O7EA 3LCEA 3UE3A 1VQQA 4JF6A 4KQQA 1M6KA 3NDEA 5AQ9A 4WELA 5FI2A 3ZCZA 4P6BA 3ZG9B 4RYEA 4DE0A 2X71A 4U0XA 4FCFA 1Y54A 5FAOA 2HP5A 1GA9A 1Q2PA 4KENB 3BFCA 5KSHA 4DRTA 5HX9A 2EX8A 1K57C 1I2WA 1BT5A 1KGFA 3MKFA 2ZM0A 1IEMA 1FSYA 2ZC7A 4N9KA 1YLZA 2C6WB 2Y2JA 3AGFA 1BUEA 3OPRA 3VP2A 4QD4A 1JVJA 2Y59A 1M40A 1L0FA 4UAAA 5HAPA 4ZTKA 5CHJA 1W8QA 4JBFA 3ITBA 3Q1FA 3ZFZA 3PBTA 5GLAA 3ZG5A 3BFGA 3P98A 5TR7A 2P74A 3OZHA 2IWCA 3A3EA 4D2OA 2WGIA 3VP1A 1K57A 1DJCA 2ZM2A 3IWIA 4QU3A 1L0GA 4GDBA 3BFFA 1ZC2A 5IHVA 2HPBA 4NK3A 4E3JA 1S0WA 5G18A 1PWCA 5EOEA 4DXCA 1DY6A 2R9XA 4GNUA 1LI0A 2EXBA 1ZKJA 1K56D 1KVLA 3GTCA 3GRJA 2P9VA 3UPNA 3CZDA 2WK0A 3NC8A 4XUXA 2Y2PA 1GA0A 1SDNA 4UHUA 2CC1A 4E3IA 1QMFA 2ZD8A 1XA1A 3ZHHA 3PAGA 2EX9A 5DTTA 1K56A 1XGJA 4O7DA 3G32A 4Y0OA 3S4XA 3MZDA 4JXGA 1YMXA 1KVMA 2Q9NA 3G4PA 1ONHA 2ZQAA 4GDNA 2PU2A 1K55A 1MKIA 3WS0A 4P85A 3SH8A 3TG9A 2HDRA 4OOLA 3BM6A 2XK1A 3CMZA 1GCEA 2A3UA 1U60A 3WS5A 2R9WA 3P09A 4OONA 2ZM8A 4KG6A 4M3KA 4BD0A 2ZQ7A 4R3JA 4GN2A 5GL9A 2Y2GA 2XF3A 2J9OA 1MXOA 3CJMA 2JBFA 3N8RA 2G2UA 5E2HA 3G2YA 4BL3A 4DDSA 2ZJ9A 5FASA 1H5XA 4QY5A 4KZ4A 4B4XA 4PMAA 4S2PA 4WEKA 2H10A 2VGKA 3W4QA 1CK3A 4IVIA 5M19A 5CERA 4KG2A 1PZPA 5GHXA 1GHPA 1HD8A 2RL3A 2ZQCA 1FCNA 1MBLA 1MWUA 1BSGA 2V1ZA 4IBRA 3MKEA 4HBTA 4KZ8A 2XQZA 3HLEA 3UNWA 4JXSA 4H8RA 2WADA 4EBLA 3I7JA 1ES4A 3AGDA 4OPZA 4KZ3A 3WWXA 4E3NA 2Y2NA 3N6IA 1LI9A 3UO9A 3SH7A 5CEDA 3RXXA 3IWQA 4IBXA 3BYDA 2X01A 4OVDA 3GMWA 1XKZA 4DE1A 3MFDA 4X53A 2WGWB 3V3SA 3FKVA 4E3OA 1IKGA 2UWXA 1K6RA 5CGSA 3AGEA 4QY6A 4Y0UA 1ES2A 2G2WA 4R4SA 3VOYA 1ES5A 3HREA 4B4ZA 1MWTA 4UA9A 2BG1A 1YLWA 4KQRA 2OLVA 3IQAA 3PAEA 2XFSA 4DXBA 1SCWA 3HBRA 2H0YA 4K91A 5FQKA 1PWDA 1HVBA 1JTGA 5FQJA 4BQMA 1PWGA 5M18A 1C3BA 3PBQA 1EI5A 4LV3A 3BLSA 3N4IA 1YLPA 4R4RA 4MLLA 5AQBA 3ZDJA 4S2OA 1IYSA 5AQAA 4S2LA 5FQ9A 3ZNYA 1BLPA 3SS5A 5F1FA 5FQQA 1IYPA 2HDQA 2J9PA 4GD6A 4KZ9A 1JWVA 4FH4A 3Q7VB 2PBYA 1TVFA 3MBZA 4MBHA 2WGVA 4OOYA 1ES3A 1KGEA 4WZ4A 4CPKA 1O07A 1IYOA 3C5AA 3FYZA 1KGGA 1ERMA 2IWDA 4RA7A 2HDSA 3CG5A 5HAIA 4S2NC 3M6HA 2IWBA 2DNSA 3Q07A 4OPYA 2RCXA 2XFTA 3BEBA 4WEJA 3VP4A 3VOZA 3A3DA 4LV2A 4ZAMA 1BTLA 4LV0A 4ZDXA 1CEFA 2EX6A 3WS4A 5EVIC 1HTZA 2I72A 4JXWA 4MNRA 4MEZA 4S2JA 5EE8A 1XX2A 3VFHA 2OV5A 3D4FA 3HLFA 2Y2OA 3MZEA 3S22A 1NYMA 3IXHA 4QHCA 2FFFB 2EXAA 3IH8A 4S2NA 1DJAA 2C5WB 4WMCD 4WZ5C 5EVID 4OPQA 2WAFA 4EBPA 1Z6FA 4B88A 1YM1A 4ID4A 1TDLA 4CJNA 1DJBA 2XD5A 2XD1A 4N1HA 1E3UD 5EVLA 2Y2LA 3GQZA 1K54C 4JF5A 3TSGA 4WMCA 5E2GA 5EVIA 4UA7A 4BL2A 4OQGA 5CEBA 1NZUA 1IYQA 3PBNA 1CEGA 3IF6C 3QHYA 1CI8A 3VFFA 1OMEA 1K6SA 1E3UA 5HFOA 5KSCA 3E2KA 1K38A 4WZ5A 4YFMA 1L2SA 2ZLYA 2P9VB 1XP4A 2ZC5B 3JYIA 3PBSA 1RCJA 4P87A 5DF7A 5GHZA 1KE4A 3VP0A 1JWPA 3WS1A 3ZG7B 1TEMA 1FQGA 1YLYA 3B3XA 3PBRA 1ESIA 1RGZA 3HLDA 1W7FA 2Z2MB 5FATA 2Z2LB 3GR2A 1K54A 1ZG6A 2ZQ9A 4S2IA 4C75A 3DTMA 4X68A 3BFDA 5JYPA 5FI7A 3IF6A 1KDWA 4FSFA 4N92A 3VSKA 3G34A 1WE4A 4GOGA 4WYYA 4BD1A 1YQSA 2J7VA 2Y2QA 3M2JA 3OPLA 4DDYA 4PM5A 1BLHA 1G6AA 1SKFA 3C4PA 3N8SA 4A5RA 3HLWA 1NXYA 4R1GA 3RJUA 3W8KA 4C6YA 3UY6A 1E4DA 1I5QA 3NI9A 3ZG8B 4BJPA 3VSLA 3OPHA 5U47A 5A93A 3UPPA 1EWZA 1LL9A 4OQIA 3MXRA 2JCHA 2WUQA 3IF6B 3O87A 5A91A 2OLUA 4DF6A 2EX2A 2X02A 5CHUA
chains in the Genus database with same CATH superfamily
1Q2QA 2V2FF 3E4OA 5HWWA 3F1OB 2HP9A 5JYOA 1XFNA 1FCOA 1AXBA 1H3QA 2H5SA 3HUOA 1LLBA 3E2LA 2PAVP 3BQAA 4JGPA 2HZ5A 1GSXA 2M7VA 1JWZA 2Y2HA 3A0SA 1IKIA 3GV9A 1ZHHB 3HLGA 2QMIA 3NY4A 3VOLA 3UB7A 4OPRA 4OQHA 3MXSA 2Y91A 5F1GA 2K31A 2B02A 5FA7A 4XT2A 5FAQA 2INWA 3GDIA 5J3WA 4HNBA 2ZC4B 1FOFA 3LI8A 1FR1A 2QYBA 3LY3A 1NLZA 2H0TA 5L2FA 1W63M 5A92A 3TJZC 3VP3A 2Y2IA 3T4JA 4DE3A 5CECA 5J4EA 5F5YA 1HZOA 3Q81A 3E4QA 2ZMVA 1G5UA 2W3GA 4ZJ2A 1SHVA 3ZVWA 1N4OA 3MZFA 2ACGA 1W63Q 3S7PA 3BW6A 5FDHA 2DRWA 5FAPA 4LLOB 5D3OA 1L3LA 3BFEA 4S2KA 4GJ4A 1OTBA 4OLDA 3T1QB 2VEAA 3D72A 1E25A 4RQ9A 5EVIB 3DTKA 3OCNA 2VGJA 3UMDA 4YNRA 1TD5A 2WZZA 2I9VA 2WZXA 3KYQA 2ZC6B 2NUPC 4KG5A 4N9LA 4XUZA 3H7WB 5IS1A 3NBLA 3M6BA 2W1TB 1PRQA 4OKPA 3W4OA 2HV1A 4EV4A 3T1RA 2JN7A 2XEPA 5E2FA 4KZ7A 2BTFP 2ZQDA 3T4QA 1W79A 3PBOA 4PM8A 3PXPA 3LR4A 4MBFA 3HUNA 4Y5FA 5EUAA 1XPBA 2Z6DA 4U0TA 5AQ7A 3IXBA 4JF4A 3MQ0A 3FC7A 4C3QA 3SW1A 3TOIA 5EPHA 5KZHA 3UDXA 4I3IA 3KX0X 2ZC3B 3HVFA 1LHYA 1N9BA 5E2EA 4F94A 1VETB 3A3JA 4GW9A 4E6XA 3EQUA 4Q8IA 3NECA 1CI9A 1O7EA 3LCEA 4R3AA 3NDEA 5FI2A 4U0XA 3DTEA 4FCFA 4WF0A 4KUOA 1I2WA 2VLGA 1OT6A 4N9KA 1YLZA 2C6WB 4QD4A 3LR0A 2Y59A 1M40A 3IX3A 4ZTKA 1W8QA 5GLAA 3BFGA 3F1PB 2IWCA 4D2OA 3VP1A 1K57A 4HP4A 2YKFA 2HPBA 3VE4A 1BYWA 5G18A 3T4KA 1PWCA 1LI0A 3KO6A 4R38A 4M4XA 3GTCA 3KYEA 3CZDA 3NC8A 3MMHA 1QMFA 2EX9A 5DTTA 4LPZA 1KVMA 1ONHA 2PU2A 3TG9A 2HDRA 4OOLA 3KYZA 1U60A 3P09A 4GHIB 4KG6A 4BD0A 5L8MA 1SKOA 2XF3A 1MXOA 2KOIA 3CJMA 3N8RA 5E2HA 2FZ0A 1CK3A 3QP8A 1GHPA 2RL3A 3TW8A 1DP8A 3E0YA 1DP9A 4KZ8A 2XQZA 3UNWA 4OPZA 1ES4A 2VJWA 3B47A 5C5KA 4E3NA 3KSGA 1LI9A 4H6JB 3SH7A 3RXXA 1VEUA 3BYDA 2VZWA 1XKZA 2Y79A 4DE1A 1N9OA 3H82A 2D01A 3JPUA 4R4SA 1ES5A 1MWTA 2BG1A 3IQAA 3PAEA 1SCWA 3HBRA 5FQKA 1PWGA 3PBQA 3BLSA 3N4IA 2J3TC 2VV6A 4S2LA 3SS5A 5FQQA 1JWVA 3CI6A 4FH4A 1TS8A 3Q7VB 1H8MA 4OOYA 2ZBBA 3C5AA 3FG8A 1Z09A 2XFTA 3VP4A 3VOZA 3CPTB 4QPRA 4LV0A 1GSVA 1CEFA 3WS4A 5MC7A 2VV8A 5F69A 4MNRA 4CLCD 4S2JA 3D4FA 5DFXA 3HJIA 4X1MA 3IXHA 4QHCA 2FFFB 2EXAA 2C5WB 4EBPA 1Z6FA 4CJNA 1DJBA 4N1HA 1NLYA 1E3UD 3C2WA 2K7SA 4ME4A 3KSFA 4MMNA 4WMCA 4UA7A 5CEBA 4GS9A 1NZUA 3PBNA 1CEGA 2G7UA 4YFMA 3JYIA 1XP4A 3PBSA 2KLIA 1KE4A 1DP6A 1TEMA 1FQGA 3PBRA 2UV0E 2Z2LB 4WL9A 1K54A 2ZQ9A 4C75A 3DTMA 4X68A 2DMWA 3BFDA 5FI7A 2E8JA 3CUEC 1TS0A 4Q0JA 4WYYA 4BD1A 1P0ZA 2NUTC 3W8KA 1MZUA 3ZG8B 3VSLA 1MC0A 3UPPA 4OQIA 2JCHA 3BQ8A 3LIAA 4JGQA 2OLUA 2EX2A 5GLBA 5CHUA 5IHVA 1PIOA 1TDGA 4P6ZS 5FL3A 4Z9QA 4EW7A 5KMWA 5TJJA 4X55A 3FWLA 3N7WA 4I5SA 3P01A 4LCLA 1NY0A 3EWKA 4PM6A 1IELA 3IF5A 3OBFA 4MN7A 3SS3A 2XH9A 3IXDA 2LB9A 2JKTM 1IFQA 4HJ3A 4HEFA 1TS7A 5DFYA 5I5LA 2XR0A 3CHWP 2HJEA 1XFQA 2KX6A 1NZOA 3S7QA 2QKPA 4OOMA 1WYCA 5DF8A 3ZG0A 1XJ2A 3F1NA 2PT7A 2WAEA 4HESA 3O86A 2XGNA 4OP8A 3S1YA 1PYYA 2V1AA 1H0MA 1T1CA 4F3LB 3T4OA 5FQMA 4E3MA 3V50A 3UPOA 2AVXA 2IA2A 3IHAA 4JXVA 2DCFA 3VMAA 3QNCA 2VKSA 4GKUA 3IBJA 3ITAA 2J8YA 1H8ZA 1LL5A 4PHTA 3OCLA 1YLJA 4K0XA 5KIZA 5LBRA 4DKIA 1F98A 3DWKA 2ZL1A 2JE5A 3RXWA 4OQ0A 4K0WA 4BBVA 2XLNA 3MS6A 3ISGA 2E8IA 1KE0A 1MPLA 1NYYA 4EQIA 4X6TA 1XGIA 3G30A 3FPVA 5CHMA 4Y0TA 1XJ4A 3HLBA 3OPPA 2W1RA 4S2MA 4CQHA 5EECA 4QJGA 3NULA 1F9IA 3PYPA 5E43A 1LL8A 2VX8A 2GZAA 4MCWA 4MBKA 3NCKA 4ZBEA 3UMEA 4GB7A 1YLTA 5AVEA 1K4EA 5G4YA 5TFQA 4LRZE 2O99A 4YINA 3OLOA 4LCMA 1BULA 2VGLS 2ZOIA 3IS2A 2XROA 4NEED 4X56A 1KDSA 2QPNA 4OP5A 4EUZA 2HDUA 4BMWA 1UWNX 3HUMA 3EOIA 2Y55A 3A0VA 3UE3A 1VQQA 4IJGA 4P6BA 4RYEA 4DE0A 1Y54A 1Q2PA 4KENB 4HH2A 5KSHA 5HX9A 2EX8A 1K57C 4BBUA 5HWVA 2A24B 3P7NA 3AGFA 4I39A 1BUEA 3ZQ5A 1JVJA 4UAAA 1L0FA 2W3FA 5HAPA 2FH5A 3ITBA 1VHMA 3Q1FA 3PBTA 3UE6A 5TR7A 3OZHA 5HPIA 2WGIA 2ZM2A 1L0GA 4GDBA 3BFFA 4O01A 4LRXC 4DXCA 3QP1A 1K56D 4IUHA 1V9ZA 2WK0A 5G4ZA 4XUXA 4E3IA 2CC1A 2ZD8A 3QP2A 2W0NA 1N9LA 2CMNA 3S4XA 4JXGA 4GDNA 2ZQAA 2XSSA 3WS5A 2R9WA 4BBTA 4CLCE 2ZM8A 4M3KA 2ZQ7A 3EGDC 3NJAA 3W2ZA 5TBMA 2P7JA 1J3WA 3C30A 2HGVA 4DDSA 1CQAA 3E98A 1H5XA 4QY5A 2PBDP 1OTDA 2XA7M 4WEKA 3F1OA 4IVIA 4KG2A 2W27A 5EM1A 3BY8A 2WKPA 2V1ZA 2OOLA 4I3JA 4HBTA 4ARZB 4EQ1A 1T19A 3AGDA 4KZ3A 2MJ6A 3LUQA 2Y2NA 3L7HA 3UO9A 5CEDA 3IWQA 4IBXA 3GMWA 2WGWB 2V0WA 1K6RA 4II7A 4QY6A 4Y0UA 4DJ2A 2G2WA 4HQAA 4KQRA 1YLWA 2XFSA 5EV0A 1T1AA 1C3BA 1EI5A 4LV3A 5DJTA 1YLPA 3DBAA 2M7UA 4MLLA 5AQBA 3ZNYA 1IYSA 4GCZA 1IYPA 2HDQA 2J9PA 4MBHA 2J3TD 3H9WA 3MBZA 1ES3A 4WZ4A 4ZRRA 3CWFA 1ERMA 2IWDA 4D60A 2PHYA 1EW0A 4NKPA 3MSHA 3Q07A 4OPYA 3QP6A 4WEJA 3KSIA 3QP4A 4EERA 3R4KA 1BTLA 2W3DA 4IUKA 2LB5A 1P97A 2OV5A 3S22A 3IH8A 4S2NA 1DJAA 1T1BA 4G3WA 1F5MA 4Y15A 3MJQA 1K54C 5EVIA 3C38A 1CJFA 1CI8A 1K6SA 3E2KA 3U2AA 1L2SA 1SZVA 1S67L 2P9VB 5DF7A 3KSHA 2OAQ1 1JWPA 3R7WB 1YLYA 5FATA 1KOUA 3H7WA 4R70A 2W1TA 3VSKA 4N92A 3G34A 4FUWA 4GOGA 3MQQA 3OPLA 4PM5A 1BLHA 1G6AA 1SKFA 1LT0A 1DRMA 2V1BA 5HDCA 4BJPA 4DMZA 5U47A 3O87A 2V8FA 1ALQA 4PM7A 3B42A 5IT5A 3C4OA 2Y2KA 4WLAA 3S7OA 1OTIA 3FZCA 5CGWA 3Q7ZA 3BWLA 4ZJ1A 2HP6A 2J3WA 3S7NA 3ZGAB 4GZBA 3UN7A 4QB8A 3V3RA 3GSGA 4PPRA 5HL1A 1VETA 1L0EA 1N9NA 5FI6A 2XDMA 4E6WA 4UA6A 2QWSA 2Y4AA 1GHIA 2B5RA 5GLDA 5TGFA 1H8YA 5FEGA 3LIDA 2YKHA 3TRCA 1W5DA 2O9BA 5A90A 5I94A 3LIFA 1TF1A 3NDGA 1SDEA 2JKRM 4R23A 2EA9A 5CRFA 1JTDA 1FR6A 3MF0A 2A49A 1ESUA 3O3VA 5F68A 1NJ4A 4G3VA 4Y17A 5EOOA 1ZG4A 5HARA 1XJ3A 4RX3A 4L9EA 5F83A 4K08A 4KZ6A 3HL9A 4Q0IA 4L0LA 3C7VA 1K4FA 5CX7A 4WBGA 1YMSA 4KQOA 3MFXA 1BLCA 3FPWA 4JLFA 5HDSA 1NRJA 1RGYA 4GHIA 3W4PA 2BLSA 2WKQA 3UE0A 4EWFA 3HJKA 4YOFA 5HW3A 4R3BA 2EFUA 3N8LA 4GD8A 1YPRA 2GDNA 3SH9A 3SS4A 2D02A 4NXGA 5HL6A 1NWZA 3LEZA 4IEDA 4KZ5A 4UQIM 1AWIA 4R6LA 4WUJA 5CTMA 3UDFA 1D1JA 1MKMA 1XA7A 4KZAA 2JC7A 5DKLA 3WRTA 3BJNA 3V67A 5L07A 1ERQA 3G35A 3FKWA 1W8YA 2VA0A 2OWHA 1MWSA 4ESPA 3C7UA 4WM9A 3HCYA 3LO7A 3T4SA 4JPMA 3V5MA 3LIBA 4LENA 3G2ZA 5DTKA 3T4TA 4LV1A 1Y4OA 3G6OA 5M1AA 1QMEA 3Q7VA 1K0KA 3IS2B 1LSWA 4Y13A 1BLSA 1VB6A 4JF6A 1M6KA 3ZG9B 4WELA 5FAOA 1GA9A 3BFCA 3CPTA 1OJGA 1KGFA 3MKFA 4EUVA 2ZM0A 1IEMA 2ZC7A 3VP2A 1HLUP 2Y2JA 4XT2B 5CHJA 2Z6CA 4JBFA 3ZFZA 3ZG5A 1FIKA 3T12B 3RFBA 2VV7A 5DJUA 3A3EA 4CLCC 1DJCA 3IWIA 4QU3A 1ZC2A 4E3JA 1S0WA 4GLQA 5EOEA 4EESA 1DY6A 2R9XA 2EXBA 2JHEA 2Y2PA 1GA0A 3ZHHA 3PAGA 4O7DA 3G32A 1OTAA 3RH8B 5L09A 1YMXA 3G4PA 2QHKA 1MKIA 3WS0A 4P85A 5L10A 1GSWA 2XK1A 2B95A 4R3JA 2J9OA 2G2UA 4JGRA 3G2YA 4BL3A 4FOFA 1XJ6A 4B4XA 3W4QA 2VGKA 2P04A 1S1ZA 5M19A 3IBRA 2A2LA 4L9GA 1MWUA 1BSGA 4IBRA 4ETXA 2JKGA 2WADA 4EBLA 3I7JA 3WWXA 5HPFA 4L9FA 2M1CA 3NHQA 2X01A 3IX4A 3V3SA 2UWXA 5CGSA 3NOUC 3AGEA 3VOYA 4UA9A 4DXBA 4K91A 1PWDA 4DJ3A 4KQDA 4HJ4A 3ICYA 2V0UA 4S2OA 5FQ9A 5AQAA 5F1FA 3IX8A 4KZ9A 4NXFA 2PBYA 1A0KA 1KGEA 4CPKA 4F3LA 3FYZA 4RA7A 1LSXA 2HDSA 5HAIA 4S2NC 2L1MA 2IWBA 3A3DA 5FDSA 2VK3A 1YKDA 4HY8A 5EVIC 1HTZA 2I72A 4JXWA 4MEZA 5EE8A 1XX2A 1UGUA 3MZEA 3HLFA 3LYXA 1ZTUA 2ZOHA 4WMCD 1LSVA 4OPQA 4LGWA 4CLCA 1TDLA 2GJ3A 2P08A 2JKTI 4HI4A 5EVLA 2Y2LA 3GQZA 1G28A 3L9KA 2PR5A 2XRNA 1E3UA 2O9AA 5HDDA 5HFOA 5KSCA 1K38A 4WZ5A 5GHZA 2ZC5B 4Y3IA 1RCJA 4P87A 3WS1A 3ZG7B 4HIAA 3B3XA 5HZHA 1RGZA 1W7FA 3GR2A 1ZG6A 5JYPA 2PD7A 4MN5A 3IF6A 4FSFA 5EFWA 1YQSA 1STZA 2J7VA 2Y2QA 4DDYA 4Q0HA 3N8SA 5AVFA 3HLWA 4R1GA 3RJUA 2PD8A 1E4DA 1I5QA 1SKOB 2GX5A 5A93A 1LL9A 4B93A 5A91A 2X02A 3WS2A 4YWZA 1KE3A 4N1XA 4BWIA 2V9AA 3IXGA 3A3FA 3ZVTA 1L0DA 3UE1A 1I2SA 3LEQA 2PDRA 5FSRA 1D06A 4Y7PA 2ZMAA 3G31A 4LRYC 2HF6A 2XA7S 4PAUA 3O88A 3A3IA 1VEUB 4Y2FA 3H82B 1S4RA 2L4RA 2Y8HA 3IT9A 2O9CA 4BENA 4JGOA 5DF9A 1PI5A 2A24A 5DVAA 2ZQ8A 2FFYA 2Q9MA 1OJ5A 2PYPA 5HSQA 2WKEA 1J9MA 4NETA 2OAP1 3HLCA 3OC2A 1FSWA 3LIEA 3DW0A 4E3LA 3GVBA 1XXMA 1S66L 2EFXA 2OSUA 4FH2A 4RX2A 1S4SA 2OWJA 4XXRA 3VE3A 2WKHA 5HD5A 3LR3A 5HAQA 3IHBA 3WRZA 3GECA 1EROA 1VM1A 5HWTA 1JNUA 1RP5A 3M2KA 1BZAA 1MWRA 1PNEA 2QZ6A 2W3EA 1YT4A 4KZBA 4AFIA 3U4LP 1G6OA 1K55C 1YSPA 2V20A 5BOHA 5CXWA 1S6RA 4BLMA 1V9YA 3EEHA 4PM9A 5CTNA 2H28A 4GS9B 5DTSA 3ZYTA 4HHDA 5J7EA 3PTEA 5J8XA 5FQIA 4DE2A 3V39A 1P9WA 1ONGA 3QNBA 2J80A 3SOIA 3DWZA 1NRFA 1PW1A 3C8CA 3EGXC 1MY8A 5F82A 3IWOA 3BLMA 5K5BA 3UB9A 1PZOA 3LY4A 4EBNA 4RVAA 2EWWA 4ARZA 3TE8A 1PI4A 3NIAA 4E3KA 3T1XA 2PU4A 1PW8A 1ACFA 1GHMA 4FD8A 5GHYA 1D7EA 4U3TA 4OH0A 3CAXA 2WGWA 4I3AA 3UDIA 4EXOA 4P0MA 3ZNTA 2Y2MA 4OLGA 4HBUA 3FV7A 4R0QA 4JKTA 3ULFA 3QP5A 3BECA 1K25A 2K2NA 1G68A 3UB6A 4X69A 1WYBA 2WYXA 5CGXA 4ZJ3A 3Q82A 4EETB 3MQOA 2WKRA 2PR6A 5EVEA 2WKIA 1FCMA 3LICA 3UB5P 3OOVA 3EQVA 3IH9A 3BRMA 5GLCA 1X0OA 4IVKA 2V8CA 4KQQA 5AQ9A 3ZCZA 1TS6A 5FEFA 2X71A 2HP5A 3F1PA 4B9OA 3CLOA 4DRTA 1BT5A 4G3KA 5DKKA 1FSYA 3T1SA 3OPRA 3D3OA 4NG2A 3F1NB 3P98A 2P74A 3NOTC 3E4PA 3UB8A 3T4LA 3PHYA 3PR6A 4NK3A 4X1LA 2O0YA 4GNUA 1Y28A 1ZKJA 1KVLA 3GRJA 2P9VA 3UPNA 4HJ6A 3R7WA 1SDNA 4UHUA 1XA1A 1K56A 1XGJA 4Y0OA 3K2NA 3MZDA 3EEAA 4LFUA 2Q9NA 1K55A 2ZL1B 3SH8A 2GNXA 1UWPX 1FILA 4P6ZM 3BM6A 3CMZA 1GCEA 2A3UA 5EM0A 4OONA 4GN2A 5GL9A 2Y2GA 2JBFA 4QWOA 2ZJ9A 5FASA 2HJ9C 4KZ4A 3JVVA 4PMAA 4S2PA 4E04A 2H10A 4HP9A 4H6JA 4MDZA 5CERA 1PZPA 5GHXA 1HD8A 2ZQCA 1FCNA 1MBLA 2QJ5A 3LI9A 2QJ7A 1OPXA 2PRFA 3MKEA 3D9YA 3HLEA 4JXSA 4H8RA 3MXQA 3N6IA 4IHQA 3A0RA 4I38A 2EWVA 4OVDA 4UQIS 4WN5A 3MFDA 4X53A 1T18A 3CITA 3FKVA 4E3OA 4O0PA 1IKGA 1ES2A 4NXEA 3O5YA 2PYRA 4Z1WA 3HREA 1OT9A 4B4ZA 2OLVA 4PKYG 4EU0A 3SZTA 2H0YA 3DAVA 1HVBA 1JTGA 5FQJA 4BQMA 4X25A 5M18A 3BY9A 3JVUA 1YSQA 4R4RA 3ZDJA 1ODVA 2BASA 1BLPA 4GD6A 2KDKA 1TVFA 2WGVA 4HH3A 1OTEA 3B33A 1O07A 1IYOA 4EEPA 1KGGA 4PKYA 3LFVA 3CG5A 4FTXA 3M6HA 2DNSA 5HD3A 4MN6A 2RCXA 3BEBA 1WA9A 1F2KA 2R78A 5IU1A 4LV2A 4UEYA 4ZAMA 2JKFA 2L0WA 4ZDXA 2EX6A 3MR0A 2W3HA 3K3CA 3VFHA 2Y2OA 1NYMA 1CF0A 3LGOA 5EVID 4WZ5C 4DN0A 4ETZA 2WAFA 2ZMFA 4B88A 1YM1A 4ID4A 4EEUA 2XD5A 2XD1A 5AJGA 2B18A 4KUKA 4JF5A 3TSGA 5E2GA 4BL2A 4OQGA 4HOIA 1IYQA 3IF6C 3VV4A 3QHYA 5A8BA 3DTIA 3VFFA 1OMEA 4O8GA 2ZLYA 3K3DA 3VP0A 4CLCB 4NXBA 1ESIA 3HLDA 2Z2MB 1PFLA 3T50A 4S2IA 1S1YA 1P9RA 3NOPC 1KDWA 1WE4A 3M2JA 5F6AA 2JKRI 3C4PA 4A5RA 1IOUA 2Q0OA 1YAXA 2VGLM 1NXYA 3LR5A 4C6YA 3UY6A 5TBMB 3NI9A 3OPHA 3RTYA 1EWZA 3MXRA 2WUQA 3IF6B 3CUEA 4DF6A
chains in the Genus database with same CATH topology
1ALQA 1KE3A 1Q2QA 2V2FF 1PIOA 4PM7A 1TDGA 4N1XA 3C4OA 3IXGA 3A3FA 2Y2KA 4Z9QA 2HP9A 3ZVTA 1L0DA 3UE1A 1I2SA 5KMWA 3FZCA 5GLBA 4X55A 3FWLA 5CGWA 3N7WA 5FSRA 3Q7ZA 5JYOA 4ZJ1A 2HP6A 4LCLA 3ZGAB 4GZBA 1FCOA 1NY0A 1AXBA 4PM6A 4Y7PA 3UN7A 4QB8A 1IELA 2H5SA 2ZMAA 3GSGA 3HUOA 1LLBA 3G31A 3V3RA 3E2LA 4PPRA 3IF5A 5HL1A 3O88A 3A3IA 1L0EA 3SS3A 2XH9A 1JWZA 2Y2HA 3IXDA 1IKIA 4HEFA 3GV9A 5FI6A 3HLGA 2QMIA 3NY4A 3IT9A 2XR0A 2XDMA 4OPRA 4BENA 4E6WA 4OQHA 4UA6A 3MXSA 2Y91A 5F1GA 2Y4AA 1GHIA 5DF9A 1PI5A 2B5RA 5GLDA 5DVAA 5FA7A 2ZQ8A 5TGFA 1H8YA 2FFYA 2Q9MA 1NZOA 5FAQA 4OOMA 1WYCA 5DF8A 2WKEA 2ZC4B 3ZG0A 1J9MA 4NETA 1FOFA 1W5DA 3HLCA 3OC2A 1FR1A 5A90A 5I94A 1FSWA 3LY3A 1SDEA 2WAEA 3NDGA 4HESA 3DW0A 2XGNA 3GVBA 3O86A 4OP8A 4E3LA 3S1YA 2H0TA 4R23A 5L2FA 1XXMA 1PYYA 5CRFA 1JTDA 2EFXA 1FR6A 5A92A 2A49A 3VP3A 2OSUA 2Y2IA 1ESUA 4FH2A 4RX2A 4DE3A 5CECA 3O3VA 5FQMA 4E3MA 1HZOA 4XXRA 3V50A 2WKHA 3UPOA 3IHAA 3Q81A 5HAQA 1NJ4A 3IHBA 4JXVA 3WRZA 1EROA 2DCFA 5EOOA 1VM1A 3VMAA 4ZJ2A 1ZG4A 1SHVA 5HARA 3ZVWA 3QNCA 4GKUA 1N4OA 3MZFA 3ITAA 2J8YA 1H8ZA 1LL5A 1RP5A 3M2KA 1BZAA 1YLJA 3OCLA 1MWRA 2QZ6A 4K0XA 4RX3A 5FDHA 1YT4A 2DRWA 4KZBA 5F83A 4KZ6A 3HL9A 3WS2A 5FAPA 4L0LA 3C7VA 1K4FA 5D3OA 3BFEA 4S2KA 1K55C 4DKIA 4WBGA 3DWKA 2V20A 4OLDA 2JE5A 3RXWA 4OQ0A 1YMSA 5BOHA 4K0WA 4KQOA 2XLNA 1BLCA 3ISGA 1E25A 2E8IA 1KE0A 1S6RA 1MPLA 1RGYA 1NYYA 4JLFA 5CXWA 4BLMA 4PM9A 5CTNA 3W4PA 2BLSA 4EQIA 5EVIB 3UE0A 4EWFA 3OCNA 2VGJA 4X6TA 5HW3A 1XGIA 4R3BA 5DTSA 3G30A 3PTEA 2EFUA 5J8XA 3N8LA 5FQIA 2WZZA 4GD8A 2GDNA 5CHMA 3SH9A 3SS4A 4DE2A 4Y0TA 3V39A 3SOIA 1ONGA 3QNBA 2WZXA 3HLBA 2ZC6B 3OPPA 4KG5A 4N9LA 3DWZA 1NRFA 3LEZA 1PW1A 4S2MA 4IEDA 4KZ5A 1MY8A 4XUZA 5F82A 3NBLA 3IWOA 3BLMA 5EECA 4QJGA 5CTMA 3M6BA 1PZOA 3LY4A 4OKPA 3W4OA 3UDFA 4RVAA 4EBNA 4EV4A 2XEPA 5E43A 1PI4A 4KZ7A 5E2FA 3NIAA 4E3KA 2PU4A 1PW8A 4FD8A 1GHMA 2ZQDA 3NCKA 4MBKA 4ZBEA 5GHYA 4GB7A 1YLTA 4U3TA 4OH0A 1K4EA 1XA7A 2WGWA 4KZAA 2JC7A 1W79A 3UDIA 4P0MA 5TFQA 3WRTA 3ZNTA 3PBOA 2Y2MA 4PM8A 4MBFA 5EUAA 3HUNA 4YINA 4OLGA 1XPBA 1ERQA 3G35A 3FKWA 1W8YA 4LCMA 4U0TA 1BULA 4HBUA 3FV7A 4R0QA 5AQ7A 4JKTA 1MWSA 3IXBA 4JF4A 3C7UA 4WM9A 4X56A 3BECA 1KDSA 1K25A 2QPNA 1G68A 3LO7A 4OP5A 4C3QA 4X69A 1WYBA 4JPMA 3TOIA 2WYXA 4LENA 5CGXA 3G2ZA 5DTKA 3V5MA 5EPHA 4ZJ3A 3Q82A 4EUZA 4LV1A 5KZHA 3UDXA 2ZC3B 2HDUA 3HVFA 5M1AA 1QMEA 2WKIA 1FCMA 1LHYA 1N9BA 3HUMA 5E2EA 4F94A 3Q7VA 3A3JA 2Y55A 3EQVA 3IH9A 4E6XA 3EQUA 4Q8IA 3BRMA 5GLCA 4IVKA 1CI9A 1BLSA 1O7EA 3LCEA 3UE3A 1VQQA 4JF6A 4KQQA 1M6KA 3NDEA 5AQ9A 4WELA 5FI2A 3ZCZA 4P6BA 3ZG9B 4RYEA 4DE0A 2X71A 4U0XA 4FCFA 1Y54A 5FAOA 2HP5A 1GA9A 1Q2PA 4KENB 3BFCA 5KSHA 4DRTA 5HX9A 2EX8A 1K57C 1I2WA 1BT5A 1KGFA 3MKFA 2ZM0A 1IEMA 1FSYA 2ZC7A 4N9KA 1YLZA 2C6WB 2Y2JA 3AGFA 1BUEA 3OPRA 3VP2A 4QD4A 1JVJA 2Y59A 1M40A 1L0FA 4UAAA 5HAPA 4ZTKA 5CHJA 1W8QA 4JBFA 3ITBA 3Q1FA 3ZFZA 3PBTA 5GLAA 3ZG5A 3BFGA 3P98A 5TR7A 2P74A 3OZHA 2IWCA 3A3EA 4D2OA 2WGIA 3VP1A 1K57A 1DJCA 2ZM2A 3IWIA 4QU3A 1L0GA 4GDBA 3BFFA 1ZC2A 5IHVA 2HPBA 4NK3A 4E3JA 1S0WA 5G18A 1PWCA 5EOEA 4DXCA 1DY6A 2R9XA 4GNUA 1LI0A 2EXBA 1ZKJA 1K56D 1KVLA 3GTCA 3GRJA 2P9VA 3UPNA 3CZDA 2WK0A 3NC8A 4XUXA 2Y2PA 1GA0A 1SDNA 4UHUA 2CC1A 4E3IA 1QMFA 2ZD8A 1XA1A 3ZHHA 3PAGA 2EX9A 5DTTA 1K56A 1XGJA 4O7DA 3G32A 4Y0OA 3S4XA 3MZDA 4JXGA 1YMXA 1KVMA 2Q9NA 3G4PA 1ONHA 2ZQAA 4GDNA 2PU2A 1K55A 1MKIA 3WS0A 4P85A 3SH8A 3TG9A 2HDRA 4OOLA 3BM6A 2XK1A 3CMZA 1GCEA 2A3UA 1U60A 3WS5A 2R9WA 3P09A 4OONA 2ZM8A 4KG6A 4M3KA 4BD0A 2ZQ7A 4R3JA 4GN2A 5GL9A 2Y2GA 2XF3A 2J9OA 1MXOA 3CJMA 2JBFA 3N8RA 2G2UA 5E2HA 3G2YA 4BL3A 4DDSA 2ZJ9A 5FASA 1H5XA 4QY5A 4KZ4A 4B4XA 4PMAA 4S2PA 4WEKA 2H10A 2VGKA 3W4QA 1CK3A 4IVIA 5M19A 5CERA 4KG2A 1PZPA 5GHXA 1GHPA 1HD8A 2RL3A 2ZQCA 1FCNA 1MBLA 1MWUA 1BSGA 2V1ZA 4IBRA 3MKEA 4HBTA 4KZ8A 2XQZA 3HLEA 3UNWA 4JXSA 4H8RA 2WADA 4EBLA 3I7JA 1ES4A 3AGDA 4OPZA 4KZ3A 3WWXA 4E3NA 2Y2NA 3N6IA 1LI9A 3UO9A 3SH7A 5CEDA 3RXXA 3IWQA 4IBXA 3BYDA 2X01A 4OVDA 3GMWA 1XKZA 4DE1A 3MFDA 4X53A 2WGWB 3V3SA 3FKVA 4E3OA 1IKGA 2UWXA 1K6RA 5CGSA 3AGEA 4QY6A 4Y0UA 1ES2A 2G2WA 4R4SA 3VOYA 1ES5A 3HREA 4B4ZA 1MWTA 4UA9A 2BG1A 1YLWA 4KQRA 2OLVA 3IQAA 3PAEA 2XFSA 4DXBA 1SCWA 3HBRA 2H0YA 4K91A 5FQKA 1PWDA 1HVBA 1JTGA 5FQJA 4BQMA 1PWGA 5M18A 1C3BA 3PBQA 1EI5A 4LV3A 3BLSA 3N4IA 1YLPA 4R4RA 4MLLA 5AQBA 3ZDJA 4S2OA 1IYSA 5AQAA 4S2LA 5FQ9A 3ZNYA 1BLPA 3SS5A 5F1FA 5FQQA 1IYPA 2HDQA 2J9PA 4GD6A 4KZ9A 1JWVA 4FH4A 3Q7VB 2PBYA 1TVFA 3MBZA 4MBHA 2WGVA 4OOYA 1ES3A 1KGEA 4WZ4A 4CPKA 1O07A 1IYOA 3C5AA 3FYZA 1KGGA 1ERMA 2IWDA 4RA7A 2HDSA 3CG5A 5HAIA 4S2NC 3M6HA 2IWBA 2DNSA 3Q07A 4OPYA 2RCXA 2XFTA 3BEBA 4WEJA 3VP4A 3VOZA 3A3DA 4LV2A 4ZAMA 1BTLA 4LV0A 4ZDXA 1CEFA 2EX6A 3WS4A 5EVIC 1HTZA 2I72A 4JXWA 4MNRA 4MEZA 4S2JA 5EE8A 1XX2A 3VFHA 2OV5A 3D4FA 3HLFA 2Y2OA 3MZEA 3S22A 1NYMA 3IXHA 4QHCA 2FFFB 2EXAA 3IH8A 4S2NA 1DJAA 2C5WB 4WMCD 4WZ5C 5EVID 4OPQA 2WAFA 4EBPA 1Z6FA 4B88A 1YM1A 4ID4A 1TDLA 4CJNA 1DJBA 2XD5A 2XD1A 4N1HA 1E3UD 5EVLA 2Y2LA 3GQZA 1K54C 4JF5A 3TSGA 4WMCA 5E2GA 5EVIA 4UA7A 4BL2A 4OQGA 5CEBA 1NZUA 1IYQA 3PBNA 1CEGA 3IF6C 3QHYA 1CI8A 3VFFA 1OMEA 1K6SA 1E3UA 5HFOA 5KSCA 3E2KA 1K38A 4WZ5A 4YFMA 1L2SA 2ZLYA 2P9VB 1XP4A 2ZC5B 3JYIA 3PBSA 1RCJA 4P87A 5DF7A 5GHZA 1KE4A 3VP0A 1JWPA 3WS1A 3ZG7B 1TEMA 1FQGA 1YLYA 3B3XA 3PBRA 1ESIA 1RGZA 3HLDA 1W7FA 2Z2MB 5FATA 2Z2LB 3GR2A 1K54A 1ZG6A 2ZQ9A 4S2IA 4C75A 3DTMA 4X68A 3BFDA 5JYPA 5FI7A 3IF6A 1KDWA 4FSFA 4N92A 3VSKA 3G34A 1WE4A 4GOGA 4WYYA 4BD1A 1YQSA 2J7VA 2Y2QA 3M2JA 3OPLA 4DDYA 4PM5A 1BLHA 1G6AA 1SKFA 3C4PA 3N8SA 4A5RA 3HLWA 1NXYA 4R1GA 3RJUA 3W8KA 4C6YA 3UY6A 1E4DA 1I5QA 3NI9A 3ZG8B 4BJPA 3VSLA 3OPHA 5U47A 5A93A 3UPPA 1EWZA 1LL9A 4OQIA 3MXRA 2JCHA 2WUQA 3IF6B 3O87A 5A91A 2OLUA 4DF6A 2EX2A 2X02A 5CHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ALQ A;  1KE3 A;  1Q2Q A;  2V2F F;  1PIO A;  4PM7 A;  1TDG A;  4N1X A;  3C4O A;  3IXG A;  3A3F A;  2Y2K A;  4Z9Q A;  2HP9 A;  3ZVT A;  1L0D A;  3UE1 A;  1I2S A;  5KMW A;  3FZC A;  5GLB A;  4X55 A;  3FWL A;  5CGW A;  3N7W A;  5FSR A;  3Q7Z A;  5JYO A;  4ZJ1 A;  2HP6 A;  4LCL A;  3ZGA B;  4GZB A;  1FCO A;  1NY0 A;  1AXB A;  4PM6 A;  4Y7P A;  3UN7 A;  4QB8 A;  1IEL A;  2H5S A;  2ZMA A;  3GSG A;  3HUO A;  1LLB A;  3G31 A;  3V3R A;  3E2L A;  4PPR A;  3IF5 A;  5HL1 A;  3O88 A;  3A3I A;  1L0E A;  3SS3 A;  2XH9 A;  1JWZ A;  2Y2H A;  3IXD A;  1IKI A;  4HEF A;  3GV9 A;  5FI6 A;  3HLG A;  2QMI A;  3NY4 A;  3IT9 A;  2XR0 A;  2XDM A;  4OPR A;  4BEN A;  4E6W A;  4OQH A;  4UA6 A;  3MXS A;  2Y91 A;  5F1G A;  2Y4A A;  1GHI A;  5DF9 A;  1PI5 A;  2B5R A;  5GLD A;  5DVA A;  5FA7 A;  2ZQ8 A;  5TGF A;  1H8Y A;  2FFY A;  2Q9M A;  1NZO A;  5FAQ A;  4OOM A;  1WYC A;  5DF8 A;  2WKE A;  2ZC4 B;  3ZG0 A;  1J9M A;  4NET A;  1FOF A;  1W5D A;  3HLC A;  3OC2 A;  1FR1 A;  5A90 A;  5I94 A;  1FSW A;  3LY3 A;  1SDE A;  2WAE A;  3NDG A;  4HES A;  3DW0 A;  2XGN A;  3GVB A;  3O86 A;  4OP8 A;  4E3L A;  3S1Y A;  2H0T A;  4R23 A;  5L2F A;  1XXM A;  1PYY A;  5CRF A;  1JTD A;  2EFX A;  1FR6 A;  5A92 A;  2A49 A;  3VP3 A;  2OSU A;  2Y2I A;  1ESU A;  4FH2 A;  4RX2 A;  4DE3 A;  5CEC A;  3O3V A;  5FQM A;  4E3M A;  1HZO A;  4XXR A;  3V50 A;  2WKH A;  3UPO A;  3IHA A;  3Q81 A;  5HAQ A;  1NJ4 A;  3IHB A;  4JXV A;  3WRZ A;  1ERO A;  2DCF A;  5EOO A;  1VM1 A;  3VMA A;  4ZJ2 A;  1ZG4 A;  1SHV A;  5HAR A;  3ZVW A;  3QNC A;  4GKU A;  1N4O A;  3MZF A;  3ITA A;  2J8Y A;  1H8Z A;  1LL5 A;  1RP5 A;  3M2K A;  1BZA A;  1YLJ A;  3OCL A;  1MWR A;  2QZ6 A;  4K0X A;  4RX3 A;  5FDH A;  1YT4 A;  2DRW A;  4KZB A;  5F83 A;  4KZ6 A;  3HL9 A;  3WS2 A;  5FAP A;  4L0L A;  3C7V A;  1K4F A;  5D3O A;  3BFE A;  4S2K A;  1K55 C;  4DKI A;  4WBG A;  3DWK A;  2V20 A;  4OLD A;  2JE5 A;  3RXW A;  4OQ0 A;  1YMS A;  5BOH A;  4K0W A;  4KQO A;  2XLN A;  1BLC A;  3ISG A;  1E25 A;  2E8I A;  1KE0 A;  1S6R A;  1MPL A;  1RGY A;  1NYY A;  4JLF A;  5CXW A;  4BLM A;  4PM9 A;  5CTN A;  3W4P A;  2BLS A;  4EQI A;  5EVI B;  3UE0 A;  4EWF A;  3OCN A;  2VGJ A;  4X6T A;  5HW3 A;  1XGI A;  4R3B A;  5DTS A;  3G30 A;  3PTE A;  2EFU A;  5J8X A;  3N8L A;  5FQI A;  2WZZ A;  4GD8 A;  2GDN A;  5CHM A;  3SH9 A;  3SS4 A;  4DE2 A;  4Y0T A;  3V39 A;  3SOI A;  1ONG A;  3QNB A;  2WZX A;  3HLB A;  2ZC6 B;  3OPP A;  4KG5 A;  4N9L A;  3DWZ A;  1NRF A;  3LEZ A;  1PW1 A;  4S2M A;  4IED A;  4KZ5 A;  1MY8 A;  4XUZ A;  5F82 A;  3NBL A;  3IWO A;  3BLM A;  5EEC A;  4QJG A;  5CTM A;  3M6B A;  1PZO A;  3LY4 A;  4OKP A;  3W4O A;  3UDF A;  4RVA A;  4EBN A;  4EV4 A;  2XEP A;  5E43 A;  1PI4 A;  4KZ7 A;  5E2F A;  3NIA A;  4E3K A;  2PU4 A;  1PW8 A;  4FD8 A;  1GHM A;  2ZQD A;  3NCK A;  4MBK A;  4ZBE A;  5GHY A;  4GB7 A;  1YLT A;  4U3T A;  4OH0 A;  1K4E A;  1XA7 A;  2WGW A;  4KZA A;  2JC7 A;  1W79 A;  3UDI A;  4P0M A;  5TFQ A;  3WRT A;  3ZNT A;  3PBO A;  2Y2M A;  4PM8 A;  4MBF A;  5EUA A;  3HUN A;  4YIN A;  4OLG A;  1XPB A;  1ERQ A;  3G35 A;  3FKW A;  1W8Y A;  4LCM A;  4U0T A;  1BUL A;  4HBU A;  3FV7 A;  4R0Q A;  5AQ7 A;  4JKT A;  1MWS A;  3IXB A;  4JF4 A;  3C7U A;  4WM9 A;  4X56 A;  3BEC A;  1KDS A;  1K25 A;  2QPN A;  1G68 A;  3LO7 A;  4OP5 A;  4C3Q A;  4X69 A;  1WYB A;  4JPM A;  3TOI A;  2WYX A;  4LEN A;  5CGX A;  3G2Z A;  5DTK A;  3V5M A;  5EPH A;  4ZJ3 A;  3Q82 A;  4EUZ A;  4LV1 A;  5KZH A;  3UDX A;  2ZC3 B;  2HDU A;  3HVF A;  5M1A A;  1QME A;  2WKI A;  1FCM A;  1LHY A;  1N9B A;  3HUM A;  5E2E A;  4F94 A;  3Q7V A;  3A3J A;  2Y55 A;  3EQV A;  3IH9 A;  4E6X A;  3EQU A;  4Q8I A;  3BRM A;  5GLC A;  4IVK A;  1CI9 A;  1BLS A;  1O7E A;  3LCE A;  3UE3 A;  1VQQ A;  4JF6 A;  4KQQ A;  1M6K A;  3NDE A;  5AQ9 A;  4WEL A;  5FI2 A;  3ZCZ A;  4P6B A;  3ZG9 B;  4RYE A;  4DE0 A;  2X71 A;  4U0X A;  4FCF A;  1Y54 A;  5FAO A;  2HP5 A;  1GA9 A;  1Q2P A;  4KEN B;  3BFC A;  5KSH A;  4DRT A;  5HX9 A;  2EX8 A;  1K57 C;  1I2W A;  1BT5 A;  1KGF A;  3MKF A;  2ZM0 A;  1IEM A;  1FSY A;  2ZC7 A;  4N9K A;  1YLZ A;  2C6W B;  2Y2J A;  3AGF A;  1BUE A;  3OPR A;  3VP2 A;  4QD4 A;  1JVJ A;  2Y59 A;  1M40 A;  1L0F A;  4UAA A;  5HAP A;  4ZTK A;  5CHJ A;  1W8Q A;  4JBF A;  3ITB A;  3Q1F A;  3ZFZ A;  3PBT A;  5GLA A;  3ZG5 A;  3BFG A;  3P98 A;  5TR7 A;  2P74 A;  3OZH A;  2IWC A;  3A3E A;  4D2O A;  2WGI A;  3VP1 A;  1K57 A;  1DJC A;  2ZM2 A;  3IWI A;  4QU3 A;  1L0G A;  4GDB A;  3BFF A;  1ZC2 A;  5IHV A;  2HPB A;  4NK3 A;  4E3J A;  1S0W A;  5G18 A;  1PWC A;  5EOE A;  4DXC A;  1DY6 A;  2R9X A;  4GNU A;  1LI0 A;  2EXB A;  1ZKJ A;  1K56 D;  1KVL A;  3GTC A;  3GRJ A;  2P9V A;  3UPN A;  3CZD A;  2WK0 A;  3NC8 A;  4XUX A;  2Y2P A;  1GA0 A;  1SDN A;  4UHU A;  2CC1 A;  4E3I A;  1QMF A;  2ZD8 A;  1XA1 A;  3ZHH A;  3PAG A;  2EX9 A;  5DTT A;  1K56 A;  1XGJ A;  4O7D A;  3G32 A;  4Y0O A;  3S4X A;  3MZD A;  4JXG A;  1YMX A;  1KVM A;  2Q9N A;  3G4P A;  1ONH A;  2ZQA A;  4GDN A;  2PU2 A;  1K55 A;  1MKI A;  3WS0 A;  4P85 A;  3SH8 A;  3TG9 A;  2HDR A;  4OOL A;  3BM6 A;  2XK1 A;  3CMZ A;  1GCE A;  2A3U A;  1U60 A;  3WS5 A;  2R9W A;  3P09 A;  4OON A;  2ZM8 A;  4KG6 A;  4M3K A;  4BD0 A;  2ZQ7 A;  4R3J A;  4GN2 A;  5GL9 A;  2Y2G A;  2XF3 A;  2J9O A;  1MXO A;  3CJM A;  2JBF A;  3N8R A;  2G2U A;  5E2H A;  3G2Y A;  4BL3 A;  4DDS A;  2ZJ9 A;  5FAS A;  1H5X A;  4QY5 A;  4KZ4 A;  4B4X A;  4PMA A;  4S2P A;  4WEK A;  2H10 A;  2VGK A;  3W4Q A;  1CK3 A;  4IVI A;  5M19 A;  5CER A;  4KG2 A;  1PZP A;  5GHX A;  1GHP A;  1HD8 A;  2RL3 A;  2ZQC A;  1FCN A;  1MBL A;  1MWU A;  1BSG A;  2V1Z A;  4IBR A;  3MKE A;  4HBT A;  4KZ8 A;  2XQZ A;  3HLE A;  3UNW A;  4JXS A;  4H8R A;  2WAD A;  4EBL A;  3I7J A;  1ES4 A;  3AGD A;  4OPZ A;  4KZ3 A;  3WWX A;  4E3N A;  2Y2N A;  3N6I A;  1LI9 A;  3UO9 A;  3SH7 A;  5CED A;  3RXX A;  3IWQ A;  4IBX A;  3BYD A;  2X01 A;  4OVD A;  3GMW A;  1XKZ A;  4DE1 A;  3MFD A;  4X53 A;  2WGW B;  3V3S A;  3FKV A;  4E3O A;  1IKG A;  2UWX A;  1K6R A;  5CGS A;  3AGE A;  4QY6 A;  4Y0U A;  1ES2 A;  2G2W A;  4R4S A;  3VOY A;  1ES5 A;  3HRE A;  4B4Z A;  1MWT A;  4UA9 A;  2BG1 A;  1YLW A;  4KQR A;  2OLV A;  3IQA A;  3PAE A;  2XFS A;  4DXB A;  1SCW A;  3HBR A;  2H0Y A;  4K91 A;  5FQK A;  1PWD A;  1HVB A;  1JTG A;  5FQJ A;  4BQM A;  1PWG A;  5M18 A;  1C3B A;  3PBQ A;  1EI5 A;  4LV3 A;  3BLS A;  3N4I A;  1YLP A;  4R4R A;  4MLL A;  5AQB A;  3ZDJ A;  4S2O A;  1IYS A;  5AQA A;  4S2L A;  5FQ9 A;  3ZNY A;  1BLP A;  3SS5 A;  5F1F A;  5FQQ A;  1IYP A;  2HDQ A;  2J9P A;  4GD6 A;  4KZ9 A;  1JWV A;  4FH4 A;  3Q7V B;  2PBY A;  1TVF A;  3MBZ A;  4MBH A;  2WGV A;  4OOY A;  1ES3 A;  1KGE A;  4WZ4 A;  4CPK A;  1O07 A;  1IYO A;  3C5A A;  3FYZ A;  1KGG A;  1ERM A;  2IWD A;  4RA7 A;  2HDS A;  3CG5 A;  5HAI A;  4S2N C;  3M6H A;  2IWB A;  2DNS A;  3Q07 A;  4OPY A;  2RCX A;  2XFT A;  3BEB A;  4WEJ A;  3VP4 A;  3VOZ A;  3A3D A;  4LV2 A;  4ZAM A;  1BTL A;  4LV0 A;  4ZDX A;  1CEF A;  2EX6 A;  3WS4 A;  5EVI C;  1HTZ A;  2I72 A;  4JXW A;  4MNR A;  4MEZ A;  4S2J A;  5EE8 A;  1XX2 A;  3VFH A;  2OV5 A;  3D4F A;  3HLF A;  2Y2O A;  3MZE A;  3S22 A;  1NYM A;  3IXH A;  4QHC A;  2FFF B;  2EXA A;  3IH8 A;  4S2N A;  1DJA A;  2C5W B;  4WMC D;  4WZ5 C;  5EVI D;  4OPQ A;  2WAF A;  4EBP A;  1Z6F A;  4B88 A;  1YM1 A;  4ID4 A;  1TDL A;  4CJN A;  1DJB A;  2XD5 A;  2XD1 A;  4N1H A;  1E3U D;  5EVL A;  2Y2L A;  3GQZ A;  1K54 C;  4JF5 A;  3TSG A;  4WMC A;  5E2G A;  5EVI A;  4UA7 A;  4BL2 A;  4OQG A;  5CEB A;  1NZU A;  1IYQ A;  3PBN A;  1CEG A;  3IF6 C;  3QHY A;  1CI8 A;  3VFF A;  1OME A;  1K6S A;  1E3U A;  5HFO A;  5KSC A;  3E2K A;  1K38 A;  4WZ5 A;  4YFM A;  1L2S A;  2ZLY A;  2P9V B;  1XP4 A;  2ZC5 B;  3JYI A;  3PBS A;  1RCJ A;  4P87 A;  5DF7 A;  5GHZ A;  1KE4 A;  3VP0 A;  1JWP A;  3WS1 A;  3ZG7 B;  1TEM A;  1FQG A;  1YLY A;  3B3X A;  3PBR A;  1ESI A;  1RGZ A;  3HLD A;  1W7F A;  2Z2M B;  5FAT A;  2Z2L B;  3GR2 A;  1K54 A;  1ZG6 A;  2ZQ9 A;  4S2I A;  4C75 A;  3DTM A;  4X68 A;  3BFD A;  5JYP A;  5FI7 A;  3IF6 A;  1KDW A;  4FSF A;  4N92 A;  3VSK A;  3G34 A;  1WE4 A;  4GOG A;  4WYY A;  4BD1 A;  1YQS A;  2J7V A;  2Y2Q A;  3M2J A;  3OPL A;  4DDY A;  4PM5 A;  1BLH A;  1G6A A;  1SKF A;  3C4P A;  3N8S A;  4A5R A;  3HLW A;  1NXY A;  4R1G A;  3RJU A;  3W8K A;  4C6Y A;  3UY6 A;  1E4D A;  1I5Q A;  3NI9 A;  3ZG8 B;  4BJP A;  3VSL A;  3OPH A;  5U47 A;  5A93 A;  3UPP A;  1EWZ A;  1LL9 A;  4OQI A;  3MXR A;  2JCH A;  2WUQ A;  3IF6 B;  3O87 A;  5A91 A;  2OLU A;  4DF6 A;  2EX2 A;  2X02 A;  5CHU A; 
#chains in the Genus database with same CATH topology
 1Q2Q A;  2V2F F;  3E4O A;  5HWW A;  3F1O B;  2HP9 A;  5JYO A;  1XFN A;  1FCO A;  1AXB A;  1H3Q A;  2H5S A;  3HUO A;  1LLB A;  3E2L A;  2PAV P;  3BQA A;  4JGP A;  2HZ5 A;  1GSX A;  2M7V A;  1JWZ A;  2Y2H A;  3A0S A;  1IKI A;  3GV9 A;  1ZHH B;  3HLG A;  2QMI A;  3NY4 A;  3VOL A;  3UB7 A;  4OPR A;  4OQH A;  3MXS A;  2Y91 A;  5F1G A;  2K31 A;  2B02 A;  5FA7 A;  4XT2 A;  5FAQ A;  2INW A;  3GDI A;  5J3W A;  4HNB A;  2ZC4 B;  1FOF A;  3LI8 A;  1FR1 A;  2QYB A;  3LY3 A;  1NLZ A;  2H0T A;  5L2F A;  1W63 M;  5A92 A;  3TJZ C;  3VP3 A;  2Y2I A;  3T4J A;  4DE3 A;  5CEC A;  5J4E A;  5F5Y A;  1HZO A;  3Q81 A;  3E4Q A;  2ZMV A;  1G5U A;  2W3G A;  4ZJ2 A;  1SHV A;  3ZVW A;  1N4O A;  3MZF A;  2ACG A;  1W63 Q;  3S7P A;  3BW6 A;  5FDH A;  2DRW A;  5FAP A;  4LLO B;  5D3O A;  1L3L A;  3BFE A;  4S2K A;  4GJ4 A;  1OTB A;  4OLD A;  3T1Q B;  2VEA A;  3D72 A;  1E25 A;  4RQ9 A;  5EVI B;  3DTK A;  3OCN A;  2VGJ A;  3UMD A;  4YNR A;  1TD5 A;  2WZZ A;  2I9V A;  2WZX A;  3KYQ A;  2ZC6 B;  2NUP C;  4KG5 A;  4N9L A;  4XUZ A;  3H7W B;  5IS1 A;  3NBL A;  3M6B A;  2W1T B;  1PRQ A;  4OKP A;  3W4O A;  2HV1 A;  4EV4 A;  3T1R A;  2JN7 A;  2XEP A;  5E2F A;  4KZ7 A;  2BTF P;  2ZQD A;  3T4Q A;  1W79 A;  3PBO A;  4PM8 A;  3PXP A;  3LR4 A;  4MBF A;  3HUN A;  4Y5F A;  5EUA A;  1XPB A;  2Z6D A;  4U0T A;  5AQ7 A;  3IXB A;  4JF4 A;  3MQ0 A;  3FC7 A;  4C3Q A;  3SW1 A;  3TOI A;  5EPH A;  5KZH A;  3UDX A;  4I3I A;  3KX0 X;  2ZC3 B;  3HVF A;  1LHY A;  1N9B A;  5E2E A;  4F94 A;  1VET B;  3A3J A;  4GW9 A;  4E6X A;  3EQU A;  4Q8I A;  3NEC A;  1CI9 A;  1O7E A;  3LCE A;  4R3A A;  3NDE A;  5FI2 A;  4U0X A;  3DTE A;  4FCF A;  4WF0 A;  4KUO A;  1I2W A;  2VLG A;  1OT6 A;  4N9K A;  1YLZ A;  2C6W B;  4QD4 A;  3LR0 A;  2Y59 A;  1M40 A;  3IX3 A;  4ZTK A;  1W8Q A;  5GLA A;  3BFG A;  3F1P B;  2IWC A;  4D2O A;  3VP1 A;  1K57 A;  4HP4 A;  2YKF A;  2HPB A;  3VE4 A;  1BYW A;  5G18 A;  3T4K A;  1PWC A;  1LI0 A;  3KO6 A;  4R38 A;  4M4X A;  3GTC A;  3KYE A;  3CZD A;  3NC8 A;  3MMH A;  1QMF A;  2EX9 A;  5DTT A;  4LPZ A;  1KVM A;  1ONH A;  2PU2 A;  3TG9 A;  2HDR A;  4OOL A;  3KYZ A;  1U60 A;  3P09 A;  4GHI B;  4KG6 A;  4BD0 A;  5L8M A;  1SKO A;  2XF3 A;  1MXO A;  2KOI A;  3CJM A;  3N8R A;  5E2H A;  2FZ0 A;  1CK3 A;  3QP8 A;  1GHP A;  2RL3 A;  3TW8 A;  1DP8 A;  3E0Y A;  1DP9 A;  4KZ8 A;  2XQZ A;  3UNW A;  4OPZ A;  1ES4 A;  2VJW A;  3B47 A;  5C5K A;  4E3N A;  3KSG A;  1LI9 A;  4H6J B;  3SH7 A;  3RXX A;  1VEU A;  3BYD A;  2VZW A;  1XKZ A;  2Y79 A;  4DE1 A;  1N9O A;  3H82 A;  2D01 A;  3JPU A;  4R4S A;  1ES5 A;  1MWT A;  2BG1 A;  3IQA A;  3PAE A;  1SCW A;  3HBR A;  5FQK A;  1PWG A;  3PBQ A;  3BLS A;  3N4I A;  2J3T C;  2VV6 A;  4S2L A;  3SS5 A;  5FQQ A;  1JWV A;  3CI6 A;  4FH4 A;  1TS8 A;  3Q7V B;  1H8M A;  4OOY A;  2ZBB A;  3C5A A;  3FG8 A;  1Z09 A;  2XFT A;  3VP4 A;  3VOZ A;  3CPT B;  4QPR A;  4LV0 A;  1GSV A;  1CEF A;  3WS4 A;  5MC7 A;  2VV8 A;  5F69 A;  4MNR A;  4CLC D;  4S2J A;  3D4F A;  5DFX A;  3HJI A;  4X1M A;  3IXH A;  4QHC A;  2FFF B;  2EXA A;  2C5W B;  4EBP A;  1Z6F A;  4CJN A;  1DJB A;  4N1H A;  1NLY A;  1E3U D;  3C2W A;  2K7S A;  4ME4 A;  3KSF A;  4MMN A;  4WMC A;  4UA7 A;  5CEB A;  4GS9 A;  1NZU A;  3PBN A;  1CEG A;  2G7U A;  4YFM A;  3JYI A;  1XP4 A;  3PBS A;  2KLI A;  1KE4 A;  1DP6 A;  1TEM A;  1FQG A;  3PBR A;  2UV0 E;  2Z2L B;  4WL9 A;  1K54 A;  2ZQ9 A;  4C75 A;  3DTM A;  4X68 A;  2DMW A;  3BFD A;  5FI7 A;  2E8J A;  3CUE C;  1TS0 A;  4Q0J A;  4WYY A;  4BD1 A;  1P0Z A;  2NUT C;  3W8K A;  1MZU A;  3ZG8 B;  3VSL A;  1MC0 A;  3UPP A;  4OQI A;  2JCH A;  3BQ8 A;  3LIA A;  4JGQ A;  2OLU A;  2EX2 A;  5GLB A;  5CHU A;  5IHV A;  1PIO A;  1TDG A;  4P6Z S;  5FL3 A;  4Z9Q A;  4EW7 A;  5KMW A;  5TJJ A;  4X55 A;  3FWL A;  3N7W A;  4I5S A;  3P01 A;  4LCL A;  1NY0 A;  3EWK A;  4PM6 A;  1IEL A;  3IF5 A;  3OBF A;  4MN7 A;  3SS3 A;  2XH9 A;  3IXD A;  2LB9 A;  2JKT M;  1IFQ A;  4HJ3 A;  4HEF A;  1TS7 A;  5DFY A;  5I5L A;  2XR0 A;  3CHW P;  2HJE A;  1XFQ A;  2KX6 A;  1NZO A;  3S7Q A;  2QKP A;  4OOM A;  1WYC A;  5DF8 A;  3ZG0 A;  1XJ2 A;  3F1N A;  2PT7 A;  2WAE A;  4HES A;  3O86 A;  2XGN A;  4OP8 A;  3S1Y A;  1PYY A;  2V1A A;  1H0M A;  1T1C A;  4F3L B;  3T4O A;  5FQM A;  4E3M A;  3V50 A;  3UPO A;  2AVX A;  2IA2 A;  3IHA A;  4JXV A;  2DCF A;  3VMA A;  3QNC A;  2VKS A;  4GKU A;  3IBJ A;  3ITA A;  2J8Y A;  1H8Z A;  1LL5 A;  4PHT A;  3OCL A;  1YLJ A;  4K0X A;  5KIZ A;  5LBR A;  4DKI A;  1F98 A;  3DWK A;  2ZL1 A;  2JE5 A;  3RXW A;  4OQ0 A;  4K0W A;  4BBV A;  2XLN A;  3MS6 A;  3ISG A;  2E8I A;  1KE0 A;  1MPL A;  1NYY A;  4EQI A;  4X6T A;  1XGI A;  3G30 A;  3FPV A;  5CHM A;  4Y0T A;  1XJ4 A;  3HLB A;  3OPP A;  2W1R A;  4S2M A;  4CQH A;  5EEC A;  4QJG A;  3NUL A;  1F9I A;  3PYP A;  5E43 A;  1LL8 A;  2VX8 A;  2GZA A;  4MCW A;  4MBK A;  3NCK A;  4ZBE A;  3UME A;  4GB7 A;  1YLT A;  5AVE A;  1K4E A;  5G4Y A;  5TFQ A;  4LRZ E;  2O99 A;  4YIN A;  3OLO A;  4LCM A;  1BUL A;  2VGL S;  2ZOI A;  3IS2 A;  2XRO A;  4NEE D;  4X56 A;  1KDS A;  2QPN A;  4OP5 A;  4EUZ A;  2HDU A;  4BMW A;  1UWN X;  3HUM A;  3EOI A;  2Y55 A;  3A0V A;  3UE3 A;  1VQQ A;  4IJG A;  4P6B A;  4RYE A;  4DE0 A;  1Y54 A;  1Q2P A;  4KEN B;  4HH2 A;  5KSH A;  5HX9 A;  2EX8 A;  1K57 C;  4BBU A;  5HWV A;  2A24 B;  3P7N A;  3AGF A;  4I39 A;  1BUE A;  3ZQ5 A;  1JVJ A;  4UAA A;  1L0F A;  2W3F A;  5HAP A;  2FH5 A;  3ITB A;  1VHM A;  3Q1F A;  3PBT A;  3UE6 A;  5TR7 A;  3OZH A;  5HPI A;  2WGI A;  2ZM2 A;  1L0G A;  4GDB A;  3BFF A;  4O01 A;  4LRX C;  4DXC A;  3QP1 A;  1K56 D;  4IUH A;  1V9Z A;  2WK0 A;  5G4Z A;  4XUX A;  4E3I A;  2CC1 A;  2ZD8 A;  3QP2 A;  2W0N A;  1N9L A;  2CMN A;  3S4X A;  4JXG A;  4GDN A;  2ZQA A;  2XSS A;  3WS5 A;  2R9W A;  4BBT A;  4CLC E;  2ZM8 A;  4M3K A;  2ZQ7 A;  3EGD C;  3NJA A;  3W2Z A;  5TBM A;  2P7J A;  1J3W A;  3C30 A;  2HGV A;  4DDS A;  1CQA A;  3E98 A;  1H5X A;  4QY5 A;  2PBD P;  1OTD A;  2XA7 M;  4WEK A;  3F1O A;  4IVI A;  4KG2 A;  2W27 A;  5EM1 A;  3BY8 A;  2WKP A;  2V1Z A;  2OOL A;  4I3J A;  4HBT A;  4ARZ B;  4EQ1 A;  1T19 A;  3AGD A;  4KZ3 A;  2MJ6 A;  3LUQ A;  2Y2N A;  3L7H A;  3UO9 A;  5CED A;  3IWQ A;  4IBX A;  3GMW A;  2WGW B;  2V0W A;  1K6R A;  4II7 A;  4QY6 A;  4Y0U A;  4DJ2 A;  2G2W A;  4HQA A;  4KQR A;  1YLW A;  2XFS A;  5EV0 A;  1T1A A;  1C3B A;  1EI5 A;  4LV3 A;  5DJT A;  1YLP A;  3DBA A;  2M7U A;  4MLL A;  5AQB A;  3ZNY A;  1IYS A;  4GCZ A;  1IYP A;  2HDQ A;  2J9P A;  4MBH A;  2J3T D;  3H9W A;  3MBZ A;  1ES3 A;  4WZ4 A;  4ZRR A;  3CWF A;  1ERM A;  2IWD A;  4D60 A;  2PHY A;  1EW0 A;  4NKP A;  3MSH A;  3Q07 A;  4OPY A;  3QP6 A;  4WEJ A;  3KSI A;  3QP4 A;  4EER A;  3R4K A;  1BTL A;  2W3D A;  4IUK A;  2LB5 A;  1P97 A;  2OV5 A;  3S22 A;  3IH8 A;  4S2N A;  1DJA A;  1T1B A;  4G3W A;  1F5M A;  4Y15 A;  3MJQ A;  1K54 C;  5EVI A;  3C38 A;  1CJF A;  1CI8 A;  1K6S A;  3E2K A;  3U2A A;  1L2S A;  1SZV A;  1S67 L;  2P9V B;  5DF7 A;  3KSH A;  2OAQ 1;  1JWP A;  3R7W B;  1YLY A;  5FAT A;  1KOU A;  3H7W A;  4R70 A;  2W1T A;  3VSK A;  4N92 A;  3G34 A;  4FUW A;  4GOG A;  3MQQ A;  3OPL A;  4PM5 A;  1BLH A;  1G6A A;  1SKF A;  1LT0 A;  1DRM A;  2V1B A;  5HDC A;  4BJP A;  4DMZ A;  5U47 A;  3O87 A;  2V8F A;  1ALQ A;  4PM7 A;  3B42 A;  5IT5 A;  3C4O A;  2Y2K A;  4WLA A;  3S7O A;  1OTI A;  3FZC A;  5CGW A;  3Q7Z A;  3BWL A;  4ZJ1 A;  2HP6 A;  2J3W A;  3S7N A;  3ZGA B;  4GZB A;  3UN7 A;  4QB8 A;  3V3R A;  3GSG A;  4PPR A;  5HL1 A;  1VET A;  1L0E A;  1N9N A;  5FI6 A;  2XDM A;  4E6W A;  4UA6 A;  2QWS A;  2Y4A A;  1GHI A;  2B5R A;  5GLD A;  5TGF A;  1H8Y A;  5FEG A;  3LID A;  2YKH A;  3TRC A;  1W5D A;  2O9B A;  5A90 A;  5I94 A;  3LIF A;  1TF1 A;  3NDG A;  1SDE A;  2JKR M;  4R23 A;  2EA9 A;  5CRF A;  1JTD A;  1FR6 A;  3MF0 A;  2A49 A;  1ESU A;  3O3V A;  5F68 A;  1NJ4 A;  4G3V A;  4Y17 A;  5EOO A;  1ZG4 A;  5HAR A;  1XJ3 A;  4RX3 A;  4L9E A;  5F83 A;  4K08 A;  4KZ6 A;  3HL9 A;  4Q0I A;  4L0L A;  3C7V A;  1K4F A;  5CX7 A;  4WBG A;  1YMS A;  4KQO A;  3MFX A;  1BLC A;  3FPW A;  4JLF A;  5HDS A;  1NRJ A;  1RGY A;  4GHI A;  3W4P A;  2BLS A;  2WKQ A;  3UE0 A;  4EWF A;  3HJK A;  4YOF A;  5HW3 A;  4R3B A;  2EFU A;  3N8L A;  4GD8 A;  1YPR A;  2GDN A;  3SH9 A;  3SS4 A;  2D02 A;  4NXG A;  5HL6 A;  1NWZ A;  3LEZ A;  4IED A;  4KZ5 A;  4UQI M;  1AWI A;  4R6L A;  4WUJ A;  5CTM A;  3UDF A;  1D1J A;  1MKM A;  1XA7 A;  4KZA A;  2JC7 A;  5DKL A;  3WRT A;  3BJN A;  3V67 A;  5L07 A;  1ERQ A;  3G35 A;  3FKW A;  1W8Y A;  2VA0 A;  2OWH A;  1MWS A;  4ESP A;  3C7U A;  4WM9 A;  3HCY A;  3LO7 A;  3T4S A;  4JPM A;  3V5M A;  3LIB A;  4LEN A;  3G2Z A;  5DTK A;  3T4T A;  4LV1 A;  1Y4O A;  3G6O A;  5M1A A;  1QME A;  3Q7V A;  1K0K A;  3IS2 B;  1LSW A;  4Y13 A;  1BLS A;  1VB6 A;  4JF6 A;  1M6K A;  3ZG9 B;  4WEL A;  5FAO A;  1GA9 A;  3BFC A;  3CPT A;  1OJG A;  1KGF A;  3MKF A;  4EUV A;  2ZM0 A;  1IEM A;  2ZC7 A;  3VP2 A;  1HLU P;  2Y2J A;  4XT2 B;  5CHJ A;  2Z6C A;  4JBF A;  3ZFZ A;  3ZG5 A;  1FIK A;  3T12 B;  3RFB A;  2VV7 A;  5DJU A;  3A3E A;  4CLC C;  1DJC A;  3IWI A;  4QU3 A;  1ZC2 A;  4E3J A;  1S0W A;  4GLQ A;  5EOE A;  4EES A;  1DY6 A;  2R9X A;  2EXB A;  2JHE A;  2Y2P A;  1GA0 A;  3ZHH A;  3PAG A;  4O7D A;  3G32 A;  1OTA A;  3RH8 B;  5L09 A;  1YMX A;  3G4P A;  2QHK A;  1MKI A;  3WS0 A;  4P85 A;  5L10 A;  1GSW A;  2XK1 A;  2B95 A;  4R3J A;  2J9O A;  2G2U A;  4JGR A;  3G2Y A;  4BL3 A;  4FOF A;  1XJ6 A;  4B4X A;  3W4Q A;  2VGK A;  2P04 A;  1S1Z A;  5M19 A;  3IBR A;  2A2L A;  4L9G A;  1MWU A;  1BSG A;  4IBR A;  4ETX A;  2JKG A;  2WAD A;  4EBL A;  3I7J A;  3WWX A;  5HPF A;  4L9F A;  2M1C A;  3NHQ A;  2X01 A;  3IX4 A;  3V3S A;  2UWX A;  5CGS A;  3NOU C;  3AGE A;  3VOY A;  4UA9 A;  4DXB A;  4K91 A;  1PWD A;  4DJ3 A;  4KQD A;  4HJ4 A;  3ICY A;  2V0U A;  4S2O A;  5FQ9 A;  5AQA A;  5F1F A;  3IX8 A;  4KZ9 A;  4NXF A;  2PBY A;  1A0K A;  1KGE A;  4CPK A;  4F3L A;  3FYZ A;  4RA7 A;  1LSX A;  2HDS A;  5HAI A;  4S2N C;  2L1M A;  2IWB A;  3A3D A;  5FDS A;  2VK3 A;  1YKD A;  4HY8 A;  5EVI C;  1HTZ A;  2I72 A;  4JXW A;  4MEZ A;  5EE8 A;  1XX2 A;  1UGU A;  3MZE A;  3HLF A;  3LYX A;  1ZTU A;  2ZOH A;  4WMC D;  1LSV A;  4OPQ A;  4LGW A;  4CLC A;  1TDL A;  2GJ3 A;  2P08 A;  2JKT I;  4HI4 A;  5EVL A;  2Y2L A;  3GQZ A;  1G28 A;  3L9K A;  2PR5 A;  2XRN A;  1E3U A;  2O9A A;  5HDD A;  5HFO A;  5KSC A;  1K38 A;  4WZ5 A;  5GHZ A;  2ZC5 B;  4Y3I A;  1RCJ A;  4P87 A;  3WS1 A;  3ZG7 B;  4HIA A;  3B3X A;  5HZH A;  1RGZ A;  1W7F A;  3GR2 A;  1ZG6 A;  5JYP A;  2PD7 A;  4MN5 A;  3IF6 A;  4FSF A;  5EFW A;  1YQS A;  1STZ A;  2J7V A;  2Y2Q A;  4DDY A;  4Q0H A;  3N8S A;  5AVF A;  3HLW A;  4R1G A;  3RJU A;  2PD8 A;  1E4D A;  1I5Q A;  1SKO B;  2GX5 A;  5A93 A;  1LL9 A;  4B93 A;  5A91 A;  2X02 A;  3WS2 A;  4YWZ A;  1KE3 A;  4N1X A;  4BWI A;  2V9A A;  3IXG A;  3A3F A;  3ZVT A;  1L0D A;  3UE1 A;  1I2S A;  3LEQ A;  2PDR A;  5FSR A;  1D06 A;  4Y7P A;  2ZMA A;  3G31 A;  4LRY C;  2HF6 A;  2XA7 S;  4PAU A;  3O88 A;  3A3I A;  1VEU B;  4Y2F A;  3H82 B;  1S4R A;  2L4R A;  2Y8H A;  3IT9 A;  2O9C A;  4BEN A;  4JGO A;  5DF9 A;  1PI5 A;  2A24 A;  5DVA A;  2ZQ8 A;  2FFY A;  2Q9M A;  1OJ5 A;  2PYP A;  5HSQ A;  2WKE A;  1J9M A;  4NET A;  2OAP 1;  3HLC A;  3OC2 A;  1FSW A;  3LIE A;  3DW0 A;  4E3L A;  3GVB A;  1XXM A;  1S66 L;  2EFX A;  2OSU A;  4FH2 A;  4RX2 A;  1S4S A;  2OWJ A;  4XXR A;  3VE3 A;  2WKH A;  5HD5 A;  3LR3 A;  5HAQ A;  3IHB A;  3WRZ A;  3GEC A;  1ERO A;  1VM1 A;  5HWT A;  1JNU A;  1RP5 A;  3M2K A;  1BZA A;  1MWR A;  1PNE A;  2QZ6 A;  2W3E A;  1YT4 A;  4KZB A;  4AFI A;  3U4L P;  1G6O A;  1K55 C;  1YSP A;  2V20 A;  5BOH A;  5CXW A;  1S6R A;  4BLM A;  1V9Y A;  3EEH A;  4PM9 A;  5CTN A;  2H28 A;  4GS9 B;  5DTS A;  3ZYT A;  4HHD A;  5J7E A;  3PTE A;  5J8X A;  5FQI A;  4DE2 A;  3V39 A;  1P9W A;  1ONG A;  3QNB A;  2J80 A;  3SOI A;  3DWZ A;  1NRF A;  1PW1 A;  3C8C A;  3EGX C;  1MY8 A;  5F82 A;  3IWO A;  3BLM A;  5K5B A;  3UB9 A;  1PZO A;  3LY4 A;  4EBN A;  4RVA A;  2EWW A;  4ARZ A;  3TE8 A;  1PI4 A;  3NIA A;  4E3K A;  3T1X A;  2PU4 A;  1PW8 A;  1ACF A;  1GHM A;  4FD8 A;  5GHY A;  1D7E A;  4U3T A;  4OH0 A;  3CAX A;  2WGW A;  4I3A A;  3UDI A;  4EXO A;  4P0M A;  3ZNT A;  2Y2M A;  4OLG A;  4HBU A;  3FV7 A;  4R0Q A;  4JKT A;  3ULF A;  3QP5 A;  3BEC A;  1K25 A;  2K2N A;  1G68 A;  3UB6 A;  4X69 A;  1WYB A;  2WYX A;  5CGX A;  4ZJ3 A;  3Q82 A;  4EET B;  3MQO A;  2WKR A;  2PR6 A;  5EVE A;  2WKI A;  1FCM A;  3LIC A;  3UB5 P;  3OOV A;  3EQV A;  3IH9 A;  3BRM A;  5GLC A;  1X0O A;  4IVK A;  2V8C A;  4KQQ A;  5AQ9 A;  3ZCZ A;  1TS6 A;  5FEF A;  2X71 A;  2HP5 A;  3F1P A;  4B9O A;  3CLO A;  4DRT A;  1BT5 A;  4G3K A;  5DKK A;  1FSY A;  3T1S A;  3OPR A;  3D3O A;  4NG2 A;  3F1N B;  3P98 A;  2P74 A;  3NOT C;  3E4P A;  3UB8 A;  3T4L A;  3PHY A;  3PR6 A;  4NK3 A;  4X1L A;  2O0Y A;  4GNU A;  1Y28 A;  1ZKJ A;  1KVL A;  3GRJ A;  2P9V A;  3UPN A;  4HJ6 A;  3R7W A;  1SDN A;  4UHU A;  1XA1 A;  1K56 A;  1XGJ A;  4Y0O A;  3K2N A;  3MZD A;  3EEA A;  4LFU A;  2Q9N A;  1K55 A;  2ZL1 B;  3SH8 A;  2GNX A;  1UWP X;  1FIL A;  4P6Z M;  3BM6 A;  3CMZ A;  1GCE A;  2A3U A;  5EM0 A;  4OON A;  4GN2 A;  5GL9 A;  2Y2G A;  2JBF A;  4QWO A;  2ZJ9 A;  5FAS A;  2HJ9 C;  4KZ4 A;  3JVV A;  4PMA A;  4S2P A;  4E04 A;  2H10 A;  4HP9 A;  4H6J A;  4MDZ A;  5CER A;  1PZP A;  5GHX A;  1HD8 A;  2ZQC A;  1FCN A;  1MBL A;  2QJ5 A;  3LI9 A;  2QJ7 A;  1OPX A;  2PRF A;  3MKE A;  3D9Y A;  3HLE A;  4JXS A;  4H8R A;  3MXQ A;  3N6I A;  4IHQ A;  3A0R A;  4I38 A;  2EWV A;  4OVD A;  4UQI S;  4WN5 A;  3MFD A;  4X53 A;  1T18 A;  3CIT A;  3FKV A;  4E3O A;  4O0P A;  1IKG A;  1ES2 A;  4NXE A;  3O5Y A;  2PYR A;  4Z1W A;  3HRE A;  1OT9 A;  4B4Z A;  2OLV A;  4PKY G;  4EU0 A;  3SZT A;  2H0Y A;  3DAV A;  1HVB A;  1JTG A;  5FQJ A;  4BQM A;  4X25 A;  5M18 A;  3BY9 A;  3JVU A;  1YSQ A;  4R4R A;  3ZDJ A;  1ODV A;  2BAS A;  1BLP A;  4GD6 A;  2KDK A;  1TVF A;  2WGV A;  4HH3 A;  1OTE A;  3B33 A;  1O07 A;  1IYO A;  4EEP A;  1KGG A;  4PKY A;  3LFV A;  3CG5 A;  4FTX A;  3M6H A;  2DNS A;  5HD3 A;  4MN6 A;  2RCX A;  3BEB A;  1WA9 A;  1F2K A;  2R78 A;  5IU1 A;  4LV2 A;  4UEY A;  4ZAM A;  2JKF A;  2L0W A;  4ZDX A;  2EX6 A;  3MR0 A;  2W3H A;  3K3C A;  3VFH A;  2Y2O A;  1NYM A;  1CF0 A;  3LGO A;  5EVI D;  4WZ5 C;  4DN0 A;  4ETZ A;  2WAF A;  2ZMF A;  4B88 A;  1YM1 A;  4ID4 A;  4EEU A;  2XD5 A;  2XD1 A;  5AJG A;  2B18 A;  4KUK A;  4JF5 A;  3TSG A;  5E2G A;  4BL2 A;  4OQG A;  4HOI A;  1IYQ A;  3IF6 C;  3VV4 A;  3QHY A;  5A8B A;  3DTI A;  3VFF A;  1OME A;  4O8G A;  2ZLY A;  3K3D A;  3VP0 A;  4CLC B;  4NXB A;  1ESI A;  3HLD A;  2Z2M B;  1PFL A;  3T50 A;  4S2I A;  1S1Y A;  1P9R A;  3NOP C;  1KDW A;  1WE4 A;  3M2J A;  5F6A A;  2JKR I;  3C4P A;  4A5R A;  1IOU A;  2Q0O A;  1YAX A;  2VGL M;  1NXY A;  3LR5 A;  4C6Y A;  3UY6 A;  5TBM B;  3NI9 A;  3OPH A;  3RTY A;  1EWZ A;  3MXR A;  2WUQ A;  3IF6 B;  3CUE A;  4DF6 A; 
#chains in the Genus database with same CATH homology
 1ALQ A;  1KE3 A;  1Q2Q A;  2V2F F;  1PIO A;  4PM7 A;  1TDG A;  4N1X A;  3C4O A;  3IXG A;  3A3F A;  2Y2K A;  4Z9Q A;  2HP9 A;  3ZVT A;  1L0D A;  3UE1 A;  1I2S A;  5KMW A;  3FZC A;  5GLB A;  4X55 A;  3FWL A;  5CGW A;  3N7W A;  5FSR A;  3Q7Z A;  5JYO A;  4ZJ1 A;  2HP6 A;  4LCL A;  3ZGA B;  4GZB A;  1FCO A;  1NY0 A;  1AXB A;  4PM6 A;  4Y7P A;  3UN7 A;  4QB8 A;  1IEL A;  2H5S A;  2ZMA A;  3GSG A;  3HUO A;  1LLB A;  3G31 A;  3V3R A;  3E2L A;  4PPR A;  3IF5 A;  5HL1 A;  3O88 A;  3A3I A;  1L0E A;  3SS3 A;  2XH9 A;  1JWZ A;  2Y2H A;  3IXD A;  1IKI A;  4HEF A;  3GV9 A;  5FI6 A;  3HLG A;  2QMI A;  3NY4 A;  3IT9 A;  2XR0 A;  2XDM A;  4OPR A;  4BEN A;  4E6W A;  4OQH A;  4UA6 A;  3MXS A;  2Y91 A;  5F1G A;  2Y4A A;  1GHI A;  5DF9 A;  1PI5 A;  2B5R A;  5GLD A;  5DVA A;  5FA7 A;  2ZQ8 A;  5TGF A;  1H8Y A;  2FFY A;  2Q9M A;  1NZO A;  5FAQ A;  4OOM A;  1WYC A;  5DF8 A;  2WKE A;  2ZC4 B;  3ZG0 A;  1J9M A;  4NET A;  1FOF A;  1W5D A;  3HLC A;  3OC2 A;  1FR1 A;  5A90 A;  5I94 A;  1FSW A;  3LY3 A;  1SDE A;  2WAE A;  3NDG A;  4HES A;  3DW0 A;  2XGN A;  3GVB A;  3O86 A;  4OP8 A;  4E3L A;  3S1Y A;  2H0T A;  4R23 A;  5L2F A;  1XXM A;  1PYY A;  5CRF A;  1JTD A;  2EFX A;  1FR6 A;  5A92 A;  2A49 A;  3VP3 A;  2OSU A;  2Y2I A;  1ESU A;  4FH2 A;  4RX2 A;  4DE3 A;  5CEC A;  3O3V A;  5FQM A;  4E3M A;  1HZO A;  4XXR A;  3V50 A;  2WKH A;  3UPO A;  3IHA A;  3Q81 A;  5HAQ A;  1NJ4 A;  3IHB A;  4JXV A;  3WRZ A;  1ERO A;  2DCF A;  5EOO A;  1VM1 A;  3VMA A;  4ZJ2 A;  1ZG4 A;  1SHV A;  5HAR A;  3ZVW A;  3QNC A;  4GKU A;  1N4O A;  3MZF A;  3ITA A;  2J8Y A;  1H8Z A;  1LL5 A;  1RP5 A;  3M2K A;  1BZA A;  1YLJ A;  3OCL A;  1MWR A;  2QZ6 A;  4K0X A;  4RX3 A;  5FDH A;  1YT4 A;  2DRW A;  4KZB A;  5F83 A;  4KZ6 A;  3HL9 A;  3WS2 A;  5FAP A;  4L0L A;  3C7V A;  1K4F A;  5D3O A;  3BFE A;  4S2K A;  1K55 C;  4DKI A;  4WBG A;  3DWK A;  2V20 A;  4OLD A;  2JE5 A;  3RXW A;  4OQ0 A;  1YMS A;  5BOH A;  4K0W A;  4KQO A;  2XLN A;  1BLC A;  3ISG A;  1E25 A;  2E8I A;  1KE0 A;  1S6R A;  1MPL A;  1RGY A;  1NYY A;  4JLF A;  5CXW A;  4BLM A;  4PM9 A;  5CTN A;  3W4P A;  2BLS A;  4EQI A;  5EVI B;  3UE0 A;  4EWF A;  3OCN A;  2VGJ A;  4X6T A;  5HW3 A;  1XGI A;  4R3B A;  5DTS A;  3G30 A;  3PTE A;  2EFU A;  5J8X A;  3N8L A;  5FQI A;  2WZZ A;  4GD8 A;  2GDN A;  5CHM A;  3SH9 A;  3SS4 A;  4DE2 A;  4Y0T A;  3V39 A;  3SOI A;  1ONG A;  3QNB A;  2WZX A;  3HLB A;  2ZC6 B;  3OPP A;  4KG5 A;  4N9L A;  3DWZ A;  1NRF A;  3LEZ A;  1PW1 A;  4S2M A;  4IED A;  4KZ5 A;  1MY8 A;  4XUZ A;  5F82 A;  3NBL A;  3IWO A;  3BLM A;  5EEC A;  4QJG A;  5CTM A;  3M6B A;  1PZO A;  3LY4 A;  4OKP A;  3W4O A;  3UDF A;  4RVA A;  4EBN A;  4EV4 A;  2XEP A;  5E43 A;  1PI4 A;  4KZ7 A;  5E2F A;  3NIA A;  4E3K A;  2PU4 A;  1PW8 A;  4FD8 A;  1GHM A;  2ZQD A;  3NCK A;  4MBK A;  4ZBE A;  5GHY A;  4GB7 A;  1YLT A;  4U3T A;  4OH0 A;  1K4E A;  1XA7 A;  2WGW A;  4KZA A;  2JC7 A;  1W79 A;  3UDI A;  4P0M A;  5TFQ A;  3WRT A;  3ZNT A;  3PBO A;  2Y2M A;  4PM8 A;  4MBF A;  5EUA A;  3HUN A;  4YIN A;  4OLG A;  1XPB A;  1ERQ A;  3G35 A;  3FKW A;  1W8Y A;  4LCM A;  4U0T A;  1BUL A;  4HBU A;  3FV7 A;  4R0Q A;  5AQ7 A;  4JKT A;  1MWS A;  3IXB A;  4JF4 A;  3C7U A;  4WM9 A;  4X56 A;  3BEC A;  1KDS A;  1K25 A;  2QPN A;  1G68 A;  3LO7 A;  4OP5 A;  4C3Q A;  4X69 A;  1WYB A;  4JPM A;  3TOI A;  2WYX A;  4LEN A;  5CGX A;  3G2Z A;  5DTK A;  3V5M A;  5EPH A;  4ZJ3 A;  3Q82 A;  4EUZ A;  4LV1 A;  5KZH A;  3UDX A;  2ZC3 B;  2HDU A;  3HVF A;  5M1A A;  1QME A;  2WKI A;  1FCM A;  1LHY A;  1N9B A;  3HUM A;  5E2E A;  4F94 A;  3Q7V A;  3A3J A;  2Y55 A;  3EQV A;  3IH9 A;  4E6X A;  3EQU A;  4Q8I A;  3BRM A;  5GLC A;  4IVK A;  1CI9 A;  1BLS A;  1O7E A;  3LCE A;  3UE3 A;  1VQQ A;  4JF6 A;  4KQQ A;  1M6K A;  3NDE A;  5AQ9 A;  4WEL A;  5FI2 A;  3ZCZ A;  4P6B A;  3ZG9 B;  4RYE A;  4DE0 A;  2X71 A;  4U0X A;  4FCF A;  1Y54 A;  5FAO A;  2HP5 A;  1GA9 A;  1Q2P A;  4KEN B;  3BFC A;  5KSH A;  4DRT A;  5HX9 A;  2EX8 A;  1K57 C;  1I2W A;  1BT5 A;  1KGF A;  3MKF A;  2ZM0 A;  1IEM A;  1FSY A;  2ZC7 A;  4N9K A;  1YLZ A;  2C6W B;  2Y2J A;  3AGF A;  1BUE A;  3OPR A;  3VP2 A;  4QD4 A;  1JVJ A;  2Y59 A;  1M40 A;  1L0F A;  4UAA A;  5HAP A;  4ZTK A;  5CHJ A;  1W8Q A;  4JBF A;  3ITB A;  3Q1F A;  3ZFZ A;  3PBT A;  5GLA A;  3ZG5 A;  3BFG A;  3P98 A;  5TR7 A;  2P74 A;  3OZH A;  2IWC A;  3A3E A;  4D2O A;  2WGI A;  3VP1 A;  1K57 A;  1DJC A;  2ZM2 A;  3IWI A;  4QU3 A;  1L0G A;  4GDB A;  3BFF A;  1ZC2 A;  5IHV A;  2HPB A;  4NK3 A;  4E3J A;  1S0W A;  5G18 A;  1PWC A;  5EOE A;  4DXC A;  1DY6 A;  2R9X A;  4GNU A;  1LI0 A;  2EXB A;  1ZKJ A;  1K56 D;  1KVL A;  3GTC A;  3GRJ A;  2P9V A;  3UPN A;  3CZD A;  2WK0 A;  3NC8 A;  4XUX A;  2Y2P A;  1GA0 A;  1SDN A;  4UHU A;  2CC1 A;  4E3I A;  1QMF A;  2ZD8 A;  1XA1 A;  3ZHH A;  3PAG A;  2EX9 A;  5DTT A;  1K56 A;  1XGJ A;  4O7D A;  3G32 A;  4Y0O A;  3S4X A;  3MZD A;  4JXG A;  1YMX A;  1KVM A;  2Q9N A;  3G4P A;  1ONH A;  2ZQA A;  4GDN A;  2PU2 A;  1K55 A;  1MKI A;  3WS0 A;  4P85 A;  3SH8 A;  3TG9 A;  2HDR A;  4OOL A;  3BM6 A;  2XK1 A;  3CMZ A;  1GCE A;  2A3U A;  1U60 A;  3WS5 A;  2R9W A;  3P09 A;  4OON A;  2ZM8 A;  4KG6 A;  4M3K A;  4BD0 A;  2ZQ7 A;  4R3J A;  4GN2 A;  5GL9 A;  2Y2G A;  2XF3 A;  2J9O A;  1MXO A;  3CJM A;  2JBF A;  3N8R A;  2G2U A;  5E2H A;  3G2Y A;  4BL3 A;  4DDS A;  2ZJ9 A;  5FAS A;  1H5X A;  4QY5 A;  4KZ4 A;  4B4X A;  4PMA A;  4S2P A;  4WEK A;  2H10 A;  2VGK A;  3W4Q A;  1CK3 A;  4IVI A;  5M19 A;  5CER A;  4KG2 A;  1PZP A;  5GHX A;  1GHP A;  1HD8 A;  2RL3 A;  2ZQC A;  1FCN A;  1MBL A;  1MWU A;  1BSG A;  2V1Z A;  4IBR A;  3MKE A;  4HBT A;  4KZ8 A;  2XQZ A;  3HLE A;  3UNW A;  4JXS A;  4H8R A;  2WAD A;  4EBL A;  3I7J A;  1ES4 A;  3AGD A;  4OPZ A;  4KZ3 A;  3WWX A;  4E3N A;  2Y2N A;  3N6I A;  1LI9 A;  3UO9 A;  3SH7 A;  5CED A;  3RXX A;  3IWQ A;  4IBX A;  3BYD A;  2X01 A;  4OVD A;  3GMW A;  1XKZ A;  4DE1 A;  3MFD A;  4X53 A;  2WGW B;  3V3S A;  3FKV A;  4E3O A;  1IKG A;  2UWX A;  1K6R A;  5CGS A;  3AGE A;  4QY6 A;  4Y0U A;  1ES2 A;  2G2W A;  4R4S A;  3VOY A;  1ES5 A;  3HRE A;  4B4Z A;  1MWT A;  4UA9 A;  2BG1 A;  1YLW A;  4KQR A;  2OLV A;  3IQA A;  3PAE A;  2XFS A;  4DXB A;  1SCW A;  3HBR A;  2H0Y A;  4K91 A;  5FQK A;  1PWD A;  1HVB A;  1JTG A;  5FQJ A;  4BQM A;  1PWG A;  5M18 A;  1C3B A;  3PBQ A;  1EI5 A;  4LV3 A;  3BLS A;  3N4I A;  1YLP A;  4R4R A;  4MLL A;  5AQB A;  3ZDJ A;  4S2O A;  1IYS A;  5AQA A;  4S2L A;  5FQ9 A;  3ZNY A;  1BLP A;  3SS5 A;  5F1F A;  5FQQ A;  1IYP A;  2HDQ A;  2J9P A;  4GD6 A;  4KZ9 A;  1JWV A;  4FH4 A;  3Q7V B;  2PBY A;  1TVF A;  3MBZ A;  4MBH A;  2WGV A;  4OOY A;  1ES3 A;  1KGE A;  4WZ4 A;  4CPK A;  1O07 A;  1IYO A;  3C5A A;  3FYZ A;  1KGG A;  1ERM A;  2IWD A;  4RA7 A;  2HDS A;  3CG5 A;  5HAI A;  4S2N C;  3M6H A;  2IWB A;  2DNS A;  3Q07 A;  4OPY A;  2RCX A;  2XFT A;  3BEB A;  4WEJ A;  3VP4 A;  3VOZ A;  3A3D A;  4LV2 A;  4ZAM A;  1BTL A;  4LV0 A;  4ZDX A;  1CEF A;  2EX6 A;  3WS4 A;  5EVI C;  1HTZ A;  2I72 A;  4JXW A;  4MNR A;  4MEZ A;  4S2J A;  5EE8 A;  1XX2 A;  3VFH A;  2OV5 A;  3D4F A;  3HLF A;  2Y2O A;  3MZE A;  3S22 A;  1NYM A;  3IXH A;  4QHC A;  2FFF B;  2EXA A;  3IH8 A;  4S2N A;  1DJA A;  2C5W B;  4WMC D;  4WZ5 C;  5EVI D;  4OPQ A;  2WAF A;  4EBP A;  1Z6F A;  4B88 A;  1YM1 A;  4ID4 A;  1TDL A;  4CJN A;  1DJB A;  2XD5 A;  2XD1 A;  4N1H A;  1E3U D;  5EVL A;  2Y2L A;  3GQZ A;  1K54 C;  4JF5 A;  3TSG A;  4WMC A;  5E2G A;  5EVI A;  4UA7 A;  4BL2 A;  4OQG A;  5CEB A;  1NZU A;  1IYQ A;  3PBN A;  1CEG A;  3IF6 C;  3QHY A;  1CI8 A;  3VFF A;  1OME A;  1K6S A;  1E3U A;  5HFO A;  5KSC A;  3E2K A;  1K38 A;  4WZ5 A;  4YFM A;  1L2S A;  2ZLY A;  2P9V B;  1XP4 A;  2ZC5 B;  3JYI A;  3PBS A;  1RCJ A;  4P87 A;  5DF7 A;  5GHZ A;  1KE4 A;  3VP0 A;  1JWP A;  3WS1 A;  3ZG7 B;  1TEM A;  1FQG A;  1YLY A;  3B3X A;  3PBR A;  1ESI A;  1RGZ A;  3HLD A;  1W7F A;  2Z2M B;  5FAT A;  2Z2L B;  3GR2 A;  1K54 A;  1ZG6 A;  2ZQ9 A;  4S2I A;  4C75 A;  3DTM A;  4X68 A;  3BFD A;  5JYP A;  5FI7 A;  3IF6 A;  1KDW A;  4FSF A;  4N92 A;  3VSK A;  3G34 A;  1WE4 A;  4GOG A;  4WYY A;  4BD1 A;  1YQS A;  2J7V A;  2Y2Q A;  3M2J A;  3OPL A;  4DDY A;  4PM5 A;  1BLH A;  1G6A A;  1SKF A;  3C4P A;  3N8S A;  4A5R A;  3HLW A;  1NXY A;  4R1G A;  3RJU A;  3W8K A;  4C6Y A;  3UY6 A;  1E4D A;  1I5Q A;  3NI9 A;  3ZG8 B;  4BJP A;  3VSL A;  3OPH A;  5U47 A;  5A93 A;  3UPP A;  1EWZ A;  1LL9 A;  4OQI A;  3MXR A;  2JCH A;  2WUQ A;  3IF6 B;  3O87 A;  5A91 A;  2OLU A;  4DF6 A;  2EX2 A;  2X02 A;  5CHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...