3OQ1A

Crystal structure of 11beta-hydroxysteroid dehydrogenase-1 (11b-hsd1) in complex with diarylsulfone inhibitor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
261
structure length
261
Chain Sequence
QPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The synthesis and SAR of novel diarylsulfone 11beta-HSD1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 83
structure length 261
sequence length 261
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2010-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3oq1A00
2P9GA 4CPDA 5HA5A 1B3BA 4BNNA 3JYLA 3L6EA 4B8WA 4JP2A 4YJGA 5KIAA 3ST7A 1DLJA 1I3NA 2IRWA 3KVOA 3RC1A 2EKQA 3GVCA 3RUIA 3AW9A 3QVOA 1O89A 3JQAB 3UKOA 4BQPA 1R0KA 4GL4A 3UGKA 1FDSA 1KC3A 2PZLA 3ZWXA 4Y6PA 5B1YA 4Z9YA 5DP1A 3ZNOA 5EPOA 1ZK1A 1FDTA 2AEFA 1BDBA 2E37A 1WNTA 2Y1CA 2JCYA 3CXRA 4NIMA 3P2OA 4BGUA 1GR0A 3I3OA 3LC7O 2O3TA 3JQGB 4GGPA 3RJ5A 3P19A 4GBJA 3E6AA 3RC2A 2EW8A 4D43A 4RDHA 5JAIA 3LF1A 2VRCD 4DBZA 1NQOA 3UICA 3BMNA 5ER6A 2ZTUA 4NJMA 2VWQA 3CTMA 1S7CA 1VJ0A 1NFQA 4YTEA 3INRA 3IS3A 1E92A 3DBLA 4HV4A 3K5PA 4IIUA 2WE7A 4YAGA 2WYUA 3RU7A 4PLGA 3NT5A 5A04A 1GEGA 4FC7A 4AJKA 3DBVO 2D2IA 2WEKA 2IODA 1R4MB 2A4KA 4JXKA 4M55A 1X1TA 3DAGA 4MIEA 2AQKA 4XYGA 1IHXA 2V6FA 3LT2A 1YRLA 2DUWA 3DZIA 1JKJA 3GZ4A 1PX0A 2UYYA 3LT0A 4Q9NA 4R3NA 3WLFA 2Q46A 1X13A 1P1RA 4UULA 1XSEA 4WEOA 1G1AA 5JDCC 2GCGA 3GHHA 2GPTA 1H6AA 4E5KA 2DBVO 1ONPA 2WSBA 4CM3A 1B15A 1SOVA 3JD0A 4NH4A 3WG9A 2CNBA 4CM6A 5H81A 4TMFA 1LRJA 2V6MA 2X9GA 3G79A 4M49A 3DMYA 4PG6A 4IDBA 3OJFA 4TRRA 4HFRA 3BMOA 4LGVA 4W6ZA 4ZQBA 3M1AA 3EMKA 4OAQA 4D3DA 4HNHA 4WCFC 1MG0A 2ZB8A 4A73A 4KWIA 1UAYA 2QZ9A 5KJCA 2E49A 1UXKA 4R41A 1NPTO 3ENNA 4HXYA 2NLOA 5EQFA 4WK6A 1J5PA 3CIFA 3QVXA 2VOJA 5DZSA 4NU6A 3JQFC 1E7MA 3PHLA 1WPQA 4PZCA 4EGFA 4B3JA 1EK5A 4LK3A 5ICMA 3ETEA 2PWZA 4IXWA 4S3MA 4E5NA 2Q50A 1X14A 3KEOA 3GMDA 4JN6B 5IN4A 1HDXA 1AHIA 2AEMA 2NVUA 4OSOA 4OKNA 3AJRA 4D0RA 3I83A 1YJQA 3G1TA 4ND5A 3JYQA 8ADHA 5TIIA 1V35A 1E77A 3GQVA 3H7AA 4WE3A 4XYMA 3AU8A 1CWUA 5L7TA 4BNMA 3WIEA 3OSUA 4GX1A 3NGXA 2X0NA 3NT4A 5T67A 5GZ6A 2J5RA 4KQXA 3E9QA 3AOEC 2VNAA 3KO8A 1ISJA 4NPCA 2EHDA 1U8XX 1BTOA 2WYVA 2Y0EA 4FOOA 4M8SA 4Z0HO 2EP5A 1GL3A 1YS4A 1M66A 4ZJUA 4YPOA 3JQDA 1IZ0A 5DULA 3FF4A 2VRBA 4R5HA 3RIHA 2GD1O 1HDOA 3RBXA 1SMKA 3DHNA 2UV8A 3R3SA 3LSYA 1RKXA 2PZJA 5I8ZA 4GWGA 4J1SA 4JIGA 6ADHA 5G4LA 4N54A 4XYLA 2DTDA 1HKUA 3NTRA 2BF7A 4LW8A 1XA0A 4H7PA 1I2BA 2OP0A 1EBFA 3IMFA 4B3HA 1JKFA 2FRDA 1E3SA 5IFLA 4P38A 5B4TA 4RDIA 3E5RA 4E2WA 3KOUA 5ENVA 3PRJA 1WDMA 3HZZA 3LLVA 1SEPA 3Q9UA 1L7EA 1IUKA 2HLPA 2ZB4A 1JDJA 3IL2A 2FN7A 3N7UA 5CPBA 4S1VA 1W8DA 3DC2A 4FGSA 4MOWA 4R1UA 1F12A 1QYVA 4KTTE 3I23A 1BXKA 2WMDA 1GZ4A 3HDJA 3ZV5A 1ZSVA 1P3DA 3H4VA 4ZICA 3JQAA 3PZRA 5EERA 1D3AA 1BW9B 3KLPX 1LBEA 3QJ5A 2XPCA 4QSMA 5GZ3A 3RUFA 3M2PA 1C0PA 1HDRA 2PD3A 3ADOA 3H2ZA 3MJTA 4CL3A 4XEHA 1UP6A 1NHWA 1SOWA 3WGYA 2HCTA 3CUKA 2RAFA 3DAPA 2CVQA 1M2WA 3ZWOA 2VWPA 5JE8A 2CVOA 2EGHA 1NWCA 4OQZA 1JAXA 2QRJA 2X4GA 3GF4A 5KVSA 5JBIA 3CINA 1PJ2A 4Z6KA 5B4UA 1XIVA 1MLDA 2BFPA 1BVUA 1KVSA 2BELA 1M75A 3JQFA 3K2BA 3L07A 3OA0A 4N18A 1ENYA 2FR0A 1H2BA 2SCUA 3U0BA 1DFHA 3ROQA 3WGQA 2PD4A 1TEHA 1C1XA 3L6OO 1HYGA 4PIVA 8LDHA 1Z6ZA 3BYZA 3NRCA 4LCEA 4YJDA 4BOYA 2X5OA 1O6ZA 4Q3CA 4M1QA 3B70A 5IDXA 5U4QA 2NVBA 1W0CA 3SC6A 3BMCA 4PCVA 1ARZA 1NAIA 4CLHA 3EVNA 3D0OA 4PLCA 5CFZA 2VHVA 3WYBA 1BHSA 4M86A 2X6TA 4ND1A 3MJEA 1UDAA 3R6DA 2ZYDA 3QWFA 1PL8A 3T4EA 1GY8A 1VE9A 4B7XA 2YV2A 3OA2A 2UVDA 1VL0A 1MFPA 3TPCA 1YE3A 4NG5A 2TMDA 3RUHA 5JYEA 1MXHA 4BKOA 5CEJA 1RPNA 1V0JA 3PYXA 4RORA 5FEUA 2G1UA 1VSVA 4K6FA 1PR9A 3UFXA 3SC4A 3PQDA 4JP3A 3ZU5A 4CMIB 4UVIA 2WD7B 1J4AA 4DPLA 3UCFA 3K92A 1EUZA 4EI2A 3L4BA 3IJPA 4QFDA 5IZ4A 1OZAA 3K31A 3I9LA 2BGMA 3QVWA 1LJ8A 1CRWG 1DB3A 2B5VA 1D1TA 1LA2A 1NP3A 1QKIA 4ZN6A 4O0LA 3F1KA 4J16A 1X7DA 2GGSA 4ZRMA 5A05A 3SJ7A 1HE3A 1BXZA 3KYDB 2AQHA 3TOZA 1GQ2A 3UF0A 4XGNA 1SB9A 4YACA 5AVOA 4A26A 3E48A 4C7JA 3WIDA 4F6CA 1CDOA 3U62A 1H9AA 2NU8A 5JAZA 3JQEA 3H65A 2OMEA 3BTOA 5F21A 5JDIA 4BNKA 4MKZA 1U3WA 4JLWA 5JC8A 1UZMA 4F46A 3AWDA 1HE4A 4FS3A 3O38A 1QV6A 3ZNNA 2GZ2A 4CQMD 1ZBQA 4DPMA 4NR0A 3H3FA 1ZMOA 4RL6A 3FBTA 1GYQA 1U3UA 2WD8A 1DHTA 4ZRNA 2G0TA 1P1IA 3H9QA 2POQX 3HJAA 3AOGA 2JFGA 1E3WB 1C1XB 1T2AA 4MVJA 3E82A 4DVJA 1WMAA 2VQ3A 4CV2A 1DC3A 4YEDA 4CM9D 3BA1A 1PQUA 1X0VA 3A28A 3ZV4A 2C20A 2P4HX 2NNLD 4DLAA 5G0VA 4GX0A 4NZ9A 4O1MA 3DOOA 4DA9A 2IZ0A 3BXXA 3CEAA 3WJ7A 4BHTA 5T64A 4CMEC 3K8ZA 4MVJM 1I36A 4LN1A 1BVRA 3D3WB 3LLSA 1PZGA 4AG3A 3WGIA 4EEXA 2O2SA 3ZHZA 2HDHA 1OC2A 2QQ5A 3QHAA 1N7HA 2O4CA 5MGBA 1IY8A 3BHIA 3MEQA 4OKIA 3RU9A 2EF1A 3DOJA 1HE2A 1QXSA 2LDBA 3PWZA 4EJ6A 4BGVA 6LDHA 3W6ZA 2DU8A 3JYPA 3X2EA 4BNGA 4MVJP 1LI4A 3E1KA 4EBFA 2O3RA 3O8QB 3D4OA 2BFOA 3ICPA 2Q2WA 3BZUA 4OL9A 1U8FO 5JNLA 2C59A 1K3TA 1RM0A 4EZBA 3LC1O 1YDEA 5DNAA 3E18A 3WQRA 4AJ2A 4D41A 2EXXA 1ADFA 3WICA 1LUAA 2EG9A 5JDIC 3Q3CA 4J43A 3H5NA 4IJVA 1LXCA 1T1RA 4B4OA 3W8DA 3VZRA 3LU1A 4YXFA 3FTNA 1E3EA 1EDZA 3KEQA 3F47A 1T2DA 4KTVE 1DC4A 1PEDA 4L75A 1D8AA 1ISMA 5G0TA 1NFRA 3C85A 4PZDA 3P7MA 3RROA 2BMAA 4MKRA 3TNLA 4XDZA 3VH1A 4DLLA 3AY7A 1ONOA 2GF2A 3BTSA 5EN4A 4BO8A 2OFPA 2CF5A 1XU9A 2CF6A 3AFNA 4GLLA 4NI5A 1DRUA 1VKOA 3OICA 4J7UA 4LVUA 1J6UA 4A03A 5I7EA 4ZVVA 3PDJA 4ND3A 4MO2A 3E03A 4IIVA 3VPSA 2ZTLA 3ANLA 1U28A 2VN8A 3CMCO 4HX5A 1OMOA 4ONEA 1L1FA 4PRLA 4R1TA 1HE5A 4DYVA 3AUTA 1DHRA 3QLJA 3GNTA 3UAGA 3PK0A 4BO5A 4Z3KA 1U2DA 4I9UA 3WYCA 1D7OA 4L4XA 1UXIA 3AU9A 4DXHA 1VKNA 1DPGA 1VJ1A 3DONA 3C7CB 2NUAA 4BNIA 1R66A 2AG5A 4GSKA 1TI7A 2G82A 2HMSA 2PD6A 4FPXA 4BNXA 3KM0A 2YV1A 3WYEA 2PH3A 3KV3O 4YDRA 3STHA 1I5RA 1R6DA 2J3JA 4MVJG 4R51A 1OBFO 5ILGA 2NVUB 1ORRA 5KCZA 3GEGA 4IPTA 3BMOB 3WSWA 4BO1A 1E6WA 3HDQA 4RO0A 3GFGA 3G0OA 4DPKA 3ZW8A 2P2SA 3C8MA 4MKXA 2O23A 4RVUA 2FHSA 9LDBA 4ID9A 1LRKA 3O4RA 2J5QA 3H9JA 2TMGA 3VDRA 4JBGA 2V7PA 3I4CA 4L0QA 3R1IA 4FJ2A 4BO2A 3DR3A 2HMVA 4D42A 2YV3A 2Y66A 1K0UA 3SLKA 4Z9XA 2PR2A 1K6IA 4ZQFA 3MTGA 3LK7A 3IOYA 3QV1A 4WLNA 4FSHA 3PGJA 1KEWA 3GEDA 4U5QA 3VZQA 4CM9A 1QG6A 2Q2VA 2QZZA 1C0KA 3H3JA 4IJKA 2Y99A 5L45A 4BNVA 2O48X 2CDBA 3M2TA 1O5IA 1YQXA 1GZ3A 5JXWA 3NX4A 1SAYA 4FFRA 3COSA 2HQ1A 1KEPA 4GPD1 1UDCA 5CEFA 4XZ3A 3JQBA 2VYVA 4TROA 3WQSB 1XR3A 2PGDA 3TSCA 1FDVA 3VDQA 5A03A 1DC6A 3KZVA 4Z0PA 3JQ7B 2FR1A 5ILOA 3RKUA 2Q3EA 1E5LA 3ZWMA 1YO6A 5BNFA 3DO5A 2W4QA 2NWQA 3GAFA 4XB1A 4YQYA 3OP4A 2PH5A 1Y9EA 5C5IA 1MC4A 1K6JA 3OQ6A 3JQ9A 4AJ1A 4U6SA 2I66A 2P9CA 2Y93A 3Q6IA 5G2OA 5T57A 3V2HA 2VUTA 4IXTA 3GH3A 4IGFA 3WB9A 5G0SA 1P0CA 3RUAA 2GRAA 3WOHA 1QLJA 2J6IA 2OBNA 5JW6A 3WFJA 1FK8A 1QLHA 2HU2A 4WGGA 4TWRA 1CF2O 1SNYA 1RM5A 4HWKA 1HETA 1YXMA 4WASA 4UUPA 3EZLA 5C7IO 3UOGA 5L95A 2PV7A 1TLTA 3OIDA 4MIOA 2HJSA 3QE3A 1ADGA 4E12A 1ZKMA 4K1LA 3ZNQA 1E3LA 1HSZA 2A9FA 2Y67A 3WDSA 2BLLA 1GYRA 4HFJA 1NVMB 3TZQA 3EYWA 2ZATA 5THQA 3VPXA 2CMDA 1YQDA 3A06A 3S2GA 4II3A 3MOGA 4LSWA 1NQ5A 5DT9A 3IP1A 2F00A 1QRRA 3ASUA 1ZH8A 5JCJD 1BW9A 4XR4A 2RH4A 2VHWA 3BHJA 3B6ZA 3VOSA 3MJSA 1YJ8A 5LDGA 1HDGO 1R16A 5IF3A 3ROKA 3L4SO 5JPIA 3RUCA 4FGWA 3JV7A 2GN9A 1Z7EA 2VTDA 5F3RA 4NBTA 4DQVA 3TRIA 1LSOA 2D59A 3GFBA 2X9NA 1PZEA 2X58A 4WCDA 2CDAA 4J2HA 7ADHA 3BTVA 2Q1WA 2EV9A 4LSMA 1NPYA 3S2EA 4WNIA 4TVBA 1U7TA 5A9TA 4I9HA 5JYDA 3NJ4A 4XRGA 2CSUA 4YT2A 3GT0A 4Y6RA 4TKMA 1G0OA 3UCXA 2PKQO 2EJWA 3ZNPA 2PZKA 2F1KA 3WJAA 4GMFA 4W7HA 4XDYA 3RWBA 1LDBA 3KBOA 4B3IA 2JKVA 5KKCA 1VJTA 1I24A 1R15A 1I8TA 4CLXA 2NVWA 3MCVA 3GDFA 1YBVA 3BIOA 4MP3A 4Q3BA 1N92A 5CPFA 4KUGA 4D0SA 2X86A 1XLTA 4MVJE 1R4NB 4ALMA 1IB6A 2IYPA 4DC0A 2WM3A 3PLRA 3JTMA 1V8BA 3JQAD 3ZWWA 3OQ1A 3V1YA 4ALKA 1R0LA 3TZCA 4I5GA 4KZPA 4XX0A 5CAEA 1DJQA 1QSGA 2W2LD 1Z73A 4XYBA 4J3FA 3CSDA 3RUDA 2EP7A 4HY3A 4DLBA 3JSAA 2B4QA 2BHLA 5JAMA 2NM0A 1E6UA 3F5SA 1HT0A 5THKA 1R4NA 5KWEA 1HDZA 4ZD6A 4EYEA 1ZK2A 1NPDA 3N58A 4XQEA 4EDFA 3GDOA 3QP9A 5T8KA 1PGOA 4E0BA 1Y6JA 4CMJA 1W73A 3PFFA 3FNFA 1P1JA 5I7VA 4RLSA 2B0JA 4ZQEA 1BSVA 1CERA 2OL4A 1CYDA 1A4IA 1DFGA 2VYNA 2ZKLA 5HTOA 2AW5A 1LX6A 3KSUA 3PWKA 5KJ6A 5A9SB 2YHIA 3ZI0A 4AJEA 2H6EA 5CDGA 3DBHA 2B69A 3DZKA 1X0XA 3OM9A 3PYLA 5AXDA 3UN1A 3ZU3A 4CLRA 1EVZA 2EEZA 1DSSG 3MWEB 3KXDA 3H5AA 4W82A 1N9GA 2JL1A 1E3IA 1PJBA 3AI2A 2GZ1A 3EK2A 1CQIA 5BSGA 4BO3A 4A5OA 4M54A 3AY6A 1Q0LA 1KIFA 3GDGA 1WW8A 1YDWA 2P68A 3V1TC 4FOSA 2GO1A 5KNLA 1PJ3A 4XGKA 4BVAA 4FN4A 2YFHA 4KDFA 3HFSA 5KVCA 4I5FA 4WOKA 3C7AA 4NFHA 2QRKA 3DL2A 4YT5A 1T2EA 1S6YA 4OXKA 4UUOA 2OHXA 3CZMA 3AOEA 4RF3A 3B1KA 5EIOA 3ZV6A 3WGTA 2PFGA 4O6VA 4XRRA 3W4IA 1JVBA 3OJOA 1PJTA 4K9DA 3ZWBA 1U4SA 4KDEA 4CQLB 3ZDFA 2BFAA 3EY4A 1NYTA 3OBBA 4D45A 1JN0A 4GH5A 1BXGA 1EBUA 1G0NA 3DAFA 4BNJA 5JCJA 3ZWAA 2C54A 3ROMA 4R9RA 3GPDG 3O9ZA 3PI7A 2VNSA 4I5DA 5TSDA 1C14A 2PGLA 3ICCA 4XWYA 3G1UA 4WCFB 3SVTA 2CFCA 5KOIA 1B3RA 4IDGA 3U09A 2AQIA 4KOAA 2DVMA 4R5MA 3QSGA 4HFNA 4Q3DA 4CM7A 4CJXA 5DBIA 5BSHA 3TZKA 4IS3A 2ZCUA 5JC1A 1N1GA 1LSSA 1X15A 2X1HA 2I65A 2ZQZA 3GUYA 4CQMA 3KYBA 1VM6A 1ISIA 4IDCA 5J23A 4AJJA 2Z1MA 1BDMA 2FY8A 3PXXA 2CZCA 3IUSA 4GKVA 3UCEA 1TXGA 2DAPA 4G5HA 3GGPA 4NK4A 1XDWA 3PWSA 1T24A 1H6DA 4BNHA 1DEHA 4E31A 1N9GB 1TVEA 3WWYA 1E1KA 3D5QA 5JY6A 3KYCB 2GASA 4IJUA 3F1LA 4KQWA 1GZ6A 3JYNA 1L7DA 3S8MA 1YBMA 4E5MA 4WLUA 1WDKA 4D79A 2Q1UA 1KY5A 4GGOA 4J9UE 4BMNA 1LSUA 4RJTA 3GNQA 1ZEMA 5JSFA 3PGXA 3Q2IA 4G81A 1C1DB 2V6GA 5A1TA 5COBA 4PLPA 2AHRA 4H16A 1KERA 5COQA 5F5NA 4DIBA 1WMBA 4ALNA 4F6LA 5AYVA 1B0AA 3AI3A 4U0KA 4B8ZA 1Y1PA 3VHRA 5EJ2A 1HYEA 4RVHA 1P74A 4NQZA 3FPLA 2O3JA 2AG8A 5TS3A 4BMSA 4IY1A 5JLAA 1WWKA 3PVZA 2GYYA 1MA0A 1I2CA 1F8FA 3BHMA 4YT8A 4DIFA 4MVJI 2AE2A 3S55A 3WR5A 4WUVA 3UUWA 5CDYA 1P31A 3AUAA 3ORFA 3Q0EA 2YDXA 2PK3A 4R1NA 3RI3A 4G65A 1DIRA 3EVTA 3TWOA 1GPDG 1K2WA 5AXAA 3D4NA 3U9LA 3G17A 2ZB7A 1PL7A 1FJHA 4J7CA 2PNFA 3HG7A 2Q2QA 1MFZA 4PVDA 3TL2A 1M76A 4PG7A 4BKUA 4JNKA 4XQGA 3HWRA 4IM7A 3M1LA 4YYZA 1FDWA 4B79A 1IPEA 2NU7A 2RHRA 1YWGO 2CD9A 4JGBA 4PLYA 5DP2A 1KVTA 4R3WA 5B37A 5L4SA 2QYTA 5LDHA 3KB6A 3GUCA 4R01A 1PIWA 2C7VA 3QRWA 3GN1A 3KSDO 5K0ZA 1F06A 4L74A 4J0EA 2H1SA 2ZJ0A 4W7IA 4XCVA 4QT0A 2P91A 4QX6A 3K30A 1HLPA 4J6FA 4JCOA 4K26A 1H6BA 3TF5A 1U3TA 1GV1A 3LZ6A 3DTTA 1A4UA 3D1LA 3BTUA 2HRBA 3WTBA 3WNVA 3HQ4O 5I7FA 5L4LA 4D7AA 1O9BA 2YFQA 3I5MA 3W4KA 3G49A 4U8GA 1GD1O 5TGDA 4RPLA 4YWJA 1QV7A 4J4BA 3HHPA 3PJDA 3RAJA 3ULKA 1ZXBA 3FNHA 3QWBA 5C37A 1GEEA 2FP4A 1I3LA 1ZCJA 2B5WA 3JD4A 4RVFA 1TT7A 2B4TO 4J91A 5LC1A 2HMTA 3W1VA 4GX2A 5A06A 1Z75A 4FCCA 2PGJA 4BMVA 1P9LA 2C0CA 1BXGB 3AI1A 3HB4X 3NTQA 3OH8A 3AUSA 3MJ4A 2R2GA 3WMWA 4XR9A 2AMFA 1HRDA 4FIZA 5KJFA 2HK9A 5TX7A 3RUEA 3VH3A 3E5MA 4YJHA 4YB8A 1EFKA 3T7EA 3PFWO 1H6CA 1T26A 1FF9A 1H94A 2W8ZA 5IN5A 4RPKA 4RZIA 5ADHA 1Q7CA 3OF2A 1V6AA 2OBYA 3OJLA 3ZH2A 2PA3A 4WCFA 3ZZNA 3ZU4A 4YR9A 3PP8A 3ON5A 5EL0A 4Q3EA 2CY0A 3RBVA 1EUCA 2HRZA 4B4UA 2PTGA 2WJPA 4RF4A 3IP3A 4NJOA 1JQBA 3TDKA 1EVYA 2GN8A 3DDNA 3VKUA 4MDHA 5L51A 3RFXA 3M6IA 4FFPA 1C3VA 1F14A 2VYVD 3AM3A 2C2YA 4MPDA 2J8ZA 3GZNA 1JLLA 1TT5A 2EERA 1PQWA 2RH8A 5H82A 3GZNB 1NTOA 4ESOA 2JJYA 3NGLA 3HN7A 4BNZA 3ZWCA 1T2CA 3ROPA 4YT4A 1YOVA 3CZRA 5I9LA 1Q0QA 2EWMA 3H9GA 4FW8A 3ZN2A 1EZ4A 2IEDA 1HZZA 3IJRA 5KKAA 2I3AA 1SO8A 1KYQA 1ZZEA 2Q99A 1WZIA 1VRWA 4HUJA 4IQGA 4PRKA 4K6CA 4MINA 3RBZA 3TN7A 1SZJG 4GAEA 4IS2A 3EC7A 2Q1SA 3VTZA 2ZYGA 4IUYA 3NEPX 4BO6A 5FWNA 3H2SA 3WWZA 1PSDA 3ASVA 1XELA 1ZEJA 3FTPA 4JQCA 3JCZA 1NBOA 1KVRA 1Y5MA 4OYRA 4CM5A 3D3WA 3I52A 1N7GA 1PQPA 4J2OA 2BD0A 4RQUA 2GDZA 1IOLA 2BI8A 4II2A 2QW8A 3VPFA 4CR6A 1UXHA 3I9NA 4E2XA 2Z5LA 3INTA 3C1OA 5JO9A 2FWMX 3LT1A 3RQSA 4RF5A 1PZFA 1VSUA 3OEWA 3F4LA 1Q7GA 4LRTB 4UVHA 2HO5A 3PPIA 4JJGA 4LISA 3U4CA 4Z9FA 2BGKA 2CUKA 1IHYA 1O8CA 1LLCA 2AA3A 2HK7A 1I32A 1XQ6A 3EGOA 1YKFA 3QWAA 1GADO 3DB2A 3DBHB 4MIYA 5AXBA 4W99A 2I3GA 4YBZA 3W8FA 2E82A 4KWHA 4ALJA 5I9NA 2YUTA 2YY7A 3DZHA 4W4TA 1Z7BA 1GCUA 3GVPA 4CUKA 4GVXA 3WFIA 3VVCA 3VH4A 3GG2A 5DBGA 4E4YA 1LC3A 4E30A 5IXSA 1HSOA 3PJFA 5JMPA 1MC5A 1D1SA 2X7HA 5DF1A 4ZHSA 4BQRA 1YQGA 2D1YA 4BO4A 4EJ0A 4NU5A 5IZCC 1Y8RB 2J3KA 3D64A 4XJTA 4GWKA 3NJ8A 1Q1NA 1T25A 2JCVA 2NQTA 3FNEA 2Y1DA 1ZXLA 3U4HA 4PN3A 5FI3A 2DBRA 1RYDA 1XG5A 4FD3A 4IDAA 5HBRA 4ITUA 4M87A 4IBOA 3L6DA 2GZ3A 4QECA 1Y5RA 1LQUA 4CM8A 4DMLA 5A9SA 1PGNA 1LDNA 2X5KO 2G76A 4XKJA 3ZV3A 2J5KA 1GUZA 5CDSA 3TFQA 3EZYA 3I6QA 3ONDA 3E8XA 3TZHA 2Q1TA 1F0YA 3Q11A 2I99A 3DZGA 1QYWA 1EFLA 3DMTC 3JQ9C 4OMUA 1YH3A 4OO3A 1YBAA 5DOVA 5T6BA 3FWZA 5T8KC 3ANNA 4FB5A 1H2HA 2XXJA 1B8UA 3CMMA 5KVVA 1LRLA 4DRYA 3FNGA 3V5NA 5G0WA 2W2LA 1H93A 1P1HA 4KMSA 5DDIP 5IZCA 1DOHA 2VZ0A 2CVZA 1GQYA 1LLQA 3OHSX 4L8VA 2IXAA 4UVGA 4OHUA 2YQ5A 1PL6A 2FSVA 3HFGA 3OQBA 3A1NA 2OP1A 3A9WA 1UAGA 1X1EA 4UUMA 1Y8QA 1U1IA 3GRKA 3VAZA 2V6BA 1XHLA 1UXJA 4D3FA 4XGIA 5JMWA 1ZNQO 3KYCA 4JBIA 1N8KA 1NXQA 2PLAA 4CMHA 5KVQA 3ZWVA 4DUPA 5A5FA 4BNLA 3W4JA 3JQ8B 2XXBA 5IXYA 1U3VA 3WX0A 4R16A 1EEHA 4JX8A 4YAKA 4XIYA 1VI2A 2H63A 2DM6A 3GR6A 4Y98A 4N7RA 1YB4A 4WEQA 2YW9A 1O94A 3ADPA 1HF3A 1OFGA 1IE3A 2X22A 3FPCA 2JHFA 5KJ1A 1DRVA 1XQ1A 4BKQA 2NACA 3I6IA 4KUEA 4AICA 2HMUA 1PJLA 2XF8A 3F4BA 1T1SA 1IYZA 1IULA 4ZQHA 4BS9A 3GOHA 3AY3A 1ENOA 1PS0A 2O7QA 4QO8A 1DIGA 4Y67A 3DBLB 4YQZA 4D46A 4XIJA 1ZJYA 4WNCA 4ALLA 2Y05A 4CV3A 5A3JA 3U5TA 3DWFA 4HBGA 2C82A 5DN9A 3WTCA 1HLDA 3ZHYA 5CEEA 4CUJA 4AJIA 3V2GA 3GNSA 4E2ZA 1Z45A 4P8RA 1N1EA 4Q39A 2EW2A 4WOJA 1SPXA 1GUFA 1NFFA 2HMWA 3Q9NA 4LVCA 1I01A 2J3IA 3D4PA 2DC1A 2OUIA 4AJPA 4YJFB 4E2YA 2ZQYA 4BB6A 5JY1A 3CH6A 1KVUA 3I9JA 4TSKA 3JD2A 3LC2O 3PTZA 4IDDA 3FN4A 4CUZA 4HP8A 1TA4A 3IQDB 3C1AA 3K6JA 1DC5A 4FR5A 3NDIA 2A35A 4U7WA 5FF9A 5L40A 5TF4A 2R6JA 5L3ZA 1UJMA 4AL4A 2AXQA 2X0IA 3ABIA 1QP8A 3PJGA 1HZJA 2OORA 1KETA 1NQAO 1ENZA 1P0FA 1XU7A 3LYLA 1OI7A 3RFVA 1GYPA 3Q1LA 2IZZA 3D7LA 3QA9A 4Y8VA 2D3TA 2GN4A 3U49A 1EUDA 4NBVA 3HSKA 3WBBA 3ZCXA 3I4FA 2NSDA 1BG6A 4AJHA 4B4WA 5TLSA 1WDLA 2UUOA 1NR7A 1HDYA 1ISHA 2C2XA 3E9MA 5JO0A 4RLHA 1LQTA 1XWFA 1ZW1A 1LC0A 1E6EA 2WTBA 2HAEA 4RVGA 3JD1A 4CODB 1DIBA 1RM4A 4JROA 2A92A 1QMGA 4E5PA 2NU9A 3LQFA 2VT3A 4R4JA 2D8AA 1X7HA 2WD7A 4QTZA 4HFMA 4M89A 4IDFA 1JKIA 3OIFA 4RGBA 2JD1A 2ZYAA 1PJ4A 3E9NA 5FI5A 1HTBA 4E33A 4TRNA 5EQDA 5K9ZA 3FSRA 3L9XA 3WGZA 3EHEA 2GNAA 2XOXA 1OC4A 4OXYA 2X0RA 5BT9A 4JJFA 4BIIA 2VOEA 3H9EO 2P9EA 3R3JA 2O4UX 5AXCA 3S2IA 5DCYA 1QYDA 2RCYA 1B8PA 1I10A 4QFCA 3IAHA 5DCWA 3CKYA 4E32A 4FBGA 2IDZA 4EJMA 2JD2A 3GMSA 4CM4B 3WQQA 4YAEA 3ZWPA 3GA0A 3ZW9A 1PJQA 4RPHA 3OJEA 4GX5A 4QO7A 5BSFA 4RVSA 3TZ6A 1DBVO 4CMGA 4ZQGA 3OJ0A 4RV9A 1V3UA 4E6PA 5TNXA 3JD3A 5GMOA 2DUUA 2ZTVA 2HUNA 3GEMA 4NMHA 1NWHA 1C1DA 4AVYA 1ENPA 3DZFA 3MTJA 1PJCA 4EITA 3H5RA 4CMEA 3N74A 3NUGA 2E48A 2RIRA 3Q2KA 4GQAA 3C1TA 4J1QA 3WNQA 2VUSA 1W4ZA 2BI7A 4OJNA 4PG4A 1MXFA 3DOCA 3EUWA 2O2YA 1M6WA 3OEYA 1LDEA 1YOVB 2B4RO 1DJNA 2YDYA 4I5EA 1IPFA 4YJGB 1UZLA 3OMLA 4DL9A 2X0JA 5DCUA 2Y0CA 2CDCA 1HWYA 3QW2A 1CQJA 4WECA 2FR8A 4BO9A 3A4VA 3HN2A 2W98A 1E7RA 5A3VA 3RASA 1OOEA 3CE6A 3GHYA 3PJEA 4NBWA 2ZCVA 4CLDA 2NQ8A 5ICSA 3F6YA 1MV8A 1A5ZA 3KTDA 5TJHA 2Y1FA 1YB1A 5L53A 4UREA 3DTYA 3LVFO 1SC6A 3QWHA 2VWHA 3HE3A 5L9AA 1E7WA 4MJLA 3BMQA 1EE9A 4ZU3A 4BO0A 4Y9DA 3FBGA 4OM8A 4U0JA 2YYYA 3IIEA 4GMGA 4NJMB 1FMCA 5ITWA 2NV6A 2Y68A 3BAZA 3K9QO 4AJOA 1DFIA 4G2NA 3I9KA 1Z74A 2I76A 3GK3A 4Q3AA 4RPGA 3SEFA 1AXGA 5BSEA 1JAYA 1ZK0A 4YJHB 4AJNA 4XQCA 3U3XA 3K2EA 1ISFA 3RKRA 4FFLA 4OSPA 3DFUA 5GZ1A 4W9NC 4RQTA 1SCUA 3TQHA 1ZUD1 4WLEA 2FZEA 3RSHA 1MUUA 4R54A 1LLUA 4P4NA 4RPJA 1N5DA 3DBRB 4O5OA 1P44A 3KYDA 4L76A 3FI9A 1DDOA 4N5MA 5C3MA 1FXSA 4UEKA 4E5YA 1Q7BA 3EW7A 9LDTA 3F46A 1G6KA 5G4KB 1TB4A 2JD0A 1JTVA 1YONA 2PKRA 2HK8A 1PJSA 4CLRB 4ND4A 3WLEA 4X54A 4NNJA 4PG8A 1UP4A 3PIDA 2NTJA 4KUHA 1AHHA 1JU9A 3JQ7A 1K5HA 2O3UA 1A72A 3O8QA 1SEVA 1ULSA 4CL8A 1E3WA 5CG2A 2BRUA 2Y1EA 3R0IA 2DTXA 4DQUA 5JS6A 3RC7A 1J49A 3DEYX 4URFA 1V3VA 4L9RA 1E1MA 3S2FA 1V3TA 1GAEO 4OH1A 3NDJA 5IDWA 2FOIA 1WLYA 4CM4A 5FYDA 4FJ0A 1GDHA 3CPSA 1DLIA 2ZJ1A 2LDXA 5CG1A 4A27A 4RF2A 2DBZA 1EQ2A 1P33A 4QQRA 4R68A 4XYEA 1R37A 5DOZA 1I3MA 1Y7TA 3JQBC 3MJCA 1KVQA 1NQTA 3KRTA 5KJEA 4CM1A 1DAPA 3PQFA 2DT5A 2JAHA 5GY7A 4YCAA 1PR3A 3LF2A 1E1NA 2ILTA 4IDEA 3HUDA 3UW3A 3AFMA 4Z3DA 1MGOA 3OIGA 4BB5A 1KS9A 2VTEA 4CR7A 1ZO8A 3GGGA 1A7AA 2DLDA 2HJRA 3QY9A 4INAA 2X23A 3L0DA 4L73A 3LT4A 3WGHA 2EGGA 3AM5A 5JCXA 5F1OA 2H5LA 4PG5A 2IXBA 5BQFA 4TKLA 1PGPA 2D5CA 3W6UA 2VHZA 1RJWA 1P45A 4BO7A 4A7PA 4BKRA 1KEVA 4GI2A 2P4QA 3KUXA 3PYMA 1YB5A 4PLWA 4R1SA 4DYDA 2JHGA 1B26A 3NTOA 3HDYA 2C29D 2Z1NA 1PWZA 3PHJA 5CP8A 4ZGWA 4LCJA 1DAOA 5JAQA 4E13A 5JFOA 2QRLA 5HWSA 1AUPA 3KHUA 3VZPA 1QR6A 4BNUA 1VL8A 4FQ8A 1QYCA 3P5SA 1ONNA 3DFZA 5L7YA 5U1PA 5B4VA 4MP8A 5HS6A 1DXYA 1UZNA 1LLDA 3GGOA 4CQMB 1P1FA 1UXGA 1I3KA 1QORA 2OZPA 1ZVMA 1DO8A 4HNGA 1K89A 4XQ9A 5TRTA 2JCXA 3TFOA 2XAAA 1ISGA 1Y9AA 4DIOA 2YHUA 1RYEA 3FD8A 1ML3A 1LDYA 5G4KA 1A71A 1GU7A 2UDPA 2GR9A 3AM4A 1IL0A 2B35A 4IGEA 1GTMA 2VHYA 3B1FA 2EKLA 5TJ9A 3GRPA 4MVJH 1VL6A 3ZGYA 5K6AC 3GLQA 3U4DA 5ITVA 5U9CA 1K6XA 1SB8A 3MJVA 3SX2A 4GKBA 2EJVA 2AEJA 3QWIA 2FMUA 2Q4BA 3NYWA 2QHXA 2EIHA 3NKLA 1ADCA 4EUEA 2Y0DA 3ONFA 2W90A 1AE1A 4YAIA 3A14A 4CQLA 2DPGA 2I67A 2J3HA 1V9LA 4GVLA 4BNWA 1ZK3A 1UDBA 2GSDA 5BNIA 2IEBA 1JA9A 3HDHA 1PZHA 3D5TA 3KETA 4F3YA 1Y81A 3V2UA 5A4DA 4CMKA 1LU9A 4XB2A 4LRSB 4EUHA 4UVDA 1B16A 3BMNB 1AGNA 3IUPA 4FFNA 3L4BC 3L9WA 4PLTA 4EEZA 4OOEA 1DIHA 1CJCA 1ZMTA 5LCXA 1EE2A 3WBFA 4TQGA 3JQGA 1NHGA 1YL6A 1VPDA 1WXDA 4CR8A 3NV9A 1Y8QB 4E3ZA 1LSJA 2WWRA 3T4XA 5HS4A 2JAPA 3QVSA 1DRWA 1LNQA 1XYGA 1AXEA 2OO5A 3P2YA 3GG9A 3K96A 4FJ1A 3C7DB 1B7GO 4NBRA 5JDCA 4Z0TA 5FFFA 2Q4EA 4J1TA 3MZ0A 3ZHXA 1UUFA 1PS8A 4XA8A 3TL3A 4AFNA 5C7OO 1JWAB 2Q45A 2FPIA 3DQPA 4J7XA 2O3SA 3NDRA 2ET6A 3F3SA 2DFVA 2E6UX 4BV9A 4J4HA 5A9RA 1BWSA 1PS9A 1XKQA 5DBFA 7MDHA 4B4VA 3FR7A 1A27A 1KEUA 4C7KA 4WPGA 5ER9A 3X2FA 3PHGA 1E5QA 4IQ8A 2VZ9A 1RM3A 4OQYA 4NFYA 3VPHA 4C4OA 3OECA 2Z95A 1BMDA 2JFHA 4DREA 1XGKA 3C3XA 1H9BA 4PLVA 1CEQA 1R0SA 4ALIA 2JFFA 3ZU2A 2UUPA 4IMRA 1EMDA 3ENKA 2OGUA 1O95A 1LDMA 2GLXA 1LEHA 1T2FA 2OXIA 5ENDA 5CDUA 2IYOA 4PZEA 1NAHA 2VZ8A 3PQEA 4ND2A 1I30A 1NASA 4UVEA 1DIAA 3ITDA 3I1JA 5A02A 4L4SA 3V1UA 4CMIA 2AE1A 1B2LA 2GERA 3ANMA 5IG2A 4KP7A 3UXYA 4FFMA 1NVGA 4DTIA 2FPPA 1P1KA 5F5LA 1U7HA 1UR5A 1Q0HA 2YQ4A 4UEOA 3PIIA 2NTNA 4CLOA 1WVGA 4YAJA 1JWBB 1AN9A 3WMXA 3UHAA 3AUUA 4O63O 3QQPA 3VZSA 4YRBA 2W2KB 3GN2A 2WDZA 5T5QA 1KOLA 4HKTA 4BV8A 1MX3A 2I6TA 4IQ0A 4R69A 4WJZA 4CMBA 3IKTA 2B36A 5G0UA 2P5YA 4WLOA 4AJLA 2NU6A 1UH5A 1GUYA 4NDNE 3T7CA 3SLGA 4WKGA 4BGEA 2AQ8A 2IE0A 4P4GA 4PFJA 1OAAA 1U9JA 2Y1GA 4QXMA 3H8VA 5IDYA 1ZIDA 3INGA 1U5CA 1M6HA 3VTFA 3WSVA 1Q2XA 1EDOA 2PKQP 2A94A 5KTKA 4MP6A 1A7KA 4OOFA 2FZWA 3NT2A 3F5QA 4OGWA 1E0DA 3VKVA 3FHLA 4J0FA 3RJ9A 1Y8RA 2GN6A 3H9UA 5L7WA 4CV1A 4NK5A 1PGQA 4R9SA 5MDHA 4IZHA 3EAGA 1C0IA 4I9NA 1R4MA 3KSZO 4Y6SA 3QIVA 4A2CA 5BR7A 4UAGA 4EW6A 1HXHA 2HSDA 2R00C 1ZSYA 3V8BA 4B7CA 1B8VA 5I8WA 1WP4A 4PLZA 4Q3NA 4F45A 3ZWNA 3JQCA 3RFTA 4ROSA 2X8LA 3W8EA 4WLVA 3DHEA 1GV0A 2UAGA 4J49A 2G5CA 3ZWYA 5L4NA 3PZBA 3OETA 1R12A 3OFSA 3TJRA 5ES3A 2QG4A 2WYWA 4RVDA 1MB4A 2BKAA 1E1LA 3GVIA 4PLFA 4N5LA 2NADA 1BGVA 5CDTA 2O50A 4YVFA 4CLEA 3BMQB 3GVHA 3PDUA 2C5AA 5IAAA 2ZK7A 4YJFA 1NR1A 4RZHA 4A10A 1C0LA 3BMCB 2DKNA 3G3EA 2Q49A 4BNTA 1SBYA 2VYND 3HADA 4WLFA 3PHHA 2PZMA 1MP0A 5IDQA 1KBZA 4OXNA 2O7SA 3FCOA 4DBVO 1TT5B 3K73O 5A5EA 2VT2A 1Z82A 4MVJF 2NTVA 4FFOA 2X9VA 1E3JA 1JW9B 3QVTA 1YL7A 2YJZA 4A0SA 1F17A 3DBRA 3JQ6A 1GPJA 4IMPA 4QEDA 4PGFA 1EVJA 3B20A 1ULUA 4I8XA 3O26A 4TRJA 1CETA 5CHEA 4GLOA 2B37A 3WXBA 4YRDA 4TRMA 3S1LA 1D4FA 2BH9A 5IJZA 3WGGA 1KY4A 4QUKA 3SXPA 4FDAA 4UUNA 4CMCA 1T4BA 5HRUA 1XCBA 1I0ZA 2VUUA 1E7YA 2DTEA 1VC2A 4DC1A 1CIVA 1A9ZA 1I2ZA 3ZHBA 2RBEA 1F8GA 1HL3A 4O59O 1UP7A 3IDSA 1GQQA 3WS7A 4TZTA 3VC7A 3F9IA 5B12A 2O3QA 4IJWA 4W9NA 4I1IA 1QYXA 3ONEA 5H83A 4J4TA 5TQVA 4CMAA 2RHCA 2ZTMA 3FRJA 4LMPA 4NHEA 4BKPA 4XD2A 1XEAA 1LTHR 4K28A 5COAA 2VWGA 4NFSA 4BL5A 3DZBA 1LDGA 2VRCA 2W2KA 4H15A 1YGYA 4ZA2A 2YZ7A 4UEJA 3NAQA 4DWVA 3JQ8A 2C07A 4J1NA 5TT1A 5F1PA 1E7SA 3IKVA 4U6QA 1KC1A 3UVEA 4HADA 4YRAA 1PTJA 1VLLA 2GUGA 3GVXA 1NX6A 5BNTA 2YHIB 4MVJD 2QIOA 1U4OA 4DGSA 4J90A 2ZB3A 1J0XO 1YL5A 5HM8A 4AJ4A 3AK4A 1P77A 3PHIA 4J9VA 2I9PA 4CM8B 3TOXA 1H0KA 2PY6A 3B1JA 4H3VA 4JJIA 5I7SA 1IZ9A 3WGOA 1GFSA 4RCVA 2ZIZA 3RCBA 3VPGA 3O03A 2X5JO 2FSSA 1A9YA 3GC6A 1W6UA 1ZFNA 5C7LO 3L77A 1WAMA 4OIMA 1ID1A 3ITKA 1U2GA 1BRMA 2IZ1A 5EINA 2G17A 3KLMX 1ZJZA 1PWXA 2DPHA 3IC5A 3SBOA 2C7GA 3FWNA 3GY0A 3FR8A 3PLNA 4XJSA 3U4IA 4JBHA 3JYOA 1X7GA 3RC9A 3H6KA 1HDCA 3RD5A 3VVBA 4BNYA 1RWBA 2QX7A 3LDHA 4P22A 2VCYA 3UH1A 3ETDA 4DQXA 1NM5A 1T4DA 1NVTA 1I33A 3C24A 4N5NA 4BUCA 1FDUA 3VH2A 1U5AA 4D3SA 3GAZA 4CLOB 2WE8A 2BFMA 3D3EA 2D4AA 3DMTA 3EDMA 4EUFA 5AQ1A 4DMMA 5TC4A 4ILKA 3DZJA 4IINA 2DQ4A 2B83A 1ADBA 1EQUA 3I9MA 1ZSNA 4JK3A 5F1KA 2EKPA 2FPGA 2P5UA 1H5QA 4BGIA 1N2SA 1EK6A 3MOIA 1MG5A 4YA6A 1M67A 4PVCA 5K6AA 3MWDB 4GSLA 4TZKA 5EMHA 1ZK4A 1E7QA 4E21A 3ETGA 4L4RA 1O0SA 1HYHA 1HEUA 2QYSA 5EESA 3RVDA 2Y1OA 1EVIA 1B14A 2VHXA 3DHYA 3HNPA 2D5AA 5I9MA 2C5EA 2DBQA 1WZEA 4BNFA 4FC6A 4NBUA 1PU2A 2R00A 5TT0A 4TVOA 2OOSA 2HKIA 1GCOA 2DFDA 4P4LA 2E4AA 2I5PO 4B7UA 4PLHA 2D0IA 2H9IA 1YVEI 3GPIA 4I08A 5AOVA 3I9OA 4IZIA 1NNUA 3SJUA 1JVSA 1PGJA 4LMRA 3PEFA 4D44A 3DXFA 2BGLA 2V65A 4CV0A 3HB5X
chains in the Genus database with same CATH superfamily
1MBZA 2O5VA 2P3SA 3WSTA 5I7WA 4LC9A 3OESA 2F4VB 2PL9A 3RBAA 3UWMA 5FV7A 4Z1MA 2QVLA 3WI7A 1SU4A 1NNEA 4JP2A 4YJGA 3AHGA 4DSAA 3I5AA 3MUOA 3TPFA 4RTKA 1LPBB 2WV7A 5EMNA 4MUKA 2GSWA 3LH5A 3H1GA 1EINA 3GVCA 1KU6A 4OHXA 1WSWA 2BGWA 2QA5A 4W9MC 4C4ZA 3ABRB 3G2JA 1EXMA 1W88B 1NXTA 1P75A 3JQAB 3FSGA 3QVOA 5C0OE 4TXHA 4OHVA 2P3QA 4GL4A 3UKOA 2J30A 4N3BA 1FDSA 4FBMA 5AM4A 4LXTA 4MMZB 4Z9YA 1N2IA 2M98A 3D3JA 4LY0A 1CRZA 1OKKA 4B6EA 3U6BA 3T1YB 2A5GA 2JCYA 3CH7A 4DQDA 4BQFA 4AZSA 3JQGB 3GJ0A 4LA4A 4LTDA 2UZ4A 1SVOA 3HL0A 1J8YF 3E6AA 4UATA 5K0GA 1NBEA 1S7GA 1OQAA 1XLUA 2AFHB 3LF1A 1GTG1 4D74A 2VRCD 1NQOA 3NKFA 4KIUA 3V6MA 4NJMA 4PBTA 3PUHA 3TQRA 1VJ0A 3SSMA 1XYVA 1YZNA 1I4WA 2WTNA 3LBIA 3KZCA 3VO9A 4ZWNA 4JLSA 3WKEA 3TVYA 3IUBA 1E92A 3DBLA 1N77A 2FUG1 4IIUA 4ZYUA 2AG1A 1IAQA 2NXEA 4TMTA 1TUGA 3BXGA 4DJ5X 1Z13A 3NT5A 1Z35A 1G21A 1FQWA 3QUCA 1ZWKA 4Q4AB 5EJ4A 1C2YA 3JATB 2YXDA 4Q1VA 2FZLA 1ZLXA 3KLBA 3NBAA 2IODA 1HQYE 3GJQA 3L1IA 3OWOA 1NA5A 2I03A 4JXKA 3WRVA 5KSOA 5LQCA 4MIEA 2P77A 2V6FA 1YRLA 4ABYA 2ZIEA 4V3BA 5ALYA 1CUWA 5AIAA 2VPWA 4Q1DA 4MI6A 4QASA 1PX0A 2UYYA 3KQPA 3LT0A 2OM6A 4YDSA 1D03A 4ZOBA 2HSWA 3F3MA 2Q46A 3C39A 4UAJA 5E6RA 5I8PA 1P1RA 1Z0SA 1XSEA 3TAXA 4WAUA 3U9TA 4F5YA 2GCGA 3UGJA 3T3DA 1UF9A 2WTAA 4OBXA 1OFUA 4FMDB 1VG1A 1SOVA 3JD0A 4HLDA 1LS6A 4XTCS 3NUQA 3KSBC 3HR7A 4YCLA 1NVWQ 1JXQA 2BE9A 2V6MA 2WKRA 3G79A 3BL8A 3GZJA 4TMFA 3LY9A 2WB2A 1IN8A 3OJFA 4TRRA 1N78A 5E9JA 1E2PA 1UQRA 1CFJA 4WCFC 1ONSA 5DHFA 4ZRDA 3X0DA 2YYSA 1QONA 3AVPA 1YVUA 2UZAA 1NPTO 2EAUA 1JHVA 2Z56A 1N3YA 2F3TA 4BBZA 5IT5A 1T0JB 3HKEB 3D6TB 4WK6A 4Z1MD 1VJDA 4QJ4A 4YCNA 1ZISA 1YMQA 2BJHA 2PKXA 4O2BF 2YJ4A 1E7MA 2WKQA 3PHLA 1JFFB 3QNMA 1T3HA 5D3KA 4B82A 5B3KA 3H75A 3AQIA 2NUAB 2J1LA 4KRXA 1EK5A 4LK3A 4LJ4A 3DZCA 2OHGA 2QPOA 2Q50A 1QDEA 3H4MA 5J2TB 4CEIB 1HE8B 3B6MA 2AEMA 2NVUA 4OSOA 4OKNA 3LPAA 2QTCA 4KQGA 1Y1KE 3HHEA 4AS1A 1RI2A 1FUYB 3GLHA 3NNDA 4X24A 2IHZA 2GFIA 1VBNA 5JLJA 4QAQA 1Y6FA 1T9GS 2ZITA 3HNRA 4KSBA 5TIIA 1RLTA 1V35A 3GQVA 3OZVA 1V11B 3JARB 4RZQA 3UTCA 4GRDA 3DL0A 4GX1A 2TYSB 2X0NA 3OX4A 3U0VA 4FGJA 1JDVA 2UUBB 4DDUA 5A5DA 3JZIA 4BYMA 1POWA 3AOEC 3E9QA 4TLAA 2VNAA 3KO8A 1C30B 5CVCA 2RGEA 4UBOA 1UKZA 5SY6A 3K53A 3FOEC 4DDMA 1QPGA 2VO1A 2PTHA 2Y0EA 2AYYA 3CNBA 2JLZA 4M8SA 4Z0HO 1OTHA 1GL3A 1QUEA 4A5SA 5DGDA 5J4LA 5MN5A 1KJZA 3RVLA 4GECA 4YPFA 1PT6A 3M3PA 4JJKA 3A8TA 9ABPA 1AJEA 3ZBQA 3RIHA 2DECA 2X14A 1VCMA 4O25A 3WRXC 3ZTYA 4CQNA 5KOYA 1NKVA 4RH1A 1ECCA 1WZUA 3NHZA 5ALQA 2WT8A 1NMYA 1RKXA 2PZJA 4GI7A 1WXEA 4MCIA 2RG7A 2NXJA 4JXZA 4J1SA 4PF1A 3HO8A 4ZMRA 1F5NA 2QRVB 4TT3A 2IX3A 1FS4A 3EHDA 4EF5A 1KRHA 4XYLA 3NTRA 2BF7A 4ETMA 5K3EA 1XA0A 3AEUA 4JYBA 3GV0A 3C16C 4IG9A 2VDUE 2XYQA 5CXXA 3WL5A 3GP3A 3MTDA 2XR1A 5B7NA 3LDAA 3WK8A 1JKFA 1ZD8A 1E3SA 1TJYA 2IPMA 2WM8A 3I6ZA 3T3IA 5IFLA 4NLLA 2GBPA 4Y2JA 3TEMA 3K8OE 1W19A 4ZVUA 2BEWA 1MR3F 5CD9A 1SD2A 1GG8A 4YV2A 2ASEA 1E6KA 1S8OA 2G0AA 1IRXA 2ZRNA 1XTRA 3ELWA 5FLKA 2DRIA 1JDJA 3A05A 3GYGA 2X0FA 3QEAZ 2PSJA 4OHPA 1WUIS 4DUGA 2W6JA 2IXFA 1MAVA 3K0HA 4R1UA 5DW3A 3LWNA 5LBIA 3I23A 5DI3B 3H0KA 1UKBA 5DSTA 1A8PA 4KYUA 3K4PA 3R76A 4YY3B 3HDJA 4DLRA 1P2TA 1P3DA 3H4VA 4ZU6X 1AK1A 1CUVA 2AFRA 3JQAA 1D3AA 1TYDE 521PA 3TI9A 4ARZA 2V54A 3KLPX 4NNPA 4R2KA 3AR9A 1F20A 4BLRA 1OI2A 1V5EA 1B8OA 3RUFA 4LBYA 3MJTA 3OT4A 3ADOA 3H9BA 2K2QB 1G42A 1KSFX 1UP6A 1NHWA 1QQ6A 1XP5A 2IP1A 2PUHA 2X2EA 3F4KA 3QOWA 2FUG6 2IOFK 2YWRA 1X7WB 4KB5A 4TN1A 3S68A 2IUYA 3LK6A 3ZZUA 4E13A 1M1XB 3LA6A 4FT4A 3DAPA 2CVQA 3ZWOA 2EJCA 3H9CA 5IBCA 2JAWA 4U2FA 5JE8A 3QMPA 4D9CA 1M8JA 5B7QA 1C7IA 4W8OA 3PPYA 3S1SA 5JAOA 2C77A 1TAHA 3ZJUA 2G36A 1OH8A 1T3GA 2EBFX 3OQJA 3TW8A 1KJNA 5JBIA 4CEJA 1NATA 3L8HA 3X1ZA 2PYDA 2C92A 2VP9A 4WDQA 3UK7A 3QVGB 2VBIA 2X76A 1ETUA 1N3BA 5I5EA 1MLDA 5BQOA 1BVUA 1KVSA 4NDAA 4FDLA 2X0EA 2O5CA 3MFQA 3KLNA 3H87A 3OQIA 2FR0A 3CJTA 1DFHA 4YCMA 5K8JB 3G6KA 3W5CA 3ITEA 5DYGA 3ACDA 1BE1A 1ADYA 1J7KA 4ER3A 2DH5A 4PIVA 5F9MA 1TYBE 2VDPB 2CFIA 2YY6A 3BYZA 4YJDA 2X5OA 4Q3CA 4M1QA 5K0TA 4UJ5A 4MLZA 2JB9A 1KH1A 1OPRA 1U2PA 1ZCAA 3C98A 1KJYA 3FCEA 4CCAA 2IYYA 5HUQA 2VK8A 5J43A 4XSHA 4WW0A 1OWNA 1UMDA 1W75A 3L0PA 3HYCA 3EVNA 3RKSA 4PLCA 5SZKB 2H31A 4NE9A 3MSXA 1PJRA 3WYBA 2HK6A 5A4IS 3GLGB 3BGIA 3KQMA 3IDOA 2IVZA 4ND1A 1JEAA 3R6DA 4P5PA 1IN5A 1J21A 2P75A 3QWFA 1Z5VA 4HDMA 3EXFB 4MULA 3T4EA 3HP7A 4FFBB 3U1TA 1DJOA 2YV2A 1T6NA 1IIRA 3CA8A 1NJ8A 2UVDA 2BZ0A 2C9CA 3O0TA 4UU7A 4AXXA 1YE3A 5JYEA 3RUHA 4AMBA 1RQPA 4L0CA 3ZI7A 4B48A 1OCEA 2JCSA 4RZSA 2X0DA 2G1UA 5JS8A 1YFKA 2I1VB 2IYTA 3ISVA 4K6FA 2AJ8A 3SC4A 3H1EA 1DKNA 1SKYE 1VHTA 3PQDA 4JP3A 3DZDA 4UVIA 2W9XA 4NV3A 1TJPB 4X66B 4CCYB 2B20A 2ZSUA 1R6AA 1YZYA 2OPBA 3BMXA 4ZCQA 1EUZA 2QQ0A 3L4BA 2AN4A 1GKIA 4R0VA 4QVKA 4QFDA 5IZ4A 1T6YA 1GWNA 4IFEA 3U60B 1EUQA 2HJVA 3K31A 3I9LA 2BGMA 1Z6TA 3QVWA 1LJ8A 4G26A 5JD3A 3LUFA 2G9QA 1W8IA 1FSSA 1O2DA 3LUPA 4EARA 2FKNA 5A05A 3PDIB 2WQ6A 4K3UA 2M1XA 1BXZA 2EWVA 1PNVA 1F1JA 2OVBA 3ZHUA 4DANA 1TK2A 4TOIA 4XGNA 1S8AA 4YACA 4FYMA 3B5IA 2GD0A 5FWAA 4YRSA 1CDOA 4B3MB 2ZREA 4QL3A 2NU8A 3ZG6A 4EGCB 3BTOA 1PVDA 1K7XB 3A3NA 3NOVA 4XUCA 4TZ6A 1P4AA 1TYZA 4FIDA 5JC8A 4F46A 1VFPA 1AZSC 3IIJA 2AMLA 3OLVA 1ZESA 4NYMQ 3T3MB 3ZHOA 1DAFA 3O38A 4FS3A 1WW2A 3LT5A 3WE7A 4N8EA 4Y9SA 2OCYC 1M2EA 5CX4A 2VK4A 1ZINA 3YASA 3D6VA 4UHJA 4OG2A 1E59A 4CKBB 5FOXA 4L5YA 4DT1A 3FBTA 3TKAA 1U3UA 4XEUA 5J3JA 1CBUA 4ZRNA 2H0RA 4OHZA 3ISTA 3V4PB 5K5EA 1QGOA 4LC0A 3BWVA 4EG0A 2POQX 3BICA 4BLWA 3AOGA 1AKUA 4MVJA 1XP8A 2H5JA 4I36A 1PR0A 1DC3A 4CV2A 1N5OX 1RYBA 3ET4A 4RXMA 3AILA 4C2UA 2EDCA 2WJWA 5JNRA 1IBKB 4JI1B 4OQNA 4OI1A 4NZZA 4YP5A 5J63A 1JYSA 1BEUB 2B8JA 4NZ9A 1N3LA 3DOOA 4O1MA 2IZ0A 3CEAA 3OEHD 1B2RA 1GRVA 1JSCA 4FMBB 4RCZA 5CTAA 5EWMB 5TARA 4EA7A 3CH4B 2IPXA 1QX4A 4OQMA 2RI6A 3A4TA 3RVOA 4Y7CA 4LJAA 2VHUA 3D3WB 5JATA 1PZGA 1I1HA 1RHJA 1ITZA 5EIEA 2O2SA 3KHSA 4COKA 3KKLA 1U7OA 1N7HA 3UMCA 4EM6A 4JODA 5KYUA 2OZLA 1O97D 1SHTX 3H7IA 4NABA 1D1QA 1UKAA 2VJQA 3IP5A 3F67A 1HMYA 1HE2A 1RJ9A 2LDBA 6LDHA 3W6ZA 4EECA 2DU8A 1V5FA 1CJMA 1IVYA 3HKDB 4MVJP 3T5DA 3LW7A 2ID4A 2O3RA 3NHRA 3DDCA 3O8QB 6ABPA 3RTAA 2C8VA 3WAKA 3UBTA 1GZDA 4UNQA 4DR2B 3MAJA 5I3ZA 2ZZKA 2FMTA 2NG1A 2Q2WA 1MN6A 3BZUA 1U8FO 4Y1RA 4H3KB 1K3TA 3BD9A 3GGJA 4R2IA 3BGSA 3LC1O 5ERGB 3GJ8A 4MWOA 8MHTA 2FN9A 5DNEA 1NW5A 3U3OA 1TUIA 3ESXA 3OTQA 1T2NA 2GKSA 1GA4A 5JDIC 1E4EB 4B3SB 4J43A 1UT5A 3H5NA 1EA7A 1NJGA 2ORYA 2J9XB 3KZMA 3QVUA 4EKDA 2PJDA 1T1RA 3I28A 1XD2A 3PNVA 5CH3A 4H6VA 1TX4B 2CFTA 3FTNA 2W93A 1E3EA 2PRZA 4MV8A 1JIJA 3NJRA 4DV4B 2QRUA 3FKSA 1T2DA 4KTVE 5KDLA 2MYPA 2QN9A 3ZD6A 6REQA 2BLNA 2G70A 3AXTA 3BDAA 1NFRA 4PZDA 3CB2A 2BMAA 1ZQ1A 4XDZA 3HEBA 2ATVA 2ZULA 5HMLA 1N8SA 4WNAB 3L8CA 3VH1A 4DLLA 5JADA 3BTSA 5EN4A 3KCQA 4C5CA 1Z56C 1Y4ZA 1XLTC 1K27A 3AH8A 5A1JA 1SOMA 3OIWA 2OYSA 4IJ5A 4F91B 1DRUA 4D97A 1QVVA 4HYEA 4A03A 5I7EA 2ZJ2A 3PC4A 4ZVVA 2E4WA 4ND3A 4O3MA 4IIVA 4Q19A 2ZTLA 4KPEC 3ANLA 1NR5A 3K0CA 3CMCO 4HX5A 2CHUA 3FMIA 1Z8DA 1JSZA 2JBHA 4HEHA 3GFTA 5E9QA 2HDWA 3PKZA 1XCOA 3TR0A 4X1IA 3GD7A 4Z3KA 3T5MA 1JH8A 1EI9A 2PLWA 4L4XA 4RQAA 4CYMA 1XLVA 3AU9A 1X80B 1SVUA 3K0AB 4N7BA 4TWJA 2PU7A 5I4IA 4QXAA 3RFCA 1UK6A 1NYLA 5DM70 1VJ1A 3ML1A 4PQEA 1AUXA 3C7CB 3QOXA 3TW4A 3P9CA 5JNWA 1VHDA 1WUYA 2NUAA 5BVHA 4GKJB 4BNIA 1R66A 3WYFA 2HRCA 1EK1A 1YR1A 4Q34A 1RXSA 1V37A 2MDTA 2P3LA 3GH1A 4MJ7A 4BMPB 2RHBA 3VOTA 3T9CA 3R9WA 2RAVA 4OHCA 3KM0A 1SD5A 2YV1A 1A1SA 1FSGA 3AUYA 3E9DA 3MT7A 5AKIA 4YRJA 5JNTA 3KV3O 3G23A 1XPJA 2HSJA 4BEJA 4EA6A 2YTZA 5DHUA 2V9ZA 3IPLA 4RHTA 4UTVA 1RACA 2IA5A 2NVUB 3GEGA 4HNQA 4D02A 5JH7A 3BGVA 2D3WA 2LIVA 4KXNA 1E6WA 3TZEA 3VR4A 5AW5A 2ZBUA 3GFGA 1GIAA 1P60A 2Q7XA 3RJTA 1JBEA 3RWMB 4DPKA 1UJ5A 3ZW8A 3FTDA 5KYWA 3O3NB 1TJ5A 4DV2B 2QNRA 3HXOA 3MG9A 4ID9A 1LRKA 3BQ9A 4XI9A 4DWJA 1WB9A 2ZSHA 3DGFC 4M98A 3IAEA 4JBGA 5TS2A 5AD1A 3RAEC 1H66A 2ZI6A 1XNQB 5FOVA 3TQTA 5HE9A 1SA0B 1T5OA 2R79A 3KLOA 1KWGA 1KPGA 1K0UA 4BASA 2PR2A 1K6IA 4J29A 2ZTHA 3ZD7A 1WTCA 1AQLA 4EOGA 1U8CB 4AB1A 3IOYA 4MUMA 3CBGA 5GGYA 2W70A 1RLIA 1KEWA 4U5QA 3VZQA 4CVNA 4DCOA 1QG6A 3T9DA 4DCVA 2FU5C 5TXGA 5JFGA 3AJ8A 1JJVA 4OLHA 4YP0A 1C0KA 1WU8A 4KXVA 5HFNA 1D6NA 1E9VA 4BJ1A 1P0MA 1VRVA 2J0UB 5EJ8A 3HXKA 3TAHA 4PU0A 4BNVA 1QCDA 1VA5A 1XDDA 2DR0A 3IP8A 3IT2A 5EC8A 2XIJA 3U39A 4O2AF 1GZ3A 3JQPA 2QVCA 1BZYA 4BJ3A 3QOYA 1PV2A 4F9EA 5IUKC 3CEHA 3O2SB 2FPUA 1R18A 1ZGGA 2HTFA 2V9PA 1Y3IA 3COSA 3GJ4A 3OZTA 4FFRA 3RS4A 1G19A 1WM1A 2O0LA 1JE1A 3TSYA 2IYNA 3H83A 1XK7A 3JQBA 3LUHA 3T7JA 3NBZC 2VYVA 4QYXA 3WQSB 1XR3A 1V9CA 1PNOA 3DWGA 1S2GA 5SY9A 2UZ1A 3QQ5A 3VDQA 2FPWA 4IIJF 4Z0PA 3BE6A 4C2AA 1QHGA 1OH7A 5ILOA 1ZU5A 3A4MA 2Q3EA 5CT4A 5DHRA 1FE8A 4RWZA 1QKJA 1YO6A 2WU8A 2YXPX 3IVCA 5BNFA 3ZE7A 4ENPA 3KT3A 3TUZC 1EUCB 3FE2A 1KDZA 4ARCA 1WCV1 1BE6A 2DCMA 3ASZA 5AO9A 4DR3B 2YS7A 1VGQA 2QTWB 2PH5A 3OP4A 4TV9F 5C5IA 3K0FB 3N2KB 3NIGB 1KZ6A 2CXPA 4PO1A 1HLGA 2FN3A 5D3ZA 4U6SA 2X2OA 2MSLA 3IQFA 5DU2A 3W7AA 3GH3A 1E2MA 4PFQA 3KT6A 4F9FA 1PVOA 3RUAA 1FRZA 2PXCA 3TSZA 4N03A 3WOHA 1WCIA 2OBNA 4Q5IA 3WFJA 4XJXA 1QLHA 3UHFA 4JC5A 2IS1A 1RM5A 1XZNA 5J2UB 2J59A 1NVVR 1MVNA 1X9IA 2H7YA 4H77A 4GKAA 4IKEA 2VBGA 3PFHA 5DW0A 3EPHA 5HKKA 4BCDA 2H7VA 1G4HA 3F5FA 4E12A 3Q8LA 3VPBA 1IHOA 3WYGA 1UK8A 1RAHA 4XPIA 5AUNB 1HRKA 1LPNA 1GSOA 3ZVLA 5KWJA 4HFJA 1NJSA 4LGYA 1XZIA 2H7CA 5D2CA 3D59A 1U7WA 5A3QA 5THQA 1UPCA 2DWUA 3TM4A 3A06A 3Q5EA 4H7JA 5KKNB 3MOGA 1AS3A 4LSWA 1NQ5A 1Z0FA 3H8JA 3IP1A 5G1NA 3ANTA 1RLUA 5KC8A 2V3VA 2F00A 1CQZA 2ZJOA 2OWDA 3BSFA 4KQ6A 1BW9A 3MMNA 4N76A 2VHWA 4HYYA 4PRYA 2I8AA 1J1ZA 3VOSA 1ZH6A 2TMKA 4RH0A 1XD9A 3HN6A 2JFWA 5LDGA 1IEVA 1HDGO 4IGKA 4AK9A 3ROKA 3KDSE 2QP4A 3L4SO 5CB4F 2FWRA 2QAGA 4PE5B 3V7WA 4DV5B 3F9RA 2B25A 1Z7EA 2Y2VA 2FQYA 1FDIA 4NBTA 5K03A 1YB7A 1OLUA 4MDYA 1H2YA 1VCIA 4LX8A 1DX6A 4YJ2B 2W0SA 1D5WA 3GFBA 2QRVA 2OFFA 3TRIA 1Y1QA 2V4UA 4J2HA 5EIBD 5EWLB 1JI0A 2FP3A 1ZUWA 2EV9A 5LZ7A 4DOMA 3ZLJA 2P62A 2R9VA 5F51A 1I1QB 1NF9A 4TVBA 1L9KA 3WL6A 3QOFA 2ZJYA 3ADDA 4JX9A 2W6MA 3GQBB 3HJCA 4XRGA 1XC7A 3V1MA 1LPAB 4KK3A 3JYHA 4YT2A 1OAOA 1G2PA 4QRHA 2PUBA 3UCXA 1QIEA 2EJWA 2B98A 2PKQO 4UUBA 5B30A 1S9HA 5BY2A 2LP4Y 2KBFA 4MV6A 1U0BB 2D62A 3VKFA 2KX7A 3E3AA 2J4FA 2OY0A 3VJMA 1A2KC 1U4NA 3AUFA 4KI0A 3EXHA 3UV7A 4DLPA 2JNWA 5HNKA 4REQA 3ICWA 4CLXA 3KWLA 3KJQA 4YO7A 3GDFA 1CDZA 4MP3A 2C97A 2FFQA 3ND8A 4KUGA 4D0SA 4WXMA 4EATA 2X86A 4OAPA 1XLTA 1NYRA 3KBBA 4W1QA 5EE1A 1UKYA 4ALMA 2IYPA 3A9RA 4ETIA 4JB3A 2W7TA 5CLHA 1E4YA 3JTMA 2EFCB 1Z4JA 2FPOA 2WQ7A 4HVAA 3OQ1A 4ALKA 2BEWB 3KJFA 2X4DA 2XUHA 4JJ4A 4DA4A 2ZJBA 1UPAA 4FEYA 4MB6A 3VAAA 2HUPA 2YVQA 3PFNA 4NAVA 3GUZA 4YROA 2GEBA 3FLEA 5CAEA 2JC3A 5ELLA 3RH0A 4J3FA 3QXSA 3CSDA 2VK2A 2A57A 1XHFA 1J24A 1DC8A 2EP7A 2Q5FA 3QXXA 2R8RA 2R8YA 1HO3A 4HY3A 3EGWA 4MTCA 2RONA 1DKQA 1DQNA 2FPGB 2I4IA 2W8BA 1BROA 1EGQA 2CMFA 4BP1A 1MJGA 2KWIA 2P11A 3LUCA 5BN3B 1R4NA 1U1GA 2CNNA 1WPXA 3H5WA 3JS5A 4JC8A 5BWLA 4XQEA 3P27A 1VSTA 3VTAA 2KQUA 4JLUA 4UM8B 5BSWA 3F3KA 3I64A 3CWZA 5I9TA 2BYTA 4JD5A 5DTEA 4XVRA 5FPQA 5JQWA 2Z3VA 3GEHA 4V02A 3HCWA 2W6PA 3K0SA 2YZ2A 3OPQA 2GESA 1ZOLA 5BVHB 2I2CA 3FNRA 7YASA 4LJRA 1WZ2A 4GGMX 1SKYB 3PX3A 1A4IA 4HAXA 1JG3A 4WN9A 3IBYA 3KSUA 3PWKA 3IODA 3R09A 3LKBA 3TCKA 1QF7A 1D5CA 2KPOA 3A4LA 4W1RA 1PR2A 4PEVA 2HLHA 5AXDA 3UN1A 2QM7A 1S2NA 2I2XB 4JL8A 2IBSA 3F5MA 4W6QA 3MWEB 2HJGA 3P45A 4RIGA 2WUGA 3SYNA 3AR3A 4W82A 5ICCA 4Y6QA 4DXAA 2GZ1A 4FMCB 4DW8A 1PQYA 4A5OA 4AICA 2AOTA 2SCUB 2ZRBA 1W76A 1XQWA 3AY6A 1KIFA 3ZE6A 221PA 4XPZA 4R40A 2IHJA 1NNLA 2IUEA 2Y0PA 2A7QA 4FOPA 5CURA 2GO1A 2NZUG 4G41A 2GLUA 1KJJA 5DRYA 4FONA 2ORVA 1XAGA 1YR8A 4PAWA 1K7SN 2QRKA 4YT5A 2EQBA 1M34B 4UUOA 5E9AA 3B12A 1BFDA 3CUSA 3E61A 1FUEA 2D5LA 3DEHA 2H51A 3B1KA 3HVIA 3P9KA 1R0YA 4N3CA 3B1XA 4QLAA 4XRRA 3WGTA 3ZV6A 1JVBA 3PDWA 3HI6A 2YOHA 1PD0A 4F1KA 2A5LA 4POOA 2QBYB 4BX9A 1U4SA 1E3TA 1SWVA 1YJBA 4PYIA 4ZOCA 4CQLB 2C99A 2I6XA 1C3OA 1OLXB 3AIOA 3KX2A 4Y2VA 3F3YA 1BXGA 2REQB 3KKKA 4BNJA 2C54A 4M83A 2ZUCA 2HMAA 3TR6A 4G23A 2L69A 3OZDA 4I5DA 5TSDA 4BLOA 1C14A 2PGLA 3CTPA 3B3FA 1I6WA 2XUPA 3KUKA 3CG4A 4XWYA 4BBJA 4KYTA 2XHZA 4IUDS 3F6PA 5FOSA 5HF9A 4CIBA 1Z4LA 1TMOA 1JDNA 1B3RA 1SGWA 4HNTA 5AVTA 3S2ZA 1J8VA 3BX1A 3OCCA 4JQSA 2A86A 5J40A 3TE6A 3TZKA 4JJ8A 1B6GA 5A5GA 2P4EA 2YWHA 1JEYB 2W6QA 2ZM5A 1ZOIA 4UM7A 3HYTA 2P6PA 1MKYA 1TE2A 4K9LA 5ALKA 1MZPA 1TU3A 3RT9A 4YYEA 4RA6B 4KQ9A 1NSYA 1F0KA 4UOQA 1XXLA 2H0QA 4EBBA 2FUEA 3IP7A 2A1UA 2VIIA 2R1VB 5JCOA 1BDMA 2FY8A 3D0RA 4HAZA 4CF7A 4MS4A 2WHPB 4OK3A 3JZDA 2CZCA 3IUSA 4GKVA 3T4UA 1TXGA 5JMTA 3BFVA 3NBKA 1IN4A 4G5HA 4KIJA 3AINA 3GGPA 3R7WB 1NTRA 4NK4A 1XDWA 3SIWA 1A9TA 3CCBA 3HYSA 2EFYA 4KR2A 4BNHA 1R64A 3PXBA 1J5EB 1WS6A 2F3PA 2XQJA 1B6SA 3T1TA 3CN9A 3ZGOA 1JHMA 1MA3A 1KY2A 4KQWA 3JYNA 2DEUA 4HEA1 2MYNA 3DOEA 4TLBA 4D79A 1KY5A 2FWJA 1UM8A 3NC0C 2AOWA 1QF6A 4C4PA 2CL7X 1ZEMA 5FA8A 4GR4A 1C7FA 2JA1A 1C1DB 2Q9UA 4UUAA 4PLPA 3IYLW 4O8CA 1KERA 1C81A 1U3DA 3UPTA 2CL5A 4DIBA 6Q21A 1GSIA 4F6LA 5AYVA 4LK2A 4EKNB 3AI3A 4U0KA 3HK2A 2JA2A 2R2AA 3DUFA 4B8ZA 2YFKA 3NIWA 1L7OA 2UXBB 1TRHA 4EMUA 2YJGA 4P7JA 1VYVA 2WKWA 3VHRA 4G1BA 5ICGA 5FNZA 3X1DA 1HYEA 3PXAA 4WKNA 4P82A 2W22A 1P74A 1BKDR 3FPLA 1DI0A 2AG8A 2O3JA 4H7FA 4NQZA 4P3NA 5TS3A 3UPUA 4ZANA 4BMSA 1MX9A 4IY1A 4PYRA 5JLAA 3ZCRA 5DBHX 3EB9A 5TMDA 2GYYA 2GBLC 3E27A 3FDJA 4LNHA 4DIFA 3WR5A 3QF4B 3EC2A 5CDYA 1X7YA 1DZIA 3R9IA 3IUYA 3BE8A 1T0BA 3DUFB 1WBBA 4MYTA 3O1HB 2PVSA 3OCVA 4UZFA 2YDXA 4I14A 4O4HB 2PK3A 1T6ZA 3GJRA 3T34A 1G20B 1BH6A 4N82A 2XWJI 4A6XA 1DIRA 4EHIA 1KQGA 2H1RA 1NOIA 2A7XA 2L2QA 4R05A 3PCTA 4UJ3A 5CIYA 4BUZA 1Z5ZA 1UJNA 1VIAA 3FYUA 4WVFA 4J7CA 1BHQ1 1HUQA 4URUR 2Z3ZA 4EUNA 1MFZA 4PVDA 3TL2A 2I3ZA 1YA6A 1KZ1A 2QTAA 4B79A 5K8LA 3OAAD 3TCNA 1JSLA 3N8IA 1W49A 1GVHA 1CR2A 2XMDA 1UPTA 3AONB 4F2WA 4LF5B 1LCIA 4B6FA 1N6OA 2QN3A 3IR7A 3KB6A 4KXWA 5LDHA 5JSUA 4DLVA 2CLFB 3AI7A 5CDFA 4KFRA 4X93A 1T9KA 2ZJ0A 3A4YA 4W7IA 4TLMB 1CEXA 2RJ3A 5K0CA 1KK0A 3OZBA 4QT0A 3LWBA 1BMFD 1HLPA 2NSJA 2XRZA 3CVXA 4K26A 3IQHX 3MWKA 2H4XA 4QPNA 3LCJA 1EUDB 1H6BA 1XDSA 4K2AA 1YHNA 1MAHA 2VRWA 3J7AC 1L7RA 4Z49A 3FOWA 3I12A 1G5RA 2F3QA 3LX4A 2JEYA 4QRDA 1JQAA 1FXWA 2HRBA 5FO0A 4ASUA 4BFVA 3OM8A 1JL3A 2NTEA 4M1MA 5EIHA 4D7AA 1F0NA 4GICA 4BLVA 1FA9A 1Z5WA 3DB1A 3W4KA 4BQSA 2O19A 3G49A 2EQAA 3QMVA 3NHYA 4NATA 5CW1A 4OI2A 3LUAA 1BS2A 1GDTA 1LNSA 3M7IA 4X1IB 5EIWA 4KHPB 5B58T 1FFCA 2CYCA 1O03A 4J4BA 3PFBA 3ETHA 1T36B 2AUMA 2QE6A 1N5MA 1J22A 3ZLVA 4X20A 4R8LA 1EFPB 4KZKA 4MK4A 3CFYA 4FZ3A 1GAJA 1I3LA 1L1RA 3BG5A 5KTNA 1W36B 1UOPA 1ZCJA 4RVFA 3VPCA 1Q19A 2I22A 2JK0A 3C8UA 5AH0A 4GF5A 3C5CA 1KQ3A 2VRNA 3GFFA 3P52A 5IAGA 5LC1A 5A4MS 2HMTA 5DM2A 4JCCA 2OO7A 1YBFA 3FGNA 3AERB 1RXYA 1KSHA 1OV4A 1TVKA 3AETA 4JUFA 2QD1A 2PGJA 3TKYA 3UXHA 5A06A 3D02A 1BXGB 3MM4A 1I94B 1K86A 1NV8A 2FG6C 4RY0A 2HF7A 3ILVA 1FMFA 4IKPA 1Z6XA 3OH8A 3MJ4A 2C5SA 3R9XB 4EG1A 3S0JA 2P9BA 3WMWA 2FPLA 1KEZA 2VNIA 3CO0S 3DMHA 3HSSA 4IHJF 4XR9A 4CKCA 4RTPA 2I4LA 1ECJA 3O3CA 3ERCA 2LVBA 2IXGA 5JEDA 4X92A 1FF9A 1FLNA 2KW5A 5DNYB 4OQDA 3COJA 2JIQA 1J0AA 3CCCA 1M2VA 1K06A 3L02A 4YRIA 4LV6A 3GDWA 3OJLA 4Q37A 1QC5B 1W0KD 3ZH2A 5KHOC 1ZRSA 3ZU4A 1X77A 3C4VA 4FWIB 5JXGA 3WGNA 1XQVA 3ON5A 1PD1A 1UBEA 2GD6A 1G8SA 3HCEA 3RBVA 3IMEA 1K3FA 2BTQB 2C9ZA 3K1AB 4JYPA 4HSGA 4RF4A 3U7RA 5FFMA 3CWCA 1M54A 3U2QA 2G5TA 1ZIXA 3FIUA 3S81A 1EVYA 3DDNA 3NEJA 4HR7A 2B2CA 2W2OA 3QGMA 3REQB 4GM4A 1USUA 3KOOA 3VI4B 3B2NA 3NG1A 1EYZA 1YZHA 4E08A 4HMPA 1K8XB 1FFXB 3STYA 3TE7A 3MTQA 1HT3A 3GZNA 1TT5A 2EERA 4FNOA 2C57A 5AI0A 2O8CA 3MUNA 3NWPA 4LXGA 4DMFA 1TIKA 4MUFA 3JRWA 3RSCA 4HK4A 4LJYA 3EXIB 4GOMD 4BFYA 5ERXA 4MJ3A 1S3GA 2Q6TA 2XB9A 2TS1A 5FPPA 3U3ZA 2B4KA 4BNZA 1OT3A 3D4LA 4X3PA 1ATIA 3CZRA 3NHFA 2EWMA 4EHLA 1UKEA 3MWLA 1JS1X 1C3XA 1KP2A 4X44A 2H5IA 4YASA 3ZN2A 4ZTZB 2XGGA 3UMJA 4RELA 3FFAA 2I3AA 2PQMA 3H5LA 3GEBA 4V0QA 4O4IA 4Q3KA 2B30A 3ZDEA 3HCFA 4PYNA 1AQJA 4OB7A 2BTEA 5EHGA 4ON9A 3V8PA 4K6CA 4AUNA 4H35A 1QIJA 1RLMA 3W3AA 3TN7A 3RFUA 1ZCBA 2C1EA 4IS2A 2Q1SA 1YFJA 4RFSA 2Q6IA 4D99A 3C0KA 1E0AA 2NO1A 2W8BB 2WAAA 2J85A 3ASVA 3C3MA 5DYNA 1KVRA 1Y5MA 4ERXA 5TQ0A 4JUBA 4RQUA 3Q6MA 3LCMA 2BI8A 4HPWA 4JIMA 4R83A 3VPFA 1UXHA 1UM9B 4E2XA 4X64B 1JMKC 1XWIA 4N6GA 1OW3B 1D2EA 1PV1A 4GZ3A 5JO9A 1OWOA 5HQ3B 2O05A 2I78A 3KPVA 3OAAA 2BM0A 4GPIB 3UWDA 1R8XA 1SVNA 1NVDA 3OTWA 2GCOB 3EGXA 1FYDA 1Q7GA 1OKKD 1QF9A 3F4LA 3PQCA 2YBEA 4V1CA 3QKWA 1N1DA 3UJPA 4MWBA 3EGOA 2AA3A 1LBIA 1XRRA 5IP5A 3QWAA 4NP6A 3BF8A 4D9NA 3SQXA 2QL7A 1RKQA 2PLRA 2XQFA 4UNRA 1M10A 4MRSA 4MIYA 1U9IC 3TIVA 4HRVA 4LVNA 2WMOB 1NBMD 4O8ZA 2DLCX 4DG5A 3RYHA 2E82A 1OIXA 1UODA 1H1DA 3PC8C 2DHQA 8OHMA 5FL3A 1YS1X 5H9WA 3DZHA 4W4TA 2P7HA 1GCUA 3GVPA 1ZJ6A 4GVXA 4C7OB 3RRZA 5IJ0A 4US0R 2JG3A 2MINA 4M1ZA 2EBWA 4WGFA 1P2BA 4H0FA 4J0JA 2X3UA 4Q48A 1TUBA 1HK7A 2XMBA 2X7HA 2OXTA 2IFTA 1KMNA 5D5PA 4JELA 1SVLA 3F6RA 4BO4A 5JRDS 2HI0A 4G0XA 1OHHD 1FNCA 1Y8RB 1UL1X 3D64A 3GT3A 3L1JA 5IJXA 3SR3A 5IZCC 5KQGA 2GFHA 4WL0A 3U4HA 4YLYA 4DNFA 3U3RA 5KQPA 5FI3A 5EJ6A 4WZ6A 3LFTA 4WY2A 1UBHS 3O21A 2XX3A 3G82C 1XG5A 2OLJA 3GA5A 3HJGA 4WK2B 3B2EA 1EK2A 2F48A 4J8PA 5HBRA 2CVFA 3DMGA 2VDRB 4M87A 2ZXEA 2GZ3A 3V97A 3IELA 3DXXA 3QLUC 3QTTA 3EF0A 5A9SA 2G76A 3FI0A 1ZX1A 2X5KO 1Y9DA 1OBCA 3NYIA 3QFFA 3M3DA 2WFLB 4L27A 3TFQA 1J56A 2HGZA 1U0EA 2G4VA 2Z8YM 5HOQA 3ONDA 4M8LA 3TZHA 2OG2A 1I13A 1SCBA 4D4JA 4EMBA 3VNUA 3RUPA 1SBNE 5CGZA 3IERA 4N0DA 3FWZA 2OCGA 3K0BA 4DAEA 1UPBA 1H2HA 3ADKA 3CMMA 3MRVA 2QTVB 3BXHA 3RWOA 1PDVA 4Q1FA 4UKDA 1ESCA 4D4GA 1P1HA 1UANA 2X8JB 2GBCA 2ZE8A 3F71A 4QBFA 4X71A 4DA6A 2CFSA 2VZ0A 5K7SA 5ELXA 3OHSX 1YAJA 4L8VA 2JBAA 1B74A 4OHUA 2ANCA 3ZK8A 4DDHA 2FSVA 4U2GA 4UUQA 1R50A 3OQBA 4MAFA 5JSYA 1RYFA 5C8YF 5K4GA 3VAZA 2QSYA 3EXG2 3L46A 4BMDA 1DAKA 2VFAA 4MWGA 1YFZA 4LRQA 1TO6A 1ECFA 1UMBA 3TW6A 3O9MA 3KYCA 1WPGA 2OR3A 2HJWA 2WIDA 3EGVA 3JAMA 1ZM3A 2ODNA 2EJTA 1VIVA 1FFDA 1E96A 2ZWIA 1L5KA 1H1LB 1EEHA 2A78A 3BORA 4JX8A 5CT6A 1OX6A 4ACBA 4AG6A 2DM6A 4UOZA 3T7TA 5JU6A 3TRDA 5J1SB 4N7RA 4RD6A 3VX3A 1GPYA 4AI6A 4IHQA 1GZ7A 4FLEA 1D4ZA 3FPCA 2QXUA 4LYFA 2VR1A 5HQTA 2P0YA 3DDHA 2M6KA 4ZK2A 4KWTA 3WWCA 1G2IA 5K2MA 5K0BA 5KNBH 4CCSA 2VXBA 4UTOA 3DAYA 3V3TA 4L7VA 4AN4A 5A4FS 2HIHA 3I1YA 1DZ3A 2JPDA 2CNLA 4MA5A 4XSGA 4RGYA 1T1SA 2J9FA 3NUZA 5DLQC 4QOHA 4QOSA 1RSZA 1DIGA 4YQZA 1ZJYA 2AZ4A 4ND8B 3RVSA 1XOIA 1GPWB 2HMYB 2FFAA 2Y05A 5A3JA 4UM5A 4M8IA 3U5TA 1RRPA 4LBVA 3DWFA 1GPNA 2VHQA 3KCNA 4OP2A 4QU0A 2JRCA 4BX8A 4LY6A 3NBQA 2P4UA 4RE6A 2NSHA 4UMVA 1RAFA 3IOBA 5K8UA 5CHYA 3P4YA 2BSXA 3WYNA 4CUJA 1Y5NA 2H1HA 3V2GA 5A3SA 1KTIA 3E7FA 1W0JD 3IE0A 1Z45A 3V34A 3H1AA 1RR6A 5CCEA 3MERA 1SPXA 1NFFA 2W83A 3JVDA 3KOZA 1U9IA 1RFGE 2APJA 2R84A 1CUBA 2FLWA 2GEJA 5JNUA 2PX0A 4BB6A 4HJXA 1U0OC 3Q6NA 4K8OA 3QVJA 3TD6A 2AYZA 4M0MA 4BFWA 2IDKA 3WLMA 3VR3A 3WLQA 4W5OA 1W5BA 4HP8A 4EW2A 5FOTA 4MUNA 4BLQA 4OBEA 3IQDB 1M1NB 4H6PA 2IHNA 4S24A 3ZUGA 4ZYWA 1E2KA 1VPTA 2MHCA 2NO5A 4AL4A 4DS3A 3WK5A 1J2JA 1ZQ9A 2VQ6A 5IUNC 1ISRA 1OWLA 4CT5A 1HZJA 2YVLA 4DZTA 4EW3A 1XQYA 1ENZA 2FV8A 1IDN1 1ORDA 2UZIR 3KUUA 4PSDA 3LYLA 4CEHA 1A04A 2ECQA 4G0YA 3U5ZB 3QA9A 3LPCA 1OLXA 3AUKA 3MXOA 4U3JA 2PX2A 3U49A 1VE5A 4NSNA 2AFIE