3OQ1A

Crystal structure of 11beta-hydroxysteroid dehydrogenase-1 (11b-hsd1) in complex with diarylsulfone inhibitor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
261
structure length
261
Chain Sequence
QPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title The synthesis and SAR of novel diarylsulfone 11beta-HSD1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 83
structure length 261
sequence length 261
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2010-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3oq1A00
4DMLA 3OJLA 4B79A 2BLLA 1UDCA 2C5AA 1CQIA 2O48X 1DC4A 3EAGA 1KVSA 1DJNA 3E82A 4BKRA 1I3KA 4MVJE 5DNAA 2UAGA 4XYGA 2PGJA 4RPGA 1JN0A 5L7TA 4CUZA 1H94A 2NNLD 2AQIA 4XYMA 3L4BC 3PQDA 4J7UA 4CM4B 1S6YA 4E2XA 3NTRA 2Y1FA 2Q4BA 3AUAA 1ZZEA 3KHUA 4RDHA 1OI7A 4BS9A 4PLPA 3B6ZA 4G2NA 5C37A 1LA2A 1UDAA 5A03A 2RBEA 4IS3A 9LDTA 4LN1A 5KNLA 4BGIA 5BSFA 2Y1DA 4QUKA 5L95A 4AVYA 2EXXA 3A14A 2QYTA 1R0SA 4CMHA 4R54A 1GPJA 1O94A 3GR6A 2FN7A 3K8ZA 1HDXA 3CIFA 3PHJA 3PWKA 4RPLA 4J4TA 4CMEA 1ISGA 1BG6A 5JDCC 3TZCA 4YR9A 3OJEA 2ILTA 1MLDA 4BKQA 1E1LA 1YBMA 5B1YA 3I4FA 2Y0DA 4UVHA 3VZRA 1F8FA 1OOEA 1LU9A 4IZHA 5FYDA 3GN2A 1E3WA 4XYLA 4ID9A 3GMDA 3HN7A 4B3IA 1SOVA 5KVQA 4WKGA 2Q1UA 3VH1A 4KQXA 4WGGA 5G0VA 1PL8A 3DBRA 1ML3A 3B1JA 1GDHA 3QA9A 5DCUA 4ZVVA 4BNNA 3UUWA 3B20A 3H5NA 3ZNQA 5LC1A 4BMNA 3FD8A 3RASA 4K28A 2VRCD 4CMAA 1HWYA 3DQPA 3QIVA 2GZ1A 3K92A 5DN9A 4DGSA 1EUZA 2D4AA 1ADCA 1FJHA 2VNSA 5A02A 4U5QA 1MP0A 2NU9A 3GHHA 3LZ6A 3W4IA 4GMFA 4TQGA 2Q99A 4I5EA 4BGUA 3HG7A 3JQ7A 5A1TA 1ZNQO 3QVSA 4BNYA 4CV0A 2ZATA 1U2GA 4XB2A 3PJGA 1PR9A 3PI7A 1RM5A 4E21A 1TT7A 1X0XA 3ZZNA 4BQPA 4YJHA 5IJZA 2G1UA 3OH8A 4PG8A 2QRKA 2BGLA 3DOOA 5TJ9A 2ZQZA 1T4DA 1ONNA 3DHYA 3H2ZA 3OF2A 1KY5A 1CQJA 4DTIA 4R69A 2P5YA 1LLUA 4BO0A 4EDFA 1ONPA 3IJRA 1V0JA 3QY9A 3FF4A 4A0SA 2HSDA 2VYND 4A5OA 4IINA 4GVXA 4Z0HO 2B35A 3MTJA 2EHDA 4NK4A 3S55A 3QHAA 4HNGA 4H7PA 4DVJA 3GZ4A 1TB4A 1ZK4A 1IYZA 2I6TA 4W9NC 4DWVA 2UDPA 3D3WB 3KRTA 2HK9A 4MVJF 4HV4A 4D0SA 2P2SA 2VN8A 4JBHA 1ZEMA 4MVJI 3H9JA 3PEFA 3GVIA 1QXSA 5CDUA 2W2LD 1QP8A 2QYSA 1PWXA 3I9NA 4M49A 3W4KA 5I7SA 2E6UX 3IKTA 1HDZA 5TLSA 4XEHA 2C5EA 1PS0A 3FNEA 4BO9A 4DBVO 3GQVA 1PL7A 2CNBA 2YHIA 1XU7A 1XA0A 2PFGA 3RROA 3AU9A 5JLAA 3HDHA 3ZNPA 1HDOA 3D0OA 1GYRA 2Q1TA 1ZUD1 3PGXA 4DUPA 2C59A 4FJ1A 4EJ0A 3F46A 1E6UA 1HTBA 4A26A 3LT1A 3UF0A 4PRKA 4ZU3A 4CQMD 2I3GA 3EYWA 4D3SA 3HB4X 3EMKA 1ISFA 3OFSA 5JO9A 2EEZA 3BA1A 4AJJA 1ZSYA 3G0OA 3WYCA 3ZV5A 4EUFA 4IZIA 4II2A 1M67A 3MWEB 3RFVA 4FGWA 1DEHA 2JCVA 2UYYA 3Q1LA 5T5QA 1PQUA 2C54A 3LC1O 3QP9A 5EQFA 1NXQA 3F9IA 3GOHA 1EBFA 3D7LA 2IXBA 3F5QA 3IJPA 3H65A 2CMDA 2JD2A 4WCFA 4IQ8A 1AXEA 1Y5MA 2BRUA 2D59A 3VZQA 3D64A 3ORFA 3F47A 4CLOA 5IXSA 1SNYA 4YDRA 3KZVA 3TF5A 4OMUA 3FBGA 4U8GA 2OP0A 6LDHA 4F45A 2J8ZA 3PGJA 1WW8A 3ZNOA 1EZ4A 5B12A 4E3ZA 1JAXA 4FDAA 4ILKA 2C82A 2DBVO 1X14A 4TZTA 3I6QA 4BO8A 1PJ4A 3PHLA 1BSVA 2I3AA 5U9CA 2VHWA 5GY7A 1TEHA 4Q3AA 2VZ8A 2ZTMA 4J43A 3SJUA 3RFXA 5JAQA 4YTEA 4KTVE 4NNJA 1AXGA 3RBXA 4E13A 5ILOA 1PU2A 3L77A 3RUAA 1ZH8A 2PZKA 4D45A 3WS7A 4IS2A 5F3RA 5GZ1A 1B0AA 3GEGA 3I9JA 1YS4A 1M66A 1FXSA 2HDHA 2CD9A 4BNZA 1N7HA 1KYQA 1Z75A 2F1KA 4K9DA 4L75A 4MVJA 3U3XA 3R6DA 3B70A 4CMGA 4PN3A 4Y8VA 3ZWCA 2BD0A 4YT8A 4Z0PA 3UN1A 1PIWA 1I36A 4ZN6A 4M8SA 3PRJA 4HWKA 2EWMA 1FDSA 4DLAA 5KJFA 2OO5A 2ZTUA 3QQPA 2C29D 1BW9A 1NAHA 4I9HA 4K6CA 4CM4A 2AEJA 2AQHA 1IZ9A 2ZK7A 4YRBA 2CZCA 4RF4A 1JWBB 4JQCA 1CEQA 4F46A 3EDMA 9LDBA 4YAEA 3UW3A 4FIZA 1DAOA 2NADA 1SZJG 1DIBA 2B83A 1ZXLA 3PJEA 4L73A 4JN6B 2EKLA 4LRSB 2IRWA 2VZ9A 4D43A 2Q1WA 2O3RA 4P4NA 5AOVA 4D41A 3CMMA 2G76A 1PZFA 2O3SA 2D3TA 3JD3A 1ENYA 3JQCA 4R16A 5DDIP 3DZKA 4QX6A 2ZB3A 2YJZA 1A7AA 3DOCA 4R1SA 3W6ZA 3X2FA 3ANNA 4J9VA 3VTFA 1VL8A 3PTZA 3PIIA 1NFRA 3DMTA 4CMEC 3P5SA 3AY7A 2FHSA 4DPLA 4PLGA 2VUSA 5TJHA 5KJEA 2A9FA 3VOSA 4HBGA 1OBFO 4ND1A 3AW9A 4NPCA 1PJSA 1YJ8A 4IDBA 5CFZA 2IDZA 1P74A 1I2CA 2ZB7A 1EE9A 1JA9A 1QMGA 4QEDA 1LEHA 1PR3A 3F3SA 4XIYA 4CM7A 4ALKA 1V9LA 1UXIA 4GWKA 4LMRA 3PK0A 3FNFA 1LC3A 4L4SA 3W8EA 4A73A 4AJPA 2EKPA 4IDAA 2OL4A 1LBEA 1ZK2A 1ADGA 3GG9A 1MXHA 4RCVA 1GL3A 2VYVD 5AXAA 2DLDA 3WGQA 3JD4A 3KYDA 3ZW8A 1GY8A 1NPTO 3OQBA 4XZ3A 1Y8QA 4YRDA 1LDGA 2P91A 4YRAA 5I9LA 5BNFA 5T57A 2VHYA 1DSSG 3ZN2A 3OJOA 5F5LA 2H6EA 3WG9A 2PZLA 4HNHA 1SOWA 5TT0A 1K2WA 1R12A 4WK6A 4GX1A 4XX0A 1DB3A 1L1FA 5ICMA 3JYPA 4R9SA 3M2PA 3SC6A 2HMVA 1U1IA 4DXHA 4F6LA 4K1LA 1UZNA 1KVTA 2OUIA 3DB2A 3RD5A 4BVAA 4Z3KA 4Q39A 5AXDA 3V5NA 2X86A 4RF2A 4L4XA 4MKXA 1T2CA 1G1AA 1YVEI 5DF1A 4E30A 4RPKA 2W2KB 5H82A 4YAKA 2BFAA 5JYEA 1DLJA 3QJ5A 1G6KA 1HYEA 3GFBA 3NT4A 4URFA 3JYOA 5LCXA 4DQXA 2AXQA 4B4VA 5CPBA 5I7EA 5KIAA 4NR0A 3PPIA 1NQAO 4A7PA 3DBHB 3I4CA 1X7GA 3X2EA 1B8VA 1C1XB 1K0UA 4BV9A 4FSHA 1HSOA 1CYDA 1DFHA 2VCYA 3E18A 4XCVA 5IZ4A 4FFMA 1SB8A 3AOEA 5DCYA 5TNXA 3HUDA 3QW2A 3KTDA 1GR0A 5KCZA 2VOEA 4Y6PA 3AI1A 3JYNA 1P33A 5DBGA 2XXBA 1IL0A 1Q0QA 3D5QA 4DMMA 4NJMA 3GVCA 2Q49A 4OGWA 3V2UA 1AUPA 1N1EA 3JSAA 1Y5RA 1WDMA 1J5PA 1N5DA 3WQQA 2HMUA 1KOLA 3OBBA 3Q6IA 1EEHA 1I10A 2VT2A 4FBGA 1ISIA 1H6AA 1V3UA 2ZKLA 2X0IA 5AVOA 3ROQA 4LGVA 3MJCA 3FRJA 2AE2A 2P5UA 4BB6A 1HE4A 1QSGA 3BTVA 4B7CA 5BSEA 2EP5A 3N58A 3O9ZA 3EK2A 3V2GA 4BGVA 4R4JA 1E3JA 4BGEA 4F6CA 4FFOA 2PLAA 1T2FA 2P4HX 1U3WA 1X1TA 4RVFA 2OZPA 2B36A 3BHIA 3UOGA 3LK7A 4KP7A 1GCOA 1VL0A 2GZ2A 2GZ3A 3QWBA 5BNIA 3RBZA 1IHXA 4NU5A 4YACA 5GZ3A 5JDIA 4N5NA 2IYPA 1E3LA 1JVSA 4DRYA 4BNJA 5BR7A 3MZ0A 4H3VA 3IIEA 1MX3A 2B0JA 1YRLA 3WNVA 4OKNA 4OQYA 3VPSA 1VM6A 4GPD1 1I8TA 4Y6SA 3WFJA 3I83A 1WDLA 1V3TA 4ONEA 1YQGA 4NBTA 3BMCB 5B4UA 1NYTA 5IN4A 2Q3EA 1VRWA 4WCFC 1P0FA 5IDWA 3MJTA 3Q11A 3RUHA 2UVDA 1E1MA 4EEXA 5A5FA 1NVGA 4LMPA 4J4BA 1F0YA 1O5IA 3OQ6A 3PFFA 4OIMA 4BKUA 2DU8A 1KC1A 4OXYA 2X5KO 1GUFA 1ADFA 1MG5A 2EW2A 4GX5A 4JLWA 2ZB8A 3PWSA 1VE9A 4BNFA 5CG1A 1EVZA 4CJXA 1BDBA 1MA0A 3OIFA 4FFPA 2NTVA 1WAMA 2JHFA 4C7KA 4E5MA 3WGZA 3IL2A 1MG0A 2GD1O 2V7PA 1WXDA 4ZJUA 3FR8A 2Y0CA 3FWZA 4XKJA 1KVRA 2PD3A 2VHXA 1W8DA 4IXWA 1GUYA 4YAGA 3KLPX 2D5CA 3AFNA 2DTEA 3K9QO 2E82A 3Q2IA 4BO7A 4BMSA 3BMQB 1E5LA 1GEGA 2B4TO 1HXHA 3LYLA 4J0FA 1SPXA 3RQSA 5JFOA 3W6UA 1T2EA 3JQ6A 5T6BA 3K5PA 2OGUA 1MFPA 3DZJA 2WYWA 4AJ1A 2BFOA 3U9LA 5DT9A 2I99A 3C7CB 3JQAB 3INTA 5HWSA 4WEOA 3INGA 2O50A 2C0CA 2AEFA 2ET6A 4UEKA 2C2XA 3HJAA 3GC6A 1U5CA 3ZCXA 1LUAA 2C07A 4AJNA 5KTKA 2EGHA 3PQEA 1E7MA 1E7YA 2HRBA 4R5MA 1HLDA 1SEPA 4FFLA 3WGTA 5L40A 3ZV3A 4UUOA 1PQPA 1KEWA 1DIAA 3EZLA 2Z95A 3V1YA 2J3IA 1EQ2A 1ID1A 4HFNA 1XR3A 5A5EA 2GN8A 4NFYA 3WGYA 4IBOA 4WE3A 4PZCA 2FR0A 3JQEA 1AE1A 3JD0A 3NAQA 1LRKA 3E1KA 3E5MA 3WTCA 3QSGA 3ANMA 1WZIA 3TZHA 2NUAA 2VWPA 4GSKA 1SCUA 5KKCA 5MGBA 1HDRA 3H8VA 1PGNA 4E33A 5T64A 1P77A 2QZ9A 2QIOA 4CQLA 4Y6RA 3GUYA 4N18A 1ZCJA 3IC5A 1ZVMA 3T7EA 4B4WA 1IB6A 2VWGA 3K30A 3WYBA 4IIVA 1EE2A 2H63A 3RUCA 2NLOA 5DBIA 1CIVA 3DMTC 2RAFA 2RH8A 1P1FA 1E7WA 2VT3A 4MVJH 1OC2A 2EJVA 2GCGA 4FGSA 3GGOA 3FR7A 4Z6KA 5L53A 5DOZA 4M1QA 2Q2WA 2G82A 1Y7TA 2OFPA 1RWBA 2Y93A 5KJ1A 3JQGB 1U8XX 4W82A 5H81A 1H9AA 3NDIA 1NQTA 2WDZA 3DZIA 5L7YA 5DCWA 2DTXA 1I33A 2X0RA 4W6ZA 1DIGA 1N9GA 3GUCA 1XLTA 4NH4A 1XWFA 4S3MA 4WJZA 1UP6A 3DXFA 3OJ0A 5TC4A 1R0KA 4NHEA 3TZ6A 1WDKA 1XGKA 3RC7A 5THQA 4PVDA 4CM6A 4D7AA 3TJRA 5JXWA 1H6BA 5BSGA 4GGOA 1BRMA 1C1DA 4XYBA 4ZA2A 4RLSA 5TQVA 1ZK1A 4E0BA 4CM1A 5CG2A 4XR4A 2CDBA 2BI7A 3EC7A 3KLMX 4LSWA 4WLEA 3IOYA 4TVOA 3G49A 3K73O 2NQTA 3NYWA 4YAIA 5I8ZA 2PTGA 2VRBA 3GG2A 4FOSA 2JAPA 4O1MA 2O3UA 4BNLA 3WBFA 3IP1A 4XGNA 1VKOA 4OSOA 2O7SA 4IUYA 3RBVA 3JQ8A 5F1PA 3TFQA 4A2CA 1I3MA 1ZMTA 3PJFA 1D7OA 1H2HA 3VPGA 1T26A 3GRPA 5FI3A 3JQ9A 2CVZA 2YV1A 1DAPA 1BHSA 4U0JA 4AJOA 4GGPA 1BXKA 3WWYA 2HMTA 1YDWA 5TT1A 1AHHA 3NTOA 3VKVA 2YHUA 1HRDA 4YXFA 5G4LA 2B4QA 1KEVA 1P1KA 3DHNA 3K6JA 1B8UA 3GY0A 3L6OO 3Q9NA 4KWIA 4IJUA 3C7AA 1B16A 3DAGA 5IDYA 1GYPA 4CMIA 2JCXA 4TRMA 3BYZA 2ZYAA 3NJ4A 1YO6A 1M76A 3PHHA 4JJGA 1RJWA 1E77A 3R0IA 1A71A 3ZHZA 5JSFA 4TSKA 3EHEA 3AOEC 1NFQA 1W6UA 1WWKA 3OQ1A 1HE2A 4JBGA 4W99A 3AY6A 4YYZA 1NAIA 2BGMA 2YV3A 4QFCA 1WMBA 3LC7O 4J90A 2EP7A 1E1NA 3K31A 4QXMA 2P9CA 3ROKA 3WSWA 1GEEA 3GNQA 4UUPA 5CP8A 1N1GA 2Y67A 3VPXA 4Q3CA 3DTTA 3FWNA 3PDUA 4J7CA 3TRIA 4BNGA 1EVIA 4FPXA 1C14A 2BFMA 1GTMA 1HLPA 1V8BA 2PKQO 1X13A 2NTJA 4FJ2A 4H15A 4NFSA 4ZQHA 5A9SA 3S8MA 2WD7A 2YV2A 1HZJA 1JW9B 1P9LA 3TOZA 1NTOA 2JHGA 3W4JA 5DBFA 4BO2A 4OJNA 1YL6A 4RV9A 4E2WA 4J7XA 5JMWA 3GHYA 3RI3A 3OICA 1PJLA 2W90A 5HA5A 1VLLA 2VRCA 2CFCA 2RHRA 4RZIA 1Y1PA 1BMDA 2E37A 2ZJ0A 3GMSA 3WLEA 2FWMX 1Y8RB 4B7XA 1XCBA 3QV1A 4GAEA 1B3BA 5JDIC 5JPIA 4E6PA 4BO6A 1R6DA 3RAJA 5EESA 3BTSA 3BHJA 2P68A 3FNGA 4BUCA 1JLLA 4DPMA 5G0UA 3U5TA 1E6WA 3JQBA 4D3FA 4BO4A 1K6JA 3GAZA 4YJDA 4JP3A 3ZH2A 3C1AA 4BMVA 2DFVA 3GVPA 2CVOA 4E4YA 4MP3A 3BMOB 3PVZA 3MWDB 3P19A 4DYDA 4YBZA 2V65A 1I2ZA 3FI9A 2O3TA 3DBLB 2RHCA 2WM3A 2YYYA 2VYNA 4CR7A 5A3JA 1YQDA 1DO8A 1P45A 1UZLA 1NWCA 1YJQA 3UVEA 1UZMA 4BL5A 4E5PA 4Y67A 2J3KA 3OEYA 4KUEA 1PX0A 2CUKA 2NU6A 1XG5A 3CMCO 4GKBA 5T8KA 3W8DA 3HDQA 5CDSA 5K0ZA 3UCEA 4OSPA 1IZ0A 2W2LA 1UXKA 3ASUA 4GQAA 4JROA 5JY1A 4L74A 5C5IA 1Q0LA 4GLLA 1HE5A 4M55A 5F21A 4DREA 2Z1NA 3NEPX 4BB5A 1U4OA 3HHPA 3H6KA 3ZU3A 1DIRA 3CE6A 4UVIA 3OP4A 3KEOA 3IS3A 1PJ2A 4I9UA 2WSBA 1P44A 4MDHA 4IDCA 3T4XA 4E5NA 4M86A 3GK3A 3BTOA 2P9GA 1SEVA 4YJFB 3OA0A 2OOSA 4TRNA 4ZRNA 4O0LA 4WLUA 4C7JA 3M1AA 4IJVA 4TZKA 1LSJA 4DLLA 4CQMA 1R4NA 2W4QA 3W1VA 2WWRA 4KTTE 1TVEA 4NJOA 3F1LA 3RU7A 1V3VA 4PG6A 3FPCA 3RC9A 3OM9A 2HRZA 2Z5LA 3O8QA 3I9LA 1DC3A 3CKYA 2VQ3A 5COAA 1GZ3A 1O89A 3EW7A 1FDVA 2G0TA 4LW8A 5ICSA 1MXFA 4EW6A 2CVQA 3I6IA 5K6AA 4ALJA 2QRJA 4YWJA 2JFHA 2Y68A 1R37A 3GAFA 2PV7A 4BNTA 5ER6A 5JAZA 4CLRB 2X58A 3OA2A 5C3MA 1ULSA 2IODA 3A4VA 4CV1A 2PH3A 2WYVA 2FY8A 3DZGA 3WICA 5DZSA 4ZICA 4BNXA 1QYVA 1A9ZA 1XQ1A 1NASA 3C7DB 1XQ6A 3MJVA 2W8ZA 1NM5A 1EBUA 3K2BA 4YCAA 2HK7A 4MOWA 4OAQA 3R3JA 1BXGB 1SB9A 2YQ4A 4HADA 4ESOA 4FC6A 4S1VA 4DIFA 2HJRA 1D4FA 2XF8A 3WQRA 2SCUA 3I23A 3DEYX 4NMHA 1O95A 3ZWOA 1LDEA 4CUJA 3P2OA 3UICA 3GDGA 4GX0A 4O63O 1ZEJA 1UXGA 1I01A 2VWQA 3EUWA 4XR9A 5EPOA 3G3EA 1GQYA 3SLGA 5JO0A 2I5PO 2DC1A 3AUSA 4BNVA 4EUHA 3GVHA 1XSEA 4FQ8A 4RVSA 4JJIA 1Z82A 3WGOA 5DULA 3WJAA 5G4KB 4CM3A 4JBIA 4ZQGA 1BVRA 1MC4A 4I9NA 3ON5A 4EITA 4PLHA 3AU8A 2HMWA 2JD0A 1HSZA 2O3JA 1LLQA 4MP8A 5A05A 4R1UA 1LQTA 3VPFA 4AJ4A 3PDJA 3TDKA 4RPJA 1E6EA 2OBNA 4LCJA 4W7HA 4ZRMA 2NACA 1ZXBA 4J0EA 3JQ9C 5G2OA 3MOIA 3ZGYA 1ISMA 3ASVA 5C7IO 2HCTA 2RH4A 2VZ0A 4YQYA 4B7UA 1DRWA 5L4NA 1R4MB 1O8CA 3F5SA 4R01A 1HYHA 5EMHA 4UEJA 1N2SA 4OH1A 4YJGB 1TT5B 4G81A 1X1EA 1E1KA 2JFFA 1D1SA 3CPSA 1RYEA 1MC5A 3A9WA 4XJTA 4P38A 4UUMA 2O2YA 2X6TA 3BMNB 2NQ8A 3O38A 3TQHA 4IMRA 2BGKA 1W4ZA 2OBYA 4D46A 2X1HA 2QRLA 1QYXA 1K89A 3ROPA 4ND3A 4B3JA 3ADPA 2EERA 2AHRA 1CJCA 1NP3A 4RVUA 3IAHA 4Z3DA 4AJEA 4CLDA 4ALMA 2DPGA 2X8LA 4WPGA 1I3LA 3L07A 4NBVA 1JU9A 3OHSX 3KSDO 8LDHA 1VI2A 3M6IA 2D5AA 4DA9A 1H93A 2QG4A 3ABIA 3IP3A 4XIJA 3V8BA 3WBBA 4XRGA 4XD2A 5ES3A 3ST7A 4J4HA 4Y98A 1IOLA 1XIVA 3T4EA 4DLBA 5CEFA 1ZSVA 3QWHA 3PLRA 4PG4A 1X15A 3EVNA 5CPFA 3VHRA 5COBA 1EMDA 2ZYGA 3RFTA 5KVVA 4QO7A 2VYVA 4A03A 1JWAB 1MB4A 3MCVA 4R1NA 4UVEA 1YE3A 4PLVA 3WDSA 3ZU5A 4R51A 4XGIA 3D4OA 1ZJZA 3D4PA 3UAGA 1PGJA 1QLHA 4F3YA 4TWRA 4FS3A 1P1RA 5IG2A 1R66A 1YOVB 3ENNA 1C0KA 2FSSA 4R9RA 3VH4A 1ZK0A 1VJ1A 5F1KA 2NU8A 2NU7A 3GZNB 3AUTA 3JQBC 2DM6A 1JAYA 3ICPA 3OIDA 3WQSB 2YZ7A 4B8WA 4CMCA 4I08A 1C0LA 1DC6A 4U7WA 4CV2A 2J5QA 2BH9A 3C24A 4CLXA 1O0SA 5JBIA 5BQFA 5BSHA 4K26A 2GGSA 2H9IA 3JD2A 3ULKA 3WMXA 3FN4A 3TNLA 4GL4A 3L4SO 4AJKA 3D3WA 3E6AA 4UVGA 1P1IA 1A9YA 3QRWA 5JMPA 2X9GA 5AQ1A 3A28A 2Q1SA 3RWBA 2X23A 1KVQA 1Q0HA 1BXZA 1Q7GA 3DL2A 4KDEA 3IQDB 1EUDA 4IY1A 5T8KC 1HYGA 1HDCA 2AG5A 3TL3A 2EGGA 2WD8A 1ZIDA 4BO1A 3GGPA 3TZQA 1E3SA 3Q2KA 4CUKA 1DRUA 4NZ9A 1NHWA 4KZPA 2XXJA 1V35A 3DOJA 3TL2A 2DKNA 2YFQA 1D8AA 1GQ2A 1ZFNA 3AK4A 1WVGA 3FPLA 1PEDA 1QG6A 3CUKA 3TSCA 1KC3A 4AFNA 1BTOA 1GZ4A 3HSKA 4KDFA 4ZHSA 3HDYA 2PA3A 2GLXA 1L7EA 2CF6A 1T24A 2R6JA 4K6FA 1X0VA 1W73A 2IEBA 4IIUA 4YB8A 1X7DA 4NG5A 1H6CA 3ONFA 4RQTA 3N74A 4CL3A 2B69A 3Q9UA 1U7TA 1NX6A 1ZJYA 2NV6A 2PH5A 3SJ7A 2OORA 4KMSA 3T7CA 2X0JA 1PJCA 3LU1A 3KO8A 1PTJA 3KVOA 1ZW1A 2O7QA 3KYCB 4J1SA 5I7FA 1Q2XA 3GFGA 4BO3A 2Y1EA 1VJTA 5JY6A 3GA0A 5KWEA 3WXBA 4D44A 4Q3NA 4FFRA 4ALLA 3LLVA 2F00A 3GVXA 2HAEA 5K6AC 4MINA 3JTMA 3EZYA 2O4CA 2Q4EA 1OFGA 4HUJA 3E03A 2X22A 1E3WB 5I9NA 4WOJA 3VDRA 4TRRA 5THKA 1IHYA 1WP4A 1LJ8A 3U4HA 1F17A 3DR3A 3V1UA 4JCOA 5I9MA 3SLKA 1JDJA 1DC5A 1PGPA 2BMAA 3DBRB 3LDHA 3UCFA 4MP6A 2H1SA 4MVJG 1XYGA 2G5CA 2DVMA 3QWAA 4CMBA 1GYQA 1LLDA 4W4TA 3WFIA 1T1RA 2V6MA 4X54A 4EJMA 3ZNNA 4PLCA 1VJ0A 4LSMA 5IDXA 3JQ7B 4XA8A 5H83A 3HB5X 1JVBA 1Q7CA 5ILGA 2HJSA 1H0KA 1YB5A 4MIOA 1J4AA 3M2TA 4GMGA 4L8VA 4YJHB 5HRUA 2GN4A 5EERA 4I5FA 5MDHA 3PP8A 2PK3A 1QRRA 2D1YA 4UAGA 3D5TA 3AI3A 1R16A 2P9EA 1NQ5A 1TI7A 4IJWA 1LQUA 4EGFA 2GNAA 4A10A 4HKTA 1E0DA 1EVJA 3D4NA 4FN4A 5TSDA 3H5AA 4QFDA 1Q7BA 1LC0A 4PVCA 4BQRA 2I65A 4I1IA 1A72A 1XEAA 2YDXA 4MJLA 2YQ5A 4J6FA 2O2SA 1SC6A 4LRTB 3RVDA 1ENOA 3AFMA 2BKAA 3Q3CA 3BXXA 4M54A 4U6QA 2UUPA 3Q0EA 4CM8B 3GRKA 2GUGA 5I7VA 1I24A 2PGLA 5EJ2A 2ZTLA 2VNAA 3TWOA 3NT2A 1V6AA 3N7UA 4FD3A 3MJ4A 4FB5A 3I9OA 1NPYA 1UXJA 4XYEA 5L4LA 4WASA 1FDUA 2J3HA 3ZWWA 1UP7A 1VSVA 4O6VA 1LTHR 1UAYA 3BZUA 3U09A 1W0CA 1FK8A 4BNKA 3KETA 4ND2A 2A35A 5CDGA 3U49A 5CEJA 3VPHA 1TLTA 3CXRA 1OAAA 1VL6A 4YQZA 3VDQA 1A4IA 5A06A 3G1UA 3COSA 2QW8A 3DTYA 4DC0A 1WMAA 5LDGA 1YBVA 4YPOA 1PS9A 4ALNA 4N7RA 2QHXA 3ROMA 1PJBA 5L3ZA 1NHGA 2AQKA 3BAZA 4IJKA 1QYCA 1DFGA 1CRWG 1J6UA 3LLSA 3ZWNA 2ZQYA 3AM5A 4WNIA 1HKUA 1UAGA 2XAAA 2PY6A 3I52A 4I5GA 4A27A 1BWSA 4IQ0A 2CY0A 4HP8A 1U28A 4HFMA 1ONOA 3W8FA 1HDGO 3CEAA 4CM9D 5TS3A 3ZV6A 1LRJA 3I9KA 4CLHA 5IF3A 3LT4A 2O23A 3OSUA 4GSLA 1DIHA 4G65A 3PYLA 4NBWA 3WTBA 4J16A 2RIRA 4ZQFA 3E48A 1EDOA 4NBUA 1NR1A 2AG8A 2NTNA 4JK3A 4WCFB 1DHRA 3ZI0A 3GZNA 2YUTA 2ZJ1A 1IPFA 4PFJA 4ZQEA 2VHZA 4CLOB 3S2EA 1A7KA 1XDWA 3UH1A 4TKLA 4XB1A 5L9AA 2FOIA 1GV1A 2UV8A 2HQ1A 3MJEA 4WUVA 2W2KA 2A4KA 3HWRA 1GQQA 1BVUA 3ONDA 4IGEA 4MVJP 4YVFA 1OMOA 4U0KA 4J91A 5L7WA 2X7HA 2I76A 3OECA 4M87A 2AE1A 4IQGA 1WPQA 4Z9YA 3K2EA 2YDYA 4IDFA 4J49A 3VZSA 1H9BA 3SVTA 1YGYA 3DBHA 3GPDG 3HFSA 2PZMA 2HLPA 3TPCA 3OMLA 4O5OA 1YB4A 3AOGA 5JW6A 1C1XA 1E7QA 3UKOA 4RL6A 1PJTA 2GF2A 1KVUA 3D1LA 3AM4A 1Z6ZA 2A92A 3MOGA 3WGGA 1E3EA 4BO5A 1DJQA 2DTDA 2Q45A 2IZ1A 3I3OA 3L9XA 3NDRA 1F8GA 3QVTA 5L51A 2GN6A 5DP1A 3S1LA 5IDQA 4KOAA 1K6XA 3AM3A 3E9NA 2O4UX 1P3DA 4E5KA 5FWNA 1ADBA 2X0NA 2VUUA 3DO5A 1BW9B 2R2GA 3H5RA 1DFIA 4WNCA 5BT9A 2YFHA 1YKFA 1YONA 1HL3A 3JCZA 1KBZA 1VSUA 2LDBA 1XELA 3DBVO 1K6IA 3GNSA 3ONEA 4D42A 5C7LO 1EUCA 5CHEA 1NBOA 4FFNA 1XU9A 2ZB4A 1H6DA 4Y9DA 2V6BA 1B8PA 3CTMA 4PG5A 4DQVA 1F12A 1YL7A 4RO0A 4DIBA 2PZJA 1LNQA 4Z9FA 2DBQA 1WLYA 3C1TA 3KEQA 2VHVA 5IFLA 3CSDA 4Q3DA 3P7MA 2DUUA 1IPEA 4NU6A 4PCVA 1T2DA 2FZWA 2D8AA 4RVGA 3KYCA 5DP2A 2JL1A 2VOJA 1F06A 1LXCA 2ZCUA 5BNTA 1UUFA 1LDYA 3UCXA 1JKJA 1B3RA 4Q3EA 2NVUB 3SBOA 1DLIA 4D79A 4CM5A 3FTNA 3B1KA 1CETA 1SMKA 1IUKA 4BNWA 3QVWA 3BIOA 1H2BA 5KVCA 5CDYA 4HX5A 1YL5A 2HO5A 3U4IA 2CSUA 1N92A 4YT5A 3BMCA 2WE7A 3ETDA 1U4SA 4I8XA 4LVCA 2FPPA 1E92A 4H16A 4QT0A 4YT2A 3KSZO 1RPNA 4E32A 2YY7A 3UXYA 2QX7A 3RCBA 4RVHA 1KEUA 1GFSA 2DAPA 5COQA 4CR8A 1J0XO 1P1JA 3FBTA 1O9BA 3GF4A 3NGXA 3WR5A 2WYUA 4BHTA 3IUSA 7ADHA 2FRDA 2NVWA 2QQ5A 2X5OA 3GEMA 1UJMA 3KYDB 1H5QA 5IZCA 1PSDA 3PZBA 4B8ZA 1ULUA 1Z7BA 2Y66A 3LF1A 1Y8QB 3SEFA 3KSUA 1LDNA 1VPDA 3QLJA 2PNFA 3C85A 1IULA 2X9VA 4IM7A 5A04A 1DOHA 4RZHA 3C1OA 1U2DA 4G5HA 3E9MA 2Y05A 4P8RA 4ZD6A 2OP1A 1G0NA 1HEUA 2FP4A 3NJ8A 4HFRA 3BMQA 1QYWA 3HN2A 3O26A 2Y1CA 4MIEA 3BTUA 2IZZA 1LRLA 2DUWA 3HQ4O 4GI2A 3KOUA 4M89A 1GPDG 4MPDA 5ENVA 3JQAA 1NWHA 3JQAD 4C4OA 3HNPA 3WGHA 2Q50A 1UP4A 1GADO 1FDTA 2HU2A 3LT0A 4J3FA 3WMWA 1YB1A 2B37A 2C7VA 5A9RA 2C7GA 3ZHXA 3LSYA 4NK5A 4NI5A 4BNUA 3ZWYA 3GGGA 5TIIA 4WLOA 5JCJA 5JE8A 4OL9A 3PQFA 5JCJD 2H5LA 5DOVA 2GDZA 4Q9NA 4OO3A 3QVXA 1EK6A 1T1SA 4KUGA 3WWZA 4B3HA 1Z74A 2JJYA 3HFGA 5B37A 4PGFA 5J23A 2W98A 1PZHA 4IXTA 5IAAA 4CM8A 1P31A 3F6YA 2Q46A 5EQDA 2OHXA 1D1TA 5JYDA 4YT4A 2DT5A 3DC2A 5JAMA 4GWGA 4E2ZA 4RJTA 3B1FA 4B4OA 3D3EA 1UDBA 4TMFA 4DIOA 2POQX 4FCCA 4FJ0A 1PZEA 3G17A 3AWDA 5U1PA 3CINA 2FPGA 4NJMB 1HF3A 3RUDA 3JV7A 5EL0A 3ANLA 2FZEA 5ER9A 1YBAA 2Z1MA 5B4TA 3RKRA 1DXYA 4DC1A 3ADOA 4Z9XA 3DZHA 3PFWO 3WIDA 3NT5A 5CDTA 1B26A 3AY3A 1JKIA 5JAIA 5L45A 5G0WA 4WCDA 2D0IA 4RORA 1R0LA 3JQGA 5G0TA 4TROA 2EV9A 4YEDA 5KVSA 4GLOA 3RJ5A 4AG3A 4BV8A 1LI4A 1U7HA 4JXKA 5CAEA 1QKIA 5ADHA 3ZW9A 1I30A 1NR7A 3AI2A 1HETA 3O03A 4ZQBA 4OXKA 2PWZA 4AJLA 4KUHA 4DQUA 4WEQA 4OOFA 3E8XA 4BIIA 4D0RA 4PRLA 5FF9A 5JC1A 2CF5A 3VAZA 3LT2A 4DBZA 2HUNA 2TMGA 2PKRA 4P22A 5F5NA 4J2OA 3RUEA 4DL9A 1J49A 1GAEO 3QE3A 3PLNA 4PLFA 4XQGA 3PYXA 2E49A 3EGOA 1UH5A 1ENPA 2NWQA 1U3TA 4NFHA 1NVTA 4JJFA 2WEKA 3TOXA 2LDXA 3ZHYA 3G79A 4ROSA 3TN7A 1SBYA 3PJDA 3RKUA 1JTVA 4ALIA 4BNHA 3WB9A 4MO2A 4R1TA 4E31A 1AHIA 4O59O 4UEOA 3JYLA 4OOEA 3JD1A 4CMJA 2ZYDA 2VTDA 2WTBA 5AYVA 3ZWBA 2JKVA 1B14A 2IYOA 2X9NA 3DONA 4OKIA 4QTZA 3UHAA 3WLFA 1E5QA 2J5KA 3GH3A 1TXGA 2R00A 1PL6A 1IY8A 1OZAA 2HKIA 4ITUA 1Z45A 3UGKA 5I8WA 1LSOA 3DFUA 3I1JA 3GEDA 5JS6A 1KETA 1NQOA 5KKAA 1FMCA 4MVJD 1F14A 5A3VA 5HTOA 3ZWAA 4FW8A 5CEEA 3WJ7A 4EZBA 1PJ3A 1I3NA 2AQ8A 1CERA 4Q3BA 3H9UA 1KERA 3I9MA 1N7GA 3VH3A 3DAFA 3CH6A 4AICA 1P0CA 1M75A 5KJ6A 4IDEA 3C8MA 3QWIA 1T4BA 3PXXA 4R68A 3H2SA 3VVCA 1HDYA 3MJSA 3VC7A 4LK3A 3PWZA 2V6FA 4WLNA 1E7SA 1CWUA 4PLWA 3RC2A 1YXMA 2GN9A 3S2IA 5JCXA 3S2FA 3WSVA 1MFZA 2GSDA 3ETEA 3L9WA 3K96A 3OJFA 1LX6A 3AUUA 1U3VA 1U8FO 2GERA 5JNLA 3KYBA 1MV8A 2E48A 4BOYA 4JX8A 2GASA 2E4AA 2GYYA 1KY4A 3E9QA 1KIFA 1D3AA 1GD1O 2NVUA 4L0QA 1ZO8A 4CQLB 2DBRA 5K9ZA 1PGQA 4E5YA 5LDHA 2FR8A 2GPTA 2VWHA 3EVTA 1Y8RA 4NDNE 3RC1A 3MEQA 4QO8A 3H9GA 5GMOA 5F1OA 4CL8A 1CF2O 3ZWVA 3CZRA 1ZMOA 1YQXA 3ITKA 4IMPA 4EEZA 1T25A 2BF7A 2I66A 2PD4A 3WOHA 4HXYA 3RUIA 5JC8A 2JD1A 8ADHA 2B4RO 2WJPA 2BELA 4NIMA 4CPDA 2AEMA 2WMDA 2BFPA 5C7OO 3G1TA 3VTZA 3NGLA 1EQUA 3IDSA 2G17A 3NUGA 3GNTA 1ORRA 3GLQA 1GCUA 1G0OA 3VKUA 2X5JO 4INAA 4JGBA 5EN4A 3SX2A 3DDNA 3VZPA 1AGNA 5IN5A 1IE3A 4MKZA 3BMOA 4B4UA 4E2YA 3VH2A 3JQFA 4UULA 1N9GB 4PLYA 4BNIA 3H3FA 1DDOA 1LDBA 3DBLA 3WX0A 4P4LA 1BGVA 3NTQA 1EK5A 3R3SA 3HDJA 3DMYA 5KJCA 1RM4A 1EFLA 4FOOA 1R15A 4PIVA 3MTGA 5IZCC 4TVBA 3OIGA 1C1DB 4J2HA 4UREA 4BKOA 3KXDA 1Z7EA 2Y0EA 1YDEA 2EIHA 1TA4A 2AMFA 4MVJM 1E7RA 1M6WA 1WZEA 4RQUA 2J6IA 2IXAA 4CLEA 1U3UA 1T2AA 3I5MA 1VC2A 5G0SA 3IKVA 3R1IA 3FSRA 2CDAA 3U62A 3ZWMA 3H3JA 4OM8A 1ZBQA 4II3A 3JQ8B 1OC4A 3OETA 4W7IA 3NX4A 2GRAA 3ZU4A 4L9RA 3L4BA 5KOIA 3ZHBA 4CR6A 3GPIA 3LVFO 3E5RA 4XDYA 2DQ4A 2DPHA 4N5MA 2IZ0A 4LVUA 3SC4A 1MGOA 2B5WA 2JCYA 1B2LA 1B15A 2YW9A 1LSSA 2I67A 4TKMA 2NM0A 4YJFA 4EI2A 1JKFA 1HE3A 5HBRA 1HZZA 4WOKA 3BHMA 3TFOA 3NRCA 3OEWA 3RUFA 4CMIB 5ITVA 4GBJA 3C3XA 4MKRA 2V6GA 4Z0TA 4EJ6A 4PZDA 3ZV4A 2XOXA 1I5RA 4YA6A 1A4UA 4JP2A 1ISJA 4RF5A 2IEDA 1LDMA 1WNTA 4PG7A 2DBZA 1GZ6A 5T67A 1ZK3A 2EG9A 4JIGA 4XGKA 5JDCA 4HY3A 3RU9A 2HK8A 3FHLA 3INRA 4CMKA 3L6DA 4IPTA 4RPHA 5TF4A 4P4GA 2Q2QA 3KUXA 4LISA 4GH5A 1RKXA 3ZWXA 4CLRA 1QLJA 4XRRA 4D3DA 4N54A 2BHLA 3S2GA 1S7CA 3DAPA 3LQFA 4GVLA 4RF3A 2A94A 4IDGA 1U9JA 1NNUA 1M6HA 4YAJA 2D2IA 5A9SB 2WD7B 1BDMA 1EFKA 2JAHA 4BNMA 4J1QA 1P1HA 3ITDA 3GDFA 4OXNA 1RYDA 3H4VA 3KBOA 4HFJA 1DBVO 2OMEA 1BXGA 1FDWA 3RJ9A 3IUPA 1VKNA 1PGOA 2ZIZA 3GN1A 3ZDFA 2PR2A 4PZEA 1DRVA 1QV6A 1QV7A 2FMUA 3PYMA 1M2WA 1Q1NA 2P4QA 3F4BA 2WE8A 4J1NA 2EJWA 5EIOA 5A4DA 4PLTA 4CODB 3JQDA 5U4QA 3ICCA 3LF2A 3WIEA 2BI8A 1NVMB 3H9QA 1I0ZA 5TRTA 4E12A 2RCYA 4I5DA 1NPDA 2C20A 4IDDA 3DWFA 4AL4A 4KQWA 3NV9A 3WYEA 2DFDA 1QYDA 2Y99A 5ITWA 4TRJA 1ISHA 2JFGA 5G4KA 4BKPA 1XKQA 4XJSA 2AA3A 1NFFA 4J9UE 4OHUA 1I2BA 2EF1A 1I32A 2XPCA 4NQZA 1KEPA 4XDZA 4U6SA 5B4VA 3V2HA 2VUTA 3PIDA 1K5HA 5HS6A 4WECA 3NDJA 2ZTVA 3L0DA 4N5LA 4R3NA 2B5VA 3IMFA 3QVOA 2UUOA 4W9NA 3F1KA 3P2YA 5FI5A 1AN9A 4ND5A 1R4MA 5L4SA 1Z73A 1DHTA 2ZCVA 2EKQA 4YJGA 1TT5A 5FFFA 1SAYA 1Y9EA 4CV3A 2R00C 4KWHA 5AXCA 4DYVA 4WLVA 6ADHA 2FR1A 3BMNA 3FTPA 2GO1A 4JNKA 1C3VA 3RSHA 1EDZA 1K3TA 5IXYA 2Q2VA 1DPGA 3DHEA 1GUZA 2I9PA 4GX2A 5ENDA 1RM3A 3PZRA 1X7HA 3A06A 4L76A 4EYEA 1PJQA 1C0IA 4XWYA 1QR6A 4AJIA 7MDHA 4UUNA 1C0PA 1PWZA 4ND4A 1N8KA 3PHGA 3VVBA 4ZGWA 3EY4A 3FNHA 2YHIB 1GV0A 2NVBA 3A1NA 3U0BA 4DPKA 1PQWA 3ETGA 1UR5A 3KB6A 3WGIA 3TZKA 4IGFA 2AW5A 1Y6JA 3UFXA 3ENKA 3GT0A 4QSMA 3M1LA 2NSDA 3STHA 1SO8A 1FF9A 2Y1OA 3O4RA 4NBRA 4CQMB 5TGDA 4R41A 2X4GA 1R4NB 4FR5A 2J3JA 3U4DA 5A9TA 4QECA 4MIYA 1JQBA 1MUUA 1B7GO 3RIHA 1QORA 1XHLA 2GR9A 3CZMA 3F4LA 4FC7A 3LC2O 4UVDA 4EUEA 4J1TA 3O8QB 3NKLA 4XQCA 3WNQA 5HM8A 4LCEA 1YH3A 2TMDA 3ZU2A 3QWFA 1A5ZA 4L4RA 1ZKMA 1GU7A 4CM9A 1RM0A 4GKVA 1LLCA 1PZGA 1PS8A 3H7AA 2CDCA 5HS4A 2PGDA 2FSVA 5FEUA 1UXHA 2C2YA 2QZZA 3DZFA 1YOVA 3FCOA 4WLFA 4QQRA 1ENZA 4RDIA 3DZBA 4PLZA 2EW8A 3HADA 1Y81A 1LSUA 3KM0A 1E3IA 5AXBA 4AJHA 1U5AA 2OXIA 3SXPA 3GDOA 2IE0A 3H9EO 4EBFA 3HZZA 4RVDA 3KV3O 3L6EA 1EVYA 4XQ9A 2PD6A 4AJ2A 3JQFC 4R5HA 1KS9A 3DFZA 3PHIA 3JYQA 1HT0A 1ARZA 4OYRA 1O6ZA 2FPIA 3HE3A 4RGBA 2J5RA 5TX7A 1A27A 3ZWPA 5GZ6A 2PKQP 3V1TC 4XQEA 1ZSNA 2HMSA 1CDOA 2VTEA 2O3QA 4OQZA 4RLHA 4R3WA 5EINA 3U4CA 1YWGO 2Y1GA 3AJRA 1Y9AA 1L7DA
chains in the Genus database with same CATH superfamily
1D5CA 1APBA 1FVHA 3GFFA 3OJLA 2R9VA 1P3Y1 3U9SA 2J0SA 3IT1A 1SC4A 3RS3A 3B36A 5A2GA 1DJNA 1EDDA 1YS1X 3DMHA 2YOGA 4BKRA 3AEQB 1I3KA 2R7AA 4QPCA 3TD2A 4B47A 4P7GA 3WMGA 4MS4B 2UAGA 1W35A 2W71A 2R86A 3NXSA 4FZVA 2H4WA 2HHHB 4CUZA 1H94A 1OY1A 1V43A 4UFOA 4N3BA 3L4BC 4J7UA 3X1XA 4CM4B 1XZEA 1SU4A 1IEXA 2C4VA 3C74A 2EGUA 3AUAA 3N0WA 2V59A 1W59A 4ARCA 4TMXA 3UBTA 1BOOA 4CF4A 5MN6A 3QX3A 4K6MA 1FW8A 3DAYA 5JAOA 2OCGA 2AKYA 3RM3A 4BGIA 3K70C 1L7QA 1C4KA 2Y1DA 1XN1A 3DL4A 4UDNA 4QUKA 4XSHA 2GBPA 2DQYA 2OAEA 2EXXA 4C2AA 1AU9A 4LVOA 2XA2A 1JT9A 5DLYA 4BU0A 1F2VA 2Z6UA 1EP9A 5LOVA 3GR6A 2QU7A 3ZDCA 4WIAA 5F3DA 5CA0A 1H42A 3SBXA 1HDXA 1OAOA 3CIFA 3PHJA 1Y1LA 2IGTA 4EW2A 3HKBA 4YNBA 1ITZA 3I6ZA 4LDNA 2HV8A 2O5CA 4YR9A 4ZDKA 4TZ6A 2C2HA 2G9RA 2G63A 3IHTA 3O8RA 1KH1A 1L3IA 1SCKA 3G2JA 3ZHOA 4KXMA 1JH9A 3A0UA 1XTIA 1CT9A 1F8FA 1W4CA 4QGAA 4PW0A 4UFNA 4CNQA 2I2DA 4IZHA 5REQA 4M0KA 1N33B 1E3WA 1M1NB 2ZU0C 1TW3A 4JHLA 1S9HA 4C3UA 3HN7A 3RT7A 4B3IA 5M29A 5KVQA 3E9ZA 5HF5A 3VH1A 2Z9BA 4KQXA 4MA5A 4WGGA 2YX1A 1PL8A 1BMFD 4LJ4A 1SQ0A 5C5CA 2QN1A 3WWOA 1BHO1 2WWWA 3OOJA 2C0PA 2VA9A 4NL4H 4AN1A 3GLFE 3AB3A 1NLUA 4DIDA 1XZAA 2HF2A 2J5BA 4OK5A 2QD1A 3QUQA 5JI2E 2ZE7A 4LK2A 3LXRA 4K28A 4YJ3F 2VRCD 3DE6X 2WMYA 3DYVA 3PX3A 1D03A 3QIVA 1NONA 4WY5A 2YKGA 1V5GA 3T3OA 3ZS8A 1SCBA 5ECDA 1FJHA 3VUFA 3GHHA 1NBME 3MGKA 5A6SB 3OQOA 3I34X 3ACCA 3CLTC 1PX2A 1VYVA 3QPBA 4FGZA 3SVZA 4YECA 4BGUA 5A1TA 1KZYC 4QHTA 1ZNQO 4KXUA 3MCWA 3U4QA 2Q5CA 1IY9A 4Y7DA 3BIXA 2D5IA 4U2FA 5EG5A 4Q18A 4RVCA 1WM1A 3PJGA 2P35A 4EJFA 2V1XA 1WZ2A 5AHOA 2C5SA 5AM5A 1ZZGA 3AH8A 1X0XA 4BQPA 1J2JA 3RJTA 3V8RA 3WC4A 3R40A 2G6TA 2G1UA 3OH8A 4RA6B 4AC9A 5IJZA 1BE0A 1Q3TA 3ML1A 2BGLA 4MZXA 1WCWA 3QU4A 1EFRA 4FNGA 3VO2A 2ZQZA 4D2IA 3D7RA 2ZPUA 3PXUA 4MUYA 1CQJA 1KRHA 3I92A 2C7BA 2P0YA 1LLUA 3G8DA 4FNOA 1AQUA 2ZVDA 2ZJ7A 4NZOA 2AFHB 3TYXA 4BO0A 1V0JA 3O2JA 4EFNA 2I3BA 3OTWA 3P2IA 1Q50A 2QQEA 3FF4A 1U0TA 4A0SA 3AHGA 2P2NA 4MWBA 3T8YA 4A5OA 3AXSA 4Z0HO 3MTJA 4A8JB 5H0IA 2XB8A 3TKYA 4YQEA 5ALRA 2ZBQA 2JCBA 1OFHA 2GPSA 4OFWA 3S55A 3FMGA 5I7RA 3QHAA 4HNGA 3R3UA 2FUEA 1XZDA 4U39A 1TB4A 2I6TA 4DWVA 3ELBA 4JLOA 1GOTA 4HV4A 4MVJI 3WIUA 5ITZA 3PEFA 2GEUA 2Q1XA 1EZ1A 1QXSA 1Y3CE 1D2HA 3JRWA 5KAMA 2W2LD 5CDUA 5HF6A 3H1AA 1PWXA 1YF3A 4L7VA 2PJZA 3KR1A 3NONA 1ZUNB 3I9NA 3QJYA 4M49A 4LYFA 4RFSA 3W4KA 2Q0XA 2DY1A 2YVUA 5I7SA 1P6UA 3IKTA 4ASUD 1LFAA 5TLSA 1N25A 4KLZA 5LZ2A 4AIRA 3FNEA 4YN3A 2SKDA 3IA7A 2GXUA 3DJFA 3VJMA 1KBOA 4ZMBA 1Z08A 3O9VA 5D01A 4CFSA 1REQA 3MGCA 3P5BA 1Z6TA 2PFGA 3EFBA 3NNNA 4L6AA 3I01M 2IYUA 3H5LA 5KSYA 4OU4A 2R8RA 1ZUD1 3PGXA 2EX0A 3C14C 4BFLA 2ZW9A 4FJ1A 2P8JA 5D6OA 1A9OA 1E6UA 2IXDA 3B5IA 3L0ZA 1NN1A 2GOYA 2OZEA 3CEMA 4QDTA 3KFLA 4QBFA 4U9HS 2DFNA 5G40A 4G0XA 1CZNA 2ID4A 2VJAA 3EEBA 2PZBA 3T94A 1SU6A 1AKYA 1X7WB 4PYMA 4NH0A 5EXXA 5JO9A 4AXXA 3T06B 1AKUA 2OFWA 3MXOA 3BA1A 4L3OA 5K0LA 4PTLA 1ZSYA 3A1EA 4ZEOA 1CS0B 3TW8A 4EUFA 5SY4A 4QTYA 3DCNA 4G1EB 4N40A 2CHQA 4YASA 1BAPA 4EGSA 2R1VA 4X91A 3IFSA 1M67A 3MWEB 3STWA 2OK8A 2JCVA 3K9BA 5CURA 5LB2A 3BS4A 2XTZA 3L5KA 3Q1LA 3IE0A 5T5QA 4AZWA 3AY0A 4UBMA 2ODNA 1XL0A 2IIPA 3F9IA 3GOHA 4J1TC 4YJ3A 3RJMA 5CLLA 1IZ8A 3GIWA 4RC9A 1QZZA 2IXBA 2NYRA 1T8RA 3JVEA 2HIGA 2V3VA 1OXSC 3TQSA 2OGSA 3H65A 2CMDA 2E5WA 1T8SA 2GFQA 4RNDB 1WXWA 2Z09A 5K0EA 1LBSA 4EPWA 2QLLA 1PJZA 1Y5MA 3DB1A 1IY0A 2FSVC 3JASB 4N3CA 3VZQA 1OYOA 1G63A 2QTAA 3FHCB 4WA7A 3F47A 5IXSA 1QANA 4IH1A 4V0LA 3WNZA 3DYIA 1J99A 1NP7A 2WWIA 4YLEA 2FN3A 2Q3JA 4DUGD 2QM0A 3AEUA 1T6XA 1ND5A 3ZHRA 1ZINA 3F2IA 1TF7A 2JAWA 4IIJB 1T3GA 1KJNA 3EG9A 1L4BA 4HEA1 3LDFA 4LNHA 5DBOA 5B12A 1SKQA 2D0OB 3T41A 5JEEA 1EWQA 1X14A 3Q3VA 4PXAA 2JGKA 2OHGA 2O07A 4QT4A 3HB1A 5LYJF 3QA3E 2I3AA 3OPYA 3IAEA 5KNDH 1VJRA 4Y0AA 1VCNA 1Z5PA 5GY7A 4A1OA 1OWMA 1V48A 4RTSA 1SCDA 1ZGCA 2ZTMA 3G7UA 1R6UA 1RHQA 2HWUA 3P9PA 2AR7A 3RFXA 1GAWA 5JAQA 1KYWA 2E1RA 4B74A 4E13A 4Q4CA 2JH9A 3DD5A 3L77A 3R8XA 1K75A 3DJYA 3II6X 5AJZA 3R44A 4IS2A 1K4KA 3KC2A 4HNVA 3AIKA 5B1HA 5NULA 4AECA 2VDKB 1AZSC 2HDHA 1FXSA 4QREA 1AURA 2CD9A 1FFEA 1OIVA 4L75A 5FPYA 2JDID 4LGMA 3RNLA 1EFPB 1B00A 3RO7A 2IDJA 4CMGA 4DM4A 4EHFA 4PN3A 1PG5A 2JIPA 4Z0PA 1P9NA 1I36A 2ONJA 1NLYA 4HTFB 3TNFA 1K8QA 4Z49A 4R98A 3DM9B 4DLAA 5KJFA 5IH3A 2OO5A 4G8JA 3ZTYA 1VHDA 2ETVA 3F6SA 1VRVA 2C29D 1RKVA 2A0FA 1JBEA 2W2MA 3S6JA 1VOTA 6CHYA 2AQHA 2OG1A 3OIVA 2QZSA 3V4OA 1Z8DA 3PJRA 4ON9A 5BQPA 4HWSA 3OIUA 4ZO7A 1X8KA 2IV7A 3L8CA 4DF3A 3DXYA 4TWJA 3OU2A 4M1YA 3M83A 4JYBA 5HRAA 4GZ6A 3TBHA 1R9GA 2O2GA 3EQ2A 5BSRA 5EJ8A 1Y7PA 5I7OA 1W87A 4K05A 2GRUA 1GGKA 2B83A 1ZXLA 3PJEA 3QBJA 1JYFA 2Z4SA 4ER0A 3FPJA 1DVRA 2QA5A 3MK31 5LZ8A 1CQWA 1UJBA 2G77B 4ZO9A 1R8YA 2VZ9A 4C6SA 2R79A 4P4NA 5JFTA 3OKAA 5AOVA 1XZKA 5KYUB 2O3SA 3HO1A 1Z0KA 4PPGA 1SA0A 1LI7A 1XP5A 3E3LA 5DDIP 4OHRA 3SFZA 1GPLA 4QX6A 1XBTA 3L0CA 3LECA 2PO7A 4R1SA 1AHNA 1E60A 3CUVA 3H8SA 3JYHA 3OJCA 4TQAA 2QLBA 3W2FA 4P2GA 1U3CA 3G2NA 1PJ8A 4RGVA 3W2TA 3K1YA 2CJYA 2I29A 3IXQA 4IH4A 4QICA 4GE0A 3RR2A 2Y0PA 2GXSA 4MPPA 4PLGA 4DPLA 4D5GA 2MSEB 4AYWA 3CZ5A 1UINA 5LR6A 2ZDGA 5HFAA 3HU3A 2XWJI 3GLFA 3SBEA 3MBIA 5BR1A 4U9UA 1PJSA 2Q5LA 1P9RA 2FPMA 2RHDA 4X66B 4W6QA 1TK9A 2JJQA 2HU5A 3QUSA 4Z4IA 1EE9A 1ZN8A 4QSHA 1CUBA 3O6VA 4QEDA 3WSTA 1PR3A 1W36C 1NE7A 4JT4A 3EEIA 4CM7A 2HF8A 4PX3A 1HQKA 2B3TA 5EIFA 1ZM2A 4CT4B 4CIVA 3PK0A 3FNFA 1LC3A 1WUKS 2Z5VA 4KGXA 1NBMA 1U63A 3W5HA 2FPUA 1SELA 3FIJA 5AXAA 1CUIA 2XNJA 3W8RA 4KPEC 4YP0A 3JD4A 3GUVA 3H4IA 3ZW8A 1J9GA 3PNQA 1GY8A 4MPJA 3VVMA 3W2HA 4YRAA 1MNQA 1Y8QA 4BIMA 1Y34E 1VPVA 2NZ2A 3F7NA 3HVUA 3D8HA 2BR4A 5THXA 2AHOA 1L1QA 2VHYA 1DSSG 4ME6A 3T5PA 3ZN2A 4H0CA 2AFVA 5F5LA 1QRSA 2H6EA 1X1BA 2CXXA 1Q7RA 4EHLA 3EXIB 3DL7A 1R12A 2R8EA 3PICA 3HHEA 3FYHA 1L1FA 3SOZA 5FWYA 5AM4A 1SVNA 4ARIA 2HMVA 1XRJA 2FWNA 3BAFA 2WB2A 1Y3BE 2R44A 2E0IA 2RD2A 4BVAA 5E95A 1RMTA 3ISVA 4LPKA 1AUQA 2X86A 4L4XA 4RF2A 1P29A 4MKXA 1TCVA 4PZ9A 1KY2A 1FTGA 1HFWA 3SLRA 1PT5A 1ZOSA 5H82A 1Z35A 2BFAA 2RCNA 3ND8A 4KHZA 4YAKA 2ZAGA 4M1ZA 3QJ5A 3TFWA 1G6KA 1HYEA 3GFBA 1YQEA 3UPUA 1OVMA 5BORA 3FIUA 2C4NA 2ANCA 2CHEA 2GS9A 2QD2A 4DQXA 1FTWA 4PR3A 4P58A 2WU4A 2XKBA 4B3TB 4AUNA 1JKXA 5CPBA 2CK3A 4EL5A 3N2KB 4NR0A 3UUGA 4JXZA 2V4MA 1CQPA 3NHRA 2OD9A 3ZD9A 3X2EA 3LX4A 2A5YB 1W96A 4AP9A 3A3OA 1KYVA 5CX1B 1XFAA 2YS6A 3SZUA 3UWPA 1HSOA 3OG9A 4UZFA 1QWSA 4NCXA 1II8A 5CBPA 2ORWA 4LZPA 4CCAA 3KU1A 1DFHA 2FDXA 2VCYA 4XCVA 3GA5A 3PFHA 3VYVA 3JATA 2VQ6A 2ZSDA 1OU4A 1SB8A 3AOEA 2WBLC 1KARA 5TNXA 5BSWA 3HUDA 4BX3A 4DZTA 4HQFA 5K0BA 2JLYA 5BN4B 1ZRNA 3ZE8A 3TIFA 1G5TA 4NONA 3KYJB 5F7JA 3HRHA 3B7PA 3RVLA 4ENVA 2W2VA 1U99A 2XXBA 3IILA 4LDRA 1VE6A 2QXYA 3K4HA 1JFRA 3V2UA 2N1BA 1N1EA 1WDMA 5LVAA 3M3PA 1QIEA 2HZBA 3E22B 2HMUA 3LK6A 2VPIA 3OBBA 4PS1A 2IU0A 1BCRB 2O8CB 2EF0A 1EEHA 1IDN1 2NSHA 4FBLA 4RLQA 3THYA 1FOEB 5KHLB 4INJA 1ODKA 4LX0A 1EUCB 4LGVA 4DBLE 3ET4A 5K4GA 1OFVA 2P5UA 4BB6A 1AJEA 3F9RA 2NP7A 3C3BA 3BTVA 2E21A 5BSEA 4HYYA 4E09A 3D2LA 3QYJA 1Z22A 2PMKA 3H16A 4BGVA 4L85A 5JZ9A 1PUJA 1Y3HA 3OE7A 5CMLA 5E1DA 2IITA 1G21B 1O03A 2P78A 1U3WA 1EG2A 1X1TA 2B20A 4PAWA 3U7IA 3BHIA 4IDHA 4KAFA 2UXDB 3V46A 4MYHA 3FTEA 1C5KA 1M2EA 3F7TA 3R41A 1GCOA 1VL0A 2GZ2A 2PL9A 1PSWA 3QWBA 4KVAA 4M1MA 3ZX4A 3ZD7A 3T3GA 4NV1A 4QUHA 1YZUA 2JJMA 3RH0A 1N2HA 2YXLA 3NHMA 3QTBA 2IYPA 4IYJA 1R88A 3VR4A 4YRGA 3OJXA 5E0OA 2RK3A 5BR7A 4IVNA 1PEKE 1VBNA 1L4LA 2GJ4A 3TDMA 3FNQA 3FM9A 3WGVA 5EIWA 4CDRA 1RLIA 4K9SA 2GAJA 1GPNA 3CRQA 4F2PA 1Q6YA 3IBTA 5AK3A 5DYNA 3TVDA 1WDLA 1V3TA 4ONEA 2EEPA 1YQGA 3THRA 5B4UA 1P9WA 5IN4A 4MYCA 1DS6A 2R97A 2ZYVX 3F6EX 1L4UA 4V0NA 3DH0A 3RUHA 1SG9A 5JH7B 4L78A 2J7PA 3MGAA 1JE0A 4UFPA 1IZ7A 4LMPA 4R9VA 3URKA 4W1RA 2WT9A 1RRKA 2JFBA 4MVXA 4N49A 1WZCA 1N2JA 4IKOA 3REOA 3IH5A 2HEIA 2IY9A 1I4LD 2IT1A 3HXQA 1G64A 2Z0MA 4CNBA 1SXHA 1KK2A 4Q47A 5TQJA 4XH9B 4JLWA 4IJ6A 2ZB8A 3EA4A 4ZPXA 1AUOA 3E58A 2V96A 3ZLUA 3OIFA 1NUQA 1FFSA 4AY2A 2HC9A 1VHTA 1WAMA 3DVLA 2OILA 3E0XA 3EXAA 3OMXA 3KZXA 3PE4A 4HUQB 3IHWA 4PCAA 1MG0A 3VOAA 3I45A 1E2IA 4B44A 1P4AA 1MPTA 4EHAA 4ZJUA 2MSNA 1X77A 2WHXA 3FWZA 2OQVA 1KVRA 2PD3A 4G5XA 5K0CA 4A4DA 3TMYA 1OYWA 2FP4B 3R0VA 3LQ4A 3UB4A 1E5LA 2B4TO 1SPXA 3RQSA 1DMSA 2BEWB 3CPEA 3JQ6A 5A4MS 5JFOA 1TW2A 2OGUA 3RSZA 5I4IA 2IVFA 1KMIY 2AXEA 2PLWA 2WYWA 4ZAFA 4NAVA 3OPMA 2IHJA 2JIQA 1VIVA 4ENRA 1TO6A 5HBGA 2XVMA 4YC7A 2GCPA 1IBKB 2BJHA 2X5XA 4ISCA 1T2NA 1A9RA 1UMBB 3INYA 2QL6A 3QBEA 3HJAA 4IHJB 4F06A 1D7AA 3KV1A 3LIPA 3MERA 3W2IA 4CZ2A 1U5CA 3GO4A 2J7KA 3FX2A 4EY3A 1KWGA 2J6CA 4MAAA 2OO5C 5KTKA 1N6OA 2RONA 5IUKC 5IJ9B 1L9KA 2HRBA 2V7QD 4TKZA 1KGSA 1HY3A 3IBYA 2JIOA 4FFLA 1M2VA 4G4JA 4WKPA 3QVVA 4UUOA 1PQPA 3C5WP 4QPJC 3IOMA 1ELOA 1WMDA 1V6SA 2ZAYA 4MR7A 1DXQA 2YWJA 5F78A 2I7CA 4QM6A 1J9EA 5KQRA 4ITVA 4QYIB 2GN8A 3L04A 3WGYA 2YOFA 3GRUA 4PZCA 3L1IA 2O1XA 1X6VA 2HXYA 1FBTA 3MQ2A 5FWXB 3TAHA 3PCTA 3E1KA 1U8ZA 3QSGA 1DIOB 3LPLA 3D8SA 3TZHA 2VWPA 5MGBA 1HDRA 1SULA 4P3OA 5A3RA 4GUAA 1BHQ1 2KWIA 2WTAA 5T64A 2PS1A 2QZ9A 3EBLA 4LRQA 4Y6RA 1QUFA 4UUBA 1Z0ZA 1HG1A 2VQSA 3MINA 3UT0A 1UWKA 2V54A 1IB6A 4HJRA 3KELA 4BUJA 4X61A 3OZRA 4YRQA 4AKHA 4RK0A 2DFKB 1LK7A 2OZLA 1B0PA 3LHSA 1L5HA 2RAFA 3LYUA 1E9FA 1I2DA 4KPUB 5HQ3A 2F48A 1TCUA 5DOZA 3JZMA 1SD5A 5IBRA 4C78A 4AMVA 1C7RA 2G09A 4WXHA 3AJEA 3KUDA 4LOJA 4EYGA 3SPXA 4W82A 4ZVRA 3NDIA 3W3AD 4P82A 4GOJA 1V8PA 4G9BA 4LHEA 3VPAA 2GH1A 2G4LA 2DTXA 1I33A 4I81A 4W6ZA 4BATA 3EDOA 1N9GA 4H6VA 4HN4B 1JG3A 1OGYA 3GUCA 3ONVA 5TB5A 5TE9A 4DR3B 3EEFA 4I3HA 4B0PA 3DXFA 3BCSA 3CM0A 1ZUIA 5TC4A 1XGKA 5CD1A 5IP5A 3U3JA 4CM6A 1JTFA 3NORA 1J0DA 1NXOA 1H6BA 2EFHB 1UANA 2PO5A 1NVFA 2ZRNA 3TD6A 1JR3D 2VDLB 4XYBA 2VHCA 1DO0A 2H7XA 4E0BA 4AQ7A 3S70A 1DAGA 2QQGA 4P4TA 4O2BB 2BI7A 4TTVA 4KPYA 4WLEA 3D8BA 1JS1X 3N39C 4HDOB 3RAFC 1GDDA 3BK7A 4LYEA 1L7PA 2JAPA 1J20A 3LGXA 4O1MA 3LVRE 2O3UA 1RBYA 3WBFA 4AB1A 2A8YA 2OO7A 3DFFA 4UC0A 4IUYA 5JTUA 3TFQA 2JHAA 1W88B 2PL3A 1M2HA 4PZUA 3TX6A 1UQRA 2I87A 2BGTA 2HY7A 4L0CA 5DLQC 3DT9A 3EFEA 1E2UA 3W7VA 4B40A 2CCJA 2CVZA 2AX3A 2OXFA 3CF6R 4AJOA 8OHMA 1FCJA 2C1ZA 1TUIA 4LQCA 1V5WA 3P26A 3IP6A 2IUUA 3FUVA 3TNYA 1YE5A 3W5IA 2UUBB 3I0MA 3LHFA 4I46A 3LQRA 3HKEB 3VKVA 4WFIA 1HRDA 4YXFA 1Z5OA 4H7JA 2F3QA 1P1KA 4C0HA 2LP4Y 1AZTA 4IJUA 3C7AA 4R71A 3DAGA 2WF9A 3OKPA 4JLAA 4MH0R 4MUFA 2FXVA 2ENUA 2JCXA 4PXYA 5PNTA 2NZXA 4TRMA 5D84A 3BYZA 4ENPA 1ORHA 3NJ4A 2ZXUA 2H0RA 1YO6A 4OD0A 2Q29A 4NFLA 2OAQ1 3N2ZB 1G3MA 2R6AA 2ZE5A 3GXBA 1RJWA 2I3ZA 3PHHA 3HB0A 1G42A 5LBUA 3ZHQA 5LUAA 3AOEC 5IH7A 1W1IA 4G5FA 1YR2A 3JWHA 4WNAA 2P69A 3BK1A 1X1RA 2TSYB 2VXBA 4Q9LA 4ZCIA 1WMBA 3LC7O 2R6DA 3NNDA 4MV9A 3PPXA 1E1NA 3PUIA 1Q14A 4CTKA 4EUSA 1CDDA 4KFRA 1OH7A 1GEEA 4RK5A 2AUTA 3SYTA 4FYVA 1Q57A 1WW2A 1J00A 6Q21A 1AKVA 5LD2B 4PAGA 4IAOA 1DV1A 3HVRA 4Q3CA 3DTTA 1P2VA 1YZHA 3GLHB 3R24A 1MENA 4Q6BA 3STXA 4BVLA 4F3CA 1EVIA 2BSQA 4BJ1A 2AMJA 1RHJA 3TPFA 1Z6XA 3C3JA 4MDYA 3KCQA 5FOSA 1T0HB 1UKCA 2E55A 2PSHA 4K40A 4TTQA 4CTOA 1TNDA 1GL7A 2IYFA 2JHGA 1OWPA 4OIFA 1GLVA 5EIBD 4BO2A 4XWAA 4OJNA 1DADA 1E0KA 1YL6A 2C9CA 1IG0A 4QUDA 3GHYA 4RV9A 5JMWA 1NI4B 1LZLA 3FAKA 3FDFA 4PZZA 4AY4A 1GNVA 2BE9A 5IVDA 2W90A 4YUAA 3PSHA 3GP3A 5AW9A 1MAHA 1VLLA 2VRCA 3O2QB 3G2HA 4ZANA 1M1YE 1Y1PA 1BMDA 2QR5A 4F91B 2RE8A 2FWMX 4EENA 2VF7A 3EC2A 4H7EA 3B5EA 2VK1A 3G8AA 1DKOA 4LPSA 4QRDA 5KVAA 1B3BA 1JRLA 3RVKA 4E6PA 4BO6A 4MUAA 4MNTA 2CYCA 3RAJA 4Q1VA 4U5XA 5EXEA 2XTNA 5BOSB 3W79A 2MTBA 2ATIA 4G8DA 4C22A 2OV1A 4A2PA 5AI4A 3G2KA 4G89A 4DPMA 5EEGA 5BUCA 1E6WA 1X8LA 2EWVA 3H2GA 4PX2A 3NBKA 4I1UA 4RMHA 2J3LA 2JFUA 2AC4A 2PRSA 4HVCA 4YJDA 4F60A 4XLZA 4D8XA 4P3XA 4JP3A 2XA1A 5EJFA 3SR3A 4GL2A 3TZLA 2BFEA 3AQ4A 5T3UA 2A0YA 3V1LA 2QLJA 2DFVA 4BMVA 1I1OA 4JT2A 5ERGB 1U0NA 4ARVA 1ULAA 1AG9A 2E2WA 5IAOA 4DJDC 2WWYA 1R9MA 4ABTA 2J31A 1WVMA 2W93A 2FEAA 2Z2XA 5KTTA 5I48A 3FNBA 1AQ6A 4Z4CA 1VG1A 2O3TA 1JQEA 4I55B 2QL9A 3PC6A 3V4PB 1A9TA 1XCMA 4G1MB 4CR7A 5A3JA 3ZVMA 1YQDA 5AJTA 4BWFB 2VHEA 5CFRA 1F0KA 3GCZA 1KDVA 1UZMA 2NUPB 3C16C 4E5PA 5HX7A 5JCZA 4NAUA 3Q5DA 2XT0A 4FYKA 3OEYA 2GPWA 4RFVA 1M83A 1ZN2A 2XF2A 3CMCO 3VYSB 2QJOA 1PBTA 1X80A 2P3QA 3S2ZA 1IZ0A 1RMYA 3HMQA 3U7QB 2W2LA 1UXKA 2WJHA 3K0EA 3T5CA 4XVQA 2C42A 2UVPA 4IXMA 3ZXXA 2F3UA 1S1CA 2B30A 4R0NA 2DPYA 4GLLA 5DM70 3MILA 4MLZA 4ASUA 4OPMA 1J24A 2PT6A 2Z1NA 1MB0A 3D7SA 4OBBA 4OLJA 2I7XA 2HWWA 3IQWA 2IW3A 3OP4A 2H1LA 3ZCTA 3IS3A 1M33A 1PJ2A 3M7IA 1A4RA 1P44A 2OHIA 1P2UA 4MGEA 4XSGA 1LVUA 4DG8A 4R2MA 1BKSB 4UHFA 4HEA6 4M86A 3GK3A 1SEVA 1ACMA 1HURA 2FLKA 4YJFB 1CUEA 1AZLA 1XDGA 5KNBH 1T36B 1OKKD 3GJ3A 3OA0A 2LGJA 4ZRNA 3SF8A 3D3QA 5EC8A 1G19A 3RS5A 2PH7A 1JJBA 4TZKA 4C7JA 2FE1A 1IQPA 2HA3A 4DLLA 1DG3A 3PC2A 5CT6A 4RANA 2UU9B 3A32A 3EG5A 2ZRAA 5GJVC 5DE3A 2WWRA 1NDHA 1TVEA 4NJOA 2FUNB 1A76A 3A3YA 1CUYA 2NG1A 2ZUSA 3KOWA 4MWOA 4E5UA 3AUYA 3JWEA 4DDKA 2OHJA 2HRZA 2REQA 3I9LA 1DC3A 3CKYA 5COAA 4XTCS 1GSIA 2GK6A 4MUIA 2TS1A 3SC2B 4UCFA 1KE2A 2F4NA 4JI1B 2WINI 3D6TB 1TYBE 2NNWB 2CVQA 5LBTA 3DUWA 3K94A 4Q05A 3SE7A 1UBUS 2ZSHA 3GLKA 4Z4GA 1XK6A 5DEIA 3R8CA 3RT1A 5JXGA 1E2LA 1U0RA 2JFHA 4HL6A 3GJYA 2IHYA 2Y4OA 1R37A 2C2MA 2PV7A 2Y68A 3GAFA 4HB3A 5FQNA 5JAZA 1KI7A 3OZEA 1OV6A 3A1WA 2DG2A 2NO7A 3IP8A 3LQKA 2XD4A 5AKZA 4ARZB 2FOLA 3FB1A 3B2NA 1H23A 2IODA 1W0KD 2FLWA 4BMDA 4CV1A 4F4IA 2PH3A 2WYVA 2Z4TA 3ACDA 1O9HA 3O1LA 4ERXA 4ZICA 2CLIB 1KJQA 1P7PA 3AT1A 3ZCQA 4DUGA 4BLWA 5IKMA 5KDLA 1N2BA 2FZ4A 4W63A 3L82B 4OFBA 1EBUA 3K2BA 4EY5A 3EOAI 3MJDA 2ZULA 4YCNA 1XPRA 3A27A 1TYDE 2IH2A 2IQ5A 1SHKA 4HZUB 2GWHA 4KH0A 1Y6FA 4HADA 3MLAA 4ESOA 4FC6A 1ZN7A 2HJRA 2XF8A 3ICVA 2XUPA 3LP8A 3QI2A 4MSUA 4ZHQF 3OLVA 3GFQA 1XMOB 1C1YA 1O95A 2IGBA 2PBFA 2VTKA 4DLUA 2NAFA 4CUJA 3VNUA 2W6ZA 4AWXA 2CLLB 1C9YA 1YMUA 3Q8KA 4GX0A 4O63O 4B6SA 1ZEJA 4O4HF 4OFZA 1INLA 4S2UA 4R0MA 5BNWA 1AV6A 3PNVA 3VNBA 1CXZA 4R7GA 2VWQA 3FE2A 3NOOA 1Y4UA 4M8IA 5EPOA 2R7MA 1B74A 5LUBA 5IYZB 4KQ9A 3MSXA 5DPMA 4LI0A 1XSEA 4FQ8A 4JEMA 3R7LA 4JJIA 5EOVA 5ALIA 1MW8X 2I6FA 5DULA 4BNDB 3WJAA 4G37A 3TTXA 4ZQGA 4NAHA 1L8QA 4TLCA 5EHXA 2JDIA 4YV7A 4K7JA 4MMYB 1SBHA 4F5EA 4FHZA 5J4VA 2EJCA 4C01A 2JD0A 1HSZA 1WY7A 1UFQA 1NYRA 4X24A 2O3JA 3WAJA 1EVKA 4OHXA 3ZXUB 2MYUA 2PX4A 3B78A 1WVIA 5FTMA 4EQ6B 1N6HA 221PA 3UMVA 3PDJA 3L7BA 1TEXA 4AJ4A 3L7YA 7GPBA 5JXIA 4RPJA 1KH2A 1KAMA 4LCJA 5C8ZA 4HGZA 5DMHA 4J0EA 1RRMA 1E1YA 2PPLA 3N2NA 5AOAA 1FL9A 3SYLA 4YRMA 5H70A 5DNUA 4B7UA 1DRWA 5L4NA 2CL7X 3ORYA 3K53A 3F5SA 4INOA 4L7QA 5K3OA 5BQOA 1HYHA 5EMHA 5FI0B 2AI3A 3LWDA 1M2GA 3WQBA 5A4JA 4CEIB 1TT5B 3JZDA 3UB3A 1X1EA 3CPSA 1UDWA 1FDOA 5DNVA 5L51A 3A9WA 2CLCX 4XJTA 4P38A 3U3RA 2O2YA 3W7AA 4BZWA 2FEPA 1ZJ6A 4IMRA 3BKWA 1W4ZA 3KDAA 3KOMA 4D46A 4I1VA 4Y1FA 4GYJA 3C41J 1EP1B 1FLNA 2GD6A 2IWRA 2H4FA 2VO1A 2PZGA 4XUEA 1KIAA 3EX7C 3ROPA 1EWRA 5AK6A 2VAWA 3QUAA 3ADPA 3EDRA 3RHSA 3TJZA 3FZQA 4E5SA 3U5ZB 3AVVA 1CJCA 4ZTZB 1QF7A 5FPKA 3ZWOA 4CLDA 3VU9A 3AB8A 4DBLC 3SAJA 2DPGA 4JZKA 4LYDA 3RADC 1YFJA 3FFAA 3C48A 2I4TA 3QEJA 2HSWA 2CMKA 1G6OA 3G2LA 3KSDO 3L7LA 1EQAA 4H17A 4AWAA 5A5DA 3RV3A 3UJ3X 4EF6A 1VI2A 2BMJA 1VMAA 3N3AC 3BSSA 4D9HA 3AKZA 1H93A 3KZNA 5IVPA 2SKEA 1M8PA 3ABIA 5L3RA 1G66A 3W34A 5CH8A 3HSYA 3LUAA 4MRSA 4C3ZA 3J80A 1PG0A 2JIZD 4XRGA 3VSEA 1M1YA 3OTHA 4D96A 5KU1A 2YVKA 3CR8A 1IOLA 4E5VA 2DQZA 1CE8A 3T4EA 2C88A 2WHPB 5CVJA 3QWHA 4YS6A 2YVQA 3PLRA 3DMRA 1X15A 3QKTA 3TGWA 1XN4A 3TW4A 2ZYGA 4FCTA 3CKLA 4JUFA 1KTVA 2YWBA 3C5VA 1MB4A 1CSEE 2Q07A 2WAOA 2B8JA 2O0HA 4OREX 1RYBA 3L7MA 3IAXA 4PLVA 4R1NA 2A58A 2OV4A 3QKSA 3D4OA 3PNKA 1L8OA 4R51A 4XGIA 3T4UA 1ZJZA 3PGKA 1TZBA 4Q1EA 4F3YA 4DCVA 4QVGA 2J9GA 3K5WA 4FS3A 4H35A 3VR1A 5INTA 4WBNA 2QTMA 1YOVB 2V45A 1BGWA 4O4HA 4JDUA 4U02A 2ZJOA 3OM8A 3QZUA 1U7ZA 4QNNA 2NU8A 3DQQA 1TZ2A 1GNQA 5E9QA 2ZWAA 1RPAA 2X6QA 3NBZC 4QJ4A 2YYAA 2VP4A 4YREA 2C3MA 3BZBA 3FVTA 4U00A 3MWDA 3OD1A 4QWWA 1UM8A 3WQSB 2P2GA 2PL1A 2YZ7A 4B8WA 2C03A 1XP8A 4I08A 3MWFA 4CMCA 5FJJA 1U8UA 4F56A 7REQB 4XVHA 3UPTA 2XZLA 1Q5PA 4F3RA 1SUWA 4HJXA 2VBFA 4IKPA 4N41A 3HO8A 5BUSA 2EG5A 4KO8A 4K2AA 4W5HA 2D1QA 5JD6A 4N5DA 3AETA 4EY6A 4X7RA 3TM4A 2PJUA 4DT1A 4LSZA 1OLUA 4PO9A 4PSUA 2X41A 3JD2A 1CRPA 2LNDA 3EBPA 4RD3A 1UM9B 1HQCA 3AR3A 1M2NA 3E6AA 3ITNA 3KQYA 4UVGA 2ZWMA 2RGAA 2F8MA 1OJ7A 4HMQA 5JMPA 4EB6A 5AQ1A 4M0CA 1MTOA 5BPFA 4KDEA 4MHSA 3ER9A 3PDHA 4BVJA 1EUDA 4LOHA 4XD7D 3EVEA 2HCBA 3IQIX 4OXQA 2CLHB 4DMHA 2EGGA 3HLYA 1ZIDA 2QTRA 3MUEA 3TZQA 2QEQA 4NZ9A 8MHTA 3P9IA 4ERNA 3UMFA 3L1JA 3QXGA 1K9SA 2IH5A 4LF4B 5KMGA 3P0HA 1ZGBA 3DOJA 3OZ7A 2PWPA 2DKNA 1QTRA 4GXRA 2F8TA 4U7HA 1G3QA 4PHGA 1I4WA 2A3NA 3TI9A 3BB1A 3WP1B 4DVGA 4GR5A 3ZI7A 3ICQB 1R1DA 2M2IA 3KBBA 4AFNA 4O0MA 2ZE6A 1HYQA 1KFEB 2WF5A 1OT3A 1TFUA 2ECOA 2C00A 4GPIB 3EEQA 1PT7A 1L7EA 1JR2A 2OENG 2VYQA 4H7FA 4K6FA 4D9KA 4HDRA 2EVWX 4YB8A 3QXSA 4BVBA 3K4QA 1L5GB 2JLZA 1L5MA 3I61A 1FP6A 3RFFA 5MFPA 4OLBA 3OX3A 2R8XA 3SS8A 3QXJA 4D0GA 2HSGA 1FA9A 2PH5A 4DV3B 3L1VA 1DELA 3G59A 3IERA 4ZAZA 4CEHA 3MXTA 5LOVB 1U31A 2W11A 1J7KA 4HGOA 1R18A 4B3FX 2HZ7A 5CA0B 1PTJA 1VI6A 5I7FA 3HKBB 3TE6A 1S2IA 3GFGA 3VSBA 2WW8A 3C3WA 3GA0A 3WXBA 4D44A 5I7HA 4D98A 3ZGVA 3H17A 1OXUA 4M8NE 1YQ9A 2F00A 2ZWPA 3GVXA 3AC0A 1NUAA 1OA0A 3JTMA 4RTRA 2O4CA 1OFGA 1CQXA 3ZDEA 4D8YA 2O06A 2X22A 5REQB 1ZJWA 1E3WB 5EE3A 5IBQA 3DDWA 1I6KA 3T61A 1YUMA 5EZYF 5FRDA 3VDRA 1FU7A 5HOQA 1OFUA 2HNKA 5THKA 1IHYA 1P4HA 3WZMA 1F17A 3NH9A 5JG7A 4HLDA 3WYFA 4C06A 2YWFA 3A3PA 4MA0A 2BMAA 3UCFA 3ET5A 2H1SA 3GEHA 2MOKA 4GI5A 3RB8A 1MH1A 4TUYA 1NKSA 1SHUX 3BH0A 1E62A 1C7FA 4J7AA 4MVJG 4PGHA 1RQ2A 3DA8A 2N46A 1A97A 4CMBA 4MB2A 4JLBA 2D7DA 3WFIA 1NYQA 2HIHA 4KO2S 3W78A 4ZOBA 1Z18A 2O8FA 3EIEA 3RREA 2UYCA 1GPMA 3DLAA 2GPJA 4HAVA 1L3BA 3OZIA 1C7ZA 2FWPA 1X9HA 1FE8A 3I8XA 1O95C 3PVCA 1DO2A 4H6XA 5TVKA 5IDXA 3U4QB 1CEEA 2IYVA 3BM5A 3ELUA 4PQEA 2P9ZA 2GVNA 1JVBA 3FMIA 1Q7CA 1OYVA 2IZOA 2Q6TA 3ZX5A 5CVUA 2PMEA 1J4AA 1FQJA 3M2TA 5CLGA 4RK1A 5J63A 4UATA 1JJFA 1OI3A 4GMGA 1J23A 1O5TA 3OM0A 5AVUA 1B93A 1QFJA 4TYMA 5HJ7A 1FMFA 5ADUS 1L7OA 2PKXA 2H2HA 1IQ0A 1N0HA 1YZKA 2PK3A 4H7HA 1CQJB 2C3YA 5BN3A 3ABOB 1R8SA 1G2QA 1LI5A 4EA7A 3AI3A 2ZRLA 3JZAA 4L51A 1R16A 4RKRA 1CUGA 4BFZA 2WKRA 3B51X 4EGAA 2CV1A 1CJBA 1TI7A 4TLDA 4IJWA 1Z15A 1BFDA 3E35A 3BULA 1E0DA 1EVJA 2BPOA 4FN4A 8AT1A 4KCGA 3W5CA 2Q3LA 2V7QA 2XNCA 1L4YA 2ILVA 1LC0A 1WKVA 2R6FA 5FBQB 4L15A 3UNXA 4K0KB 1TMYA 5HIJA 4CRWB 4OU5A 1MH9A 3P9CA 3G5MA 4QZVA 4JLNA 2YDXA 4MJLA 3CN7A 1QIFA 2P11A 4OA8A 3A2MA 4QOEA 1KK3A 4FCWA 1KH3A 1VDMA 4RHCA 4DCJA 5IT4A 3S44A 5ITZB 3AFMA 3N7AA 2ES4A 1F9AA 1S01A 2YXBA 5K2MA 4LV8B 5FKJA 4E03A 4W1PA 3SSNA 2HLHA 1SHJA 4RFSB 4B8YA 4PY2A 4HVLA 4OQNA 1P7VA 3D43A 2JEZA 4NXNB 3I1FA 3N2YA 1D2CA 1BE8A 4G0YA 2DUMA 4MGYR 1DT3A 5FBZA 3I9OA 1KI9A 1T9ZA 2HF7A 3GZTB 3H6GA 2O1SA 4NCNA 4Q3LA 4TLBA 1REQB 3BE4A 4NENA 5KTPA 3U7GA 1ZU4A 1RKUA 4K8OA 3FLMA 5KHOC 3PFCA 1I5OA 2ZVPX 4LC0A 1TLTA 2QN8A 1SU7A 2P77A 3G1UA 2P9JA 2GESA 2PL5A 1LTQA 2CC2A 2WSLA 3K8YA 1SXIA 5KINB 1TMOA 1M2KA 2P30A 1OTHA 3DTYA 1YBVA 4LX8A 3GAAA 4ALNA 1Z68A 1IVNA 2YXNA 1PJBA 2C99A 3AHEA 3CXUA 4TL7A 5EZYA 1X86B 5TPZD 4EVSA 4UHKA 3P94A 1U0EA 1M10A 3GEBA 3LLSA 4OI1A 2V6JA 3ZWNA 1QU3A 3UOWA 3N8KA 2R1VB 1Z0UA 1U7XA 4QDKA 2PY6A 4EKGA 5HF8A 4Y2XA 2R25B 2CY0A 4HQLA 5G1NA 4JJEA 1U28A