3OQ1A

Crystal structure of 11beta-hydroxysteroid dehydrogenase-1 (11b-hsd1) in complex with diarylsulfone inhibitor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
261
structure length
261
Chain Sequence
QPLNEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The synthesis and SAR of novel diarylsulfone 11beta-HSD1 inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 83
structure length 261
sequence length 261
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2010-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3oq1A00
1ISGA 3DONA 1YBMA 2QRKA 4OKNA 3M6IA 3ROPA 3KOUA 5ENDA 1LNQA 1ZK2A 2NWQA 2QZ9A 3BTUA 3L77A 2DAPA 5BNTA 4J2OA 4DLAA 1E3WA 3ONEA 2VYVA 5ES3A 3E9NA 4Z0HO 3Q2IA 1JQBA 4OSOA 5IF3A 4ND3A 4XQCA 1EBUA 4LN1A 3FI9A 1P74A 1IPEA 3IUPA 3D64A 3GDGA 3JCZA 3DQPA 3H9QA 1C14A 3PFWO 3LQFA 1VJTA 5L40A 1HE4A 3TRIA 3PHIA 1RJWA 4R9RA 1ENOA 3WTCA 3DWFA 4R9SA 2NACA 1XGKA 1U2DA 4LW8A 1DRWA 4CMEA 1B8VA 1LJ8A 3RU9A 4CQMB 3VKUA 4GKBA 2H1SA 4W99A 4AJKA 5IZCC 4CQMA 1FDWA 4FFPA 4DPKA 1I2BA 5I7SA 4CLDA 1N2SA 1XYGA 1U28A 3JQAD 1T2FA 4HFMA 4E0BA 3ON5A 2OP1A 2G76A 4FJ0A 2JL1A 4MP3A 1VL0A 1YO6A 2X7HA 3QVTA 3FHLA 4UUNA 5A9TA 1OOEA 4CMBA 3QY9A 1NFRA 5G0VA 4EITA 2DC1A 1BTOA 2J3KA 2IEDA 1T4BA 2I66A 1RM5A 2HQ1A 2V65A 3WIDA 4J4TA 3NKLA 3E1KA 2HRZA 1A9ZA 2YV2A 4J1QA 1BWSA 2VZ9A 3WOHA 4YAKA 1PS8A 2WDZA 1R16A 3KYDB 3PJDA 2X0RA 3AY6A 1UP4A 4U7WA 1HLDA 1ISFA 2P4QA 5ENVA 3QWHA 2AEMA 2IYPA 1EQUA 3DZGA 5I9LA 3PJGA 1N7GA 3S2EA 2J8ZA 4CR7A 2CDCA 5ER9A 5A9RA 1EK6A 4PZCA 4RZIA 5IJZA 2NV6A 4YCAA 2PD3A 2PZLA 1PS9A 1JW9B 2ZATA 4I8XA 4YJGA 1DSSG 4NJMB 2RAFA 1MA0A 1QXSA 4J2HA 4RQUA 1T26A 4NU6A 4YJHA 1LRJA 2VYVD 4ZQHA 3WFIA 5GZ1A 3S1LA 4B3HA 4TKLA 3TWOA 3ROKA 2F00A 3G3EA 1GAEO 2ZB8A 3ZW8A 5IN4A 5T67A 1J49A 4CMIB 1VL8A 2EF1A 5B1YA 1MGOA 3C1TA 3H3JA 5A04A 1QYVA 5TT1A 1I5RA 3WYBA 4AVYA 1HYEA 4WLNA 1BMDA 2HU2A 4CLEA 1ISJA 4BOYA 1ZSYA 3PZRA 2AQKA 3GZNB 2QRLA 3PDJA 3I5MA 2CVQA 3DOCA 1PL7A 3GQVA 1YRLA 1I3MA 5CG1A 3WQRA 4R5MA 4I9NA 3S2IA 1SO8A 5AOVA 1XA0A 2X9GA 5F5LA 1P77A 3BMQA 4YAGA 3KETA 4W9NC 3AUUA 3RUFA 1TVEA 2FPGA 3E6AA 4W7HA 2HMVA 2BGKA 2WE7A 3GK3A 3H7AA 4BNZA 5CFZA 3GHYA 1B16A 4YT4A 4N5MA 3FPLA 1BRMA 1BVRA 1YL5A 2YFHA 4QXMA 3VPHA 4FC6A 1XWFA 2WEKA 1LDNA 4WLVA 3UCXA 2HJSA 2JAPA 2P4HX 4BKQA 4II3A 1DEHA 4AJIA 5A4DA 1KVRA 3HWRA 1GQQA 3R0IA 1SPXA 1X14A 4FJ2A 4KWIA 2YQ4A 3PI7A 3U62A 3PFFA 6LDHA 4G65A 5L4SA 4LCEA 3VPGA 1A9YA 1T2CA 5KNLA 5JAIA 2CMDA 1M6WA 4N5LA 3LSYA 4GMFA 4CLXA 2Y0EA 1VL6A 3HN2A 4JN6B 3KHUA 2NLOA 4BKUA 1WLYA 4KTTE 3VHRA 5GZ6A 4NBWA 4C7KA 1SZJG 3FPCA 4YJFA 4LSWA 1YQDA 2W8ZA 1U4SA 3FNFA 3JQCA 2ZJ0A 1NVMB 4GI2A 5JC8A 1YBVA 4WCFB 5TRTA 4BL5A 5I7FA 1H0KA 1E1NA 2YDXA 2BF7A 3LT1A 1R4MA 5KCZA 2YHUA 2YUTA 5DULA 4GKVA 3Q2KA 3T4XA 5T64A 4BGUA 1HZZA 1C1DB 2UV8A 4W7IA 1LQUA 3GPIA 4CM9A 3PHJA 3TF5A 1ZUD1 3WJAA 1LDYA 2JJYA 2LDBA 1V3UA 3C8MA 3PYMA 4AJOA 3NTRA 2ZCVA 2Q1TA 1SMKA 3NX4A 1E6EA 1I01A 3OICA 4F45A 3G49A 1P45A 4ONEA 1B3RA 5BR7A 3L6DA 4XRGA 4TSKA 1HYGA 3GNQA 3U9LA 3WYEA 2NSDA 3ZZNA 1KEWA 2D59A 4B7CA 1LDMA 1CQJA 2JFFA 5CEEA 4BO7A 3I4CA 4KUGA 4OOFA 2EV9A 1PGJA 4GLLA 3GA0A 4PG6A 4WUVA 4BO4A 4J16A 4D3DA 3CMCO 3QRWA 4BB6A 2ET6A 3VDRA 2PY6A 2NNLD 4NFSA 1EQ2A 5L3ZA 1T4DA 4W9NA 1I0ZA 3HADA 3OH8A 1T2AA 4KDEA 2ILTA 5EESA 2ZTUA 3QVWA 5L45A 1JKIA 1E3SA 2C2XA 1LC0A 1QV7A 2GO1A 5JW6A 4D3SA 5CDTA 1IL0A 3ZHZA 4GX2A 4ALKA 2VHXA 3U5TA 3HDYA 2HK8A 1PZHA 2B35A 3U0BA 1XR3A 1B0AA 1ONNA 4E2ZA 1HEUA 4RO0A 3OQBA 2J5KA 3GUYA 2PGLA 2Q45A 3C7AA 4CUZA 3CINA 4N5NA 3NUGA 3JD1A 3DZBA 5GZ3A 3GDOA 2Q49A 3UKOA 3GVCA 1DC6A 3JD4A 3NDIA 1DC5A 5KTKA 3OQ6A 3DBRB 3VZPA 1B14A 1OMOA 1CJCA 4BO1A 2C7GA 2JKVA 1WDKA 3PWZA 5I9MA 2AG8A 1GYRA 4KWHA 2NTJA 1QR6A 3OBBA 1B8PA 2QX7A 1WDMA 2H5LA 4E33A 3H8VA 5TF4A 4HNGA 5IN5A 3ZGYA 1KETA 3V1YA 4Q9NA 3GDFA 4OAQA 1RM0A 4RPHA 1MP0A 1Z74A 1L7DA 3UXYA 5G4KA 2B83A 4PLZA 2C20A 5IXSA 4OM8A 4XQGA 4DC1A 1IOLA 2NTVA 4ILKA 2Y68A 3ANLA 4QSMA 3GEDA 2DVMA 4QUKA 3KSZO 2VZ8A 3AU9A 3UF0A 1DAOA 4AICA 3H2SA 2PKQO 1QSGA 4L73A 4LCJA 4CMEC 1Q7GA 1MXHA 4GL4A 1ZVMA 3F46A 2BRUA 2DKNA 4IS2A 2DPGA 1GV1A 2EJVA 2BHLA 3BTVA 3VZRA 1YB1A 3IOYA 5T6BA 2YW9A 4NFHA 1GYQA 1GUYA 1U8XX 1KEUA 4ZVVA 4CM1A 1NPDA 1NHWA 4PG8A 2W2KB 3G79A 3AY3A 2BFPA 2DLDA 3H9EO 3PWSA 1ZCJA 4RF3A 1EVJA 4C7JA 4AL4A 5K0ZA 1FDSA 3HG7A 1LDBA 2ZTMA 4L9RA 4D41A 2XF8A 4EGFA 5F1OA 2RIRA 5HS6A 4YRAA 3LC7O 3ROQA 3FBGA 4WE3A 4DVJA 3JQGA 4RVHA 3LC2O 3I9KA 3LLVA 5AXDA 1GQYA 2CNBA 2CSUA 4Q3NA 4RORA 1NVTA 3RUAA 4IS3A 2DBZA 3RAJA 2PK3A 4D3FA 1PZEA 2PZJA 5TT0A 5TLSA 1XSEA 3ANMA 3INRA 4CM3A 3QIVA 4DPLA 4M1QA 2O3RA 2P91A 1JAXA 4H3VA 1K6JA 1R0KA 3O8QB 1TA4A 3UN1A 5LC1A 1YDEA 2X9VA 2B4TO 1R66A 3FWNA 1DJNA 4EUEA 3BMCA 4PCVA 4J7UA 3MJEA 3ZHXA 5JAZA 2PV7A 1DIAA 1DRUA 4R3WA 1P0CA 3H6KA 4HBGA 1BG6A 1UXJA 3NDJA 3TL3A 1O5IA 4ESOA 1GEEA 4B7UA 4MKXA 4A2CA 1KS9A 3OEWA 4WLEA 5DNAA 3K96A 1D8AA 3AOGA 4RF2A 4Q3CA 2B0JA 1V3VA 4PLPA 1TXGA 1YS4A 2AEFA 3STHA 1AXGA 3ZNPA 1VPDA 4BVAA 4FB5A 3FR7A 2B37A 1P1IA 3SBOA 3H9JA 2PD6A 4L4RA 4J90A 2Y1EA 1U1IA 2DBQA 2X5OA 3FTPA 1YJQA 1UH5A 2CZCA 3WGIA 5DCWA 2JD1A 3ZWMA 1F8GA 4PN3A 5ILOA 4E5NA 3L6EA 4YT5A 1SBYA 3WLEA 4HWKA 1UXHA 5TSDA 4FD3A 4DPMA 3U49A 1EDZA 4MKRA 1SC6A 4OHUA 1K3TA 1AHHA 3PEFA 3I9OA 5A06A 5I7VA 3OJLA 4NU5A 4CMJA 4WASA 1UXGA 1JLLA 4JP3A 4DYVA 1MFZA 3IQDB 1PQWA 3JYLA 2Q4EA 2PGDA 1XU7A 2C54A 4RPJA 3DDNA 3MJ4A 3A9WA 1ZFNA 1BDBA 1Q7BA 5AQ1A 1FJHA 1QLJA 2CFCA 2IDZA 5HA5A 4ND5A 3BIOA 1BXGB 5L9AA 2A9FA 3BMQB 1AUPA 4XYBA 3BHJA 3EZYA 2OZPA 3NEPX 2G1UA 1VLLA 2GGSA 1BXKA 1PSDA 3WG9A 3ZNQA 4BO3A 1LA2A 4IIVA 5COBA 4EUHA 5K6AA 2EERA 1MX3A 1E6UA 4E3ZA 4QX6A 3O9ZA 2G0TA 4TRRA 3FRJA 3SLGA 2FRDA 1HDYA 1E3JA 1R4NA 3RU7A 4GX1A 3DZHA 4GX0A 4L4SA 5KJFA 1F17A 4KP7A 4C4OA 4IIUA 3IJPA 1E7YA 2DFDA 1O95A 4LGVA 5CHEA 3TZ6A 2Q4BA 3C24A 3KB6A 4D46A 4D0SA 1ADCA 2X23A 3FNHA 2FSVA 2Y67A 3H5AA 1AGNA 5DBGA 2QG4A 1X0XA 3PP8A 2Y0DA 3A06A 4S3MA 4XB1A 4DIBA 2FPPA 2DTEA 3KYCA 2W2LD 3E5RA 3T7EA 3ZCXA 2XPCA 3R3SA 4FFNA 4CLRA 3TJRA 1YB4A 4ZRMA 3EK2A 2OUIA 4GWGA 1UZNA 4IQGA 3H65A 5AVOA 1X1EA 3E9QA 4J9VA 3I9LA 2JHGA 2RHRA 2JFHA 3X2EA 4BNWA 1P33A 4R69A 3TPCA 5TQVA 4JLWA 2R2GA 4BNFA 2WSBA 1N92A 3GRPA 5JNLA 4HUJA 4U6QA 4WOKA 4YAIA 1TEHA 4M54A 4L76A 3AY7A 3CKYA 3H2ZA 3HZZA 1I32A 1XU9A 2BI8A 1E5LA 3F3SA 5DDIP 2C29D 2CDBA 2AE1A 2YHIB 4U0KA 3B1KA 3V8BA 4RVSA 3C1OA 3UFXA 3UVEA 1QYXA 1U9JA 2LDXA 4Q3EA 3G1UA 3BTSA 4WCFC 4BQRA 3IAHA 2V6GA 3UICA 3E18A 1C0KA 3NT5A 4BGIA 3F4LA 3JYNA 4FN4A 1R0LA 1GUZA 5C7OO 4BS9A 3I6IA 4B4UA 4MO2A 2W98A 3W8EA 4A0SA 4I5FA 1W0CA 4JJGA 2VT2A 1SB9A 5JYDA 1CERA 3H5RA 2HRBA 1EVYA 5DF1A 3KSUA 4RDIA 1B3BA 3F47A 2PA3A 2X5JO 2JFGA 1F12A 1Q7CA 4XEHA 5EQDA 1YL7A 3VPXA 4N7RA 4B3IA 2WE8A 1EUDA 4YRBA 1XQ1A 1GQ2A 4RLHA 4ALLA 1NBOA 1N7HA 3AI1A 3M2PA 1PGQA 1IE3A 3K8ZA 1ISHA 2NUAA 4BV9A 3EZLA 1CIVA 1LSSA 2ZK7A 3IL2A 1XDWA 2GERA 3GF4A 4BNNA 3INGA 3CIFA 4TVBA 4RF4A 1NTOA 3RASA 1V8BA 4F6LA 1C3VA 3D0OA 4OQZA 3AOEA 1PZFA 3FCOA 2QRJA 3CMMA 5KJEA 1VKNA 1YDWA 4BKPA 1BXGA 5L4NA 1ZXLA 4Y9DA 5A5EA 3WWZA 3JYOA 1ISMA 1ZK0A 3VTZA 1E3EA 4ID9A 3JQDA 2DFVA 4MOWA 1XQ6A 3LU1A 5KKAA 4XB2A 2E49A 1Z7EA 1H6AA 3ADPA 4E5YA 4UVDA 5DCYA 1EVZA 4M87A 4YAEA 1EEHA 2I99A 1Q1NA 2UUPA 3K5PA 4W82A 5F5NA 4BNKA 4PLYA 3ZWCA 5F1KA 4B4WA 1F06A 3KYCB 5KKCA 1OBFO 4HNHA 1DB3A 3UAGA 4Z9XA 1CDOA 1DFHA 3QA9A 3WGQA 3DZFA 1R4MB 1DDOA 4MVJE 3K2BA 2WD7B 4PLCA 1RM3A 3CE6A 1HXHA 4FSHA 1K2WA 3VTFA 1HTBA 1PL8A 4K6FA 5U1PA 3K73O 3W1VA 4O6VA 5ILGA 3OA0A 4IMRA 1UXKA 2J3JA 3OA2A 3BMCB 4CMIA 2AQ8A 3E82A 3F9IA 1LXCA 4IDFA 2X1HA 2FR8A 2QZZA 4Z9FA 3X2FA 1JA9A 2I3AA 3GLQA 5A05A 1D4FA 2PZMA 5C3MA 5JXWA 3JQ7B 1Y6JA 3GPDG 1HT0A 3ADOA 2O3SA 3GZNA 2R6JA 4KQWA 1RYEA 5FWNA 4D79A 2VZ0A 1O9BA 4RJTA 1R12A 3UW3A 1QYDA 1KVSA 2O3QA 1YOVA 3SC6A 4E4YA 1PGPA 3PQDA 3NGLA 2B69A 3NT2A 2IZ1A 4R68A 4WK6A 5TNXA 3C7CB 3I3OA 3IS3A 2I76A 3ZWXA 5FFFA 4H15A 1H2HA 5DOVA 3HUDA 3F5QA 1I2ZA 1VM6A 5KVVA 4JIGA 2PFGA 4OXNA 3T4EA 2E6UX 5THKA 1LI4A 1H9BA 1OC2A 2CF5A 3A28A 2O23A 2GLXA 2IZ0A 4PFJA 2R00C 3ZH2A 2E82A 1IPFA 5JE8A 3FSRA 3WTBA 3GOHA 3ANNA 3DMTA 1HE2A 1IHXA 2HO5A 4DMMA 3V1UA 3N58A 1M6HA 4NI5A 1ZNQO 2NU6A 2JAHA 3PPIA 2VOJA 4RF5A 4ZU3A 1ZJYA 3KV3O 2QYSA 1VI2A 1O94A 4OKIA 1GY8A 3PDUA 3ASVA 2PGJA 3DHNA 4DMLA 4UVHA 1N1GA 2Y1FA 4J6FA 3TZHA 4A7PA 1UUFA 4ND2A 1PIWA 4GPD1 5DBFA 3U09A 3GHHA 2Y05A 3HHPA 3GFBA 4E5MA 3U4IA 5CDUA 4JNKA 1BW9A 3L9WA 2YV1A 3GR6A 4M86A 4GWKA 4W4TA 3ZI0A 2VUSA 2GZ1A 3IIEA 5JCJD 1YE3A 1PJLA 4PIVA 4IMPA 3RCBA 3KTDA 3D7LA 4WLOA 1ISIA 3DTYA 4GQAA 5FF9A 1U4OA 3I52A 1PJCA 3RUDA 1DHRA 2E48A 2X58A 3ZV3A 2BD0A 1C1XB 2VNSA 4ALJA 1C1DA 2EKLA 2RH4A 4MINA 3W4JA 2VWHA 1BGVA 1D7OA 3W4IA 5BT9A 4E6PA 1I24A 3WGZA 4WKGA 2ZJ1A 4O0LA 4BO8A 4CR6A 1I3LA 1U7HA 1SCUA 2JCYA 1L1FA 3ZWAA 1CWUA 2G82A 4FOOA 3HDJA 1FMCA 1ZMOA 3EC7A 4JXKA 4BNJA 2B4QA 1LTHR 3IDSA 4CM9D 1DHTA 2WM3A 3WMXA 4ZHSA 2AE2A 3G0OA 3NAQA 1QMGA 3KO8A 4DQUA 3FN4A 4ZICA 1U8FO 2WYWA 4CJXA 3W6ZA 1Q0LA 2Q2QA 3JYPA 4PRLA 1C0IA 5K6AC 3IKTA 5DOZA 4DLLA 1EK5A 2WWRA 2C5EA 1Y8RB 2AA3A 2XXBA 2PD4A 3E8XA 5C5IA 1GTMA 1DFIA 3RBVA 4NBUA 1LSUA 4IM7A 3TL2A 2WD7A 2VYNA 3LF2A 3OMLA 1I30A 1O0SA 5COAA 5EQFA 3KLPX 3NGXA 3E48A 1PJQA 2VNAA 3TZKA 3DBRA 1T2EA 3ZHBA 5IAAA 1U7TA 2Q1UA 5EERA 4O1MA 5U9CA 4TZTA 4OOEA 4YB8A 2Z95A 3ABIA 3DEYX 4LRTB 1Z73A 2OBNA 1NX6A 3V2UA 2NADA 3K92A 3V2HA 2NU7A 3BMOB 3Q9UA 2GNAA 3JQ7A 3C3XA 1HYHA 3GG9A 3PWKA 4IZHA 3ITKA 1MV8A 2GSDA 5JCXA 5JCJA 3MEQA 4PG7A 2DUUA 1DPGA 1F0YA 2VWPA 3Q0EA 1K6IA 3GZ4A 3SC4A 5DZSA 2GR9A 3ONDA 1A72A 1OI7A 1VE9A 5A1TA 3F4BA 4KZPA 4XGKA 2Z1MA 1SOVA 4Z9YA 1AN9A 3JQ8A 4XYMA 3ORFA 4J0FA 4UUMA 4ITUA 1H6BA 3L9XA 3ONFA 4M89A 4OJNA 2X5KO 3H9UA 3JQAA 4PG4A 4Y6PA 5T8KA 3V1TC 2W90A 3RBZA 1JDJA 5CEJA 1XELA 2WYUA 5HWSA 4TWRA 4IUYA 4CODB 1GYPA 1ZO8A 4GX5A 4A5OA 4PLGA 2HMSA 3PQFA 2NVBA 4XR4A 4ZQEA 5KVSA 1Z6ZA 2HAEA 1Y8RA 3KSDO 4G81A 4BO9A 5B4TA 4IJKA 3WWYA 2BELA 1JVBA 4RCVA 4BHTA 2BMAA 4NJMA 3E9MA 5A9SA 4KTVE 4RQTA 2VRCA 3ZWWA 3G17A 3PK0A 2A92A 4BNGA 4EJ0A 1E6WA 1P1HA 3RKUA 3QE3A 5K9ZA 3TZQA 1FDVA 1WAMA 3PRJA 4UUPA 4HFJA 5JDIA 1HDZA 2X9NA 5BQFA 2YV3A 3ZNOA 3DBHA 4FC7A 5JMPA 4MKZA 1I10A 1DJQA 5JAQA 2HMUA 4XD2A 1ZK3A 1I36A 3UUWA 2WTBA 1ZMTA 3MWDB 3D1LA 4BMSA 4QQRA 1AXEA 2EKPA 1JN0A 5IDWA 3LK7A 4AJJA 1BHSA 2DUWA 3AI2A 1YB5A 2D4AA 5DP2A 1B26A 5BNFA 4FPXA 4JROA 2Q50A 3FD8A 3NTQA 1LRLA 1WVGA 4KMSA 2J3HA 3KM0A 5TIIA 5F1PA 4FW8A 2AHRA 3FTNA 1V35A 4HFRA 2OBYA 3SX2A 4HX5A 3VC7A 4A03A 1LBEA 1ML3A 3D4PA 4OSPA 2AG5A 3C85A 1ADBA 1PJSA 1A7AA 2FSSA 1WDLA 3GMDA 1NM5A 4YT8A 3K30A 1U3TA 2B5WA 1H9AA 5IZ4A 1NPTO 3CH6A 1E7SA 5KVQA 1J6UA 3KZVA 3EY4A 4XR9A 4IQ0A 3QLJA 4K6CA 1EE9A 1G0NA 2VUUA 3I9MA 1EUCA 3KVOA 1L7EA 3N74A 2Q1WA 2ZB7A 3JD0A 4D43A 1A27A 4JP2A 1AE1A 3EDMA 1E1LA 4YA6A 1NVGA 1YWGO 1GEGA 4ROSA 2WMDA 4K9DA 4E30A 3K2EA 3VVCA 3AJRA 4BO5A 5JDIC 5IXYA 3ENKA 2EHDA 3WLFA 3ROMA 2X0NA 3EW7A 1F8FA 2AMFA 3D5TA 5TGDA 3ZV5A 4TKMA 3JQ6A 1TLTA 1D1SA 1GADO 2RBEA 3OP4A 1R0SA 4FGSA 1EE2A 1H5QA 1NFQA 3GEMA 2CD9A 1W6UA 2HCTA 4G5HA 5IFLA 2GZ3A 4CV2A 2AEJA 5ITVA 5A03A 1XLTA 4ZQBA 3TNLA 1LLQA 3DXFA 4BQPA 3S2GA 4FFLA 1HETA 1X13A 3OF2A 3Q1LA 5JC1A 2J3IA 4DQXA 3TSCA 5BSGA 1Z75A 5JSFA 2NVUB 4NBVA 3EYWA 1HDGO 3NV9A 1DOHA 2ZYAA 4JCOA 4N18A 5HBRA 1RKXA 4RPGA 3RC9A 3UCFA 1OZAA 9LDBA 1S7CA 1Y5RA 2H6EA 4FIZA 5H83A 3ZU5A 4CMAA 1HZJA 3MWEB 3AM4A 1YJ8A 2OHXA 4XJTA 3TQHA 3RC2A 4BNYA 2C5AA 2IYOA 3RROA 5L7TA 2I6TA 3FF4A 2VTDA 4OL9A 5EL0A 3HQ4O 1PS0A 3DMTC 5MGBA 3O4RA 4CL3A 2BFMA 2EP5A 4E13A 2FWMX 4R1TA 3LC1O 1ZK4A 2DBVO 2EWMA 2FOIA 4AJ2A 4RPLA 1P0FA 3F5SA 2B4RO 3QWIA 3VH3A 4EEZA 4J43A 4QT0A 3RUCA 2EW8A 2O48X 4IY1A 1N9GA 3M1LA 4O59O 5BSFA 3B6ZA 4BKOA 1LLDA 1RM4A 5G0TA 1KEPA 1R4NB 3NDRA 3RSHA 3BTOA 4BO6A 3WDSA 5TS3A 3ICPA 1ONPA 1Y5MA 4BGVA 3R6DA 4HP8A 1PL6A 4Z0PA 4CMCA 5J23A 4FFRA 4JBGA 2TMGA 1LDGA 2O3TA 1QKIA 1DC4A 3ASUA 2TMDA 3KBOA 3BA1A 4OIMA 3TOZA 5FEUA 4IDDA 3KUXA 3PZBA 1IY8A 1P44A 1UZLA 1VRWA 1YQXA 2I9PA 3ITDA 4PG5A 4B3JA 4J9UE 2VHVA 2I5PO 4LK3A 3RBXA 4Z6KA 2ZB4A 2IRWA 4Q3DA 4PLTA 3VDQA 1HSZA 5MDHA 3WNVA 4XA8A 1FK8A 4MVJA 4ND1A 5C37A 3AUAA 3JYQA 4R41A 4ND4A 4UEKA 4GSKA 1U3VA 1O8CA 2ZYGA 3JQBA 3L6OO 4S1VA 1IYZA 2P5YA 1MUUA 2VCYA 1P3DA 5HS4A 2O2YA 1P1FA 2W2LA 4GH5A 4NJOA 5DN9A 3ZU2A 3AOEC 2VN8A 1Y7TA 4OMUA 2O3UA 4IBOA 1YQGA 3OIDA 5FI5A 1LSOA 3GGOA 3HB4X 3H9GA 5T8KC 1J0XO 1UDBA 2FPIA 1NWCA 3H4VA 4LMPA 2NU8A 3OHSX 3VKVA 3OEYA 3SJUA 3DFZA 3KYDA 4XYLA 4E31A 2DU8A 3L0DA 4UREA 3UGKA 5BSHA 3PJEA 4F3YA 1T1RA 2V6MA 4AG3A 1PR3A 1FXSA 1ONOA 3VVBA 1NWHA 2B36A 4D7AA 4RV9A 2HLPA 2J5RA 3JQFA 4O63O 4RPKA 5G2OA 3OJ0A 4I9UA 2NVWA 4B4VA 3IMFA 3PXXA 1MLDA 4TVOA 4P8RA 1P9LA 3HDQA 4LVUA 3D3EA 3GNTA 1E7MA 3MJSA 2GN6A 4Q3AA 4F6CA 4ZGWA 5H81A 1NR7A 2O4CA 2BLLA 4GMGA 4HY3A 3QWAA 4IDBA 4CL8A 4JK3A 4BMVA 1C0LA 1EBFA 1Z7BA 3C1AA 2VHZA 1T25A 1LUAA 2HDHA 3EVNA 3QQPA 4EJMA 5ICMA 4P38A 3RUIA 4K28A 4DUPA 4D45A 4NNJA 3CUKA 4J1TA 1DO8A 2OOSA 3ZN2A 1V6AA 4GLOA 1V0JA 1ZSNA 5KVCA 1WNTA 4DRYA 1NFFA 2ZQZA 3AFNA 5CDSA 1YL6A 3DHEA 4DQVA 3JD3A 4YACA 4BNIA 4NG5A 4EJ6A 1UXIA 2DT5A 5B12A 1XCBA 4CM5A 3SJ7A 4NK5A 4B8ZA 2QQ5A 4AJNA 1HDRA 2IXBA 4FQ8A 2D3TA 2J5QA 2SCUA 3WSWA 3L4BC 3WIEA 3ULKA 4CLOB 3GAZA 5JS6A 3CZRA 4XYEA 4B8WA 2PWZA 3HFGA 3OIGA 3WBBA 2C82A 1OC4A 3QHAA 1EFKA 1EZ4A 4U6SA 1MG5A 4RVFA 4IJWA 1ADGA 2X0JA 3RI3A 4D42A 4YJFB 3KRTA 4DYDA 3W8FA 3U4CA 3DHYA 3WNQA 1PJ2A 3HSKA 4R54A 1IHYA 4A73A 2O2SA 3CSDA 1U5AA 3ZWNA 3RFVA 1HSOA 1I3NA 3GT0A 2O4UX 4EDFA 3QSGA 3Q3CA 1M75A 5HM8A 5A5FA 1NAIA 4LSMA 4QO8A 1EMDA 1HL3A 4YBZA 4NIMA 4II2A 4CMGA 2OO5A 3OIFA 4MIEA 4I5EA 1GZ3A 5G0SA 3RVDA 4INAA 4PLHA 3PYXA 4A27A 5CP8A 2YDYA 1Q2XA 6ADHA 2P5UA 3DFUA 4D0RA 5JBIA 3PLNA 1EUZA 8ADHA 4J7CA 1DBVO 4BNLA 1UR5A 1EFLA 1PQUA 1IUKA 1X7DA 1FDUA 1X7GA 3EMKA 4XGIA 2CDAA 3OJFA 3GY0A 2FZEA 3KEOA 3WB9A 3S2FA 1YONA 1JKJA 2BFOA 2X4GA 1NYTA 1UAYA 4BIIA 4J4HA 4WGGA 4RDHA 3GEGA 5TC4A 1N8KA 1KIFA 4EUFA 1WPQA 1HE5A 2PR2A 2W4QA 3L4BA 4R1SA 2EXXA 4OO3A 4AJ1A 4CM6A 2YQ5A 1H6CA 2GN4A 3PHLA 4P22A 5A3VA 1H93A 1VJ1A 4NH4A 3TDKA 3U3XA 3GH3A 3DTTA 4P4NA 3LDHA 2Q2VA 4K1LA 3QVSA 1KVQA 4E21A 5EINA 3UHAA 1BW9B 4NQZA 1OAAA 4XYGA 1PGNA 2D0IA 3GC6A 4IJUA 4KUEA 4IQ8A 2NQTA 3I83A 4QFDA 4CV0A 4CV1A 2X6TA 5L4LA 3GN1A 4XZ3A 1MB4A 3D5QA 4E5KA 5A3JA 1Y9EA 2P9GA 2ZYDA 3EVTA 3MCVA 2IXAA 2IODA 4MVJI 4J1NA 4YJGB 3QWFA 4FDAA 5DBIA 5LDGA 4XWYA 4WPGA 3GN2A 1KERA 5L7WA 4BMNA 4UVEA 4E2XA 1ZSVA 3ZU4A 1B8UA 3QVXA 4MVJG 2B5VA 3HNPA 1UJMA 5ITWA 4CMKA 1QYCA 2VUTA 1CEQA 3OQ1A 1X15A 4A10A 1KY4A 2OMEA 3HE3A 1ID1A 1H94A 1NHGA 3IUSA 2VHWA 1PJ4A 5G4KB 1N5DA 2P9EA 4MP6A 3FWZA 4FJ1A 2VT3A 2X86A 4Y6RA 3PLRA 3TOXA 3NJ4A 4M55A 4DIOA 4Y8VA 3D4OA 1ZBQA 3ZWBA 3MOIA 4RLSA 3RC7A 2EIHA 4MVJP 4DLBA 4WEOA 5H82A 1ZEJA 5CAEA 4X54A 1XKQA 3Q9NA 4XKJA 1U2GA 4CQMD 5IDYA 1B7GO 3GFGA 2CVZA 5AYVA 4AJHA 3PVZA 2DPHA 2D2IA 2HKIA 4WECA 4PLFA 1TI7A 2F1KA 5CDGA 3RQSA 3FBTA 2HJRA 1TT5B 4I1IA 4IDAA 5JDCC 1P31A 3JQBC 1B15A 3U4HA 3KYBA 1H6DA 2EEZA 4CM4B 5TX7A 3COSA 3ZV4A 3B70A 2JCVA 3OFSA 3RWBA 1B2LA 4H7PA 4BGEA 2GYYA 1ZEMA 2BGLA 5EIOA 4QFCA 4ZD6A 3DOOA 2PH5A 3WYCA 4B4OA 3WMWA 4M49A 1LU9A 2V7PA 3CTMA 5CDYA 2HMTA 4AJEA 2QYTA 4GVXA 2UUOA 3WQQA 4EBFA 3DBHB 2RCYA 1Y8QB 3P2YA 4ZJUA 1YVEI 1CF2O 1SEPA 4XRRA 2C07A 1E3IA 5T57A 1PWZA 1NNUA 1JWAB 3SVTA 3DAGA 4R5HA 4YAJA 2GF2A 4YTEA 3PGJA 4DA9A 4Y98A 1VSUA 1P1KA 3C7DB 5JO0A 2FP4A 3GGGA 5BSEA 3I9JA 2A4KA 1PZGA 3O8QA 1Z82A 4P4LA 4I5DA 3I1JA 1E7RA 4L4XA 4J4BA 2CF6A 1ZKMA 5DP1A 2QW8A 4BNXA 1NQAO 3ZNNA 2PH3A 1GCOA 1YBAA 1DXYA 2BKAA 4FS3A 1X7HA 2GN9A 2OL4A 3HFSA 5TJ9A 4AJ4A 1V3TA 2D8AA 4HKTA 4PZDA 2Y1CA 4J7XA 3G1TA 2JD2A 4EI2A 1R6DA 4MVJM 1I8TA 4NK4A 1ORRA 4E12A 4FR5A 1N1EA 3CXRA 2V6BA 2ZQYA 1M67A 4HADA 1QORA 3QJ5A 5CEFA 5I9NA 1KC1A 3DO5A 3JQ9A 4R3NA 1UZMA 3P5SA 4L74A 3ZDFA 1HDCA 4XIJA 5I8ZA 2HMWA 1GR0A 3WGYA 1K6XA 9LDTA 3FNEA 4K26A 3WFJA 1SNYA 2VWQA 3PIDA 1JKFA 3RFXA 1JAYA 1LRKA 2P68A 3KLMX 1LEHA 4Q39A 2OP0A 4YQZA 1QRRA 2I67A 1HDOA 3S55A 1QG6A 3RD5A 3DOJA 4QECA 4F46A 4CUJA 4J49A 3I9NA 2JD0A 3V5NA 4CR8A 3WJ7A 3GGPA 1GL3A 4LMRA 4YT2A 1J4AA 1IULA 1XEAA 2H9IA 3EHEA 3LVFO 4CV3A 4IDEA 3RUHA 2VRCD 3HDHA 2Q46A 4YRDA 4R01A 5CPBA 1NQTA 2AQIA 3ZWPA 2C7VA 2DTXA 4JGBA 3JV7A 2VQ3A 4N54A 1UAGA 1Q0QA 5F3RA 2FY8A 5JDCA 1G0OA 3VH2A 5KJ1A 2D5AA 5BNIA 3WXBA 2G17A 4RVGA 3AW9A 4ZQGA 2OXIA 5C7LO 4RGBA 2X8LA 2PTGA 1O89A 4AJPA 3MJVA 5L7YA 2YZ7A 1NPYA 2FR0A 4NR0A 1M2WA 3H3FA 4NBTA 4TMFA 1P1JA 2EJWA 3GVXA 1HLPA 3UH1A 3DBVO 2PKRA 2WD8A 4RL6A 1ENZA 1W8DA 4EW6A 1GCUA 2Q2WA 3RJ9A 4CLHA 5IG2A 3K9QO 4DTIA 2WJPA 1D1TA 2C0CA 3MTGA 1PJ3A 1M66A 1A7KA 2PNFA 4MDHA 4NBRA 4J1SA 4PZEA 4XIYA 3JQEA 3L4SO 3WQSB 3JQ9C 2UYYA 4CMHA 4OGWA 4Z3DA 1A5ZA 1A71A 1PJBA 4TZKA 1ENYA 3W8DA 2EGGA 4CUKA 3B20A 4NDNE 4J3FA 2GD1O 5GMOA 5COQA 2Y1OA 3AFMA 2HK9A 4PLVA 3QW2A 1KEVA 4YYZA 1MG0A 2E37A 4GSLA 4TRMA 3P2OA 4TROA 4MIYA 3ST7A 4BNMA 2XOXA 1HE3A 2VHYA 4OQYA 4WNCA 1EDOA 3RUEA 1Y81A 3OM9A 3CZMA 1MXFA 1O6ZA 5KJ6A 3OJOA 5JY6A 3JQAB 4L0QA 2VTEA 3D3WA 1ULSA 3HN7A 4GVLA 3ZV6A 2VOEA 3ICCA 1RWBA 5I7EA 3I4FA 4JBHA 5EN4A 1Y8QA 4WJZA 2Q1SA 4GAEA 1VC2A 3NJ8A 3INTA 4IDCA 1DIRA 4IDGA 4XQEA 3WX0A 3GAFA 5HRUA 1YOVB 2Y99A 2I3GA 5JPIA 1C1XA 4U0JA 4E5PA 5C7IO 4DIFA 2EG9A 4O5OA 4MVJF 3A4VA 1RYDA 5JLAA 3ZWYA 2XAAA 4EEXA 2VWGA 5A02A 5A9SB 3K6JA 3QP9A 4HFNA 5THQA 2AW5A 2H63A 2Y1DA 1DAPA 2W2KA 4FCCA 2FZWA 4YDRA 3DL2A 1PGOA 1SAYA 2ZKLA 3HB5X 3PTZA 3AUTA 3BHMA 4EZBA 1XHLA 4A26A 1HDXA 1LLCA 5DT9A 3OETA 3LF1A 2CUKA 5I8WA 1YKFA 2R00A 4WNIA 3JQGB 3QVOA 4WEQA 5U4QA 4BO2A 5AXCA 3P7MA 3L07A 1MC5A 4CM8A 4ALNA 3VZSA 4WLFA 4PVCA 1ZIDA 1E1MA 4YWJA 1ULUA 1Z45A 1CRWG 4IGEA 4R16A 4IPTA 4XGNA 2GN8A 4ZN6A 2Z1NA 3I23A 1UP6A 2QHXA 8LDHA 5JMWA 3QV1A 1H2BA 1X0VA 5FYDA 1QV6A 4BNVA 1BXZA 4NHEA 1AHIA 2OFPA 3A1NA 4BNUA 4CQLB 4J91A 2X0IA 4ALIA 4UEJA 1E0DA 4FFOA 2J6IA 4IJVA 3DC2A 5JO9A 5KWEA 4FBGA 3OSUA 1BDMA 1VJ0A 4R1UA 1K5HA 3BMOA 5JYEA 2UVDA 4GGPA 3WGHA 3IP3A 5JFOA 1GV0A 4W6ZA 1WZIA 4JQCA 2D5CA 1UDAA 3JQFC 4J0EA 2NM0A 2ZTVA 4I08A 5L51A 3GUCA 3FNGA 4DL9A 5G0WA 1VSVA 4E2YA 5ICSA 3AU8A 4CLRB 4FFMA 1ZJZA 1R15A 1OFGA 1WXDA 3SEFA 1DIGA 4PLWA 3WR5A 4YJDA 5GY7A 1NAHA 3NYWA 1E77A 1G1AA 4DBZA 1ZK1A 4G2NA 1A4UA 4MVJH 2PKQP 1J5PA 4Y67A 3ETGA 2UDPA 1JTVA 1DIHA 3PQEA 3ZHYA 4CQLA 4L75A 4D44A 2Y93A 1KY5A 1LLUA 4IGFA 4PGFA 4WCDA 3VPSA 3K31A 3AM5A 3BZUA 3DZKA 4BB5A 3SLKA 1RPNA 2FR1A 3ETDA 1HWYA 1U3UA 4YR9A 2FHSA 1S6YA 3AWDA 3MJCA 1E3WB 1ADFA 2CY0A 3GVHA 5EJ2A 2XXJA 3IJRA 2Q3EA 1GPJA 2V6FA 3JD2A 5G4LA 1DLJA 4NFYA 4CM7A 3B1FA 3TN7A 3EGOA 1YXMA 1E3LA 1SB8A 4HXYA 1HKUA 1C0PA 1QLHA 3ZWVA 2Y1GA 1BSVA 1GZ4A 2NVUA 1JU9A 2YHIA 3MJTA 3O26A 1D3AA 2ZTLA 5AXAA 3BHIA 3HJAA 4NPCA 1WP4A 4BV8A 2ZB3A 3BMNB 3S8MA 1NR1A 1ENPA 4MPDA 3VOSA 5B4VA 1MC4A 2BFAA 4Z0TA 4XX0A 1JVSA 2GPTA 1K89A 2OORA 5B4UA 1TT5A 1Q0HA 1YGYA 2GUGA 4FGWA 3P19A 5B37A 3WS7A 1U3WA 3M1AA 3PIIA 1WMBA 1I2CA 3DAPA 5F21A 1GUFA 2PLAA 2JHFA 5HTOA 4RVDA 2ZCUA 2DTDA 1VKOA 5G0UA 1PU2A 4IZIA 4XQ9A 2JCXA 3VPFA 4ALMA 3AI3A 2UAGA 4H16A 1XIVA 1SEVA 3RFTA 3TZCA 1E7QA 3WGGA 4R1NA 2EP7A 2PZKA 3PYLA 3RJ5A 2EW2A 3U4DA 1FDTA 4DBVO 3BMNA 3H5NA 3QWBA 3DZJA 2YYYA 3E5MA 4DWVA 1PJTA 5T5QA 1MFPA 5IZCA 1HRDA 2BGMA 3FR8A 4BO0A 4JX8A 1KC3A 1YH3A 3GVIA 4XDYA 4E2WA 3PGXA 4MVJD 5FI3A 1KOLA 3CPSA 1LX6A 4B7XA 3JTMA 3LT2A 3W4KA 1F14A 2OGUA 3F1LA 3I6QA 1PR9A 1ZXBA 4DREA 3AM3A 4JJFA 2DM6A 3JQ8B 3T7CA 4YPOA 2RHCA 4TRJA 4UAGA 1FF9A 3D3WB 1DC3A 1U5CA 1KVUA 1A4IA 4Z3KA 5IDQA 2FMUA 1Y1PA 4Q3BA 1KYQA 1G6KA 3WBFA 4HV4A 4FOSA 1WZEA 4MP8A 1E92A 2O7SA 2BI7A 4U5QA 4L8VA 4TRNA 4B79A 1R37A 4RZHA 1IZ0A 4KUHA 1QYWA 1K0UA 4GGOA 3O03A 4UEOA 5CPFA 4NZ9A 4BKRA 1Y9AA 3AUSA 1PEDA 2VRBA 7ADHA 1GDHA 4YXFA 4KQXA 5CG2A 3GMSA 3CEAA 4R51A 3AK4A 3GVPA 5DCUA 3V2GA 3WICA 3GNSA 3EAGA 4WLUA 2O7QA 4NMHA 1UDCA 3VH4A 1X1TA 1GFSA 1CYDA 4UULA 3TFQA 1PWXA 4LRSB 4MIOA 4URFA 5IDXA 3A14A 4QO7A 3BAZA 4XJSA 2GZ2A 5JAMA 2GRAA 4UUOA 4YQYA 4XCVA 1PTJA 2QIOA 2DQ4A 3LLSA 4YEDA 4CM8B 1ARZA 4WOJA 4YVFA 3Q11A 3DMYA 3R1IA 1LC3A 3ZWOA 4IXWA 4LISA 1CQIA 3KXDA 3MOGA 5KOIA 3IKVA 3DBLA 4DC0A 4BUCA 4QEDA 2E4AA 4DGSA 3OJEA 5LDHA 1T24A 1NQ5A 2EGHA 1NP3A 4RVUA 1T1SA 3LZ6A 3IC5A 1DIBA 3UCEA 1I3KA 1QP8A 1IZ9A 1M76A 2A35A 3F1KA 5AXBA 1T2DA 2NQ8A 3M2TA 4OYRA 5ER6A 1UP7A 3OECA 4UVIA 4Y6SA 5TJHA 2GASA 2YFQA 4MJLA 4R4JA 3WSVA 1EVIA 4ZRNA 2GDZA 1KVTA 4WCFA 3SXPA 1HF3A 3VAZA 5EMHA 3BXXA 3R3JA 2BH9A 4AFNA 2Y66A 2IZZA 4XDZA 3ZW9A 2HUNA 3RIHA 1NASA 1E7WA 2AXQA 4IXTA 7MDHA 1LSJA 3UOGA 1GZ6A 2P2SA 3NRCA 3Q6IA 4CLOA 3DB2A 3EUWA 2A94A 1SOWA 4PRKA 4JJIA 3JSAA 4KDFA 3BYZA 3NTOA 2RH8A 4ZA2A 2CVOA 3GG2A 4QTZA 2EKQA 1W4ZA 3NT4A 1WW8A 1N9GB 5EPOA 2YY7A 1NQOA 3DZIA 4IINA 1DRVA 2I65A 3PHHA 3D4NA 3E03A 1PX0A 1BVUA 2G5CA 2P9CA 3TFOA 4CPDA 3W6UA 1JWBB 2Y0CA 1DLIA 1I33A 5ADHA 5KJCA 3ETEA 4P4GA 2POQX 3DR3A 2IEBA 4CM4A 1ZW1A 2C2YA 4YJHB 1ZH8A 3MZ0A 1DFGA 1E5QA 3ENNA 3IP1A 3LT4A 4PVDA 2Z5LA 5KIAA 3PHGA 3LYLA 4M8SA 4OXKA 4UVGA 4AJLA 4OXYA 3RC1A 1ZZEA 2O50A 4JBIA 4BNHA 1GU7A 2X22A 3WGOA 4E32A 2HSDA 2HK7A 3N7UA 2FN7A 2DBRA 2WYVA 1IB6A 4I5GA 1LDEA 2YJZA 1NXQA 1XG5A 3DBLB 2C59A 3GRKA 5JY1A 1GPDG 1GD1O 3F6YA 2Q99A 1KBZA 4I9HA 1TB4A 1W73A 3MTJA 4U8GA 5L53A 3VZQA 4LVCA 3PJFA 2NTNA 1V9LA 3RKRA 1PQPA 3WGTA 4EYEA 4DXHA 3LT0A 4KOAA 3KEQA 2GCGA 1WMAA 2O3JA 3VH1A 4BNTA 2D1YA 2ZIZA 3O38A 5LCXA 2VYND 1P1RA 1E1KA 1WWKA 2IE0A 3DAFA 2AQHA 4ZQFA 1CETA 4TQGA 5L95A 1TT7A 4OH1A 3B1JA 4GBJA 3ZU3A 1LQTA 2NU9A
chains in the Genus database with same CATH superfamily
2IH4A 4FIDA 2P30A 1MU0A 4Z4FA 4OKNA 1WPGA 1IOWA 2HRCA 2XRFA 3M6IA 2EQAA 3ROPA 3L92A 2N42A 2P9TA 4WKBA 2Z58A 2X3FA 4WINA 1U8ZA 2XB4A 2PWYA 4YRZA 2DAPA 5ALWA 4NFLA 1PR6A 3TLAA 4IG9A 1ORIA 4J2OA 4EEZA 3DH0A 3IYLW 4XQCA 1EBUA 1SKAA 2WK1A 4EG1A 3JCZA 3OPMA 4DZRA 4KMMA 1MOPA 2VA9A 3HUFA 2OYRA 1HMPA 1VJTA 3Q5DA 2ZUUA 3CVOA 2B9VA 2YXNA 3TRIA 3GRUA 3PHIA 1QAOA 2J7KA 1ODKA 4R9RA 3CZPA 3UAWA 3WBJA 5KPJA 2VCHA 4DNOA 4LUCA 4UCWA 4H9GA 3CZAA 1RQ2A 4V0QA 2I29A 3EXHB 1RWVA 1J1IA 3I0NA 4COKA 5EJAA 3RU9A 2XTJA 3LQYA 2ZM5A 4YRRA 1HO3A 1Z33A 3QFRA 4YMTA 5E8RA 3T5BA 1VYUA 3EVDA 3QBJA 5I7SA 2C03A 1XYGA 5JISA 2FRVA 1A4XA 1IFXA 4DC9A 2VKTA 1ZRNA 3ORYA 3FHJA 4ERXA 2G76A 3F5DA 4MP3A 5AESA 5JJ5A 3QX9A 5F73A 2F8TA 2YWXA 2ZJBA 4Y9RA 4U7TB 4BDSA 2G88A 4QGSA 2VZEA 2IEDA 5FL3A 5KUTA 3O8OB 1KO7A 2GAIA 3HVJA 2HQ1A 2V65A 2ZZNA 2QMEA 3K0FA 3MUEA 2G4LA 3R40A 1H4TA 4J4TA 4PS1A 2CCGA 5ICCA 4J1QA 1A9ZA 4X1IA 3WOHA 4MR7A 3HR7A 3DTVB 5CA1B 4CF6A 1MO3A 2X0RA 3LPCA 4Q9LA 4CFYA 1JXMA 1P9RA 4AQYB 2QX4A 4F3TA 1RLJA 1HLDA 1SUBA 3M4JA 3BXFA 5ENVA 2O9JA 3GARA 3QWHA 2AEMA 2IYPA 1EQUA 4PZUA 1XEWX 2VYCA 3T12A 1J0BA 2Z0MA 4BQNA 4P4TA 5I9LA 5E3JA 3EGDA 2XCSB 1NMEA 2XBLA 1N7GA 2AFIB 2RFLA 2J8ZA 2I6FA 4GP7A 1VA4A 3S2EA 2OB2A 2HLHA 4NATA 1LWOA 4LC9A 2HRDA 1VPEA 5A9RA 1EK6A 4RZIA 2HIGA 3VNRA 1Q7TA 3BGDA 4WVLA 5IJZA 3PD7A 4YCAA 4YY3B 2UXDB 2PZLA 4E14A 1JW9B 2FSFA 4IQFA 4E09A 3M4YA 4NYIR 1Z0ZA 1DSSG 1Y4UA 4C29A 4CKCA 1PQ4A 1MA0A 3H84A 4YJKA 3H2IA 4I6EA 4JQSA 1LRJA 2VYVD 4B4DA 2P0YA 3MRVA 4RVOA 3ZBUA 4FGLA 3NFYA 3E22B 3G6KA 4TKLA 3TWOA 4QPZA 1J00A 1DMSA 2F00A 1ISPA 1RYBA 2DWQA 2JLYA 2VF5X 3G3EA 3O5AA 4WMLA 5CCDA 3ITNA 1FVFA 4HR7A 4PONA 5IUKC 3T7JA 4GO1A 2VJMB 3DF9A 2PO5A 3UIEA 2BBOA 5B1YA 3C1TA 3H3JA 4QIHA 3HVKA 1Y80A 3QVUA 4E5DA 4CTMA 1PKXA 1ZA2A 2I6SA 2WVAA 4OLBA 4AVYA 1Z0AA 2ZS9A 4TN1A 1ISJA 2YVLA 3ZS8A 2PUBA 3M0EA 5MN6A 4U02A 4ZPJA 3AF3A 2AQKA 2XMBA 3GZNB 5EHIA 1IHPA 2D0OB 2CVQA 2UYQA 4G25A 2H1IA 4HB3A 4OTZA 3D6NB 4BLRA 3QBDA 1I3MA 2QU8A 3WQRA 5CG1A 4R5MA 4I9NA 2CHQA 3LNCA 4MW0A 3S2IA 5DYNA 1BCRA 4GPZA 2WIJA 2X9GA 1FSFA 1Y6QA 2KMLA 3K70C 2HF7A 1IWBB 3DCJA 3U80A 3BMQA 1OXVA 3CNOA 3GLSA 4RADA 2PUTA 4ROTA 5B1EA 5E9QA 3WYNA 2BGKA 1NNLA 1XALA 1B8OA 2I4IA 2KHZA 4M1YA 4O4HB 5BWMA 3H7AA 2AI1A 1QH0A 4ISCA 4CF3A 3O4HA 2VVTA 3AESA 4YT4A 4YMGA 5M2QA 1KEZA 2VS1A 4N5MA 2JGEA 3RVKA 3DL0A 3IVRA 1YL5A 2GHTA 2YFHA 2HA5A 4Q82A 1XJWA 3VPHA 1U80A 1EP2B 2Q5HA 2W5UA 4XVQA 2XGMA 3UCXA 1F2DA 2A2ZA 3HSYA 2AZ4A 3PU6A 4D8YA 2GYVA 2GNOA 3L02A 2QD1A 2JDIA 3ILVA 3PGLA 4P2BA 2XZTA 3KX2A 1TPZA 4DLZA 3PI7A 5DGTA 4HMOA 4MGIR 4LMAA 1AKTA 2E7ZA 1XUOA 3VFDA 3BICA 4QM6A 4RVCA 1T2CA 4XJVA 3I76A 3ILYA 1Z5WA 4RKYA 4ENSA 1U7UA 1OBVA 3CLVA 3L01A 3LSYA 4N5LA 5EJ7A 2V96A 4JCCA 3KV1A 1M34A 4DV6B 7REQA 3KKLA 3U3DA 2AJCA 4KN8A 1WLYA 2Z09A 3D7SA 4N49A 4G0XA 4OLFA 4AP9A 1XTZA 4BFUA 1V25A 2IF2A 1OWOA 4YJFA 4QT4A 4GNRA 4I0WB 2Z56A 1WP9A 3BJZA 4MWZA 3WY9A 2VTBB 1ND5A 1Q21A 4N8EA 3SEAA 1YIDA 1RHUA 2W8ZA 2Y1KA 4M9SA 1U4SA 4RC9A 3VZCA 3IHTA 4LQ4A 3TTWA 1NVMB 4OMFG 4XM2A 3URMA 3T38A 5BUSA 1H0KA 1KPHA 2R1TA 3DOUA 1L5MA 3F3MA 3GJ6A 1DC8A 2VAXA 3LT1A 4UMEA 2O8CB 1SHTX 5AT1A 1K8ZB 2HHAA 1RQNA 1ZCAA 4MSUA 5DULA 1YTUA 3TLJA 3DKVA 4QYIA 1GU1A 1DX9A 4D80A 1M0EA 4D9HA 1YZKA 3WJAA 3THWB 3T95A 2I4LA 1W4RA 3DNMA 1WNFA 4E4RA 1V3UA 1ZQ9A 3NOXA 4MV6A 4UQLA 1IVNA 4G5FA 3OG9A 4KODA 1JNYA 4F45A 5KBYA 4IGAA 1CXZA 4Q9AA 4HSGA 3T4UA 3QQ5A 1S9HA 5BR7A 1E3QA 4RQAA 4XRGA 1UAAA 4G97A 4D9EA 3U9LA 4PBSA 1NVUQ 3UJNA 4NDAA 2QRVB 3GLHA 2Z8ZA 3DNFA 421PA 3I34X 4PBRA 4ZV7A 4L5IA 3RVOA 3OJXA 3T3EA 1L7NA 2BRUC 2VCEA 2Q6OA 4KUGA 5REQA 3ANTA 2IU6A 1OHHA 3N8IA 5LXTA 2FQ1A 1EUCB 1PYDA 4KFTA 4J3NA 2PM8A 3F97A 1UIRA 1T9GR 1K7EB 4MXDA 4BNDA 4NFSA 2GBCA 2NNLD 1Q83A 3DHWC 4MV3A 4K40A 2GLTA 3C45A 3PR1A 4KDEA 1WPXA 4AECA 4GSYA 4P83A 4CCSA 1XMPA 3JQPA 1ST3A 4EO4A 2FUCA 1E3SA 4BE7B 2C2XA 2QYHA 4DG8A 1LC0A 1WXHA 1A7UA 3NOQA 2C5FA 1FNBA 2VAMA 1HI9A 1T10A 1WTCA 5DIZA 2J3LA 4C6HA 4BQEA 1IL0A 2DUJA 2IGTA 5BSRA 4GX2A 1V37A 1S4QA 4P4SA 3X1WA 2HK8A 2QP9X 2B35A 2ZR7A 3BXPA 4FQ5A 4ZJPA 2ZRKA 1H0SA 5I3ZA 1XR3A 3MAAC 1TM3E 1ONNA 4E2ZA 3A11A 3EGEA 4RO0A 2BEWB 3OQBA 1U8CB 2EFCB 2Q45A 3GUYA 1FLNA 4WOPA 3CINA 3WDKA 1RPAA 1ZM2A 3BM5A 4KLAA 3BGSA 3JD1A 1RQGA 3DZBA 3EQ6A 3O83A 1GN8A 1KSHA 2ETXA 2G4CA 3C14C 3LW7A 5DRYA 2XYVA 2QSJA 5FRDA 5IRCD 4MUNA 3S1AB 1GL7A 1GARA 1DC6A 2Z5VA 3F67A 4BZQA 1H4VB 4BVLA 1E5TA 5LQNA 1E64A 1FLVA 3DBRB 1B14A 2AR0A 3IIJA 5T4FA 3D0QA 3S1SA 2QT9A 4PTYA 1H5UA 3CF0A 3PWZA 3V4PB 4B48A 2ZREA 1CE8B 5JD4A 2IHBA 4RHCA 4WAUA 1GYRA 1SIBE 3QTTA 1QR6A 2H0RA 2YVAA 5ELXA 3CM0A 1WDMA 4M8KA 1Z6GA 2QZPA 2BBSA 2H5LA 3T1VA 2PBLA 3H8VA 1XVUA 1YRAA 4I2VA 4Q9DA 1KF0A 3BT7A 3GDFA 3PCXA 3E7DA 3O0TA 3L8DA 3CUVA 1CR2A 1PTKA 1MH1A 3NVKI 3A6PC 2YN0A 1CY0A 4PLZA 2FEAA 3A1VA 4OM8A 5FOWA 3SJCA 2QXUA 1FP2A 4DIUA 1IOLA 5FUVA 1SC4A 2WA2A 4WZAE 3FPFA 2QYOA 4ILKA 1DG1G 5AW2A 2WYIA 4CCAA 3RADC 4BECA 1EXMA 1ZGHA 2LRHA 2LTAA 2Q27A 3C5CA 3R0QA 4A0GA 2I1QA 2F62A 2AT1A 4EHJA 2BDEA 3KSZO 3K4PA 2PJZA 4IHQA 1AC5A 2VZ8A 4LDJA 4Y9TA 3AU9A 4TYMA 2ZRNA 1RHRA 3HABA 1DAOA 2WUWE 4HUQA 4PPQA 4YP7A 1NSYA 3OPXA 3D2CA 4HH0A 2ZXUA 2HRQA 3GGCA 1Q74A 3TRKA 3T34A 2WWYA 5CD9A 2BFEB 1DQPA 2ZR9A 4QC2A 2Q5FA 5FOVA 1AV6A 3HEBA 3FPHA 3L0PA 3F46A 2BRUA 3B2QA 5BQXA 1T8RA 2HA3A 2RC6A 3OQVA 3FDJA 5BSWA 2JAWA 4BZWA 4DSNA 2IOYA 5EGSA 4FONA 2BFNA 3BTVA 3IJEB 1BWRA 1YB1A 3AEUB 4J0IA 4NBKA 1ADYA 3TXYA 1AO0A 3DEFA 3G5AA 4ETMA 3ORHA 3FCYA 1R5NA 2HNKA 3GYBA 1I2DA 1OZFA 1TDJA 1X77A 1KEUA 2AC2A 4P1ZA 5HYVA 1XRLA 2CFSA 4O4JB 3IDZA 2W2KB 4K8RB 3G79A 2EOAA 5DPMA 5E0OA 4F91B 1GO2A 1YTLA 1J9ZA 3AP2A 3T1TA 3ESBA 3IAFA 1EVJA 1RRCA 4AL4A 4D92A 5K0ZA 1FDSA 5FHQA 2J09A 3OZEA 4B2PA 1GOTA 1TIBA 2QNBA 3GFVA 2PUEA 5T4EA 4D41A 3AUJB 2XF8A 5EFZA 3ODGA 2A9KA 1PV1A 1Y34E 4Q4LA 1JLMA 2MWMA 2WI8A 4GXRA 1V7CA 2ZDGA 3JQGA 4RVHA 3LC2O 3EARA 1QZXA 2W2QA 5DTJA 2DEUA 1GQYA 2CNBA 4V0KA 2GQ0A 4HZIA 1NVTA 1JG7A 4IS3A 1EX9A 4TXLA 1DJLA 3RO7A 1J0DA 3LX6A 2JI7A 1KMMA 2RB5A 2PZJA 4D3FA 3THYA 3ER8A 1IXKA 3H2YA 4U00A 2MINA 3UB4A 1KQGA 3AF0A 3HRKA 4CM3A 4DPLA 3AJDA 1E8NA 1NVFA 4H3VA 5E95A 3PCRB 1TC1A 1R74A 2F3RA 4GRDA 3E81A 3OIUA 5LC1A 2XNSA 3ZCPA 3NEYA 4BTVA 3O8CA 4MROA 4P5EA 1G9TA 1NF3A 1ETHA 2B4TO 3AHEA 3S99A 1CUBA 3MWJA 3K7EA 4HNVA 5AHKA 7REQB 3ZHXA 5J1SB 3CVWA 3BWCA 3N59A 4AY4A 5IAKA 4DJDC 4R3WA 1P0CA 2CJYA 2NUPA 4KN6A 3NDJA 1KDVA 2Q0QA 1GJRA 5KOYA 4Y3UA 2FSVC 3H04A 3UMVA 2WQ6A 3KUKA 4B7UA 2XDQB 2CBGA 4CN8A 1KS9A 3P1JA 4O25A 5A4MS 2NVOA 2FPKA 3V8VA 4RF2A 4R2XA 3C48A 5FLKA 3UMBA 1Z13A 2B0JA 1DQZA 1U8YA 1C80A 1W87A 2DQZA 3EGXB 4KV9A 4MA5A 4PLPA 4RACA 3ZPXA 5CFLA 1VPDA 2W43A 4EG5A 2PD6A 4A15A 2DBQA 2X5OA 3OMWA 4Q1BA 3AQIA 1KO4A 4MS3B 4P81A 1GQFA 1VKRA 3ZWMA 1QFYA 5EMKA 4NG4A 4AUMA 1KJYA 1SBYA 1DRKA 1IEWA 1VLJA 2DP4E 1O3YA 1TYEB 4BFXA 2V3CC 2AWOA 3L7MA 5DEIA 2GRJA 2P9FA 4DPMA 4LK2A 3P9ZA 1BWPA 1SC6A 4YDHB 1PFVA 5K8JB 4YCLA 1LTKA 2WVGA 1IMJA 2X8JA 1R9MA 5EIEA 5I7VA 1XCJA 2XKAA 1NBEA 3OJLA 4IRMA 4MO9A 5ITSA 3QBTA 4CMJA 2LKDA 4N4AA 1KIAA 1UXGA 3K1AB 1FU4A 4JP3A 4X92A 4DYVA 1NOIA 4L5YA 5JSYA 3R5HA 3RYCB 3BFPA 2EC5A 3DDNA 2VRWA 2XNCA 1BDBA 3R3WA 5GJBA 1UDWA 4NXNB 1FTWA 3SLRA 4CEHB 4MVCA 4ND5A 1QMPA 4AB1A 3BIOA 1BXGB 3SSAA 5CH3A 4YWHA 1Q92A 4C01A 1SXJD 2QG9A 3BMQB 3K0EA 2FTKE 1M8FA 2ZYHA 4HVLA 4XYBA 4TVKA 4YX9A 3BHJA 3LSTA 5L3QA 2GPNA 4L3OA 4DCVA 3I5YA 3DW3X 2ERXA 4G36A 4YCBA 1PT6A 3KT8A 2G1UA 2A9OA 4YMLA 2P8JA 3IVAA 2AZMA 4FWTA 4N3BA 1Q95A 1TMKA 1U02A 2VDWA 5DX8A 2QVCA 1PG0A 1U9CA 1SU4A 1W93A 2Z3ZA 1OI3A 1XTUA 2XY4A 1A8SA 4EGCB 2SECE 1E6UA 2JIMA 2DGDA 3ISVA 3K0CA 1C4KA 1OYOA 4M0DA 5F78A 4ZI5A 2X2FA 4FX2A 2G0TA 2YJNA 3FRJA 2IFTA 3SLGA 2FRDA 2ZIVB 1YR7A 2XD4A 3GEBA 5A5GA 3DA8A 3DZHA 3TUJC 3R8CA 4L4SA 5IJXA 1XDGA 3C3DA 5JROA 3ZVMA 3RRJA 2JI4A 4IIUA 2R751 4GI5A 1PT8A 4FK8A 4LGVA 4C2AA 4C2UA 2Q4BA 1VLZA 3F74A 3KTOA 4HX2A 3P96A 4Q1DA 4ZOBA 3Q3HA 1ADCA 3I3SR 3TEJA 1Q3KA 2BM9A 3FNHA 2HLDA 4PRLA 3UWMA 1K4KA 3OZRA 1R0CA 1AGNA 3K9LA 1E66A 5DBGA 4CE6A 4X7RA 5FOTA 3CVXA 4PZZA 3VO1A 4EG3A 4HK4A 1LY1A 4XB1A 2FPPA 1N0WA 2DTEA 4GKAA 3ICQB 4KR0A 2IVZA 5BN5B 1N9ZA 5K20A 2QLJA 3KYCA 2QM0A 3UAZA 2DRIA 1ZD4A 3GDWA 4RDCA 2XPCA 3R3SA 1N6LA 4CLRA 2ZWPA 3T15A 2WJ3A 2VH5R 1VHDA 1YGPA 1HFJA 3B5IA 2O0HA 1KMCA 2PX2A 2VPZA 1ZDMA 2YJ4A 2JHAA 3E9QA 1S2IA 3H65A 3A58B 3ML1A 4MI1A 4CEHA 4PCAA 1NQXA 2JFHA 3IQFA 1R3DA 4I55B 3F71A 1MW9X 3OKAA 2G6TA 4ZYWA 3I9V6 2YVQA 4PC2A 1RAIA 2HWUA 3D3KA 5DX1A 5TQVA 5I47A 4G8DA 2YTZA 3MAJA 1Y4AE 1G8GA 4WOKA 1YR1A 4R6WA 4L76A 2PSDA 2DECA 1XRQA 1I32A 2BI8A 2ZRIA 2DFPA 1OF1A 2C29D 3W78A 2YKGA 4H6XA 2WIGA 2AE1A 3MN1A 3SVZA 2RJOA 2RGNA 1SKYE 3AF2A 3W5IA 3RSQA 1IUPA 4G9BA 3K0HA 1R64A 4DILA 1QYXA 1S96A 1V5WA 5DNUA 1J5EB 4D25A 5CXSA 4QJIA 5AKEA 3CY6A 3IAHA 1SKUA 2GBLC 1DAKA 2IW1A 3JRXA 3F4LA 1P6UA 3MJFA 2JCSA 1HBJA 3ESXA 1TU3A 5LMCA 3DDZX 3O93A 1HFKA 4MO2A 4MICA 3W8EA 2ZBGA 4E12A 2R1UA 1SVNA 4B3DA 4C76A 1OREA 1N2BA 2EW1A 2WTAA 3OUUA 3HI4A 4AC9A 5JYDA 4DAOA 3H5RA 2GCOA 2V5UA 5DF1A 4YV7A 5D00A 1O03A 3ZLVA 3F47A 3OCWA 8AT1A 2QAGB 5JLJA 1Z16A 1TM7E 2QAGC 3D3NA 4L07A 4XEHA 3X43A 2I2WA 2VJYA 1GA1A 4B3IA 2VP6A 1EUDA 5LKAA 3P5BA 1GQ2A 1H1LA 3HN6A 4LC0A 4XWAA 4MQFB 3ORRA 1KSJA 5I3CA 2H1RA 5IARA 5FOQA 2VR1A 1PG5A 2BIFA 1PGQA 2M98A 4ND8B 5DBHX 1ISHA 4LE0A 1JLLB 1UBFA 5JARA 1NJ5A 5KNBA 1CIVA 2A30A 3T5TA 2ZK7A 2D2XA 4Y1FA 1JDSA 1K4MA 5CBPA 2N9UA 4JI2B 1KQNA 2K7ZA 1T91A 1V8BA 3RASA 3PX3A 4OQZA 4PHHA 1S9DA 4R9VA 2FV8A 3L05A 4QLOA 4DQLA 2QRJA 5KJEA 3S7TA 2Q5LA 1BXGA 1O96B 2C3PA 1U1FA 2VP4A 2YJ3A 4V0NA 4YP1A 5A5EA 1CLUA 1ZK0A 1E3EA 1SH7A 2VNKA 3JQDA 1IMOA 3GJ4A 4MOWA 4CKBB 4EZEA 4YRNA 1J0AA 4XIGS 4BGDA 2V74B 1H6AA 1IHOA 4CHTA 4UVDA 5DCYA 3B9RA 4EW2A 1TA9A 4CNQA 3JARA 2R8RA 1VLMA 4UBMA 3HKCB 1H05A 5AM2A 3T5CA 1IQRA 2EDCA 3PHCA 4B4WA 2BSQA 1OBFO 1C3OB 1TCAA 2IOHA 1ESDA 5CYFA 3E3NA 4BVKA 1S1CA 4EHIA 1V8PA 3UAGA 5AOBA 3LHKA 5TQ2B 4F4DA 4TTIA 1WCIA 4V1CA 1N1DA 1PLKA 2DLCX 1RI1A 5IBCA 1HQDA 3B6JA 3MD9A 1IIRA 3QA9A 2QTBA 3WGQA 4UTZA 5JASA 2PVCA 3GPBA 4MVJE 1OAOC 3ZDCA 1ODLA 3NEAA 3GEHA 4TQUS 3TYXA 2Q3DA 1CUCA 1C8BA 1RM3A 3VNAA 1O94C 4FSHA 2JAUA 5FULA 1T1EA 1CJVC 3BKWA 4PFKA 3ROXA 3ELBA 1AKMA 5U1PA 1W85B 2G25A 2ODPA 3OA0A 1UXKA 3H2HA 3N5KA 1ACMA 4JJ8A 3NONA 4ASUA 2CL6X 3BGIA 1MTOA 4CMIA 4DEXA 1WO8A 4N03A 1NONA 4FOTA 2FR8A 2QZZA 3RFUA 3DEZA 2I4RA 2CEKA 2XDWA 2CXTA 3IKJA 1ZR4A 4GEKA 3D54D 3GROA 3L8MA 5A05A 2PZMA 4I14A 3G9TA 2WM9B 4RMIA 5EA2A 5ARCA 3UH0A 5L3SB 1ZD3A 4RXUA 3QMWA 5I48A 3ADOA 3DBOB 1AIPA 1B8NA 1T8UA 2R6JA 2ZWVA 5DLPA 2PAFA 5FPSA 3PQ8A 1E18A 1YHZA 1N8NA 4LHZA 4OXRA 5EYPB 4RJTA 2B1JA 3INNA 4IX1A 5IYZB 4JXXA 1ONBA 2EG5A 1RQLA 4MNTA 1YOVA 1E58A 3LCMA 2FN4A 4HL6A 1SURA 1XKXA 2R1VB 4L08A 4OJYA 4F85A 4EA9A 4WK6A 4RA6A 4R68A 3JSXA 3K15A 2DY1A 3ZWXA 5ARBA 2GXAA 3W79A 4H59A 1L1RA 4HDRA 2HCRA 5IM4F 1VGVA 3EXIB 5E2AA 5B7GA 2DULA 3IIMA 1KH1A 3F5QA 4KACA 3TKLA 1XMQB 4ZARA 2OXRA 1A2QA 1IY1A 4FDUA 3ZQ4A 5KVVA 3V7FA 2PFGA 4EAAA 2QZJA 4WOBA 3STUA 3T4EA 2E6UX 4GXTA 2PE5A 1LVGA 1LI4A 3C3CA 1LKZA 2ZJ4A 2CF5A 3D4LA 4QUIA 5JUWA 2R00C 4BC1A 2NYUA 1E2BA 3GOHA 1IHXA 3CTPA 2HGZA 3BS4A 4QYXA 1NMYA 2A0WA 4US1R 5DTIA 1TJPB 1EFTA 4ZAVA 4J94A 1YT5A 2FETA 4BRSA 2XCQA 5JBQA 3GU3A 1A8HA 4RF5A 4ZU3A 3SY8A 3WVNA 1FNCA 1KAMA 5FBRB 1Q0ZA 2QYSA 4B09A 4BFSA 3B3GA 1VL1A 4OKIA 5KO2A 4MQUA 1XZCA 3SDBA 1F6DA 2PGJA 3DHNA 1A2BA 5IVDA 3F7MA 5KU1A 4IH4A 1PSWA 5LOVB 3NKVA 1SQ6A 5AVTA 2BY4A 3ESZA 4YQEA 2G9UA 1J70A 2XUJA 1TD1A 1XD2B 2J67A 3B85A 3GHHA 5AO9A 3S5UA 3UC9A 3SHFA 2Y05A 2GXSA 1U0TA 3V8QA 3ZVRA 3ADDA 2QM8A 1XNHA 5GGYA 2ESRA 1BW9A 1GWNA 3R7WB 3W9YA 3ZDXB 4V1CI 2PUGA 3ZY6A 1GNTA 2GZ1A 4BLPA 3KOZA 4KFRA 4K9PA 2YWFA 4MWTA 1SGWA 2EKZA 4IMPA 3OFNA 3V3TA 3AR3A 2A84A 1Z17A 3KTDA 2J32A 2I80A 4GQAA 4MDYA 1DMRA 4MIKA 1RHKA 2C8JA 4UD6A 3RRFA 1OAOA 2X58A 4BFLA 3CLUD 4P80A 2BD0A 3MNFA 4Y18A 4D4JA 4FBLA 1JDBB 1C1DA 1AKVA 4I55F 4V0ME 2JJ1A 2WLSA 1VKJA 2QVXX 1I5EA 1UFVA 1D7OA 1BE8A 1N0HA 3HEAA 2WFMA 1GZHB 4NV1A 4NL4H 4ND6A 4OHCA 4WKGA 5BT9A 4DJJA 4ER3A 4BO8A 5F4BA 2ZUVA 2JCYA 1SCUA 1CWUA 1T2VA 1OXUA 1BKDR 4FOOA 2IYFA 4QLBA 5A7FA 1OXTA 1FMCA 1ZMOA 2GEJA 1OV4A 3BULA 4BNJA 1EFPA 1DHTA 2R48A 2WM3A 5CX1A 4U9IS 5EKTA 4XWOA 1ABBA 1LPSA 2FZ5A 2AE2A 4DQUA 4I1RA 1QMGA 4W8OA 1VOTA 2FFJA 1OAKA 1U8FO 2WYWA 5GINE 1G66A 3MTDA 2VA8A 1C0IA 5K6AC 2P69A 3A6FA 3RIGA 4O2AB 2VF2A 1NSFA 1BA3A 2RARA 1Q14A 2C5EA 2EATA 2XXBA 3UAXA 4C43A 4GM1A 1YF3A 4NZOA 1GTMA 2FEWB 4YO7A 5JWRA 4NBUA 4DXDA 3KR0A 5A3QA 2YASA 1LSUA 1QQ7A 1VECA 3H19A 4M1TA 5FBHA 3V8NA 4HRXA 4BE9A 3DDSA 1Z25A 1I30A 3JAWA 5AI5A 4M7WA 4KO2S 5AW0A 3KLPX 2RB4A 4IH9A 2PX8A 2YZ2A 2VNAA 4CIWA 5IAAA 1WB4A 1O94D 4TSFD 3SXJA 5U9CA 1E6LA 4YB8A 1JB9A 3B9QA 3CRQA 4LRTB 4LYYA 4DLYA 4EL0A 1XJCA 1NX6A 5JCZA 5FOUA 2VK4A 4DVGA 3K92A 3EG5A 4URXR 2Q29A 5IMSA 3M6MD 5A7HA 2AI2A 3RRMA 4EA6A 3FF1A 2KYRA 2GEBA 1YJBA 1HYHA 3K72B 4G0OA 4IZHA 3RG2A 2WU4A 1L1QA 2C97A 2MMCA 4FE4A 1ESNA 3BE5A 4KXMA 5CRIA 4LRYA 5BWCA 3G2JA 2Z4TA 5JCXA 2G80A 3MEQA 4AZSA 4HAOA 5TEWA 2BL4A 2HF2A 1OB5A 1N3BA 4S35A 4MRAA 1EU1A 3PLAE 3GLGB 2OO3A 5JNWA 4LSZA 1F0YA 3T0FA 1S8FA 1GA6A 2ZSAA 2Y4OA 2C7RA 5DZSA 4LYGA 2GR9A 5A1TA 1A72A 4HNQA 4NWIA 5BVHB 4KZPA 1SVMA 2R4TA 1ATZA 2Z1MA 4RABA 5BV7A 4RY0A 3EX7C 3UA3A 4XYMA 3E05A 3LHSA 3K16A 2BMWA 3UOAB 2Q0SA 5KHOC 1HOXA 1FTGA 4UUMA 2GSWA 1XA4A 3VYRB 3V1TC 3JQAA 2X5XA 1P4RA 2X13A 2GESA 1L8OA 2W90A 3LHIA 3A7EA 1BKYA 5HWSA 2R86A 1TM2A 5H68A 4B33A 4LSGA 3IO3A 2QE6A 4EYQA 5C81A 1BEEA 1GYPA 1NYQA 2SNIE 2VBFA 5HCUA 4XX0B 4D45A 3LFHA 4ZYYA 4NENB 2BTEA 2AN9A 2PXAA 1IM2A 4NE7A 4ZQEA 5IEBA 5SY4A 4YJ3B 4QYMA 1OI2A 3VR4H 1SC3A 1Z6ZA 3U7EB 3ZJUA 1S3FA 1J9EA 1L7XA 2VDUE 3KSDO 4JB3A 4BO9A 1JR6A 2ZWOA 2Q0XA 4RCVA 1ZH4A 1ACJA 1FVOA 2BMAA 3AUKA 4NJMA 4P86A 1YQQA 4G1MB 3IUQA 3BWVA 3VMMA 4E1BA 4RQTA 1VDMA 5A5VA 5A9SA 4L22A 4CXMA 1F2TA 4F5YA 1KAGA 4D9KA 3P2IA 1U99A 2A92A 5DASA 1D4OA 3WV4A 5HKKA 3SWWA 1O7JA 1P1HA 3AYZB 1D0VA 3O4JA 3QE3A 4HB2A 1FDVA 3IB3A 5K9ZA 4LNUA 5JNVA 4HFJA 2F7SA 1NN3A 16PKA 5FO1A 2H2IA 5JMPA 2IELA 4S0ZA 2H4HA 5JAQA 1RYNA 2J1LA 1ZK3A 1I36A 4BC0A 3QF4A 4YP5A 3RANA 1QO7A 2YC4C 3QEOA 3PC4A 4OX9Y 2QPOA 2ZBPA 3PVCA 4KXFB 3EXFB 4OAPA 4M0CA 4G1FA 4D26A 2VJLA 1AXEA 3WRXC 1EA5A 1MB0A 3LK7A 3DAYA 1WLSA 4AJJA 2Q5CA 3QOXA 4ZAZA 4EO9A 1TRHA 1K8RA 1AQLA 4FPXA 2IP2A 3RR2A 1C2TA 2GPYA 2QN1A 5HG0A 1AB5A 4KMSA 3NTQA 4QU8A 3BIWA 3FHOA 4YCJA 2J3HA 3KM0A 4G9EA 3EXIA 4H18A 2GD0A 4QASA 3RRXA 1M7BA 2ZS7A 4I1PA 3FTNA 3VR5D 1WZUA 3IV6A 4PC6A 3SX2A 4ZCMA 5JHHB 3TFWA 4A03A 1LBEA 1JEEA 2CL0X 3CO5A 1G5TA 1KZ6A 1RWQA 4M0EA 1KI6A 3CSUA 3FVVA 4F56A 5LOVF 3GMDA 3WJ1A 3LV8A 2V4ZA 1OT3A 3EQ2A 1RC0A 1UJNA 3BWEA 1EFDN 1OYVA 1NPTO 3CH6A 5H02A 5KVQA 1J6UA 4AX8A 2Z8YM 9ATCA 3QTBA 4ND8A 4NMLA 4EGQA 5TMEA 3IR7A 3R3VA 3KT0A 1C29B 1FB5A 1G0NA 2VUUA 3N74A 5BSMA 1TK3A 4G4GA 5LA6B 5E7MA 3V4SA 4G63A 5ALOA 3RARA 2V0NA 1MQAA 4C21A 3MGGA 4DCUA 5BY2A 4RKFA 3IAAA 4UJ5A 2GHIA 4ZO6A 1IJFA 1A7JA 3JD0A 1Q0RA 3LQQA 2OHGA 3RAEC 1A27A 1ZD2P 3BX1A 3CEMA 4JLVA 5IH7A 5C3UA 3QF7A 3ROZA 3DE2X 4YP6A 3VXKA 4YA6A 1NVGA 2XQJA 5B58T 5FPPA 3EPKA 4EHHA 3SSOA 3GUVA 2I6GA 2YNMC 2FUEA 1GL6A 2R8PA 3K1TA 3VU3A 4IRXA 4K9DA 4QOHA 5GADl 1JEYB 3AB3A 1QYIA 5IXYA 2O2DA 4F8JA 2EHDA 4RK1A 1DBQA 1NIPA 1U2QA 4HDNB 5EKXA 1NP7A 1H1TA 5IPFA 2O14A 3I42A 3SNHA 5JZVA 1WVMA 2BGRA 1G6Q1 2NPIA 1TLTA 3JQ6A 3OQJA 4HDKA 4U9HS 3ER9A 3OP4A 4EBBA 1JSLA 2O8VA 4FGSA 2GD6A 1NJ8A 4DUZB 5G41A 5CT5A 3KFLA 4JOSA 4Z99A 1MH9A 1W6UA 1KP3A 2HCTA 4G5HA 5IFLA 1DEAA 3W2EA 4CV2A 3WL8A 2AEJA 1A98A 2V8BA 1KY2A 1F20A 3TNLA 1LLQA 3HHEA 3SS8A 3ZGZA 3UJ6A 3PV0A 1HETA 2NAPA 1X13A 3A0UA 1YB6A 1G4AE 1XAIA 3F3YA 3HKBB 5BWNA 4F0JA 1T36A 3D6VA 1XWIA 3KK0A 2HUPA 2GN1A 4FXOA 3KKOA 3NO4A 3W9UA 4N18A 3M6LA 5HBRA 2VK2A 2ZM6B 1U9YA 3UCFA 1ZR2A 4XFKA 4FCVA 1S7CA 4Q7KA 3P4YA 3OZGA 2H6EA 1DJOA 3ZK8A 4C22A 3LT5A 4KLCA 5ECDA 1L5RA 3G9QA 3MWEB 4LOKA 4CMAA 4KO4S 2OHXA 1Z18A 4WESA 4I36A 4RTNA 1J99A 2H08A 3C6KA 4N48A 4OAOA 1YDHA 2R8OA 2VJPA 3HS3A 2II6A 2C5AA 1Z8DA 2P9HA 3I0ZA 4I1OA 3RROA 2I6TA 5C8XA 5L7TA 3THXB 4WA7A 1U4NA 2HPZA 3EF1A 2QV0A 4OP1A 3HQ4O 3O4RA 3X1DA 2EP5A 3FYDA 1A95A 4CL3A 1WXGA 2FWMX 3PD1A 4OHKA 1S3GA 1AGRA 1VB5A 1ECCA 4OQMA 4F96A 1SKMA 5JXIA 3LC1O 4RENA 1S3IA 3URKA 2YNMA 3UMCA 4M83A 4YALA 4JR1A 3PNOA 4RPLA 2OCGA 3D8TA 3VH3A 4BIMA 2B4RO 1G55A 1OR8A 1QG2A 1W49A 2W6ID 4M3NA 1FS6A 1BC5A 3NKFA 4L8YA 4QJ4A 5BPFA 3E1GA 4J43A 1XRJA 5FTLA 1Z8NA 1OX4A 1N9GA 2IEAA 1KI9A 2Q3JA 4GPAA 2RGNC 5DH9A 1TE2A 2Z8XA 2XYQA 1N2IA 3B6ZA 5T3UA 5CGQB 4ACAA 2ZR0A 2FG5A 4BKOA 4HT3B 4PSKA 3PS9A 4IR7A 1RM4A 3EB9A 1RWMA 1G7TA 5G0TA 1R4NB 3NDRA 2QJFA 4HQRA 2VPYA 4ZMSA 5BUQA 1PNRA 3BTOA 4CEIA 4PNHA 1SQFA 2C61A 3WDSA 5C9ZA 4MV4A 2WLTA 4BGVA 3R6DA 2HQOA 3NQ41 1PL6A 1XNQB 4KQEA 4FFRA 4N8SA 4MKGA 4GS5A 4JBGA 4ZPXA 2WAXA 3PEEA 3VR4A 4C0JA 1M8GA 3G2LA 3RS9A 2G67A 4LRQA 5IM5A 2V5VA 2UYCA 5BQPA 4O4JA 4YCCA 3KBOA 3RV3A 1YVUA 1R4AA 3D1JA 3ND8A 3OLYA 3U60B 1QHHA 1CJTC 1OLSB 3PZBA 4JX9A 5A6SB 2MSWA 1NMQA 1P60A 1PV2A 2GWHA 3L0BA 2ZSEA 4WY5A 3UAYA 5IVKA 2WM2A 3OX1A 3TD9A 2J6CA 3Q9LA 2K2QB 2PUAA 1AQIA 4PLTA 3L0ZA 3VDQA 3S2YA 1HSZA 4NONA 3HRHA 5KNCH 1NTRA 1ZMXA 1P4GA 5DHRA 4YI3A 1FPMA 1ODSA 4D9CA 1P7VA 5JAPA 4D3YA 1NNSA 4LZPA 4ND4A 2WTUA 1F38A 2XNDA 1MB9A 1ZZGA 4GSKA 4X24A 1M1ZA 1ZYUA 1WHTA 3ED5A 3JQBA 1Z0KA 6PFKA 1X7YB 2ZVJA 1P3DA 3PUIA 5HS4A 1P1FA 2W2LA 4GH5A 2YRFA 4X7BA 1VMIA 1M2NA 2J41A 3QTLA 1L5HA 3HXLA 1LK7A 3AOEC 1W29A 1Y7TA 3TRDA 5BR4A 4CN9A 1Q50A 2CGEA 2HY7A 4GYYA 3V55A 1OB2A 1ZD8A 2YR0A 4EKYA 2FPIA 3JZDA 5KTYA 1KTVA 3OHSX 3SJUA 4XYLA 3FPKA 3P0IA 3UGKA 3D43A 4FMCF 5AVYA 4CDMA 2QTGA 1NVXQ 1PR3A 4AG3A 2P9ZA 1ONOA 3KQQA 2Q8PA 3LS2A 3VVBA 1NWHA 2XVZA 3FYCA 4MLPA 4MI9A 4O4IA 4OK6A 4O63O 4RPKA 4CTKA 1UK8A 2G0NA 3X1JA 4WFIA 3TR6A 3IMFA 3PXXA 4B4VA 1MLDA 3U40A 5I7UA 2VI5A 4TT8A 1Y1LA 1P9LA 2OZEA 2FH5B 4P8RA 1E7MA 2JATA 4BE4A 1EX6A 1GNPA 5H81A 5A2GA 4NARA 2O4CA 4MWSA 5AKLA 4G3XA 4MEBA 4D82A 4GMGA 3RK4A 1Z7YA 3IT2A 4AZ3B 1N2OA 1JQEA 4IDBA 3W9SA 5E7IA 1KH2A 5FWXB 3W5AA 1C0LA 1Z7BA 3OZAA 4Z4IA 2VHZA 1T25A 3QQPA 2B6NA 4KMRA 4EJMA 2QE7D 4C7OB 5K0NA 5T6MA 1J21A 1LBHA 3CUKA 3EXHC 3LE8A 4WK2B 2IY9A 2GKGA 3E53A 3CYFA 3SR4A 4REOA 1DO8A 2NZVG 2OOSA 3ZN2A 1GKKA 3FVRA 4YASA 1CUVA 4GLOA 2PRSA 5JRJA 4TZ0A 1ZRMA 4TL7A 3M6UA 1V39A 1YI8A 1WNTA 1WMDA 2PWPA 2EX4A 3J7AC 1RZUA 2AW3A 2ZQZA 1XK7A 3AFNA 4MQEA 5EJFA 4BRUA 2PU5A 4DQVA 3JATB 4LXHA 5TMPA 4MI6A 4NG5A 3UC5A 4A2QA 1UXIA 2JIOA 3FG9A 4C0KA 3GRYA 1XCBA 2I55A 4NOMA 3GLVA 3T1NA 1BDHA 1RLMA 1T2UA 3DAOA 4FNMA 4FQ8A 2ZOSA 4B74A 2RDMA 3FRHA 5IBQA 2OVBA 5A7GA 4AG5A 4BLOA 2QGZA 3SKYA 3ULKA 1LPOA 5TQ0B 3WIEA 4BLTA 2PUJA 3GAZA 3GB9A 3GFPA 3WBBA 2C82A 2XOKA 1CUIA 2NMVA 1EZ4A 2DX7A 4G1BA 4JEMA 1MG5A 3T0IA 3PI6A 5BOVA 4GPEA 3FIUA 1YZHA 3AHFA 4FOSA 1E2KA 3V4VB 4YAOA 4Q4CA 1B74A 1X7ZA 3W8FA 2IOFK 4EG7A 4ZOQI 3DM5A 4UHJA 4OMDA 5SZIA 4J75A 4BQSA 2HV9A 4R54A 4Q4JB 3LAWA 3L1HA 2O2SA 3CSDA 3DXXA 2XGJA 3RFVA 1KYIA 3GJQA 4KPGA 2O4UX 4EDFA 1ZLXA 3BH0A 1QCYA 3N53A 5HM8A 4KBFA 2C4VA 5A5FA 4LSMA 2BMFA 3R3XA 4ZCIA 5B6JA 2IXTA 5JVDA 1KEEB 4LNHA 2C4HA 1DT5A 4NIMA 4II2A 4CMGA 3NIGB 1G3RA 4JP1A 4LWZA 2HHLA 2XLBA 4C0XA 2FNAA 3K0AB 4Y2YA 3RVDA 1AKEA 2V9ZA 1HTTA 1Q2XA 1RYYA 3GGDA