3OQ5A

Crystal structure of the 3-mbt domain from human l3mbtl1 in complex with p53k382me1
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
313
structure length
309
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title The MBT Repeats of L3MBTL1 Link SET8-mediated p53 Methylation at Lysine 382 to Target Gene Repression.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 68
structure length 309
sequence length 313
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oq5A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oq5A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oq5A03
5FRNA 3MO8A 1WJSA 4ZTJA 1MHNA 5KH6A 4IUTA 2IG0A 4A4HA 3CEYA 4E7HA 3OMGA 2BKDN 3FDRA 3MP6A 4C5IA 3MEUA 2EQKA 2EFIA 4A4EA 3MEWA 4ZTFA 3OS1A 2R57A 4NS5A 3L2RA 3MP8A 4A4GA 2FHDA 2K3YA 2NLUA 3MP1A 3H8ZA 2JTFA 2X4XA 4PL6A 3H6ZA 1WJQA 4OVAA 3UT1A 2RHYA 4IUUA 3OB9A 4BE2A 2RI2A 2RHZA 3LYIA 2B8AA 2X4WA 1KHCA 3S6WA 3OYKA 3M9QA 4IUPA 2G3RA 4QQDA 3DB3A 3OY9A 3OYHA 3S3NA 4IKFA 1OYXA 3O8VA 2EKOA 2GF7A 4IURA 4UC4A 5KE3A 1N27A 2R5MA 3PFSA 2M16A 3L2VA 3ZEHA 5IAYA 2LCCA 3EAEA 4B9XA 2GFUA 3OYNA 3LX7A 2PQWA 2RJFA 2EQMA 2L89A 2HQXA 2RHIA 5J39A 4FU6A 4X34A 4E7IA 3E9GA 3OS0A 3L2WA 3FC3A 3L42A 5C6SA 1OZ2A 2GFAA 3GOXA 5CIUA 4QQ6A 4N4GA 2M0OA 4IUQA 3S3OA 2WACA 2RJCA 2LRQA 3LGLA 3OYGA 3L2UA 2R5AA 2K3XA 2M1HA 2X4YA 5D6XA 5D6YA 4E7KA 3QJ6A 2X35A 3PMIA 3FEOA 5KCHA 3NTIA 2RHUA 4C5EA 2E5QA 4QVZA 2L3RA 3OA6A 5FROA 3MEVA 2EQUA 4PLLA 2BIVA 4RG2A 4Z02A 2JZ2A 3DLMA 3NTHA 2L8DA 3BDLA 2RJDA 5D6WA 1WGSA 4HCZA 2RI5A 2CKKA 4QQGA 1WJRA 4E7JA 3OYIA 5KCOA 3F70A 3UWNA 3PNWC 2RJEA 4PLIA 4IUVA 5FRMA 1OI1A 2RO0A 4N4HA 3QIIA 3S3MA 3QBYA 1SSFA 2MWOA 2O4XB 2XK0A 4FL6A 3OYDA 3OYLA 3P8DA 2DIQA 4BE1A 2QQSA 5M9OA 3QKJA 4GY5A 3E9FA 3OYCA 5IN1A 2R58A 4L59A 3L2QA 4EDUA 3META 3OYBA 1G5VA 2RHXA 3OQ5A 4Q5WA 3DB4A 2RI3A 2DAQA 3LGFA 1OZ3A 3OYFA 4BDYA 1XNIA 4BDZA 1H3ZA 2LTOA 3OYMA 2YRVA 3KUFA 2LVMA 2VYTA 4QW2A 5J26A 3MEAA 4II1A 2O4XA 4CRIA 4A4FA 4BE0A 2LDMA 3OMCA 3Q1JA 3OYEA 2P0KA 3OYJA 4LD6A 4E7LA 2BUDA 2QQRA 2HQEA 3PMTA 5C0MA 3SD4A 2MWPA 5KE2A 2XDPA 3ME9A 3C4SA 4BD3A 4BACA 3NTKA 4B9WA 2D9TA 2F5KA 4N4IA 2DIGA 4C5HA 3FLGA 3ASKA 3P8HA 4C5GA 3OS2A 3OYAA 3LLRA 2E6NA 3LH0A 1RI0A 2EQJA
chains in the Genus database with same CATH superfamily
1VQOQ 4LDVA 3H0FA 3J80E 1NE8A 4HXJA 1PG5B 4KGVB 5I21A 2KROA 4NS5A 3QJYA 1M2OA 3CCLQ 3H8ZA 3H6ZA 3TVTA 1SHGA 2QA4Q 1WX6A 1SSHA 3REBB 4IUUA 1C1AA 3EG3A 1IGUA 1QQJA 1YFNA 3M0TA 7AT1B 1QKWA 3CXCS 2ZZDA 4M78C 5J3BA 3H0IA 2KDSA 1N27A 1UHCA 4FIBA 3FRNA 1NEGA 3G71T 5LL6S 2LP5A 1MGQA 2EQMA 4HVWA 4FU6A 1NLPC 1GBRA 3QHSA 5FU7C 2YUNA 1OPKA 2DTIA 3CCUA 2GFAA 2XIDA 1IB8A 3BFMA 1PSEA 5LJ3h 4DBQA 1WXTA 2VXEA 2LZ6B 4AFSC 1IHWA 4X1VA 2LQNA 3VS7A 1NEBA 1M8VA 1U06A 5CKBA 1TSFA 5GMKi 4OP0A 4CC7A 1G2BA 2EJ9A 4R56A 4HCZA 5KYNA 5IHKA 1QWFA 3UWNA 4JRQA 3VS1A 2V8JA 2JOYA 5CKDA 1NZ9A 4LN2A 2MWOA 2EWNA 3NGPA 1IRXA 2KMTA 1YNZA 2COWA 3IQLA 3META 4BUGA 2FB7A 2COYA 1WXUA 2D6FA 1FMVA 1JU5C 4M78F 4QW2A 4J9FA 4OB1B 1O9SA 3M4GA 2DBMA 3SD4A 3CCQQ 3M0SA 4B9WA 2D9TA 4E6RA 2RNAA 2A36A 4EMHA 2QQ9A 4CC3A 4LD9K 5GMKh 1Y7XA 2K3BA 1K8AC 1SG5A 2BE9B 4JRKA 5GANg 1TXQA 3LH5A 4XU0A 4C5IA 3CMAA 4JLIA 1X43A 5DY9A 4B6MA 2J6KA 1IHVA 5A0GA 1N8RU 2M02A 1KIKA 1E6HA 3OW2P 1WNLA 2KXDA 4PJOE 4L5GA 3HPWA 3G6EA 1N8RR 3OSVA 3PT9A 4M77F 2ZPBB 4IURA 4UC4A 1W2BA 1VQLQ 2F1LA 3EFRA 3CMEQ 3V8KA 4RTZA 1SF9A 1YIJA 1PSFA 2DYBA 1X6OA 2PQWA 2CYZB 3LX7A 3CCST 5LJ5h 1RAGB 4M7AE 2FG0A 2KQWA 3MPUB 5GANj 4C8QD 4QQ6A 2QDLA 3GPLA 3CXCP 1M27C 3RKXA 1B07A 2PZ1A 2VGMA 1VIFA 4OB0B 2GGRA 2O2OA 1K8AR 2AZVA 3HRTA 4Z02A 2DERA 1AWWA 2YLCA 1QP3A 2J6OA 3OYIA 2EQIA 3OS5A 2HAXA 3LWIA 1Q81U 1PRMC 2RQUA 1VQMQ 5FWCA 1YHQA 5GAN5 2KI7A 1TOVA 1VQ6A 1XJWB 2E10A 4BDZA 2QYZA 1H3ZA 4ZN1A 2QQBA 4C8QG 3MEAA 3A8LB 2HKQB 2L3QA 1UUEA 2DL8A 2BUDA 2QQRA 4FW2A 2XDPA 3E2UA 4J5YA 1PD1A 2K7AA 2JXBA 1YN8A 3X20B 3CCRT 2VVKA 4C5GA 1G3WA 2FPFA 1U1TA 2XDDA 2HQHA 4QVCA 3VRZA 5GANf 3HHTB 1J3TA 2G6FX 3M4YA 2DLPA 1K73R 1D0XA 3UA7A 4MZPA 3L2ZA 3SFMA 3MP1A 4MMLA 2CREA 3FJ5A 2C0OA 3G4SQ 2L0AA 4BE2A 4F04B 2RHZA 1UG1A 2EJFA 3N5BB 2YSQA 1JB0E 4LDUA 1D09B 1PD0A 1X6GA 4OB3B 3OW2A 2JTMA 3ZEHA 4JS4A 2I0NA 2CZ7B 3BY7A 4M7DF 3JCMc 1VYVA 1YJNQ 1X6BA 1KSWA 2RJFA 4KBMB 2EAYA 2H3JA 4E7SA 1QVFA 2K5FA 4M78E 5IXBA 1QW1A 5D6XA 2X4YA 1VQ7T 4J7IA 1YJ9T 5DLQE 3VS5A 5LJ3g 1HYOA 5HCKA 1BI0A 2EW3A 3A5ZB 2X51A 5D6WA 1GCQA 2CH4A 4R0KA 1VQ5A 2RA2A 2RI5A 3BE3A 3QDRB 1EIFA 4JJNK 2RB6A 4KRTA 1D0YA 4BY6C 4IUVA 2BZXA 2DL5A 2DXCA 3S3MA 1M3BA 3QBYA 3OYDA 4E2FB 1VQPQ 4EMKB 2QQSA 4GY5A 1ZA2B 4MZMA 3DB4A 1K4US 4C8QC 4C0GA 2KRSA 1NBEB 3HP9A 3CBMA 3QUIA 3X28B 4EMKA 5GAN2 4CC4B 4M77E 1KQ2A 2K2MA 5LJ3j 3RESA 2ZCFB 1QMCA 1VQ9T 4RG2A 5A2QE 2C06A 1VQ8T 4KGZB 4TVRA 3CC7T 2DTHA 5KH6A 3CCMA 4A4HA 5AT1B 4E7HA 1LVKA 1G83A 2DM1A 2K6DA 1PKSA 1N6AA 1O75A 4C0ZA 3PIOA 1N5ZA 1RAAB 1UGVA 1E6GA 2RI2A 1I0CA 3M55A 1KC8R 2EGAA 1YITA 2X3WD 1VOMA 3ZL7C 2LC4A 4LXCA 2LT1A 5CK9A 4OMNA 1X01A 2R5MA 3EGXB 2F2XA 1AWOA 4PJOG 1RABB 1I4K1 2K9GA 5IHIA 3A8MB 4C8QF 3I56Q 3FC3A 3C95A 3CD6T 3WVEB 2M0YA 1NLOC 1K9MR 1WLPB 5GAMd 3EGXA 1V1CA 3OYGA 2J05A 2M1HA 3QYGB 4NL3A 4D8DA 2ZPHB 1QCFA 3M56A 2XU8A 3PIPA 5LJ3f 2A37A 2FO0A 4M7AG 5FROA 2JM9A 2EQUA 2PVDB 2L8DA 4RMOA 3V8LA 4J9IA 4QQGA 4AG2C 2MAMA 2V8IA 4JJBA 2LJ0A 1G3TA 2H8HA 3HSBA 5IXFA 3OYCA 3EH1A 2Y4YA 1ABOA 5GAN3 3ZFJA 1X75C 2RHXA 1YI2A 1OQKA 5GMKe 2KVQG 1Z9QA 1WQ7A 4CRIA 2WSFE 4PK4A 5LJ5j 1I8FA 2ENMA 1X2KA 3THKA 3GP8A 2F5TX 4XU2A 3KXTA 2YUOA 5L23A 3VUBA 3FJPA 4QKUA 1Y0MA 4MZTA 4RKUE 4A63B 4M7DE 1B3QA 1H641 3GNGA 2EYWA 3LH0A 4ME7A 2EPDA 3QG1A 2IG0A 2LNVA 2EFIA 3I9QA 2K4YA 1QVGA 2R57A 4N0AC 2LJ3A 2BZYA 2X4XA 4FSSA 5GAOm 2RHYA 5LJ5e 2OI3A 2SEMA 2B8AA 2X4WA 2PUOB 4QQDA 2MF2A 3O8VA 4MMKA 1SRMA 3O5ZA 1PNJA 4J9EA 3JCMd 4LUDA 1UGRB 1S72A 4KUDK 1VQKQ 3CC4T 2V26A 4A54A 2OTLA 2A7YA 5HK0A 3GF5A 5FU6B 3UF4A 1LNXA 4QVDA 4R55A 3RERA 3WXMB 3TREA 4GLMA 1WFWA 2FZGB 4GLKA 4M78G 1NYGA 3ER0A 2DX1A 1DJ7B 3CMAT 2QEXQ 3CCVQ 4C0DC 5KCOA 2E41A 3PGGA 5FRMA 1A0NB 4NOYA 2MYSA 1TTHB 1BBZA 1HJDA 2O4XB 2VC8A 4BE1A 1K9AA 1ZBXA 1JXMA 1RAFB 1Q86U 1W6XA 2RK2A 3PTAA 2BZ8A 1XQHA 2D0QB 2JT4A 1LPLA 1XNIA 5GAMe 2P4RA 3KUFA 1JQQA 1YIJT 1D1BA 2O4XA 3VS4A 3WVDB 2LDMA 4XU3A 1KD1U 2HQEA 4C0FA 1TU0B 2XI9A 4KULA 4BD3A 2DIGA 4BI4A 1KD1R 2W10A 3OS2A 2E6NA 1VQ9Q 2L3SA 4M77G 1VQ8Q 1M30A 1VQ4T 1U3OA 3VS6A 2BKDN 5GAOl 2RM4A 3PVQA 2FL7A 5I2MA 2ZPGB 1QVPA 1UTIA 1G3SA 3JCMb 1CKAA 4FYWB 1CKBA 1C6VX 1UECA 4CC2A 1YHQT 4WF2A 2ZAEA 1VQOA 3TQ7P 3OW2S 4RTYA 4DBFA 1YWPA 1VQ6T 1RAIB 5CQXA 5IAYA 2KEAA 3CCLA 1QVFS 1KK7A 5GAN8 1BIAA 2WSEE 2QA4A 3L2WA 4J6YA 3L42A 1B34B 1OZ2A 3GOXA 1M90U 4JJDA 1B7TA 3RBBB 1SEMA 4J6XA 1S1NA 1W2BP 3D7SB 2EYYA 4PJNA 4RTWA 1GFCA 2GTJA 1ZSZC 2CZ6B 2CT3A 3GNFB 3SWNB 2MI6A 1B34A 4PJOB 1WGSA 1YP5A 2RN8A 3JCMe 2CS7A 1U1SA 4M7DD 1IZ6A 4HA8A 3SWNA 2DETA 4PJOA 5IN1A 3C12A 3ULRB 3CBOA 8AT1B 1I81A 4M7AB 3I55T 3CC2Q 4MDXA 4AT1B 4LDXA 4JRIA 1T3LA 2AKLA 4C92B 1K1ZA 2P0KA 3URGA 1KFZA 2XD0A 2DL4A 4M7AA 2CP0A 4RTUA 4C5HA 1TS9A 4AFZC 4M77C 4BB7A 3INZA 4C92A 1N8RC 1MHNA 4XK8E 2ZPEB 3HL8A 2QDYB 4A4EA 4M7DG 5CKEA 3TSWA 1RL2A 4RTXA 4JDSA 2GCXA 1UHFA 4DEYA 4E47A 2J6FA 1MMNA 4KUIA 1PKTA 1K76A 2FRWA 2CGHA 2B86A 4J9GA 3I5SA 2XDBA 4ATOA 2EYZA 4JZ3A 1X2QA 4O6JA 5KE3A 2KRMA 3L2VA 1JJ2A 4M75F 2CSIA 3HTRA 2LCCA 3CC4Q 4OMQA 4XAXB 5J39A 4PFOA 4F7UF 3QSUA 2DL3A 1QP2A 1BI2A 1FWZA 4PFPA 1D3BB 4AFQC 5CIUA 2DEQA 1OX9A 1BU1A 2LRQA 4QT7A 2K3XA 4EIKA 2KYBA 1VQLA 2LX7A 3CMEA 3CCMT 1VQNT 2DYIA 1R8OB 1QVFP 2GTOA 1D3BA 4XTZA 2XMFA 1WJRA 1P92A 1F1BB 2RF0A 2DILA 4ANJA 3JAME 1WHMA 1X69A 1BIBA 3KFVA 1BKBA 4OMLA 2EGEA 2HBWA 1I5LA 2HL5C 2M9UA 4DBHA 4HT8A 3MKDA 2I2LA 1Y07A 4BI3A 3R6NA 1JRIA 4GBQA 4Q5WA 5CO7A 4M78B 2PUKB 4BDYA 3REAB 4FW1A 3AHUA 2LVMA 2D0NA 1K73C 1YIJQ 2F2WA 2KXCA 3NFCA 1V29B 2YRDA 3QZ9B 3PMTA 5IT9E 1VQMA 2MWPA 5FU7B 2XKOC 4BACA 1YJWT 4M78A 5KYWB 1Y71A 2X9HA 4JJCA 2EJGA 5CCAA 1Q81R 5FRNA 1VA7A 1VQ4Q 3CEYA 3JCMP 3QO3A 4M7DC 1QVGS 1RLQC 2DK3A 3MEWA 3OS1A 5KYWA 2DE0X 1Z9ZA 1UE9A 3EHRA 4PL6A 4J9DA 1M5Q1 3CCJA 1I07A 2L3PA 1GL5A 2KT1A 4DOVA 1EX4A 4ZGDB 1GRIA 3V7SA 4M77B 1OYXA 4PKCC 5GAMh 3QWXX 2ROLA 1YI2T 1BCOA 3PFSA 3VUZA 1BYMA 4B9XA 2DZCA 1D0ZA 1WHJA 4E7IA 2LT4A 3E9GA 4J9HA 1AWXA 3G4SA 3V8JA 4M77A 1QWEA 1JBMA 3GIBA 2R5AA 3QJ6A 1AEYA 2YT6A 3BW1A 5GJVB 5CKHA 2BIVA 4D6WA 2QK0A 4FCYA 2CT4A 3DLLA 1YJNA 3G71Q 4D8KA 4AFUC 2YUPA 3RUXA 1BI3A 2DRKA 1OI1A 2EYXA 4RTTA 1TUCA 1I5OB 2IPOB 4OMOA 2DXTA 4HCCA 2CUDA 1MMAA 1ZUYA 4HT9A 5AYFA 3I55Q 2QG9B 1NM7A 3AT1B 2ED0A 3KBGA 2HNIA 3ZBDA 2OTLT 1FMWA 2ABLA 3Q1JA 2JUFA 3NTKA 4M75E 1VQPA 2P0QA 1GCPA 2HMAA 1WA7A 2E64A 4ZGEB 3EG9B 1KC8C 1MMDA 4F7UE 1RI0A 2CZ0B 3J81E 3JB9D 3HRSA 3SB2A 2AT1B 4AG1C 5FW9A 4ZTFA 1PHTA 3HRUA 3L2RA 3JCMh 3EG9A 2DBKA 2F2VA 2GQVA 2VASA 4OVAA 3MCAB 3UT1A 2OTJT 4ELZC 2X4JA 4OB2B 2XICA 1K9MC 2QXFA 3M9QA 2EGCA 3LWHA 3A8GB 3M59A 1QVGP 2JS2A 5HY6A 1WHKA 2KT8A 2M16A 1MNEA 1PCXA 4M7DB 3M57A 1OU9A 3EAEA 4VUBA 4FT4A 1H92A 1M1KU 4X34A 4FYYB 3EHQA 2DVEA 4JLGA 3JB9G 1UEBA 1K0XA 4ZNXA 2V1QA 3S3OA 3M0UA 2QAZA 3A8OB 3SEMA 5CQYA 3NTIA 3JCMX 1FXXA 2X3XD 1ZUKA 1WIEA 3CCMQ 4PLLA 5CVIA 1VQNQ 2RJDA 2L2PA 2A08A 3I56A 2MCNA 3F70A 3CCSQ 2HEQA 1YBYA 4JUVA 4PLIA 3NPFA 2RO0A 2HD0A 3P8DA 5LJ5g 2ZPIB 2YUQA 5GMKj 1VQOT 1LOJA 1Q82U 4EDUA 1G5VA 2PNIA 5KYXB 2JMCA 4F17A 1OU8A 2KAFA 1Q82R 2VYTA 2O9VA 2GQIA 3HFNA 3CCLT 2QTVA 4RG8A 2PVGB 2DNUA 2HCKA 2QA4T 2KGTA 5C0MA 3UATA 4J7FA 3FB9A 1FMKA 1YJWQ 4LNPA 1VYTA 3FLGA 3I5RA 2QGFB 5KYXA 3VYHB 1PC0A 2FEIA 4IIOA 4J9CA 2JW4A 1ZQ1A 1HD3A 4V2SA 2K5IA 1UGSB 1HK9A 2YXYA 2JTFA 1AT1B 1HXDA 5EG2A 3VJPA 3TCJA 1WHLA 2K79A 4BY6B 3CCUT 2C0TA 1IGQA 3CCRQ 3MHXA 3OY9A 1NJIU 1KHIA 3RDVA 4EPCA 1PRLC 1Q95G 2E4HA 1YI2Q 2DKGA 2NUPB 5GAMg 4C8QB 2RQRA 2RQTA 2RHIA 5GJWB 5CAIA 4XTXA 3E19A 3QZ5B 3M0RA 2DFUA 2HSPA 2NUPA 5D6YA 3G1JA 4C8QA 3PMIA 4C5EA 4L6V5 2E5QA 1W2BS 2CP5A 1VQKA 3HFOA 2L5QA 3P8BB 3VRYA 2J7IA 3FIFA 4Y28E 3EGDB 4M75D 3CCEA 2DA9A 2YLBA 1IREB 5LJ5f 1KD1C 3E9FA 3GBQA 1TG0A 5GAMj 1VQ7Q 4ESRA 3SDZA 1YJ9Q 1AVZC 1M8MA 2DAQA 3EGDA 1OZ3A 4KH0B 3VS3A 2LTOA 5GAN7 2QEXA 2FVUA 3CCVA 1IXDA 1TWBA 4HCBA 2COZA 4LD6A 1M2VB 1GFDA 5FLXE 1RUWA 4E7ZA 3EFSA 4XTUA 3JB9F 1PWTA 3OYAA 2VV5A 3UA6A 2ZGWA 1KQSA 2EYQA 3G6ET 1VQLT 3CMET 4M75G 3FDRA 3MP6A 1M2VA 1G3YA 1W4SA 3MEUA 1AOJA 1Q86R 2DXBA 4F7UG 3M0QA 1AHJB 3TSZA 4RUGA 1WJQA 2W0ZA 1KQ1A 3JCMg 2OTJQ 3OB9A 2RPNA 4DOWA 1WDXA 4XU1A 3S6WA 1WPYA 1HSQA 1VQ8A 3OYHA 1M90C 3CC7Q 2LCSA 1CSKA 2FRYA 4ORZA 5GAMf 1YCSB 4LE9A 2FZKB 1VQMT 1K0SA 2SRCA 2M0OA 3JB9I 1TUGB 2RJCA 2RH2A 1JJ2P 4FYXB 2BTTA 2NUTB 2CP6A 5I2SA 2IIMA 3OA6A 4DA4A 3BDUA 2OAUA 2JZ2A 4LDWA 4OMFB 1NG2A 2JTEA 1U5SA 1YWOA 2O31A 2NUZA 3PNWC 2HL3A 2JVVA 3CCJT 2NUTA 3U23A 3CD6Q 5GMKl 4PNOA 5KYUB 3QKJA 2VXFA 1M90R 3PVLA 3OYBA 4N0AA 2DL7A 2O9SA 4Y92A 1Y96B 1I1JA 2YRVA 5A0DA 1H8KA 4A4FA 1M1GA 5KYUA 3G4ST 1UFFA 1Q7YU 5I22A 3CPWA 2RQVA 2CH4W 2DF6A 1Y96A 2RD1A 1OPLA 3OYFA 1Q7YR 3CC2A 2JMAA 2QTXA 2LNHB 4J9BA 2FPEA 4IUTA 4M75C 3VS2A 3VU3C 4XQ3A 5CR2A 1E7OA 2CSQA 1WXBA 1YJNT 4Y91A 2OAWA 1R0BG 3CQTA 1G8XA 4C0DB 5GANd 2D8JA 2DD5A 1UDLA 3JCMf 4A53A 3CCUQ 1WYXA 2YWWA 3H0HA 2LJ1A 3JCMW 4IKFA 2YDLA 2EKOA 3T9NA 1WI7A 2EKHA 1RAHB 1ZA1B 2GNCA 4X9CA 1VQ5T 2E1HA 2DXUA 4XTVA 2HQXA 1ZBJA 1ZUUA 3OS0A 3CCQA 3RKWA 5C6SA 3A98A 5I11A 1VQPT 4IUQA 3QDFA 3EG0A 1UJYA 1LCKA 3RIRA 5KCHA 1OULA 1ARKA 2DZ9A 3QWYA 1PM3A 2E65A 3DLMA 3UDCA 3CC4A 3JB9J 2FYKA 2KY9A 1KJWA 2F69A 4IIMA 2DTOA 2HZYA 3CPFA 2V8KA 2DIQA 4A4KA 1Y57A 3G7ZA 2R58A 1Q81C 3X26B 2IVWA 2YRCA 1WQWA 2Y4XA 2JN0A 4M4ZA 5J26A 4F16A 3CMAQ 2MPXC 4RTVA 4XTWA 3OYEA 1GCQC 5KE2A 4HKEA 3ASKA 1T3SA 3P8HA 2AK5A 5D7UA 2AHJB 2DD4A 1YITT 3NMZC 1EFNA 2A28A 3G6EQ 4DEXA 4WTOB 1SRLA 1ZSZB 2DJZA 1BI1A 1NYFA 2ED1A 5GAOq 3MP8A 4A4GA 1ZSGA 3I56T 4MDWA 2LCLA 1NPRA 2Y90A 2HKNA 3H9NA 3EG1A 1K8AU 4EMKC 2HDAA 1ZSZA 2E70A 1OEBA 3X24B 2VB6A 4C92E 5EC7A 1VQ4A 1T0JA 1WZOA 2GF7A 4PJMA 4M75B 2DEUA 5HKCA 1M3CA 3HKSA 2JJ9A 4HVUA 3VYGA 4KH1B 4F7UB 4LDYA 2MK5A 2E5KA 1TUDA 1V76A 1W1FA 4FYVB 4N4GA 4M75A 5FWBA 1GBQA 3RR6A 1YHQQ 1NPPA 2CZ1B 5GANe 4F7UA 1SHFA 2H3EB 4JZ4A 2RMOA 1M9SA 1VQ6Q 2XHCA 4FM4B 4O5VA 8ATCB 1IO6A 2DO3A 5LJ3d 2RJEA 2MOXA 3CCJQ 1XOVA 4Z88A 3QIIA 3OYLA 2AIRB 3GLXA 4KT0E 1K73U 2E12A 3J7AF 5GAN4 4P5NA 2RI3A 3L1AA 4AMCA 3G71A 1QCNA 4J83A 2E3HA 2A3LA 4HCKA 3NHNA 1R77A 2CP7A 2M51A 2PVOB 3C0CA 2QQAA 4Z8AA 3TU4K 3EH2A 3I35A 2AKKA 1ZLMA 2EBPA 4ZN3A 2WSCE 1KQSS 3OBWA 2FZCB 2ROTA 1UGPB 2EQJA 3I55A 4ZTJA 3X25B 3RNJA 1VQKT 1T0HA 2KR3A 1S72T 2FPDA 2K3YA 2NLUA 3EG2A 2JNGA 1VIEA 3CCET 2HSEB 1GXIE 2XG8D 1M1KC 1KHCA 4DQ2A 2YHTA 4IUPA 2D1XA 2J06A 3A1PA 4FSXA 3CXCA 5GAOp 2QEXT 3CCVT 4KGXB 2GFUA 3JSCA 1VQ5Q 2L89A 2QI2A 4YTLA 2KYMA 2RQWA 3QYHB 1MV0B 2VKNA 1U8RA 2CP3A 5GAOr 2QGGA 3M53A 1OV3A 2GBQA 2MMPA 3MEVA 3VS0A 4ZGJB 5LJ5d 3BDLA 1JO8A 1Q82C 3A8HB 2CKKA 4OMPA 4X9DA 1OOTA 2K57A 3JCMQ 4PJOD 1VUBA 1AZEA 1M1KR 2MIOA 4PJJA 4M7DA 2ZPFB 1AZGB 4L59A 1AWJA 1VQNA 3V7CA 3OQ5A 2DJQA 2RK1A 4JRPA 2P84A 2Z0WA 1D1CA 4JPBW 2ATCB 3DKMA 3QXEB 2LQWA 4II1A 4BE0A 3CCSA 5FU6C 5GAOn 4M7AD 2P0PA 1KC8U 5DM7R 3CPWS 4J6WA 1MV3A 3C4SA 2JM8A 4Z89A 4C92D 1BCMA 5LJ3e 1YITQ 3VKIA 3MO8A 1WJSA 3JRZA 1N9SA 2ESWA 3OMGA 2AZSA 4OMMA 3E1SA 3PE0A 1NJIC 5IHNA 1K9MU 2P4TA 2FHDA 1RLPC 4ELYC 2LQ8A 1KG1A 1XTDA 1ABQA 1YJWA 2NYSA 1KQSP 1JXOA 2G3RA 1ZHIA 3S3NA 5L8RE 2BE7D 4JS5A 2E3IA 1BB9A 3OSSC 4CI0C 2LX9A 1M4ZA 1QCOA 5HK3A 4C92G 3JCMV 5DLOA 3JCMJ 3RMSA 1R0CB 1ZX6A 2KNBB 6AT1B 4WCIA 2EIFA 3CCRA 2CDTA 2VWFA 9ATCB 1M3AA 4E7KA 2X35A 3CC2T 2RHUA 2CUBA 3SHWA 4BI8B 2L3RA 1WHHA 1JJ2S 2KE9A 3NTHA 1MUZA 1NJIR 3M54A 1UGQB 1SKUB 5CKFA 4PFZA 4FL6A 4OGEA 1WHGA 4RCCA 1VYUA 4F14A 3UPUA 4PJLA 3LGFA 2QASA 2K2VA 3V7RA 5KYYB 2VUBA 2PU9B 5IH2A 1Q86C 3OMCA 2D8HA 1LJOA 4M78D 1C0MA 4E7LA 2DPPB 3LW5E 3CCQT 3VV0A 2NWMA 5GANh 4EMGA 1VQ7A 5KYYA 4OF1A 4J8OA 1YJ9A 1X27A 3RKYA 2KRNA 3SWNC 1W70A 3M0PA 4PJOC 3JB9H 1RAEB 2EQKA 5GMKm 1S72Q 3CPWP 3QPHA 2OTLQ 2O01E 3JV3A 2KBTA 4XTYA 2KSSA 3M5AA 3CCEQ 2LQKA 3LYIA 3OYKA 1QKXA 2JS0A 1FYNA 3DB3A 4M7AC 2LMJA 1UB4A 1AD5A 1JEGA 3EFOB 3MJXA 5A0LA 1N9RA 1RADB 4C92C 1MMGA 2DMOA 4M77D 3OYNA 1D1AA 3EGUA 2A0FB 2HBPA 3H41A 2OTJA 3EFOA 3R6OA 4HVVA 2OX7A 2WACA 3LGLA 3M58A 1VQ9A 4K11A 4LUEA 3FEOA 3CC7A 2K5LA 4QVZA 1H3HA 1ACMB 1BK2A 5GAN6 2V1RA 1M1FA 1TH7A 2E6ZA 3RMQA 4PJOF 3CBPA 2PTKA 2DRMA 4DBRA 4E7JA 4FT2A 2ECZA 2EVRA 4NL2A 2O88A 1OX8A 4RCBA 1QLYA 4N4HA 1SSFA 2XK0A 3OYYA 4C8QE 1SPKA 1UJ0A 2OJ2A 5M9OA 2DVJA 2CP2A 1RACB 1Q7YC 3L2QA 5ECAA 3TEEA 4M7AF 1YCYA 3OYMA 1FX7A 3OBYA 1RI9A 3OYJA 4C92F 2C0IA 3CD6A 2VGNA 3ME9A 3C94A 2F5KA 4N4IA 1MNDA 4OGCA 2KK4A 3LLRA 1EZZB 3L2UA
chains in the Genus database with same CATH topology
4ME7A 4LDVA 3J81E 3JB9D 3QG1A 2IG0A 3HRSA 3SB2A 2LNVA 2DJZA 1BI1A 1NE8A 3J80E 2EFIA 2K4YA 4ZTFA 5I21A 3HRUA 1QVGA 2R57A 4NS5A 4N0AC 3JCMh 3L2RA 5GAOq 3MP8A 4A4GA 3QJYA 3I56T 3H8ZA 2X4XA 2GQVA 3H6ZA 5GAOm 4MDWA 4OVAA 3MCAB 2LCLA 1NPRA 2Y90A 3UT1A 2OTJT 2RHYA 4IUUA 2X4JA 4OB2B 4ELZC 4EMKC 2XICA 4F7UE 5LJ5e 1K8AU 1K9MC 2E70A 2QXFA 2B8AA 2X4WA 2PUOB 3X24B 3RERA 3M9QA 4C92E 3LWHA 3A8GB 3M59A 4QQDA 1VQ4A 2MF2A 2ZZDA 3O8VA 4M78C 3CXCS 4MMKA 5J3BA 2GF7A 2KDSA 5HY6A 3JCMd 4M75B 1UGRB 1N27A 1S72A 5HKCA 2M16A 4FIBA 3FRNA 4KUDK 3HKSA 4M7DB 3M57A 3G71T 3CC4T 3VYGA 3EAEA 4A54A 5LL6S 2OTLA 4F7UB 4VUBA 4LDYA 1MGQA 2A7YA 2EQMA 4FT4A 5HK0A 1YITT 4FU6A 1M1KU 3GF5A 4X34A 5FU6B 3QHSA 1LNXA 5FU7C 4QVDA 4R55A 2DVEA 2DTIA 4JLGA 3CCUA 2GFAA 2XIDA 3JB9G 3WXMB 1UEBA 3BFMA 1PSEA 3TREA 4N4GA 5LJ3h 4M75A 2VXEA 3S3OA 1NPPA 2CZ1B 3A8OB 5CQYA 1M8VA 5GANe 4F7UA 3NTIA 3JCMX 1FXXA 5CKBA 5GMKi 4OP0A 4GLKA 4PLLA 5CVIA 2EJ9A 1M9SA 3ER0A 4M78G 1DJ7B 2XHCA 2RJDA 4FM4B 4R56A 3CMAT 4O5VA 4HCZA 2DO3A 3I56A 4C0DC 5KCOA 3F70A 3UWNA 5LJ3d 4JRQA 2E41A 2RJEA 2V8JA 1YBYA 2JOYA 4JUVA 3PGGA 4PLIA 5CKDA 5FRMA 1XOVA 1NZ9A 4NOYA 2RO0A 2HD0A 3QIIA 2MWOA 2EWNA 2O4XB 3OYLA 2VC8A 3P8DA 5LJ5g 2ZPIB 4BE1A 1ZBXA 2KMTA 5GMKj 1VQOT 1LOJA 3GLXA 4KT0E 1K73U 1Q86U 1Q82U 2E12A 2RK2A 4EDUA 3J7AF 3PTAA 3META 4BUGA 5GAN4 2FB7A 1G5VA 4P5NA 1XQHA 2D0QB 2RI3A 2D6FA 3L1AA 1XNIA 5GAMe 3G71A 4M78F 3KUFA 2KAFA 4J83A 2VYTA 4QW2A 1YIJT 2A3LA 2O4XA 3WVDB 2LDMA 3HFNA 4OB1B 1O9SA 4RG8A 3CCLT 2PVGB 2PVOB 3M4GA 4XU3A 2QQAA 2QA4T 1KD1U 2HQEA 5C0MA 3TU4K 3SD4A 4C0FA 2XI9A 4J7FA 3FB9A 4KULA 4BD3A 4B9WA 2D9TA 2DIGA 4ZN3A 3FLGA 4BI4A 2WSCE 3VYHB 3OS2A 1KQSS 4EMHA 2QQ9A 3OBWA 2E6NA 2EQJA 1UGPB 5GMKh 4LD9K 1Y7XA 3I55A 4ZTJA 1K8AC 4M77G 3X25B 4JRKA 5GANg 1VQ4T 1VQKT 2BKDN 5GAOl 4XU0A 4C5IA 2RM4A 3CMAA 1ZQ1A 4JLIA 1S72T 2FL7A 5I2MA 2ZPGB 4V2SA 2K5IA 1UGSB 1QVPA 1G3SA 3JCMb 5DY9A 1HK9A 2K3YA 2NLUA 2JTFA 5A0GA 2JNGA 1VIEA 1HXDA 5EG2A 3VJPA 3TCJA 1N8RU 4BY6B 3CCET 1GXIE 3CCUT 2XG8D 1YHQT 1M1KC 1WNLA 4WF2A 4PJOE 1KHCA 1VQOA 4DQ2A 2YHTA 4IUPA 3MHXA 4L5GA 3HPWA 3OY9A 1NJIU 3G6EA 3OW2S 3OSVA 3PT9A 4FSXA 1KHIA 4M77F 1VQ6T 2ZPBB 4IURA 4UC4A 4EPCA 3CXCA 1W2BA 2DKGA 3EFRA 3V8KA 5GAOp 2QEXT 3CCVT 5CQXA 5IAYA 5GAMg 4C8QB 2GFUA 1YIJA 1PSFA 3JSCA 1X6OA 2PQWA 2CYZB 3LX7A 2L89A 5GAN8 2RHIA 2QI2A 1BIAA 3CCST 1QVFS 2WSEE 4YTLA 4XTXA 3E19A 3QZ5B 5CAIA 5LJ5h 4J6YA 3L2WA 2QA4A 3L42A 1B34B 4M7AE 1OZ2A 3QYHB 3GOXA 1M90U 2KQWA 5GANj 4C8QD 4QQ6A 4J6XA 3GPLA 1U8RA 3RKXA 5D6YA 2VGMA 1VIFA 4OB0B 3PMIA 4C8QA 4C5EA 4L6V5 5GAOr 2CZ6B 2E5QA 1W2BS 3GNFB 3M53A 1VQKA 3SWNB 2MMPA 3MEVA 3HFOA 3HRTA 2MI6A 4Z02A 4ZGJB 1B34A 2L5QA 2YLCA 3BDLA 5LJ5d 4PJOB 1WGSA 3P8BB 1Q82C 3A8HB 2CKKA 1QP3A 3OYIA 3FIFA 4X9DA 4Y28E 2K57A 3OS5A 3JCMe 4M75D 2CS7A 1U1SA 3LWIA 1Q81U 3JCMQ 2HAXA 3CCEA 4PJOD 4M7DD 1VUBA 1IZ6A 2YLBA 4HA8A 3SWNA 1YHQA 1IREB 5GAN5 5LJ5f 1KD1C 3E9FA 4PJOA 4M7DA 5IN1A 3C12A 2ZPFB 5GAMj 3CBOA 4L59A 3SDZA 1VQNA 1I81A 4M7AB 3I55T 1VQ6A 3V7CA 3OQ5A 2E10A 4BDZA 2DAQA 2RK1A 1OZ3A 4JRPA 4MDXA 1H3ZA 2LTOA 5GAN7 4ZN1A 2FVUA 2QEXA 3CCVA 2QQBA 3DKMA 3QXEB 4JRIA 4C8QG 3MEAA 4II1A 4BE0A 4LDXA 3CCSA 3A8LB 5FU6C 4C92B 4HCBA 5GAOn 4M7AD 2P0PA 2P0KA 1KC8U 4LD6A 3URGA 5DM7R 2BUDA 2QQRA 3CPWS 2XD0A 4J6WA 2XDPA 3C4SA 4J5YA 5FLXE 4M7AA 3EFSA 4C5HA 3X20B 4C92D 3CCRT 4XTUA 3JB9F 4C5GA 1G3WA 3OYAA 2VV5A 1U1TA 5LJ3e 2ZGWA 4M77C 2XDDA 3VKIA 1KQSA 3MO8A 1WJSA 2EYQA 3INZA 3JRZA 4BB7A 4C92A 1MHNA 4XK8E 3G6ET 1N8RC 1VQLT 2ZPEB 4QVCA 3HL8A 5GANf 1N9SA 1H641 3HHTB 3OMGA 4M75G 3FDRA 3M4YA 3MP6A 1G3YA 3E1SA 2QDYB 1W4SA 3MEUA 4A4EA 4M7DG 1NJIC 5CKEA 2DXBA 1RL2A 1K9MU 2P4TA 4F7UG 4MZPA 2FHDA 3L2ZA 4ELYC 3SFMA 3MP1A 1AHJB 4JDSA 4MMLA 2GCXA 2LQ8A 4E47A 1KG1A 1WJQA 1XTDA 1YJWA 1KQ1A 3JCMg 4KUIA 3OB9A 4BE2A 4DOWA 2RHZA 2EJFA 3N5BB 4XU1A 3S6WA 2CGHA 1WPYA 1JB0E 4LDUA 2G3RA 1ZHIA 1VQ8A 3OYHA 3S3NA 1M90C 5L8RE 4OB3B 2XDBA 4ATOA 4JS5A 3OW2A 4O6JA 5KE3A 2JTMA 3OSSC 3L2VA 4CI0C 1JJ2A 2LX9A 3ZEHA 4M75F 1M4ZA 4JS4A 2LCCA 2CZ7B 3BY7A 4M7DF 5GAMf 3JCMc 5HK3A 4C92G 4XAXB 2RJFA 4KBMB 5J39A 4F7UF 3JCMV 2EAYA 5DLOA 3JCMJ 3RMSA 2H3JA 3QSUA 1QP2A 1QVFA 1VQMT 1BI2A 1FWZA 1D3BB 2K5FA 5CIUA 4M78E 2EIFA 2DEQA 3LLRA 2M0OA 3CCRA 3JB9I 1QW1A 2LRQA 2RJCA 2RH2A 2K3XA 5D6XA 2X4YA 4E7KA 1VQ7T 2X35A 4J7IA 1YJ9T 5DLQE 3CC2T 2RHUA 5LJ3g 1VQLA 5I2SA 4BI8B 2L3RA 3OA6A 3CMEA 3CCMT 1JJ2S 1VQNT 4DA4A 1BI0A 2OAUA 1R8OB 3BDUA 3CMET 2JZ2A 3A5ZB 3NTHA 4LDWA 5D6WA 1D3BA 4OMFB 4XTZA 1VQ5A 2RA2A 2RI5A 1WJRA 3M54A 1P92A 3QDRB 1EIFA 1UGQB 4JJNK 2RB6A 3PNWC 3JAME 4BY6C 4IUVA 1BIBA 2JVVA 3CCJT 1BKBA 2DXCA 5CKFA 3S3MA 3QBYA 4OGEA 4FL6A 3OYDA 5GMKl 1I5LA 4PNOA 2M9UA 4EMKB 2QQSA 4HT8A 4RCCA 3QKJA 4GY5A 2I2LA 1Y07A 2VXFA 4MZMA 4BI3A 3UPUA 3OYBA 1JRIA 4N0AA 4Q5WA 3DB4A 3LGFA 2PUKB 4M78B 5CO7A 4BDYA 2K2VA 3V7RA 1Y96B 4C8QC 4C0GA 2YRVA 3AHUA 5A0DA 2VUBA 2LVMA 2PU9B 1K73C 1Q86C 4A4FA 3HP9A 3CBMA 3QUIA 3NFCA 3X28B 1M1GA 3OMCA 4EMKA 1V29B 1LJOA 5GAN2 4M78D 4E7LA 3QZ9B 2DPPB 3PMTA 4M77E 5IT9E 2MWPA 1VQMA 3LW5E 3CCQT 3G4ST 1KQ2A 5LJ3j 5FU7B 2XKOC 1Q7YU 4BACA 3CPWA 3RESA 3VV0A 1YJWT 2ZCFB 4M78A 1Y71A 3CCLA 5GANh 1Y96A 4EMGA 2EJGA 2RD1A 1VQ7A 4OF1A 4J8OA 3OYFA 4RG2A 5CCAA 5A2QE 1VQ9T 1YJ9A 2C06A 3CC2A 5FRNA 3RKYA 1VQ8T 2QTXA 4TVRA 3SWNC 3CC7T 2DTHA 5KH6A 4IUTA 4M75C 4A4HA 3CEYA 3CCMA 3VU3C 4E7HA 4XQ3A 3JCMP 3QO3A 5CR2A 4M7DC 4PJOC 1QVGS 3JB9H 5GMKm 2EQKA 2DK3A 3MEWA 1YJNT 1N6AA 1O75A 3OS1A 3QPHA 4Y91A 2O01E 4PL6A 4C0ZA 4C0DB 1M5Q1 5GANd 3CCJA 4XTYA 2KSSA 3M5AA 3PIOA 2DD5A 3JCMf 4A53A 2LQKA 2RI2A 3M55A 3LYIA 4DOVA 3OYKA 1YITA 2LC4A 4ZGDB 3DB3A 3JCMW 2LT1A 1UB4A 4IKFA 3V7SA 4M77B 5CK9A 1OYXA 4M7AC 4PKCC 5GAMh 2EKOA 3T9NA 1YI2T 1X01A 5A0LA 2R5MA 3PFSA 1N9RA 3VUZA 1BYMA 4C92C 4PJOG 4B9XA 4X9CA 1I4K1 2DZCA 4M77D 3OYNA 1VQ5T 2E1HA 2DXUA 4XTVA 2HQXA 3A8MB 4C8QF 4E7IA 2LT4A 3E9GA 3OS0A 3FC3A 3CCQA 3C95A 2HBPA 3RKWA 5C6SA 3V8JA 4M77A 3G4SA 3WVEB 3CD6T 2OTJA 3R6OA 1VQPT 4IUQA 1JBMA 2WACA 5GAMd 3LGLA 3M58A 3OYGA 3L2UA 2R5AA 2M1HA 3QYGB 3GIBA 4NL3A 1VQ9A 3QJ6A 2ZPHB 3RIRA 3M56A 3FEOA 2XU8A 5KCHA 3BW1A 3CC7A 3PIPA 2K5LA 4QVZA 5LJ3f 2DZ9A 4M7AG 5CKHA 5FROA 2EQUA 5GAN6 2BIVA 2PVDB 2E65A 3DLMA 3UDCA 4D6WA 2L8DA 1M1FA 1TH7A 3DLLA 3CC4A 1YJNA 4RMOA 3V8LA 3JB9J 2E6ZA 2FYKA 2KY9A 4QQGA 3RMQA 2F69A 4PJOF 3CBPA 4E7JA 2DTOA 4FT2A 4NL2A 2MAMA 2V8IA 4RCBA 3RUXA 1BI3A 1G3TA 1OI1A 4N4HA 3CPFA 1SSFA 2V8KA 2XK0A 3HSBA 3OYYA 2DXTA 2DIQA 4HCCA 4A4KA 4C8QE 5M9OA 3G7ZA 3OYCA 2Y4YA 2R58A 5GAN3 1Q7YC 1Q81C 5AYFA 3X26B 3L2QA 3ZFJA 4HT9A 1X75C 2IVWA 2RHXA 1YI2A 3TEEA 5GMKe 1WQWA 1YCYA 4M7AF 2KVQG 3OYMA 2Y4XA 3KBGA 2HNIA 1FX7A 2JN0A 1WQ7A 3OBYA 5J26A 4CRIA 2WSFE 3ZBDA 5LJ5j 1I8FA 2OTLT 3Q1JA 4XTWA 3OYEA 3OYJA 4C92F 2F5TX 3GP8A 3CD6A 2JUFA 4XU2A 5KE2A 3KXTA 2VGNA 3ME9A 3VUBA 3FJPA 3C94A 3NTKA 4M75E 4MZTA 2F5KA 2P0QA 1VQPA 4N4IA 4OGCA 4HKEA 4RKUE 4M7DE 3ASKA 2KK4A 2E64A 3P8HA 4ZGEB 1KC8C 2AHJB 3GNGA 2DD4A 3LH0A 1RI0A 2CZ0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FRN A;  3MO8 A;  1WJS A;  4ZTJ A;  1MHN A;  5KH6 A;  4IUT A;  2IG0 A;  4A4H A;  3CEY A;  4E7H A;  3OMG A;  2BKD N;  3FDR A;  3MP6 A;  4C5I A;  3MEU A;  2EQK A;  2EFI A;  4A4E A;  3MEW A;  4ZTF A;  3OS1 A;  2R57 A;  4NS5 A;  3L2R A;  3MP8 A;  4A4G A;  2FHD A;  2K3Y A;  2NLU A;  3MP1 A;  3H8Z A;  2JTF A;  2X4X A;  4PL6 A;  3H6Z A;  1WJQ A;  4OVA A;  3UT1 A;  2RHY A;  4IUU A;  3OB9 A;  4BE2 A;  2RI2 A;  2RHZ A;  3LYI A;  2B8A A;  2X4W A;  1KHC A;  3S6W A;  3OYK A;  3M9Q A;  4IUP A;  2G3R A;  4QQD A;  3DB3 A;  3OY9 A;  3OYH A;  3S3N A;  4IKF A;  1OYX A;  3O8V A;  2EKO A;  2GF7 A;  4IUR A;  4UC4 A;  5KE3 A;  1N27 A;  2R5M A;  3PFS A;  2M16 A;  3L2V A;  3ZEH A;  5IAY A;  2LCC A;  3EAE A;  4B9X A;  2GFU A;  3OYN A;  3LX7 A;  2PQW A;  2RJF A;  2EQM A;  2L89 A;  2HQX A;  2RHI A;  5J39 A;  4FU6 A;  4X34 A;  4E7I A;  3E9G A;  3OS0 A;  3L2W A;  3FC3 A;  3L42 A;  5C6S A;  1OZ2 A;  2GFA A;  3GOX A;  5CIU A;  4QQ6 A;  4N4G A;  2M0O A;  4IUQ A;  3S3O A;  2WAC A;  2RJC A;  2LRQ A;  3LGL A;  3OYG A;  3L2U A;  2R5A A;  2K3X A;  2M1H A;  2X4Y A;  5D6X A;  5D6Y A;  4E7K A;  3QJ6 A;  2X35 A;  3PMI A;  3FEO A;  5KCH A;  3NTI A;  2RHU A;  4C5E A;  2E5Q A;  4QVZ A;  2L3R A;  3OA6 A;  5FRO A;  3MEV A;  2EQU A;  4PLL A;  2BIV A;  4RG2 A;  4Z02 A;  2JZ2 A;  3DLM A;  3NTH A;  2L8D A;  3BDL A;  2RJD A;  5D6W A;  1WGS A;  4HCZ A;  2RI5 A;  2CKK A;  4QQG A;  1WJR A;  4E7J A;  3OYI A;  5KCO A;  3F70 A;  3UWN A;  3PNW C;  2RJE A;  4PLI A;  4IUV A;  5FRM A;  1OI1 A;  2RO0 A;  4N4H A;  3QII A;  3S3M A;  3QBY A;  1SSF A;  2MWO A;  2O4X B;  2XK0 A;  4FL6 A;  3OYD A;  3OYL A;  3P8D A;  2DIQ A;  4BE1 A;  2QQS A;  5M9O A;  3QKJ A;  4GY5 A;  3E9F A;  3OYC A;  5IN1 A;  2R58 A;  4L59 A;  3L2Q A;  4EDU A;  3MET A;  3OYB A;  1G5V A;  2RHX A;  3OQ5 A;  4Q5W A;  3DB4 A;  2RI3 A;  2DAQ A;  3LGF A;  1OZ3 A;  3OYF A;  4BDY A;  1XNI A;  4BDZ A;  1H3Z A;  2LTO A;  3OYM A;  2YRV A;  3KUF A;  2LVM A;  2VYT A;  4QW2 A;  5J26 A;  3MEA A;  4II1 A;  2O4X A;  4CRI A;  4A4F A;  4BE0 A;  2LDM A;  3OMC A;  3Q1J A;  3OYE A;  2P0K A;  3OYJ A;  4LD6 A;  4E7L A;  2BUD A;  2QQR A;  2HQE A;  3PMT A;  5C0M A;  3SD4 A;  2MWP A;  5KE2 A;  2XDP A;  3ME9 A;  3C4S A;  4BD3 A;  4BAC A;  3NTK A;  4B9W A;  2D9T A;  2F5K A;  4N4I A;  2DIG A;  4C5H A;  3FLG A;  3ASK A;  3P8H A;  4C5G A;  3OS2 A;  3OYA A;  3LLR A;  2E6N A;  3LH0 A;  1RI0 A;  2EQJ A; 
#chains in the Genus database with same CATH topology
 1VQO Q;  4LDV A;  3H0F A;  3J80 E;  1NE8 A;  4HXJ A;  1PG5 B;  4KGV B;  5I21 A;  2KRO A;  4NS5 A;  3QJY A;  1M2O A;  3CCL Q;  3H8Z A;  3H6Z A;  3TVT A;  1SHG A;  2QA4 Q;  1WX6 A;  1SSH A;  3REB B;  4IUU A;  1C1A A;  3EG3 A;  1IGU A;  1QQJ A;  1YFN A;  3M0T A;  7AT1 B;  1QKW A;  3CXC S;  2ZZD A;  4M78 C;  5J3B A;  3H0I A;  2KDS A;  1N27 A;  1UHC A;  4FIB A;  3FRN A;  1NEG A;  3G71 T;  5LL6 S;  2LP5 A;  1MGQ A;  2EQM A;  4HVW A;  4FU6 A;  1NLP C;  1GBR A;  3QHS A;  5FU7 C;  2YUN A;  1OPK A;  2DTI A;  3CCU A;  2GFA A;  2XID A;  1IB8 A;  3BFM A;  1PSE A;  5LJ3 h;  4DBQ A;  1WXT A;  2VXE A;  2LZ6 B;  4AFS C;  1IHW A;  4X1V A;  2LQN A;  3VS7 A;  1NEB A;  1M8V A;  1U06 A;  5CKB A;  1TSF A;  5GMK i;  4OP0 A;  4CC7 A;  1G2B A;  2EJ9 A;  4R56 A;  4HCZ A;  5KYN A;  5IHK A;  1QWF A;  3UWN A;  4JRQ A;  3VS1 A;  2V8J A;  2JOY A;  5CKD A;  1NZ9 A;  4LN2 A;  2MWO A;  2EWN A;  3NGP A;  1IRX A;  2KMT A;  1YNZ A;  2COW A;  3IQL A;  3MET A;  4BUG A;  2FB7 A;  2COY A;  1WXU A;  2D6F A;  1FMV A;  1JU5 C;  4M78 F;  4QW2 A;  4J9F A;  4OB1 B;  1O9S A;  3M4G A;  2DBM A;  3SD4 A;  3CCQ Q;  3M0S A;  4B9W A;  2D9T A;  4E6R A;  2RNA A;  2A36 A;  4EMH A;  2QQ9 A;  4CC3 A;  4LD9 K;  5GMK h;  1Y7X A;  2K3B A;  1K8A C;  1SG5 A;  2BE9 B;  4JRK A;  5GAN g;  1TXQ A;  3LH5 A;  4XU0 A;  4C5I A;  3CMA A;  4JLI A;  1X43 A;  5DY9 A;  4B6M A;  2J6K A;  1IHV A;  5A0G A;  1N8R U;  2M02 A;  1KIK A;  1E6H A;  3OW2 P;  1WNL A;  2KXD A;  4PJO E;  4L5G A;  3HPW A;  3G6E A;  1N8R R;  3OSV A;  3PT9 A;  4M77 F;  2ZPB B;  4IUR A;  4UC4 A;  1W2B A;  1VQL Q;  2F1L A;  3EFR A;  3CME Q;  3V8K A;  4RTZ A;  1SF9 A;  1YIJ A;  1PSF A;  2DYB A;  1X6O A;  2PQW A;  2CYZ B;  3LX7 A;  3CCS T;  5LJ5 h;  1RAG B;  4M7A E;  2FG0 A;  2KQW A;  3MPU B;  5GAN j;  4C8Q D;  4QQ6 A;  2QDL A;  3GPL A;  3CXC P;  1M27 C;  3RKX A;  1B07 A;  2PZ1 A;  2VGM A;  1VIF A;  4OB0 B;  2GGR A;  2O2O A;  1K8A R;  2AZV A;  3HRT A;  4Z02 A;  2DER A;  1AWW A;  2YLC A;  1QP3 A;  2J6O A;  3OYI A;  2EQI A;  3OS5 A;  2HAX A;  3LWI A;  1Q81 U;  1PRM C;  2RQU A;  1VQM Q;  5FWC A;  1YHQ A;  5GAN 5;  2KI7 A;  1TOV A;  1VQ6 A;  1XJW B;  2E10 A;  4BDZ A;  2QYZ A;  1H3Z A;  4ZN1 A;  2QQB A;  4C8Q G;  3MEA A;  3A8L B;  2HKQ B;  2L3Q A;  1UUE A;  2DL8 A;  2BUD A;  2QQR A;  4FW2 A;  2XDP A;  3E2U A;  4J5Y A;  1PD1 A;  2K7A A;  2JXB A;  1YN8 A;  3X20 B;  3CCR T;  2VVK A;  4C5G A;  1G3W A;  2FPF A;  1U1T A;  2XDD A;  2HQH A;  4QVC A;  3VRZ A;  5GAN f;  3HHT B;  1J3T A;  2G6F X;  3M4Y A;  2DLP A;  1K73 R;  1D0X A;  3UA7 A;  4MZP A;  3L2Z A;  3SFM A;  3MP1 A;  4MML A;  2CRE A;  3FJ5 A;  2C0O A;  3G4S Q;  2L0A A;  4BE2 A;  4F04 B;  2RHZ A;  1UG1 A;  2EJF A;  3N5B B;  2YSQ A;  1JB0 E;  4LDU A;  1D09 B;  1PD0 A;  1X6G A;  4OB3 B;  3OW2 A;  2JTM A;  3ZEH A;  4JS4 A;  2I0N A;  2CZ7 B;  3BY7 A;  4M7D F;  3JCM c;  1VYV A;  1YJN Q;  1X6B A;  1KSW A;  2RJF A;  4KBM B;  2EAY A;  2H3J A;  4E7S A;  1QVF A;  2K5F A;  4M78 E;  5IXB A;  1QW1 A;  5D6X A;  2X4Y A;  1VQ7 T;  4J7I A;  1YJ9 T;  5DLQ E;  3VS5 A;  5LJ3 g;  1HYO A;  5HCK A;  1BI0 A;  2EW3 A;  3A5Z B;  2X51 A;  5D6W A;  1GCQ A;  2CH4 A;  4R0K A;  1VQ5 A;  2RA2 A;  2RI5 A;  3BE3 A;  3QDR B;  1EIF A;  4JJN K;  2RB6 A;  4KRT A;  1D0Y A;  4BY6 C;  4IUV A;  2BZX A;  2DL5 A;  2DXC A;  3S3M A;  1M3B A;  3QBY A;  3OYD A;  4E2F B;  1VQP Q;  4EMK B;  2QQS A;  4GY5 A;  1ZA2 B;  4MZM A;  3DB4 A;  1K4U S;  4C8Q C;  4C0G A;  2KRS A;  1NBE B;  3HP9 A;  3CBM A;  3QUI A;  3X28 B;  4EMK A;  5GAN 2;  4CC4 B;  4M77 E;  1KQ2 A;  2K2M A;  5LJ3 j;  3RES A;  2ZCF B;  1QMC A;  1VQ9 T;  4RG2 A;  5A2Q E;  2C06 A;  1VQ8 T;  4KGZ B;  4TVR A;  3CC7 T;  2DTH A;  5KH6 A;  3CCM A;  4A4H A;  5AT1 B;  4E7H A;  1LVK A;  1G83 A;  2DM1 A;  2K6D A;  1PKS A;  1N6A A;  1O75 A;  4C0Z A;  3PIO A;  1N5Z A;  1RAA B;  1UGV A;  1E6G A;  2RI2 A;  1I0C A;  3M55 A;  1KC8 R;  2EGA A;  1YIT A;  2X3W D;  1VOM A;  3ZL7 C;  2LC4 A;  4LXC A;  2LT1 A;  5CK9 A;  4OMN A;  1X01 A;  2R5M A;  3EGX B;  2F2X A;  1AWO A;  4PJO G;  1RAB B;  1I4K 1;  2K9G A;  5IHI A;  3A8M B;  4C8Q F;  3I56 Q;  3FC3 A;  3C95 A;  3CD6 T;  3WVE B;  2M0Y A;  1NLO C;  1K9M R;  1WLP B;  5GAM d;  3EGX A;  1V1C A;  3OYG A;  2J05 A;  2M1H A;  3QYG B;  4NL3 A;  4D8D A;  2ZPH B;  1QCF A;  3M56 A;  2XU8 A;  3PIP A;  5LJ3 f;  2A37 A;  2FO0 A;  4M7A G;  5FRO A;  2JM9 A;  2EQU A;  2PVD B;  2L8D A;  4RMO A;  3V8L A;  4J9I A;  4QQG A;  4AG2 C;  2MAM A;  2V8I A;  4JJB A;  2LJ0 A;  1G3T A;  2H8H A;  3HSB A;  5IXF A;  3OYC A;  3EH1 A;  2Y4Y A;  1ABO A;  5GAN 3;  3ZFJ A;  1X75 C;  2RHX A;  1YI2 A;  1OQK A;  5GMK e;  2KVQ G;  1Z9Q A;  1WQ7 A;  4CRI A;  2WSF E;  4PK4 A;  5LJ5 j;  1I8F A;  2ENM A;  1X2K A;  3THK A;  3GP8 A;  2F5T X;  4XU2 A;  3KXT A;  2YUO A;  5L23 A;  3VUB A;  3FJP A;  4QKU A;  1Y0M A;  4MZT A;  4RKU E;  4A63 B;  4M7D E;  1B3Q A;  1H64 1;  3GNG A;  2EYW A;  3LH0 A;  4ME7 A;  2EPD A;  3QG1 A;  2IG0 A;  2LNV A;  2EFI A;  3I9Q A;  2K4Y A;  1QVG A;  2R57 A;  4N0A C;  2LJ3 A;  2BZY A;  2X4X A;  4FSS A;  5GAO m;  2RHY A;  5LJ5 e;  2OI3 A;  2SEM A;  2B8A A;  2X4W A;  2PUO B;  4QQD A;  2MF2 A;  3O8V A;  4MMK A;  1SRM A;  3O5Z A;  1PNJ A;  4J9E A;  3JCM d;  4LUD A;  1UGR B;  1S72 A;  4KUD K;  1VQK Q;  3CC4 T;  2V26 A;  4A54 A;  2OTL A;  2A7Y A;  5HK0 A;  3GF5 A;  5FU6 B;  3UF4 A;  1LNX A;  4QVD A;  4R55 A;  3RER A;  3WXM B;  3TRE A;  4GLM A;  1WFW A;  2FZG B;  4GLK A;  4M78 G;  1NYG A;  3ER0 A;  2DX1 A;  1DJ7 B;  3CMA T;  2QEX Q;  3CCV Q;  4C0D C;  5KCO A;  2E41 A;  3PGG A;  5FRM A;  1A0N B;  4NOY A;  2MYS A;  1TTH B;  1BBZ A;  1HJD A;  2O4X B;  2VC8 A;  4BE1 A;  1K9A A;  1ZBX A;  1JXM A;  1RAF B;  1Q86 U;  1W6X A;  2RK2 A;  3PTA A;  2BZ8 A;  1XQH A;  2D0Q B;  2JT4 A;  1LPL A;  1XNI A;  5GAM e;  2P4R A;  3KUF A;  1JQQ A;  1YIJ T;  1D1B A;  2O4X A;  3VS4 A;  3WVD B;  2LDM A;  4XU3 A;  1KD1 U;  2HQE A;  4C0F A;  1TU0 B;  2XI9 A;  4KUL A;  4BD3 A;  2DIG A;  4BI4 A;  1KD1 R;  2W10 A;  3OS2 A;  2E6N A;  1VQ9 Q;  2L3S A;  4M77 G;  1VQ8 Q;  1M30 A;  1VQ4 T;  1U3O A;  3VS6 A;  2BKD N;  5GAO l;  2RM4 A;  3PVQ A;  2FL7 A;  5I2M A;  2ZPG B;  1QVP A;  1UTI A;  1G3S A;  3JCM b;  1CKA A;  4FYW B;  1CKB A;  1C6V X;  1UEC A;  4CC2 A;  1YHQ T;  4WF2 A;  2ZAE A;  1VQO A;  3TQ7 P;  3OW2 S;  4RTY A;  4DBF A;  1YWP A;  1VQ6 T;  1RAI B;  5CQX A;  5IAY A;  2KEA A;  3CCL A;  1QVF S;  1KK7 A;  5GAN 8;  1BIA A;  2WSE E;  2QA4 A;  3L2W A;  4J6Y A;  3L42 A;  1B34 B;  1OZ2 A;  3GOX A;  1M90 U;  4JJD A;  1B7T A;  3RBB B;  1SEM A;  4J6X A;  1S1N A;  1W2B P;  3D7S B;  2EYY A;  4PJN A;  4RTW A;  1GFC A;  2GTJ A;  1ZSZ C;  2CZ6 B;  2CT3 A;  3GNF B;  3SWN B;  2MI6 A;  1B34 A;  4PJO B;  1WGS A;  1YP5 A;  2RN8 A;  3JCM e;  2CS7 A;  1U1S A;  4M7D D;  1IZ6 A;  4HA8 A;  3SWN A;  2DET A;  4PJO A;  5IN1 A;  3C12 A;  3ULR B;  3CBO A;  8AT1 B;  1I81 A;  4M7A B;  3I55 T;  3CC2 Q;  4MDX A;  4AT1 B;  4LDX A;  4JRI A;  1T3L A;  2AKL A;  4C92 B;  1K1Z A;  2P0K A;  3URG A;  1KFZ A;  2XD0 A;  2DL4 A;  4M7A A;  2CP0 A;  4RTU A;  4C5H A;  1TS9 A;  4AFZ C;  4M77 C;  4BB7 A;  3INZ A;  4C92 A;  1N8R C;  1MHN A;  4XK8 E;  2ZPE B;  3HL8 A;  2QDY B;  4A4E A;  4M7D G;  5CKE A;  3TSW A;  1RL2 A;  4RTX A;  4JDS A;  2GCX A;  1UHF A;  4DEY A;  4E47 A;  2J6F A;  1MMN A;  4KUI A;  1PKT A;  1K76 A;  2FRW A;  2CGH A;  2B86 A;  4J9G A;  3I5S A;  2XDB A;  4ATO A;  2EYZ A;  4JZ3 A;  1X2Q A;  4O6J A;  5KE3 A;  2KRM A;  3L2V A;  1JJ2 A;  4M75 F;  2CSI A;  3HTR A;  2LCC A;  3CC4 Q;  4OMQ A;  4XAX B;  5J39 A;  4PFO A;  4F7U F;  3QSU A;  2DL3 A;  1QP2 A;  1BI2 A;  1FWZ A;  4PFP A;  1D3B B;  4AFQ C;  5CIU A;  2DEQ A;  1OX9 A;  1BU1 A;  2LRQ A;  4QT7 A;  2K3X A;  4EIK A;  2KYB A;  1VQL A;  2LX7 A;  3CME A;  3CCM T;  1VQN T;  2DYI A;  1R8O B;  1QVF P;  2GTO A;  1D3B A;  4XTZ A;  2XMF A;  1WJR A;  1P92 A;  1F1B B;  2RF0 A;  2DIL A;  4ANJ A;  3JAM E;  1WHM A;  1X69 A;  1BIB A;  3KFV A;  1BKB A;  4OML A;  2EGE A;  2HBW A;  1I5L A;  2HL5 C;  2M9U A;  4DBH A;  4HT8 A;  3MKD A;  2I2L A;  1Y07 A;  4BI3 A;  3R6N A;  1JRI A;  4GBQ A;  4Q5W A;  5CO7 A;  4M78 B;  2PUK B;  4BDY A;  3REA B;  4FW1 A;  3AHU A;  2LVM A;  2D0N A;  1K73 C;  1YIJ Q;  2F2W A;  2KXC A;  3NFC A;  1V29 B;  2YRD A;  3QZ9 B;  3PMT A;  5IT9 E;  1VQM A;  2MWP A;  5FU7 B;  2XKO C;  4BAC A;  1YJW T;  4M78 A;  5KYW B;  1Y71 A;  2X9H A;  4JJC A;  2EJG A;  5CCA A;  1Q81 R;  5FRN A;  1VA7 A;  1VQ4 Q;  3CEY A;  3JCM P;  3QO3 A;  4M7D C;  1QVG S;  1RLQ C;  2DK3 A;  3MEW A;  3OS1 A;  5KYW A;  2DE0 X;  1Z9Z A;  1UE9 A;  3EHR A;  4PL6 A;  4J9D A;  1M5Q 1;  3CCJ A;  1I07 A;  2L3P A;  1GL5 A;  2KT1 A;  4DOV A;  1EX4 A;  4ZGD B;  1GRI A;  3V7S A;  4M77 B;  1OYX A;  4PKC C;  5GAM h;  3QWX X;  2ROL A;  1YI2 T;  1BCO A;  3PFS A;  3VUZ A;  1BYM A;  4B9X A;  2DZC A;  1D0Z A;  1WHJ A;  4E7I A;  2LT4 A;  3E9G A;  4J9H A;  1AWX A;  3G4S A;  3V8J A;  4M77 A;  1QWE A;  1JBM A;  3GIB A;  2R5A A;  3QJ6 A;  1AEY A;  2YT6 A;  3BW1 A;  5GJV B;  5CKH A;  2BIV A;  4D6W A;  2QK0 A;  4FCY A;  2CT4 A;  3DLL A;  1YJN A;  3G71 Q;  4D8K A;  4AFU C;  2YUP A;  3RUX A;  1BI3 A;  2DRK A;  1OI1 A;  2EYX A;  4RTT A;  1TUC A;  1I5O B;  2IPO B;  4OMO A;  2DXT A;  4HCC A;  2CUD A;  1MMA A;  1ZUY A;  4HT9 A;  5AYF A;  3I55 Q;  2QG9 B;  1NM7 A;  3AT1 B;  2ED0 A;  3KBG A;  2HNI A;  3ZBD A;  2OTL T;  1FMW A;  2ABL A;  3Q1J A;  2JUF A;  3NTK A;  4M75 E;  1VQP A;  2P0Q A;  1GCP A;  2HMA A;  1WA7 A;  2E64 A;  4ZGE B;  3EG9 B;  1KC8 C;  1MMD A;  4F7U E;  1RI0 A;  2CZ0 B;  3J81 E;  3JB9 D;  3HRS A;  3SB2 A;  2AT1 B;  4AG1 C;  5FW9 A;  4ZTF A;  1PHT A;  3HRU A;  3L2R A;  3JCM h;  3EG9 A;  2DBK A;  2F2V A;  2GQV A;  2VAS A;  4OVA A;  3MCA B;  3UT1 A;  2OTJ T;  4ELZ C;  2X4J A;  4OB2 B;  2XIC A;  1K9M C;  2QXF A;  3M9Q A;  2EGC A;  3LWH A;  3A8G B;  3M59 A;  1QVG P;  2JS2 A;  5HY6 A;  1WHK A;  2KT8 A;  2M16 A;  1MNE A;  1PCX A;  4M7D B;  3M57 A;  1OU9 A;  3EAE A;  4VUB A;  4FT4 A;  1H92 A;  1M1K U;  4X34 A;  4FYY B;  3EHQ A;  2DVE A;  4JLG A;  3JB9 G;  1UEB A;  1K0X A;  4ZNX A;  2V1Q A;  3S3O A;  3M0U A;  2QAZ A;  3A8O B;  3SEM A;  5CQY A;  3NTI A;  3JCM X;  1FXX A;  2X3X D;  1ZUK A;  1WIE A;  3CCM Q;  4PLL A;  5CVI A;  1VQN Q;  2RJD A;  2L2P A;  2A08 A;  3I56 A;  2MCN A;  3F70 A;  3CCS Q;  2HEQ A;  1YBY A;  4JUV A;  4PLI A;  3NPF A;  2RO0 A;  2HD0 A;  3P8D A;  5LJ5 g;  2ZPI B;  2YUQ A;  5GMK j;  1VQO T;  1LOJ A;  1Q82 U;  4EDU A;  1G5V A;  2PNI A;  5KYX B;  2JMC A;  4F17 A;  1OU8 A;  2KAF A;  1Q82 R;  2VYT A;  2O9V A;  2GQI A;  3HFN A;  3CCL T;  2QTV A;  4RG8 A;  2PVG B;  2DNU A;  2HCK A;  2QA4 T;  2KGT A;  5C0M A;  3UAT A;  4J7F A;  3FB9 A;  1FMK A;  1YJW Q;  4LNP A;  1VYT A;  3FLG A;  3I5R A;  2QGF B;  5KYX A;  3VYH B;  1PC0 A;  2FEI A;  4IIO A;  4J9C A;  2JW4 A;  1ZQ1 A;  1HD3 A;  4V2S A;  2K5I A;  1UGS B;  1HK9 A;  2YXY A;  2JTF A;  1AT1 B;  1HXD A;  5EG2 A;  3VJP A;  3TCJ A;  1WHL A;  2K79 A;  4BY6 B;  3CCU T;  2C0T A;  1IGQ A;  3CCR Q;  3MHX A;  3OY9 A;  1NJI U;  1KHI A;  3RDV A;  4EPC A;  1PRL C;  1Q95 G;  2E4H A;  1YI2 Q;  2DKG A;  2NUP B;  5GAM g;  4C8Q B;  2RQR A;  2RQT A;  2RHI A;  5GJW B;  5CAI A;  4XTX A;  3E19 A;  3QZ5 B;  3M0R A;  2DFU A;  2HSP A;  2NUP A;  5D6Y A;  3G1J A;  4C8Q A;  3PMI A;  4C5E A;  4L6V 5;  2E5Q A;  1W2B S;  2CP5 A;  1VQK A;  3HFO A;  2L5Q A;  3P8B B;  3VRY A;  2J7I A;  3FIF A;  4Y28 E;  3EGD B;  4M75 D;  3CCE A;  2DA9 A;  2YLB A;  1IRE B;  5LJ5 f;  1KD1 C;  3E9F A;  3GBQ A;  1TG0 A;  5GAM j;  1VQ7 Q;  4ESR A;  3SDZ A;  1YJ9 Q;  1AVZ C;  1M8M A;  2DAQ A;  3EGD A;  1OZ3 A;  4KH0 B;  3VS3 A;  2LTO A;  5GAN 7;  2QEX A;  2FVU A;  3CCV A;  1IXD A;  1TWB A;  4HCB A;  2COZ A;  4LD6 A;  1M2V B;  1GFD A;  5FLX E;  1RUW A;  4E7Z A;  3EFS A;  4XTU A;  3JB9 F;  1PWT A;  3OYA A;  2VV5 A;  3UA6 A;  2ZGW A;  1KQS A;  2EYQ A;  3G6E T;  1VQL T;  3CME T;  4M75 G;  3FDR A;  3MP6 A;  1M2V A;  1G3Y A;  1W4S A;  3MEU A;  1AOJ A;  1Q86 R;  2DXB A;  4F7U G;  3M0Q A;  1AHJ B;  3TSZ A;  4RUG A;  1WJQ A;  2W0Z A;  1KQ1 A;  3JCM g;  2OTJ Q;  3OB9 A;  2RPN A;  4DOW A;  1WDX A;  4XU1 A;  3S6W A;  1WPY A;  1HSQ A;  1VQ8 A;  3OYH A;  1M90 C;  3CC7 Q;  2LCS A;  1CSK A;  2FRY A;  4ORZ A;  5GAM f;  1YCS B;  4LE9 A;  2FZK B;  1VQM T;  1K0S A;  2SRC A;  2M0O A;  3JB9 I;  1TUG B;  2RJC A;  2RH2 A;  1JJ2 P;  4FYX B;  2BTT A;  2NUT B;  2CP6 A;  5I2S A;  2IIM A;  3OA6 A;  4DA4 A;  3BDU A;  2OAU A;  2JZ2 A;  4LDW A;  4OMF B;  1NG2 A;  2JTE A;  1U5S A;  1YWO A;  2O31 A;  2NUZ A;  3PNW C;  2HL3 A;  2JVV A;  3CCJ T;  2NUT A;  3U23 A;  3CD6 Q;  5GMK l;  4PNO A;  5KYU B;  3QKJ A;  2VXF A;  1M90 R;  3PVL A;  3OYB A;  4N0A A;  2DL7 A;  2O9S A;  4Y92 A;  1Y96 B;  1I1J A;  2YRV A;  5A0D A;  1H8K A;  4A4F A;  1M1G A;  5KYU A;  3G4S T;  1UFF A;  1Q7Y U;  5I22 A;  3CPW A;  2RQV A;  2CH4 W;  2DF6 A;  1Y96 A;  2RD1 A;  1OPL A;  3OYF A;  1Q7Y R;  3CC2 A;  2JMA A;  2QTX A;  2LNH B;  4J9B A;  2FPE A;  4IUT A;  4M75 C;  3VS2 A;  3VU3 C;  4XQ3 A;  5CR2 A;  1E7O A;  2CSQ A;  1WXB A;  1YJN T;  4Y91 A;  2OAW A;  1R0B G;  3CQT A;  1G8X A;  4C0D B;  5GAN d;  2D8J A;  2DD5 A;  1UDL A;  3JCM f;  4A53 A;  3CCU Q;  1WYX A;  2YWW A;  3H0H A;  2LJ1 A;  3JCM W;  4IKF A;  2YDL A;  2EKO A;  3T9N A;  1WI7 A;  2EKH A;  1RAH B;  1ZA1 B;  2GNC A;  4X9C A;  1VQ5 T;  2E1H A;  2DXU A;  4XTV A;  2HQX A;  1ZBJ A;  1ZUU A;  3OS0 A;  3CCQ A;  3RKW A;  5C6S A;  3A98 A;  5I11 A;  1VQP T;  4IUQ A;  3QDF A;  3EG0 A;  1UJY A;  1LCK A;  3RIR A;  5KCH A;  1OUL A;  1ARK A;  2DZ9 A;  3QWY A;  1PM3 A;  2E65 A;  3DLM A;  3UDC A;  3CC4 A;  3JB9 J;  2FYK A;  2KY9 A;  1KJW A;  2F69 A;  4IIM A;  2DTO A;  2HZY A;  3CPF A;  2V8K A;  2DIQ A;  4A4K A;  1Y57 A;  3G7Z A;  2R58 A;  1Q81 C;  3X26 B;  2IVW A;  2YRC A;  1WQW A;  2Y4X A;  2JN0 A;  4M4Z A;  5J26 A;  4F16 A;  3CMA Q;  2MPX C;  4RTV A;  4XTW A;  3OYE A;  1GCQ C;  5KE2 A;  4HKE A;  3ASK A;  1T3S A;  3P8H A;  2AK5 A;  5D7U A;  2AHJ B;  2DD4 A;  1YIT T;  3NMZ C;  1EFN A;  2A28 A;  3G6E Q;  4DEX A;  4WTO B;  1SRL A;  1ZSZ B;  2DJZ A;  1BI1 A;  1NYF A;  2ED1 A;  5GAO q;  3MP8 A;  4A4G A;  1ZSG A;  3I56 T;  4MDW A;  2LCL A;  1NPR A;  2Y90 A;  2HKN A;  3H9N A;  3EG1 A;  1K8A U;  4EMK C;  2HDA A;  1ZSZ A;  2E70 A;  1OEB A;  3X24 B;  2VB6 A;  4C92 E;  5EC7 A;  1VQ4 A;  1T0J A;  1WZO A;  2GF7 A;  4PJM A;  4M75 B;  2DEU A;  5HKC A;  1M3C A;  3HKS A;  2JJ9 A;  4HVU A;  3VYG A;  4KH1 B;  4F7U B;  4LDY A;  2MK5 A;  2E5K A;  1TUD A;  1V76 A;  1W1F A;  4FYV B;  4N4G A;  4M75 A;  5FWB A;  1GBQ A;  3RR6 A;  1YHQ Q;  1NPP A;  2CZ1 B;  5GAN e;  4F7U A;  1SHF A;  2H3E B;  4JZ4 A;  2RMO A;  1M9S A;  1VQ6 Q;  2XHC A;  4FM4 B;  4O5V A;  8ATC B;  1IO6 A;  2DO3 A;  5LJ3 d;  2RJE A;  2MOX A;  3CCJ Q;  1XOV A;  4Z88 A;  3QII A;  3OYL A;  2AIR B;  3GLX A;  4KT0 E;  1K73 U;  2E12 A;  3J7A F;  5GAN 4;  4P5N A;  2RI3 A;  3L1A A;  4AMC A;  3G71 A;  1QCN A;  4J83 A;  2E3H A;  2A3L A;  4HCK A;  3NHN A;  1R77 A;  2CP7 A;  2M51 A;  2PVO B;  3C0C A;  2QQA A;  4Z8A A;  3TU4 K;  3EH2 A;  3I35 A;  2AKK A;  1ZLM A;  2EBP A;  4ZN3 A;  2WSC E;  1KQS S;  3OBW A;  2FZC B;  2ROT A;  1UGP B;  2EQJ A;  3I55 A;  4ZTJ A;  3X25 B;  3RNJ A;  1VQK T;  1T0H A;  2KR3 A;  1S72 T;  2FPD A;  2K3Y A;  2NLU A;  3EG2 A;  2JNG A;  1VIE A;  3CCE T;  2HSE B;  1GXI E;  2XG8 D;  1M1K C;  1KHC A;  4DQ2 A;  2YHT A;  4IUP A;  2D1X A;  2J06 A;  3A1P A;  4FSX A;  3CXC A;  5GAO p;  2QEX T;  3CCV T;  4KGX B;  2GFU A;  3JSC A;  1VQ5 Q;  2L89 A;  2QI2 A;  4YTL A;  2KYM A;  2RQW A;  3QYH B;  1MV0 B;  2VKN A;  1U8R A;  2CP3 A;  5GAO r;  2QGG A;  3M53 A;  1OV3 A;  2GBQ A;  2MMP A;  3MEV A;  3VS0 A;  4ZGJ B;  5LJ5 d;  3BDL A;  1JO8 A;  1Q82 C;  3A8H B;  2CKK A;  4OMP A;  4X9D A;  1OOT A;  2K57 A;  3JCM Q;  4PJO D;  1VUB A;  1AZE A;  1M1K R;  2MIO A;  4PJJ A;  4M7D A;  2ZPF B;  1AZG B;  4L59 A;  1AWJ A;  1VQN A;  3V7C A;  3OQ5 A;  2DJQ A;  2RK1 A;  4JRP A;  2P84 A;  2Z0W A;  1D1C A;  4JPB W;  2ATC B;  3DKM A;  3QXE B;  2LQW A;  4II1 A;  4BE0 A;  3CCS A;  5FU6 C;  5GAO n;  4M7A D;  2P0P A;  1KC8 U;  5DM7 R;  3CPW S;  4J6W A;  1MV3 A;  3C4S A;  2JM8 A;  4Z89 A;  4C92 D;  1BCM A;  5LJ3 e;  1YIT Q;  3VKI A;  3MO8 A;  1WJS A;  3JRZ A;  1N9S A;  2ESW A;  3OMG A;  2AZS A;  4OMM A;  3E1S A;  3PE0 A;  1NJI C;  5IHN A;  1K9M U;  2P4T A;  2FHD A;  1RLP C;  4ELY C;  2LQ8 A;  1KG1 A;  1XTD A;  1ABQ A;  1YJW A;  2NYS A;  1KQS P;  1JXO A;  2G3R A;  1ZHI A;  3S3N A;  5L8R E;  2BE7 D;  4JS5 A;  2E3I A;  1BB9 A;  3OSS C;  4CI0 C;  2LX9 A;  1M4Z A;  1QCO A;  5HK3 A;  4C92 G;  3JCM V;  5DLO A;  3JCM J;  3RMS A;  1R0C B;  1ZX6 A;  2KNB B;  6AT1 B;  4WCI A;  2EIF A;  3CCR A;  2CDT A;  2VWF A;  9ATC B;  1M3A A;  4E7K A;  2X35 A;  3CC2 T;  2RHU A;  2CUB A;  3SHW A;  4BI8 B;  2L3R A;  1WHH A;  1JJ2 S;  2KE9 A;  3NTH A;  1MUZ A;  1NJI R;  3M54 A;  1UGQ B;  1SKU B;  5CKF A;  4PFZ A;  4FL6 A;  4OGE A;  1WHG A;  4RCC A;  1VYU A;  4F14 A;  3UPU A;  4PJL A;  3LGF A;  2QAS A;  2K2V A;  3V7R A;  5KYY B;  2VUB A;  2PU9 B;  5IH2 A;  1Q86 C;  3OMC A;  2D8H A;  1LJO A;  4M78 D;  1C0M A;  4E7L A;  2DPP B;  3LW5 E;  3CCQ T;  3VV0 A;  2NWM A;  5GAN h;  4EMG A;  1VQ7 A;  5KYY A;  4OF1 A;  4J8O A;  1YJ9 A;  1X27 A;  3RKY A;  2KRN A;  3SWN C;  1W70 A;  3M0P A;  4PJO C;  3JB9 H;  1RAE B;  2EQK A;  5GMK m;  1S72 Q;  3CPW P;  3QPH A;  2OTL Q;  2O01 E;  3JV3 A;  2KBT A;  4XTY A;  2KSS A;  3M5A A;  3CCE Q;  2LQK A;  3LYI A;  3OYK A;  1QKX A;  2JS0 A;  1FYN A;  3DB3 A;  4M7A C;  2LMJ A;  1UB4 A;  1AD5 A;  1JEG A;  3EFO B;  3MJX A;  5A0L A;  1N9R A;  1RAD B;  4C92 C;  1MMG A;  2DMO A;  4M77 D;  3OYN A;  1D1A A;  3EGU A;  2A0F B;  2HBP A;  3H41 A;  2OTJ A;  3EFO A;  3R6O A;  4HVV A;  2OX7 A;  2WAC A;  3LGL A;  3M58 A;  1VQ9 A;  4K11 A;  4LUE A;  3FEO A;  3CC7 A;  2K5L A;  4QVZ A;  1H3H A;  1ACM B;  1BK2 A;  5GAN 6;  2V1R A;  1M1F A;  1TH7 A;  2E6Z A;  3RMQ A;  4PJO F;  3CBP A;  2PTK A;  2DRM A;  4DBR A;  4E7J A;  4FT2 A;  2ECZ A;  2EVR A;  4NL2 A;  2O88 A;  1OX8 A;  4RCB A;  1QLY A;  4N4H A;  1SSF A;  2XK0 A;  3OYY A;  4C8Q E;  1SPK A;  1UJ0 A;  2OJ2 A;  5M9O A;  2DVJ A;  2CP2 A;  1RAC B;  1Q7Y C;  3L2Q A;  5ECA A;  3TEE A;  4M7A F;  1YCY A;  3OYM A;  1FX7 A;  3OBY A;  1RI9 A;  3OYJ A;  4C92 F;  2C0I A;  3CD6 A;  2VGN A;  3ME9 A;  3C94 A;  2F5K A;  4N4I A;  1MND A;  4OGC A;  2KK4 A;  3LLR A;  1EZZ B;  3L2U A; 
#chains in the Genus database with same CATH homology
 4ME7 A;  4LDV A;  3J81 E;  3JB9 D;  3QG1 A;  2IG0 A;  3HRS A;  3SB2 A;  2LNV A;  2DJZ A;  1BI1 A;  1NE8 A;  3J80 E;  2EFI A;  2K4Y A;  4ZTF A;  5I21 A;  3HRU A;  1QVG A;  2R57 A;  4NS5 A;  4N0A C;  3JCM h;  3L2R A;  5GAO q;  3MP8 A;  4A4G A;  3QJY A;  3I56 T;  3H8Z A;  2X4X A;  2GQV A;  3H6Z A;  5GAO m;  4MDW A;  4OVA A;  3MCA B;  2LCL A;  1NPR A;  2Y90 A;  3UT1 A;  2OTJ T;  2RHY A;  4IUU A;  2X4J A;  4OB2 B;  4ELZ C;  4EMK C;  2XIC A;  4F7U E;  5LJ5 e;  1K8A U;  1K9M C;  2E70 A;  2QXF A;  2B8A A;  2X4W A;  2PUO B;  3X24 B;  3RER A;  3M9Q A;  4C92 E;  3LWH A;  3A8G B;  3M59 A;  4QQD A;  1VQ4 A;  2MF2 A;  2ZZD A;  3O8V A;  4M78 C;  3CXC S;  4MMK A;  5J3B A;  2GF7 A;  2KDS A;  5HY6 A;  3JCM d;  4M75 B;  1UGR B;  1N27 A;  1S72 A;  5HKC A;  2M16 A;  4FIB A;  3FRN A;  4KUD K;  3HKS A;  4M7D B;  3M57 A;  3G71 T;  3CC4 T;  3VYG A;  3EAE A;  4A54 A;  5LL6 S;  2OTL A;  4F7U B;  4VUB A;  4LDY A;  1MGQ A;  2A7Y A;  2EQM A;  4FT4 A;  5HK0 A;  1YIT T;  4FU6 A;  1M1K U;  3GF5 A;  4X34 A;  5FU6 B;  3QHS A;  1LNX A;  5FU7 C;  4QVD A;  4R55 A;  2DVE A;  2DTI A;  4JLG A;  3CCU A;  2GFA A;  2XID A;  3JB9 G;  3WXM B;  1UEB A;  3BFM A;  1PSE A;  3TRE A;  4N4G A;  5LJ3 h;  4M75 A;  2VXE A;  3S3O A;  1NPP A;  2CZ1 B;  3A8O B;  5CQY A;  1M8V A;  5GAN e;  4F7U A;  3NTI A;  3JCM X;  1FXX A;  5CKB A;  5GMK i;  4OP0 A;  4GLK A;  4PLL A;  5CVI A;  2EJ9 A;  1M9S A;  3ER0 A;  4M78 G;  1DJ7 B;  2XHC A;  2RJD A;  4FM4 B;  4R56 A;  3CMA T;  4O5V A;  4HCZ A;  2DO3 A;  3I56 A;  4C0D C;  5KCO A;  3F70 A;  3UWN A;  5LJ3 d;  4JRQ A;  2E41 A;  2RJE A;  2V8J A;  1YBY A;  2JOY A;  4JUV A;  3PGG A;  4PLI A;  5CKD A;  5FRM A;  1XOV A;  1NZ9 A;  4NOY A;  2RO0 A;  2HD0 A;  3QII A;  2MWO A;  2EWN A;  2O4X B;  3OYL A;  2VC8 A;  3P8D A;  5LJ5 g;  2ZPI B;  4BE1 A;  1ZBX A;  2KMT A;  5GMK j;  1VQO T;  1LOJ A;  3GLX A;  4KT0 E;  1K73 U;  1Q86 U;  1Q82 U;  2E12 A;  2RK2 A;  4EDU A;  3J7A F;  3PTA A;  3MET A;  4BUG A;  5GAN 4;  2FB7 A;  1G5V A;  4P5N A;  1XQH A;  2D0Q B;  2RI3 A;  2D6F A;  3L1A A;  1XNI A;  5GAM e;  3G71 A;  4M78 F;  3KUF A;  2KAF A;  4J83 A;  2VYT A;  4QW2 A;  1YIJ T;  2A3L A;  2O4X A;  3WVD B;  2LDM A;  3HFN A;  4OB1 B;  1O9S A;  4RG8 A;  3CCL T;  2PVG B;  2PVO B;  3M4G A;  4XU3 A;  2QQA A;  2QA4 T;  1KD1 U;  2HQE A;  5C0M A;  3TU4 K;  3SD4 A;  4C0F A;  2XI9 A;  4J7F A;  3FB9 A;  4KUL A;  4BD3 A;  4B9W A;  2D9T A;  2DIG A;  4ZN3 A;  3FLG A;  4BI4 A;  2WSC E;  3VYH B;  3OS2 A;  1KQS S;  4EMH A;  2QQ9 A;  3OBW A;  2E6N A;  2EQJ A;  1UGP B;  5GMK h;  4LD9 K;  1Y7X A;  3I55 A;  4ZTJ A;  1K8A C;  4M77 G;  3X25 B;  4JRK A;  5GAN g;  1VQ4 T;  1VQK T;  2BKD N;  5GAO l;  4XU0 A;  4C5I A;  2RM4 A;  3CMA A;  1ZQ1 A;  4JLI A;  1S72 T;  2FL7 A;  5I2M A;  2ZPG B;  4V2S A;  2K5I A;  1UGS B;  1QVP A;  1G3S A;  3JCM b;  5DY9 A;  1HK9 A;  2K3Y A;  2NLU A;  2JTF A;  5A0G A;  2JNG A;  1VIE A;  1HXD A;  5EG2 A;  3VJP A;  3TCJ A;  1N8R U;  4BY6 B;  3CCE T;  1GXI E;  3CCU T;  2XG8 D;  1YHQ T;  1M1K C;  1WNL A;  4WF2 A;  4PJO E;  1KHC A;  1VQO A;  4DQ2 A;  2YHT A;  4IUP A;  3MHX A;  4L5G A;  3HPW A;  3OY9 A;  1NJI U;  3G6E A;  3OW2 S;  3OSV A;  3PT9 A;  4FSX A;  1KHI A;  4M77 F;  1VQ6 T;  2ZPB B;  4IUR A;  4UC4 A;  4EPC A;  3CXC A;  1W2B A;  2DKG A;  3EFR A;  3V8K A;  5GAO p;  2QEX T;  3CCV T;  5CQX A;  5IAY A;  5GAM g;  4C8Q B;  2GFU A;  1YIJ A;  1PSF A;  3JSC A;  1X6O A;  2PQW A;  2CYZ B;  3LX7 A;  2L89 A;  5GAN 8;  2RHI A;  2QI2 A;  1BIA A;  3CCS T;  1QVF S;  2WSE E;  4YTL A;  4XTX A;  3E19 A;  3QZ5 B;  5CAI A;  5LJ5 h;  4J6Y A;  3L2W A;  2QA4 A;  3L42 A;  1B34 B;  4M7A E;  1OZ2 A;  3QYH B;  3GOX A;  1M90 U;  2KQW A;  5GAN j;  4C8Q D;  4QQ6 A;  4J6X A;  3GPL A;  1U8R A;  3RKX A;  5D6Y A;  2VGM A;  1VIF A;  4OB0 B;  3PMI A;  4C8Q A;  4C5E A;  4L6V 5;  5GAO r;  2CZ6 B;  2E5Q A;  1W2B S;  3GNF B;  3M53 A;  1VQK A;  3SWN B;  2MMP A;  3MEV A;  3HFO A;  3HRT A;  2MI6 A;  4Z02 A;  4ZGJ B;  1B34 A;  2L5Q A;  2YLC A;  3BDL A;  5LJ5 d;  4PJO B;  1WGS A;  3P8B B;  1Q82 C;  3A8H B;  2CKK A;  1QP3 A;  3OYI A;  3FIF A;  4X9D A;  4Y28 E;  2K57 A;  3OS5 A;  3JCM e;  4M75 D;  2CS7 A;  1U1S A;  3LWI A;  1Q81 U;  3JCM Q;  2HAX A;  3CCE A;  4PJO D;  4M7D D;  1VUB A;  1IZ6 A;  2YLB A;  4HA8 A;  3SWN A;  1YHQ A;  1IRE B;  5GAN 5;  5LJ5 f;  1KD1 C;  3E9F A;  4PJO A;  4M7D A;  5IN1 A;  3C12 A;  2ZPF B;  5GAM j;  3CBO A;  4L59 A;  3SDZ A;  1VQN A;  1I81 A;  4M7A B;  3I55 T;  1VQ6 A;  3V7C A;  3OQ5 A;  2E10 A;  4BDZ A;  2DAQ A;  2RK1 A;  1OZ3 A;  4JRP A;  4MDX A;  1H3Z A;  2LTO A;  5GAN 7;  4ZN1 A;  2FVU A;  2QEX A;  3CCV A;  2QQB A;  3DKM A;  3QXE B;  4JRI A;  4C8Q G;  3MEA A;  4II1 A;  4BE0 A;  4LDX A;  3CCS A;  3A8L B;  5FU6 C;  4C92 B;  4HCB A;  5GAO n;  4M7A D;  2P0P A;  2P0K A;  1KC8 U;  4LD6 A;  3URG A;  5DM7 R;  2BUD A;  2QQR A;  3CPW S;  2XD0 A;  4J6W A;  2XDP A;  3C4S A;  4J5Y A;  5FLX E;  4M7A A;  3EFS A;  4C5H A;  3X20 B;  4C92 D;  3CCR T;  4XTU A;  3JB9 F;  4C5G A;  1G3W A;  3OYA A;  2VV5 A;  1U1T A;  5LJ3 e;  2ZGW A;  4M77 C;  2XDD A;  3VKI A;  1KQS A;  3MO8 A;  1WJS A;  2EYQ A;  3INZ A;  3JRZ A;  4BB7 A;  4C92 A;  1MHN A;  4XK8 E;  3G6E T;  1N8R C;  1VQL T;  2ZPE B;  4QVC A;  3HL8 A;  5GAN f;  1N9S A;  1H64 1;  3HHT B;  3OMG A;  4M75 G;  3FDR A;  3M4Y A;  3MP6 A;  1G3Y A;  3E1S A;  2QDY B;  1W4S A;  3MEU A;  4A4E A;  4M7D G;  1NJI C;  5CKE A;  2DXB A;  1RL2 A;  1K9M U;  2P4T A;  4F7U G;  4MZP A;  2FHD A;  3L2Z A;  4ELY C;  3SFM A;  3MP1 A;  1AHJ B;  4JDS A;  4MML A;  2GCX A;  2LQ8 A;  4E47 A;  1KG1 A;  1WJQ A;  1XTD A;  1YJW A;  1KQ1 A;  3JCM g;  4KUI A;  3OB9 A;  4BE2 A;  4DOW A;  2RHZ A;  2EJF A;  3N5B B;  4XU1 A;  3S6W A;  2CGH A;  1WPY A;  1JB0 E;  4LDU A;  2G3R A;  1ZHI A;  1VQ8 A;  3OYH A;  3S3N A;  1M90 C;  5L8R E;  4OB3 B;  2XDB A;  4ATO A;  4JS5 A;  3OW2 A;  4O6J A;  5KE3 A;  2JTM A;  3OSS C;  3L2V A;  4CI0 C;  1JJ2 A;  2LX9 A;  3ZEH A;  4M75 F;  1M4Z A;  4JS4 A;  2LCC A;  2CZ7 B;  3BY7 A;  4M7D F;  5GAM f;  3JCM c;  5HK3 A;  4C92 G;  4XAX B;  2RJF A;  4KBM B;  5J39 A;  4F7U F;  3JCM V;  2EAY A;  5DLO A;  3JCM J;  3RMS A;  2H3J A;  3QSU A;  1QP2 A;  1QVF A;  1VQM T;  1BI2 A;  1FWZ A;  1D3B B;  2K5F A;  5CIU A;  4M78 E;  2EIF A;  2DEQ A;  3LLR A;  2M0O A;  3CCR A;  3JB9 I;  1QW1 A;  2LRQ A;  2RJC A;  2RH2 A;  2K3X A;  5D6X A;  2X4Y A;  4E7K A;  1VQ7 T;  2X35 A;  4J7I A;  1YJ9 T;  5DLQ E;  3CC2 T;  2RHU A;  5LJ3 g;  1VQL A;  5I2S A;  4BI8 B;  2L3R A;  3OA6 A;  3CME A;  3CCM T;  1JJ2 S;  1VQN T;  4DA4 A;  1BI0 A;  2OAU A;  1R8O B;  3BDU A;  3CME T;  2JZ2 A;  3A5Z B;  3NTH A;  4LDW A;  5D6W A;  1D3B A;  4OMF B;  4XTZ A;  1VQ5 A;  2RA2 A;  2RI5 A;  1WJR A;  3M54 A;  1P92 A;  3QDR B;  1EIF A;  1UGQ B;  4JJN K;  2RB6 A;  3PNW C;  3JAM E;  4BY6 C;  4IUV A;  1BIB A;  2JVV A;  3CCJ T;  1BKB A;  2DXC A;  5CKF A;  3S3M A;  3QBY A;  4OGE A;  4FL6 A;  3OYD A;  5GMK l;  1I5L A;  4PNO A;  2M9U A;  4EMK B;  2QQS A;  4HT8 A;  4RCC A;  3QKJ A;  4GY5 A;  2I2L A;  1Y07 A;  2VXF A;  4MZM A;  4BI3 A;  3UPU A;  3OYB A;  1JRI A;  4N0A A;  4Q5W A;  3DB4 A;  3LGF A;  2PUK B;  4M78 B;  5CO7 A;  4BDY A;  2K2V A;  3V7R A;  1Y96 B;  4C8Q C;  4C0G A;  2YRV A;  3AHU A;  5A0D A;  2VUB A;  2LVM A;  2PU9 B;  1K73 C;  1Q86 C;  4A4F A;  3HP9 A;  3CBM A;  3QUI A;  3NFC A;  3X28 B;  1M1G A;  3OMC A;  4EMK A;  1V29 B;  1LJO A;  5GAN 2;  4M78 D;  4E7L A;  3QZ9 B;  2DPP B;  3PMT A;  4M77 E;  5IT9 E;  2MWP A;  1VQM A;  3LW5 E;  3CCQ T;  3G4S T;  1KQ2 A;  5LJ3 j;  5FU7 B;  2XKO C;  1Q7Y U;  4BAC A;  3CPW A;  3RES A;  3VV0 A;  1YJW T;  2ZCF B;  4M78 A;  1Y71 A;  3CCL A;  5GAN h;  1Y96 A;  4EMG A;  2EJG A;  2RD1 A;  1VQ7 A;  4OF1 A;  4J8O A;  3OYF A;  4RG2 A;  5CCA A;  5A2Q E;  1VQ9 T;  1YJ9 A;  2C06 A;  3CC2 A;  5FRN A;  3RKY A;  1VQ8 T;  2QTX A;  4TVR A;  3SWN C;  3CC7 T;  2DTH A;  5KH6 A;  4IUT A;  4M75 C;  4A4H A;  3CEY A;  3CCM A;  3VU3 C;  4E7H A;  4XQ3 A;  3JCM P;  3QO3 A;  5CR2 A;  4M7D C;  4PJO C;  1QVG S;  3JB9 H;  5GMK m;  2EQK A;  2DK3 A;  3MEW A;  1YJN T;  1N6A A;  1O75 A;  3OS1 A;  3QPH A;  4Y91 A;  2O01 E;  4PL6 A;  4C0Z A;  4C0D B;  1M5Q 1;  5GAN d;  3CCJ A;  4XTY A;  2KSS A;  3M5A A;  3PIO A;  2DD5 A;  3JCM f;  4A53 A;  2LQK A;  2RI2 A;  3M55 A;  3LYI A;  4DOV A;  3OYK A;  1YIT A;  2LC4 A;  4ZGD B;  3DB3 A;  3JCM W;  2LT1 A;  1UB4 A;  4IKF A;  3V7S A;  4M77 B;  5CK9 A;  1OYX A;  4M7A C;  4PKC C;  5GAM h;  2EKO A;  3T9N A;  1YI2 T;  1X01 A;  5A0L A;  2R5M A;  3PFS A;  1N9R A;  3VUZ A;  1BYM A;  4C92 C;  4PJO G;  4B9X A;  4X9C A;  1I4K 1;  2DZC A;  4M77 D;  3OYN A;  1VQ5 T;  2E1H A;  2DXU A;  4XTV A;  2HQX A;  3A8M B;  4C8Q F;  4E7I A;  2LT4 A;  3E9G A;  3OS0 A;  3FC3 A;  3CCQ A;  3C95 A;  2HBP A;  3RKW A;  5C6S A;  3V8J A;  4M77 A;  3G4S A;  3WVE B;  3CD6 T;  2OTJ A;  3R6O A;  1VQP T;  4IUQ A;  1JBM A;  2WAC A;  5GAM d;  3LGL A;  3M58 A;  3OYG A;  3L2U A;  2R5A A;  2M1H A;  3QYG B;  3GIB A;  4NL3 A;  1VQ9 A;  3QJ6 A;  2ZPH B;  3RIR A;  3M56 A;  3FEO A;  2XU8 A;  5KCH A;  3BW1 A;  3CC7 A;  3PIP A;  2K5L A;  4QVZ A;  5LJ3 f;  2DZ9 A;  4M7A G;  5CKH A;  5FRO A;  2EQU A;  5GAN 6;  2BIV A;  2PVD B;  2E65 A;  3DLM A;  3UDC A;  4D6W A;  2L8D A;  1M1F A;  1TH7 A;  3DLL A;  3CC4 A;  1YJN A;  4RMO A;  3V8L A;  3JB9 J;  2E6Z A;  2FYK A;  2KY9 A;  4QQG A;  3RMQ A;  2F69 A;  4PJO F;  3CBP A;  4E7J A;  2DTO A;  4FT2 A;  4NL2 A;  2MAM A;  2V8I A;  4RCB A;  3RUX A;  1BI3 A;  1G3T A;  1OI1 A;  4N4H A;  3CPF A;  1SSF A;  2V8K A;  2XK0 A;  3HSB A;  3OYY A;  2DXT A;  2DIQ A;  4HCC A;  4A4K A;  4C8Q E;  5M9O A;  3G7Z A;  3OYC A;  2Y4Y A;  2R58 A;  5GAN 3;  1Q7Y C;  1Q81 C;  5AYF A;  3X26 B;  3L2Q A;  3ZFJ A;  4HT9 A;  1X75 C;  2IVW A;  2RHX A;  1YI2 A;  3TEE A;  5GMK e;  1WQW A;  1YCY A;  4M7A F;  2KVQ G;  3OYM A;  2Y4X A;  3KBG A;  2HNI A;  1FX7 A;  2JN0 A;  1WQ7 A;  3OBY A;  5J26 A;  4CRI A;  2WSF E;  3ZBD A;  5LJ5 j;  1I8F A;  2OTL T;  3Q1J A;  4XTW A;  3OYE A;  3OYJ A;  4C92 F;  2F5T X;  3GP8 A;  3CD6 A;  2JUF A;  4XU2 A;  5KE2 A;  3KXT A;  2VGN A;  3ME9 A;  3VUB A;  3FJP A;  3C94 A;  3NTK A;  4M75 E;  4MZT A;  2F5K A;  2P0Q A;  1VQP A;  4N4I A;  4OGC A;  4HKE A;  4RKU E;  4M7D E;  3ASK A;  2KK4 A;  2E64 A;  3P8H A;  4ZGE B;  1KC8 C;  2AHJ B;  3GNG A;  2DD4 A;  3LH0 A;  1RI0 A;  2CZ0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...