3OQ5A

Crystal structure of the 3-mbt domain from human l3mbtl1 in complex with p53k382me1
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
313
structure length
309
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The MBT Repeats of L3MBTL1 Link SET8-mediated p53 Methylation at Lysine 382 to Target Gene Repression.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
total genus 68
structure length 309
sequence length 313
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oq5A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oq5A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oq5A03
4B9WA 3CEYA 4X34A 2EQKA 2F5KA 3S6WA 4ZTJA 1OZ3A 2M1HA 4E7LA 1OYXA 3L2WA 2X35A 3E9GA 2RJCA 2L89A 3OMCA 5D6XA 3MEWA 4BDYA 3S3MA 4QVZA 2EQUA 2O4XA 2XK0A 3OYGA 3L2QA 5FROA 1H3ZA 2K3YA 2RHZA 3FC3A 1RI0A 3P8DA 2CKKA 4A4GA 4EDUA 2EQMA 2MWOA 1WJQA 2R57A 2BIVA 3OYBA 3LH0A 4UC4A 3FDRA 4BD3A 3OYEA 3OYHA 2RHYA 5KE3A 4BE2A 2LDMA 3L42A 3LGFA 2GF7A 4E7HA 4IKFA 3QJ6A 5D6WA 2RI2A 4LD6A 4CRIA 3OYLA 4BE0A 5IAYA 4PLIA 4PL6A 4ZTFA 2RI3A 3LLRA 3LX7A 2R5AA 5C0MA 4A4FA 4Q5WA 4FU6A 3MP8A 2GFAA 2PQWA 4QQGA 3OY9A 3OYNA 2R5MA 3ZEHA 2QQRA 5FRNA 4BACA 2EQJA 2G3RA 2QQSA 3OYDA 3QKJA 2M16A 3OYCA 3PNWC 3OYJA 2R58A 3PFSA 3C4SA 4E7IA 4IUTA 2HQXA 2JTFA 3FEOA 3OA6A 5KCHA 1MHNA 3L2UA 4IUVA 2LTOA 3O8VA 1KHCA 2YRVA 2LRQA 2RHIA 3M9QA 2LVMA 4C5EA 4E7JA 2XDPA 3NTHA 3DLMA 5J39A 4N4GA 3S3OA 3BDLA 4NS5A 3PMIA 3L2VA 2RO0A 3H8ZA 3MEVA 5M9OA 2P0KA 3OYIA 4IUPA 3DB3A 2E5QA 4QQ6A 2DIGA 3MEUA 2BKDN 2RJDA 3LYIA 4IUQA 2JZ2A 2X4XA 2B8AA 4RG2A 2DAQA 2NLUA 3Q1JA 2BUDA 4IURA 4QW2A 2MWPA 5KH6A 2IG0A 3ME9A 2K3XA 3OS1A 2LCCA 5FRMA 1WJRA 3LGLA 3PMTA 2DIQA 2X4YA 4II1A 3META 3EAEA 4C5IA 2X4WA 3F70A 3OYMA 4L59A 1G5VA 4A4EA 1WGSA 4N4HA 4IUUA 2L3RA 2O4XB 2RJFA 1SSFA 2E6NA 4PLLA 2EFIA 1N27A 3SD4A 3H6ZA 5KE2A 3OYAA 1WJSA 3FLGA 2RI5A 4QQDA 5CIUA 3MO8A 3MP1A 3S3NA 4OVAA 4BDZA 3QBYA 4FL6A 4N4IA 3OQ5A 3ASKA 4HCZA 3DB4A 5IN1A 3MEAA 3UWNA 4C5HA 4C5GA 2M0OA 2RJEA 4A4HA 3UT1A 1OZ2A 3E9FA 3KUFA 2RHXA 2D9TA 2FHDA 3L2RA 2L8DA 3NTIA 4Z02A 5C6SA 4BE1A 1OI1A 1XNIA 2GFUA 4B9XA 2VYTA 3NTKA 3QIIA 5KCOA 3OS2A 4E7KA 3P8HA 5J26A 3OMGA 2EKOA 2RHUA 4GY5A 3OS0A 3OYFA 3OB9A 5D6YA 2HQEA 3MP6A 3GOXA 2WACA 3OYKA
chains in the Genus database with same CATH superfamily
2O01E 3S6WA 2CS7A 1XJWB 3E9GA 2LX7A 4DBHA 2QASA 5IT9E 1WHGA 4RG8A 2R57A 4M78G 3LH0A 2M0YA 2MMPA 1FXXA 3X26B 4XK8E 1AZEA 4XAXB 5CK9A 4LD9K 4AFSC 1OQKA 1LPLA 1MMDA 2YT6A 1HSQA 2CUDA 3EH2A 4FYVB 3UDCA 3TEEA 1K73C 2FG0A 1SKUB 4A4FA 1MMAA 4DQ2A 1I5OB 3PIOA 4DA4A 1VQMT 2EJFA 4M77C 3RESA 2JT4A 1QWEA 1YWPA 2JTFA 3FEOA 3OA6A 2ENMA 2FPFA 2CP5A 1TOVA 4Y28E 2LC4A 3M9QA 1LNXA 5J39A 3JB9G 4J9DA 3VUZA 5LJ3f 2RQTA 3MEVA 3CBPA 1TUGB 3GF5A 4O5VA 2BZYA 3M53A 2HQHA 4J9IA 5KH6A 5AT1B 1O75A 4CC4B 2RPNA 2IG0A 3OS1A 4BI4A 4HCKA 2FRYA 1WXBA 4FSXA 3G71A 4BY6B 2EKHA 2NUZA 3VKIA 2QYZA 1YJWT 1V1CA 4LN2A 1UHFA 2LQ8A 3GNFB 3MP1A 3TCJA 2YWWA 3CBOA 1QVFA 2D6FA 1EIFA 2JMCA 1Y07A 2VXFA 4E7ZA 4D6WA 2QI2A 4A54A 1RLPC 1E6GA 2M9UA 3RMSA 2KNBB 4C5GA 1V29B 2ROLA 4BE1A 2K2MA 4B9XA 2YRDA 2BE7D 4C0FA 1LOJA 1LVKA 2LJ0A 3KXTA 2GQIA 4JS4A 3JCMJ 1ZLMA 5DLQE 2F5KA 4EMKC 1WA7A 3NGPA 3TSZA 1TU0B 2DRKA 2J7IA 2DJZA 3VYGA 3AHUA 1RI0A 3LW5E 4N0AC 1IO6A 1G3WA 2QEXT 2HAXA 4IKFA 3PTAA 2KT1A 1Q82R 2EYYA 1IHWA 1K9MU 1C1AA 1VQ9Q 5KYUA 2GTOA 1WI7A 4XTUA 4M7AC 2HBWA 3OYDA 3LH5A 3CC4A 3QWYA 3WVEB 3I55A 4IUVA 2LTOA 3EFOB 4L6V5 4F7UE 1OOTA 2RQUA 1MV3A 5GAOp 3DLMA 3M58A 2E41A 2EPDA 2QTXA 1VQLA 2COWA 1YIJQ 2FZKB 4AG1C 4ZN1A 1AD5A 2PVDB 1X43A 1YHQT 1PRLC 2BUDA 4BY6C 2K3XA 2DLPA 3SHWA 2MPXC 5HY6A 4F14A 5GANf 2V8KA 3PMTA 2W10A 2K57A 3HFOA 1MGQA 4LDYA 1UDLA 3D7SB 4WCIA 3SB2A 4M77F 2EWNA 5CCAA 1VQOT 2MYSA 4OVAA 1QKXA 1VOMA 1ZA2B 5A0GA 2F1LA 1UFFA 1E6HA 3UT1A 3OBWA 3RR6A 3CCJQ 2DXTA 3GP8A 3G4SQ 5GAN8 4JJCA 5C6SA 4E7KA 1S72Q 3CC4Q 1X6OA 1SEMA 1UJ0A 2HSEB 1QCFA 4XU0A 3EH1A 2QAZA 2DBMA 3EHQA 3MEWA 2D8HA 4EMHA 4F7UF 3A98A 2O4XA 2E6ZA 1ZX6A 1YIJA 4OB2B 3R6OA 2JN0A 1VQNT 4R0KA 1RAIB 2CSQA 3FDRA 4HKEA 1N9SA 3EGXA 4XTXA 2LDMA 4PJMA 5GAN6 2Y4XA 2LQWA 3RKWA 2P0QA 2QA4T 4BE0A 4M7DB 4ZTFA 1IREB 4Y91A 2QQBA 6AT1B 2QGGA 1VQ5Q 4BACA 2G3RA 4M7DC 2QQSA 3QZ5B 1SSHA 3V7SA 2R58A 3PFSA 5GAN5 4M77B 3G6ET 1OU9A 2F5TX 3HHTB 1PG5B 1KQSP 3CCJA 2M51A 3G4SA 2ECZA 3H8ZA 2I2LA 4M77A 2L2PA 1QVGS 3LYIA 2HD0A 2OJ2A 1M1KR 2DAQA 1YP5A 3MPUB 5FRMA 1WQWA 3HTRA 5CR2A 3NMZC 3QDFA 1UGRB 2RJFA 4FW1A 4PLLA 2KT8A 2DXCA 1I0CA 2E70A 1PNJA 1KG1A 1YBYA 1M3AA 1VQNQ 2CT3A 1N8RU 1GBRA 1TG0A 5LJ3j 4DBFA 3C94A 3E1SA 4V2SA 2Z0WA 1X6GA 3KUFA 2MK5A 3TREA 4PJOG 3FIFA 1ZQ1A 1NLPC 2VYTA 3INZA 2XDBA 3JCMV 2J6FA 2DF6A 2DNUA 2JTEA 5DM7R 3OS0A 1QP2A 2V8JA 3ZFJA 1D1CA 5GAMe 4RTWA 2K2VA 1K9MR 1VUBA 2WSFE 1RACB 3JCMd 3S3MA 2XK0A 2L3PA 9ATCB 3QXEB 4OF1A 3CCRT 1U06A 1JRIA 1HD3A 3M0PA 4BE2A 1RAHB 5LJ5g 4HT8A 1AZGB 3CCMT 1W4SA 5LJ3e 4C8QE 3REBB 4PLIA 3GBQA 3LLRA 4JZ4A 4C0ZA 5GMKl 4FU6A 4DOVA 3M5AA 1OX9A 4PJOE 4IUTA 3T9NA 1VQNA 2OTJA 2JMAA 4XTZA 2LRQA 1IHVA 4PJOB 1G3YA 2NYSA 1VQ7A 4FYXB 3L2VA 4FIBA 2QA4Q 5LJ3h 1WLPB 4AFUC 5M9OA 1UGPB 2EVRA 2E5QA 1G8XA 2CP6A 1QVPA 2JZ2A 4PJJA 3JB9J 4C92C 2X4YA 2XIDA 4DEYA 4RTUA 4YTLA 3TU4K 2E6NA 1Y0MA 1BBZA 2RH2A 1C6VX 3BW1A 4PJLA 4QQDA 3CC7T 4EPCA 2EYZA 3QBYA 1D3BB 1VIFA 1KFZA 2D0NA 4EMGA 3CCMA 4JRIA 2RHXA 1U8RA 4QT7A 4L5GA 2L8DA 1NPPA 1Z9ZA 3QIIA 4PFOA 3VS4A 3CD6Q 2CP7A 3EG3A 2EYXA 2OTLA 4X34A 2QQ9A 2XD0A 1IZ6A 3J80E 2CZ6B 2KY9A 4JLGA 2KDSA 2K3YA 1OU8A 3JCMW 1AT1B 2MI6A 1KQ2A 2MWOA 4JJDA 1D3BA 4D8DA 4RCBA 4J9GA 3JCMf 4JS5A 1NG2A 5GMKj 2DM1A 2W0ZA 2CZ7B 5C0MA 1Q7YU 2E12A 1AHJB 1YHQA 4M7DG 1N6AA 2EQJA 1M3BA 1PM3A 4PJOD 2K79A 1Q81C 5CKEA 1VQ6A 1OULA 2KXDA 4PFZA 1MHNA 2RQRA 3CQTA 5GANd 3C12A 1TUCA 2ZPEB 3CCMQ 3VS5A 1I5LA 2DD4A 2RO0A 2J6OA 2EGEA 4E47A 4M75D 2SRCA 1ZBXA 3A5ZB 5I11A 1YI2Q 5A2QE 4RTVA 1AWJA 3JCMg 2YLCA 4ELZC 4QW2A 1K73R 3ULRB 3FJ5A 1YJ9A 5GANh 5GMKi 2MCNA 4IUUA 5KE2A 2AKKA 1WJSA 3FLGA 1SG5A 1W2BA 4BDZA 1VQ4A 1BYMA 3DB4A 1BI0A 2LT1A 2KGTA 5DY9A 1YCSB 5IH2A 5IXBA 1G2BA 1GCQC 1K8AR 3BFMA 3E2UA 1I4K1 1VQ6Q 1JXOA 1W6XA 3MKDA 4B9WA 2HKQB 1YJNQ 1YITA 5CVIA 1B34B 1OYXA 3NHNA 5FLXE 1BIAA 2F2VA 2DA9A 1YJWA 4J6WA 1KSWA 1UGSB 5GAOm 2FVUA 4KGZB 3FC3A 4A4GA 3CCQA 5FW9A 4BD3A 1YJ9T 5GAN4 1WHJA 3URGA 1HK9A 1K9MC 1VIEA 1QKWA 1NM7A 1QWFA 1EFNA 3ZL7C 3PGGA 4JJNK 5IXFA 2DK3A 3RIRA 3L1AA 4QQGA 2EBPA 1WIEA 2VASA 1M3CA 1WYXA 2DXBA 3QKJA 4OMOA 2KVQG 3CPWA 4M75B 3L2UA 4M7AB 1VQ4Q 1KHCA 4RTTA 1KK7A 2NUPA 3VV0A 5KYNA 1QP3A 5GAOr 3OYYA 1VQLT 1GCQA 4QVDA 2O88A 3G6EA 1WFWA 3MEUA 1G3SA 3PT9A 1WXTA 3KFVA 2A0FB 5KYWA 1YITQ 1IB8A 4OMFB 1MNEA 2CUBA 4ORZA 2XI9A 4HCCA 1NEBA 4A4EA 2QGFB 3OSSC 4N4HA 3CCVA 5ECAA 3SD4A 4OB0B 3CCQQ 3OW2A 1SRLA 1GL5A 1VQKT 5GJWB 3RUXA 3EGXB 3SWNA 4FM4B 1I07A 3CC2A 3ASKA 2LQNA 2YSQA 3CCEQ 2DJQA 1OZ2A 4F7UA 2NWMA 4C8QC 1B34A 3CXCA 4HT9A 3CCLT 1X75C 1XNIA 4PNOA 4C92E 4FT4A 2XICA 1KC8C 2C0TA 4DEXA 3CC7A 2DERA 2HNIA 2B86A 3L2WA 3CCSA 2RJCA 3GPLA 3L2QA 2KXCA 1JXMA 1EZZB 4XTVA 4EDUA 1H3HA 3JV3A 5GAN2 1S72T 4D8KA 1UB4A 4LD6A 5IHKA 1R0BG 1QLYA 2HSPA 2DD5A 4K11A 1VQ6T 1HJDA 4OB3B 3JCMc 4Q5WA 3CPWP 1X01A 3CCVQ 2LCSA 4C0GA 2H8HA 3OYCA 2C06A 1WHKA 5KCHA 1QVGA 3OBYA 2VV5A 2JW4A 3QUIA 2XKOC 1GXIE 1Q86U 4E7JA 1BI1A 2HMAA 3EG2A 1IGUA 1X6BA 3BDLA 2DTIA 4PJNA 2LJ1A 1KD1R 4M78C 1LCKA 2P0KA 1G83A 3JRZA 1GBQA 5CAIA 3OYIA 4NOYA 1NBEB 1YN8A 3HSBA 2PUOB 4C92F 4IUQA 3TQ7P 1TUDA 3CMAQ 2B8AA 2NLUA 2YDLA 4ZN3A 1ZUUA 3CC7Q 2CGHA 1NJIC 2HL5C 2DETA 2VC8A 3META 4ZGEB 3OW2P 4PFPA 4RCCA 3HRTA 1SHFA 2O9VA 4J9EA 4DBQA 2HZYA 2OTLT 4KUIA 5HCKA 1M4ZA 2H3JA 3VYHB 2K5IA 4KBMB 2BTTA 4P5NA 3KBGA 3MEAA 5A0DA 1M30A 4FT2A 4M7DA 1D1BA 1OI1A 2KR3A 5J26A 3UF4A 4CC7A 5AYFA 1ZSZC 1OEBA 1M8MA 2E3HA 3I35A 1TSFA 3QSUA 5GMKm 1JBMA 1M9SA 1YNZA 1OZ3A 2X35A 2L89A 1JJ2P 1IXDA 1OX8A 1NJIU 5LL6S 4E2FB 3VJPA 3WXMB 3CCET 3OW2S 2EQIA 3GNGA 1ZA1B 3M59A 3OS5A 4M7DE 1TWBA 2SEMA 1YITT 5GAMd 2QDYB 1KQSA 2V1QA 2AHJB 5FU7B 2YLBA 1PSEA 3OYLA 2CYZB 3SFMA 1YFNA 3CMET 3CCUA 1NYGA 2VWFA 2R5AA 4JUVA 2PVGB 1U3OA 2C0OA 4C8QD 2FYKA 4LDXA 1VQKA 1ARKA 2OI3A 3VS0A 5DLOA 2K6DA 4M7DD 4C92A 3HFNA 4QKUA 4LE9A 2FO0A 5GANj 1H8KA 2BZXA 3QHSA 2YUPA 2YRVA 3VS6A 2RHIA 5LJ5d 3H0HA 2L3QA 4HVWA 4C0DC 1JQQA 1OPKA 4FYYB 4M7AD 1B7TA 1ABQA 2O2OA 2COZA 4LXCA 4RTYA 2X3WD 2DYIA 4RG2A 4JZ3A 4M77G 5HKCA 1RAGB 1WJRA 4II1A 1YIJT 3EG9A 1GRIA 1MV0B 4KRTA 4M7DF 2YRCA 2DEQA 2E65A 2CP2A 5CIUA 4RMOA 3X28B 3EG1A 2AKLA 1ZUKA 3CC4T 4J9CA 2RM4A 4ANJA 1JO8A 3JSCA 2XG8D 5GJVB 1U1SA 4RUGA 4ATOA 2X51A 4FCYA 2IPOB 4Z02A 3QYHB 4M78F 5KYYB 1CKBA 2RN8A 2RHUA 1EX4A 1FMVA 3WVDB 2RD1A 1Q86C 4CI0C 3OYKA 2LP5A 1KJWA 3CEYA 3I56T 3UA6A 2WSEE 1VQMQ 5I2MA 4OMNA 3VUBA 3I9QA 2JJ9A 2CKKA 1WJQA 4BI8B 2XHCA 4PKCC 5GAOl 1QVFS 2RHYA 5IHIA 5CO7A 5KE3A 1IRXA 4DBRA 2Y90A 2DFUA 4LDUA 3EG0A 4A63B 2YXYA 4AMCA 4MMKA 2RK1A 1YWOA 1WDXA 2HDAA 3NPFA 2GFAA 2VVKA 3OY9A 3ZEHA 1K4US 2KSSA 2CP0A 2LQKA 2KE9A 4OMPA 4LUEA 1FMKA 3X20B 1Y7XA 3H0FA 1VQ7T 1PKSA 4C0DB 4J6XA 4F7UG 2VGNA 1VA7A 1GFCA 2BE9B 1UG1A 4PK4A 1N8RR 4QQ6A 4M75F 1I1JA 2QTVA 1BB9A 2DL7A 4X9CA 2J06A 2ZPIB 3LGLA 1VQ9A 2X4WA 2XMFA 2JUFA 2L3RA 1Y71A 1Y96A 3A1PA 1K76A 4M78A 5LJ5f 2CREA 4Z88A 1VQPT 1MUZA 2X3XD 3GLXA 2D0QB 4Y92A 3I55Q 3QZ9B 1QCOA 2L3SA 3OQ5A 1MNDA 5IN1A 4HA8A 4J7IA 2ROTA 1VQLQ 2QEXQ 2V1RA 2D1XA 5GAN3 1KC8U 3M0QA 3OMGA 3CBMA 3OYFA 4R56A 2HQEA 3GOXA 1AEYA 1UEBA 3CPFA 2LX9A 3RKXA 1Q95G 3MCAB 2KQWA 2LNVA 3JB9F 5FWBA 1H3ZA 2VB6A 3RERA 1PSFA 4PJOF 4XU2A 2PVOB 3OYEA 1W70A 2QK0A 1BK2A 4C92G 2FEIA 1SRMA 2GCXA 2LCLA 2ZPBB 2DL4A 4XU3A 5FU6B 1VQOQ 3E19A 1Q86R 3JCMh 4FYWB 1T3LA 5IAYA 2YUQA 1K8AC 2KYMA 3MP8A 4OGEA 3G71Q 1UTIA 2QQRA 1S72A 3ZBDA 4JRKA 2DEUA 1ZSZA 4E7IA 1UE9A 3NFCA 2E10A 4CC3A 4MZPA 3FJPA 1C0MA 2JS0A 5I2SA 4JLIA 5LJ5e 2DVEA 1RUWA 4KH0B 1QMCA 2QEXA 1K0XA 4OMMA 3RDVA 2BKDN 1WX6A 1M2VA 4M4ZA 1M1FA 3OSVA 4ELYC 2GBQA 2LCCA 3EFSA 1KD1U 3FB9A 1RADB 3PIPA 1TXQA 2DZCA 2CSIA 1ZSGA 1G5VA 3M0UA 2JM9A 2RQVA 5LJ5h 4C92B 1X69A 3S3NA 4KULA 5CKFA 4M7AE 4EIKA 3VS7A 4WTOB 1VQOA 2ZGWA 1M5Q1 1NE8A 3PVQA 3CCLA 2VKNA 2AZVA 2AZSA 2FHDA 2ZCFB 2LZ6B 4PJOA 3CMAT 3C0CA 5HK3A 4MZTA 3CCRA 2JNGA 2WSCE 4TVRA 5KYXB 3QJYA 4KH1B 1KQSS 4ZTJA 2G6FX 3TVTA 4BUGA 5D6XA 3EFOA 2DKGA 3OYGA 2FZGB 5FROA 1M2OA 1Q7YC 5CKDA 2NUTB 5GAMj 3HRUA 4IIMA 4RTZA 4EMKA 3QJ6A 3M55A 2KYBA 5D6WA 2RI2A 5LJ3g 4CRIA 4KGXB 4J9HA 5KYXA 4JRPA 2VUBA 1VQ8T 2FRWA 2M02A 1LJOA 1MMGA 1HXDA 2R5MA 1E7OA 1NYFA 2E64A 2KMTA 4MZMA 2V8IA 3UATA 1BI2A 5GMKe 2GNCA 1WPYA 4N0AA 4C5EA 3HL8A 4OMQA 3CCLQ 2COYA 4JRQA 3PMIA 2ZPHB 4F7UB 4RTXA 3JB9H 4PJOC 4M77D 1D0YA 1M90C 3EFRA 2C0IA 1MMNA 1SF9A 2ED1A 1YCYA 4M75G 3CCRQ 3V8JA 4B6MA 2MWPA 1BCOA 3ME9A 4C92D 5GAMf 4OB1B 5FU6C 1H641 3F70A 3OYMA 4L59A 4A4KA 5LJ3d 2EFIA 3H6ZA 2OX7A 5KYWB 1J3TA 3JCMP 4OMLA 2NUTA 1BKBA 3SEMA 2PZ1A 3MHXA 1M90R 2DRMA 3I56Q 3BY7A 1ZSZB 1NLOC 1WNLA 2D9TA 1WQ7A 3NTIA 4MDXA 3A8MB 1M1KU 1VQ5A 3P8HA 1M8VA 2MIOA 4M78B 1Y96B 4J6YA 3OB9A 1BU1A 1O9SA 1FYNA 4E7LA 1UHCA 4O6JA 4ZNXA 3M0TA 3M0RA 2GGRA 3P8BB 3VU3C 3P8DA 3HPWA 3OYHA 1VYVA 5HK0A 3L42A 3RMQA 2GF7A 4E7HA 5L8RE 2ED0A 4DOWA 2JVVA 4F16A 4C8QF 3A8LB 4X1VA 2EYQA 1F1BB 4AG2C 3CXCP 2DVJA 1Q81U 1QVFP 2DBKA 2AT1B 2MF2A 3CD6A 3C4SA 3UPUA 1NPRA 2OAWA 1UGVA 1QQJA 2DYBA 2CP3A 3SWNB 1RABB 1CKAA 2EIFA 3I56A 2XDPA 2VGMA 3NTHA 4F17A 3GIBA 4M77E 3O5ZA 2DZ9A 2V26A 1PC0A 3V7CA 1AOJA 2E5KA 3DB3A 5EG2A 2RJDA 3CCQT 2RMOA 3M57A 1N9RA 2PU9B 2L0AA 3ER0A 4M75E 1B07A 2DX1A 1WGSA 1YHQQ 5CKBA 1RLQC 2XDDA 4JPBW 2RI5A 4KUDK 3R6NA 1K9AA 1FX7A 1I81A 2Y4YA 1KQ1A 2X9HA 1X2QA 1YJNT 4C8QG 2RJEA 3QYGB 1M90U 2JTMA 3CMEA 5L23A 2RB6A 3JB9D 3NTKA 2A7YA 3OS2A 3QG1A 1YI2A 2PUKB 3DKMA 4RKUE 4QVCA 5GANe 4HVVA 1R8OB 5A0LA 3JB9I 1YJ9Q 4A4HA 3X24B 2OTJQ 3PVLA 1Y57A 2L5QA 4C8QA 4BDYA 4BI3A 2EQUA 4LDWA 1VQ7Q 4F04B 1M1GA 4ZGJB 4M7AG 1BI3A 2FPEA 2QA4A 1RI9A 4HXJA 2J05A 4UC4A 4HCBA 2JS2A 2RNAA 3CCST 4ESRA 1ABOA 1NEGA 1PWTA 1VYUA 2QDLA 1T0JA 2CH4A 1M27C 2P4TA 2YHTA 1WHHA 2PQWA 3RKYA 5GMKh 3OYNA 4FW2A 5FRNA 2RQWA 2GTJA 1Q7YR 2EAYA 4J83A 2OTJT 2HQXA 4M75A 2K5LA 1T0HA 1TH7A 1YJNA 2QQAA 2QXFA 3O8VA 2KI7A 4C8QB 1UECA 3RBBB 2E1HA 2E3IA 3S3OA 4E6RA 4BB7A 4NS5A 5J3BA 1YJWQ 1KIKA 3CMEQ 3SWNC 1AWWA 4J8OA 3U23A 2K3BA 2MAMA 1TS9A 2OTLQ 3FRNA 3IQLA 2X4XA 2P4RA 1R0CB 3HRSA 2CZ0B 5FU7C 4C5IA 2FPDA 1SPKA 2DE0X 1PKTA 5GANg 4GLMA 3M0SA 1ZBJA 3SDZA 1M1KC 1D0ZA 4E7SA 3BDUA 3VS2A 1FWZA 3JAME 4HCZA 4J5YA 3M4GA 2FB7A 3E9FA 1N8RC 2EJ9A 1XQHA 5GAMg 4X9DA 2F2WA 2XU8A 2D8JA 1ACMB 1HYOA 8AT1B 5EC7A 1VQ5T 3OMCA 2DMOA 2HKNA 2K4YA 3VS1A 3CCUT 4M78D 4NL3A 1IGQA 1M2VB 2PTKA 3OYBA 2EQMA 2J6KA 1K8AU 1ZUYA 3LGFA 2DXUA 3A8OB 4MMLA 4XQ3A 5CQYA 1D0XA 2O9SA 2DO3A 4FSSA 2MOXA 1KD1C 2KK4A 2P84A 1U5SA 3N5BB 1WZOA 2F69A 3G4ST 2LJ3A 1X2KA 3PNWC 2CZ1B 1RL2A 4ZGDB 3CCSQ 1TTHB 5I21A 3QWXX 4M7AF 3H41A 2JM8A 3I5RA 3MJXA 3V8KA 1X27A 2DIGA 1Q81R 3LWHA 3G71T 2PNIA 1V76A 5CQXA 3PE0A 4IURA 1W2BS 5GAOn 2QG9B 2ZAEA 5GAMh 2BZ8A 2RF0A 4R55A 1K1ZA 1JU5C 4OGCA 2DIQA 2HEQA 1AWOA 1N27A 1QVGP 1GCPA 3CCVT 2P0PA 1XTDA 2CDTA 3HP9A 3JCMQ 2I0NA 3G1JA 3UWNA 2AIRB 4Z8AA 4J9FA 4KT0E 1P92A 1D1AA 2IVWA 2GFUA 5KCOA 3J7AF 1H92A 2JXBA 4M75C 2KROA 1XOVA 1GFDA 3VRZA 3REAB 5D6YA 1VYTA 3VRYA 5KYUB 2FL7A 4QVZA 5LJ5j 3H0IA 1S1NA 3LWIA 3M54A 2RHZA 3EGUA 1BIBA 4OP0A 1I8FA 3G6EQ 1WXUA 3A8GB 3V7RA 5I22A 3A8HB 2NUPB 2A08A 2GQVA 2ATCB 1RAFB 1SHGA 1KC8R 3LX7A 4M7AA 5GAN7 2K5FA 3BE3A 2YUNA 4JDSA 3M56A 3I55T 3QO3A 2M16A 3OYJA 2DTOA 2KRMA 4A53A 4AFQC 3HKSA 4Z89A 3CD6T 4LNPA 1UGQB 3CC2Q 1VQ9T 2LT4A 1R77A 2CT4A 2DTHA 3CCEA 2DL8A 3TSWA 4J7FA 2DL3A 3THKA 4JJBA 3DLLA 3CCJT 4IUPA 1W1FA 2ZZDA 5CKHA 1PCXA 2A3LA 2HCKA 1RAAB 1VQ4T 3Q1JA 2JOYA 1JB0E 1JJ2S 1PD0A 4ME7A 4WF2A 3CCUQ 1K73U 5KYYA 3JCMX 1ZHIA 2EGAA 4NL2A 1YI2T 2ESWA 3OYAA 2F2XA 3CPWS 3EHRA 2DPPB 3MO8A 1JJ2A 1PD1A 2EYWA 3H9NA 8ATCB 4C5HA 2ABLA 3JCMb 2A36A 2HBPA 3EGDB 3JCMe 5D7UA 2ZPGB 1VQ8A 2VXEA 3L2ZA 1VQPQ 4IIOA 5GAOq 2KEAA 4EMKB 4AFZC 1QW1A 1A0NB 4GY5A 2EGCA 2YUOA 1G3TA 2WACA 1T3SA 2EQKA 2X4JA 3EG9B 2M1HA 1N5ZA 2DILA 1Q82C 1WHMA 3C95A 2KRNA 1UJYA 4MDWA 2BIVA 2RA2A 2OAUA 1DJ7B 3M4YA 3CMAA 1FMWA 4LDVA 2LMJA 4PL6A 2RI3A 2K7AA 5FWCA 2EW3A 2LNHB 1AVZC 4GLKA 3J81E 1KHIA 4CC2A 3RNJA 4M78E 1RAEB 2DL5A 4VUBA 1Q82U 2E4HA 1U1TA 3X25B 3UA7A 2KBTA 4KGVB 3G7ZA 1CSKA 1PRMC 2O31A 1VQMA 2LVMA 1K0SA 2KAFA 4N4GA 3QDRB 2A37A 1VQ8Q 2RK2A 2AK5A 1VQPA 5IHNA 1BCMA 1W2BP 1PHTA 4J9BA 1D09B 2FZCB 1Z9QA 1B3QA 3EAEA 4LUDA 4XU1A 3CC2T 1UUEA 2O4XB 4AT1B 1SSFA 3CXCS 1JEGA 1OV3A 4HVUA 1AWXA 2IIMA 7AT1B 1WHLA 2ZPFB 2EJGA 1NZ9A 1QCNA 2CH4W 4FL6A 4XTWA 4N4IA 2H3EB 2HL3A 1NJIR 2M0OA 4GBQA 3QPHA 2K9GA 4XTYA 3L2RA 3EGDA 3I5SA 2A28A 2KRSA 1OPLA 3AT1B 3V8LA 1VQKQ 2EKOA 3VS3A 3MP6A
chains in the Genus database with same CATH topology
3X24B 3CEYA 3I56T 4X34A 2O01E 3S6WA 2QQ9A 2XD0A 2CS7A 3E9GA 1IZ6A 2WSEE 2L5QA 4C8QA 5I2MA 4BDYA 4BI3A 2EQUA 3J80E 4LDWA 2CZ6B 2KY9A 3VUBA 1M1GA 4JLGA 4ZGJB 4M7AG 1BI3A 2KDSA 2QA4A 2K3YA 5IT9E 3JCMW 2CKKA 2MI6A 4RG8A 2R57A 2MWOA 1WJQA 4M78G 2XHCA 4PKCC 3LH0A 4UC4A 4BI8B 5GAOl 4HCBA 1QVFS 2RHYA 1D3BA 5CO7A 5KE3A 3CCST 2MMPA 1FXXA 4RCBA 2Y90A 4XK8E 3X26B 4LDUA 4XAXB 5CK9A 4LD9K 3JCMf 4MMKA 4JS5A 5GMKj 3UDCA 2RK1A 3TEEA 1K73C 2P4TA 2CZ7B 5C0MA 1Q7YU 4A4FA 2E12A 2YHTA 1AHJB 2GFAA 2PQWA 3RKYA 5GMKh 4DQ2A 3OY9A 3PIOA 3ZEHA 3OYNA 4DA4A 1VQMT 1N6AA 2KSSA 2EQJA 2EJFA 4M77C 5FRNA 2EAYA 4PJOD 3RESA 1Q81C 4J83A 2LQKA 5CKEA 2OTJT 2HQXA 2JTFA 2K5LA 3FEOA 4M75A 3OA6A 1VQ6A 1MHNA 1TH7A 1YJNA 2QQAA 3X20B 5GANd 1Y7XA 2QXFA 3C12A 3O8VA 4Y28E 4C8QB 1VQ7T 4C0DB 4J6XA 2LC4A 4F7UG 3M9QA 2E1HA 1LNXA 5J39A 3S3OA 3JB9G 2VGNA 2ZPEB 4BB7A 4NS5A 5J3BA 3VUZA 5LJ3f 1I5LA 2DD4A 2RO0A 3MEVA 3CBPA 3SWNC 4E47A 4M75D 1ZBXA 3A5ZB 3GF5A 4J8OA 4O5VA 5A2QE 3M53A 4QQ6A 4M75F 2MAMA 2YLCA 3JCMg 3FRNA 4ELZC 2X4XA 4QW2A 5KH6A 1O75A 1YJ9A 2IG0A 4X9CA 3OS1A 3HRSA 2CZ0B 4BI4A 2ZPIB 5GANh 3LGLA 1VQ9A 5GMKi 5FU7C 4C5IA 2X4WA 4FSXA 2JUFA 5GANg 4IUUA 2L3RA 4BY6B 1Y71A 3G71A 1Y96A 4M78A 5LJ5f 3VKIA 5KE2A 3SDZA 1YJWT 1VQPT 1M1KC 1WJSA 3FLGA 2LQ8A 3GNFB 3MP1A 3TCJA 1W2BA 3CBOA 3GLXA 2D0QB 3BDUA 4BDZA 1QVFA 1EIFA 1VQ4A 2D6FA 3QZ9B 1BYMA 1FWZA 1Y07A 2VXFA 3OQ5A 3JAME 3JB9I 4D6WA 2QI2A 4A54A 4HCZA 3DB4A 4HA8A 1BI0A 4J7IA 2M9UA 5IN1A 3RMSA 4J5YA 4C5GA 3M4GA 1V29B 2FB7A 2LT1A 3E9FA 5DY9A 1N8RC 4BE1A 2EJ9A 1XQHA 4B9XA 5GAMg 4X9DA 5GAN3 1KC8U 3OMGA 4C0FA 1LOJA 2XU8A 3BFMA 3CBMA 3OYFA 3KXTA 4R56A 2HQEA 1I4K1 3GOXA 4JS4A 3JCMJ 4B9WA 1UEBA 3CPFA 5DLQE 1YITA 2F5KA 4EMKC 5CVIA 1B34B 1OYXA 2LX9A 5FLXE 1VQ5T 3OMCA 3RKXA 3MCAB 2KQWA 1BIAA 2K4YA 2LNVA 3CCUT 4M78D 3JB9F 4NL3A 1YJWA 4J6WA 1UGSB 5GAOm 2DJZA 1H3ZA 3RERA 1PSFA 2FVUA 3VYGA 3FC3A 3AHUA 4PJOF 1RI0A 4XU2A 2PVOB 4A4GA 3OYBA 2EQMA 3CCQA 4BD3A 3OYEA 3LW5E 4N0AC 1YJ9T 5GAN4 1G3WA 1K8AU 4C92G 3URGA 2QEXT 3LGFA 1HK9A 2DXUA 2GCXA 1K9MC 1VIEA 2LCLA 3A8OB 4MMLA 2HAXA 2ZPBB 3PTAA 4XU3A 4IKFA 5FU6B 4XQ3A 3E19A 5CQYA 3JCMh 5IAYA 1K9MU 2DO3A 3PGGA 4JJNK 1K8AC 2DK3A 1KD1C 2KK4A 3RIRA 3L1AA 4OGEA 3MP8A 4QQGA 3N5BB 2QQRA 2F69A 1S72A 4XTUA 3ZBDA 4M7AC 3G4ST 3OYDA 3CC4A 4JRKA 2DXBA 3QKJA 4E7IA 3PNWC 3WVEB 2CZ1B 2KVQG 3CPWA 4M75B 3NFCA 3L2UA 3I55A 1RL2A 4IUVA 2LTOA 2E10A 1KHCA 4M7AB 4L6V5 4F7UE 4ZGDB 4MZPA 5I21A 5GAOp 3DLMA 4M7AF 3M58A 2E41A 2QTXA 3FJPA 1VQLA 3VV0A 1QP3A 4JLIA 5I2SA 4ZN1A 5LJ5e 2DVEA 2PVDB 3OYYA 5GAOr 1VQLT 1YHQT 2QEXA 4QVDA 3V8KA 3G6EA 2DIGA 3MEUA 1G3SA 3LWHA 3G71T 2BKDN 3PT9A 5CQXA 1W2BS 4IURA 1M1FA 2BUDA 5GAOn 3OSVA 4BY6C 4ELYC 5GAMh 2K3XA 2LCCA 3EFSA 1KD1U 3FB9A 4OMFB 4R55A 5HY6A 5GANf 2V8KA 3PMTA 2DIQA 2XI9A 4OGCA 3PIPA 4HCCA 2DZCA 1YHQA 2K57A 3HFOA 1G5VA 4A4EA 3OSSC 1MGQA 4N4HA 3CCVA 4M7DG 4LDYA 1N27A 3SD4A 5LJ5h 4OB0B 3SB2A 4M77F 4C92B 2EWNA 3OW2A 5CCAA 3CCVT 1VQOT 1VQKT 3S3NA 2P0PA 4KULA 5CKFA 4M7AE 3RUXA 4OVAA 1XTDA 3SWNA 4FM4B 3HP9A 3JCMQ 3CC2A 5A0GA 1VQOA 3ASKA 2ZGWA 3UWNA 1M5Q1 1NE8A 3CCLA 4KT0E 3UT1A 1OZ2A 3OBWA 4F7UA 1P92A 2DXTA 4C8QC 2FHDA 3GP8A 1B34A 5GAN8 3CXCA 2IVWA 5C6SA 4HT9A 3CCLT 1X75C 1XNIA 2GFUA 4PNOA 2ZCFB 5KCOA 4C92E 4E7KA 3J7AF 4PJOA 4M75C 3CMAT 4FT4A 5HK3A 4MZTA 1XOVA 1X6OA 3CCRA 2JNGA 2WSCE 2XICA 1KC8C 5D6YA 4TVRA 3CC7A 3QJYA 2HNIA 4XU0A 1KQSS 4ZTJA 4BUGA 3L2WA 3CCSA 5D6XA 2RJCA 3MEWA 2FL7A 3GPLA 4QVZA 4EMHA 4F7UF 2O4XA 2DKGA 5LJ5j 3OYGA 2E6ZA 3L2QA 5FROA 3LWIA 3M54A 1YIJA 2RHZA 4OB2B 3R6OA 2JN0A 4XTVA 1BIBA 1VQNT 4OP0A 4EDUA 1I8FA 4HKEA 3FDRA 1Q7YC 5CKDA 1N9SA 3A8GB 3V7RA 4XTXA 2LDMA 5GAMj 5GAN2 5GAN6 3A8HB 3HRUA 1S72T 4EMKA 2Y4XA 3QJ6A 3M55A 5D6WA 1UB4A 3RKWA 2RI2A 4LD6A 4CRIA 5LJ3g 2P0QA 4CI0C 2QA4T 2DD5A 2GQVA 2VUBA 4JRPA 4BE0A 4ZTFA 1VQ8T 1VQ6T 1IREB 4M7DB 4Y91A 2QQBA 1LJOA 3LX7A 4M7AA 1HXDA 5GAN7 4OB3B 3JCMc 4Q5WA 2K5FA 1X01A 2R5MA 4BACA 2G3RA 4M7DC 2QQSA 3QZ5B 4JDSA 2E64A 3M56A 3I55T 4C0GA 3QO3A 2M16A 2KMTA 3V7SA 3OYCA 2DTOA 2R58A 3PFSA 4MZMA 2V8IA 4A53A 2C06A 5KCHA 1QVGA 3HKSA 5GAN5 3OBYA 3CD6T 2VV5A 4M77B 3G6ET 1BI2A 1UGQB 3QUIA 2XKOC 5GMKe 1VQ9T 4PJOE 1GXIE 1WPYA 4N0AA 1Q86U 2LT4A 4E7JA 1BI1A 2F5TX 4C5EA 3HHTB 3HL8A 2DTHA 3CCEA 4JRQA 3BDLA 3PMIA 2DTIA 4J7FA 3CCJA 3DLLA 4M78C 3G4SA 3H8ZA 2ZPHB 2P0KA 4F7UB 3OYIA 3JRZA 3CCJT 5CAIA 2I2LA 4IUPA 3JB9H 2ZZDA 5CKHA 4M77D 4NOYA 4PJOC 4M77A 1M90C 3HSBA 2PUOB 3EFRA 2A3LA 1QVGS 4C92F 3LYIA 2HD0A 4IUQA 4M75G 1YCYA 1VQ4T 2B8AA 2DAQA 2NLUA 2JOYA 3Q1JA 1JB0E 3V8JA 2MWPA 4ZN3A 1JJ2S 2CGHA 3ME9A 4ME7A 4C92D 5GAMf 1NJIC 4WF2A 5FRMA 1WQWA 1K73U 5CR2A 4OB1B 2VC8A 3META 5FU6C 4ZGEB 1H641 3JCMX 3F70A 3OYMA 1ZHIA 4L59A 4A4KA 4NL2A 5LJ3d 1UGRB 3HRTA 4RCCA 2RJFA 4PLLA 1YI2T 2EFIA 3H6ZA 2DXCA 3OYJA 2E70A 3OYAA 3CPWS 2OTLT 4KUIA 1KG1A 1YBYA 3MO8A 2DPPB 1JJ2A 1N8RU 3JCMP 1M4ZA 2H3JA 3VYHB 5LJ3j 1BKBA 2K5IA 4KBMB 1KQ2A 3C94A 3E1SA 4P5NA 3MHXA 4C5HA 3KBGA 3MEAA 5A0DA 3JCMb 4V2SA 3BY7A 4FT2A 2HBPA 3KUFA 2D9TA 1WNLA 3TREA 1WQ7A 2ZPGB 4PJOG 3JCMe 1VQ8A 3FIFA 3NTIA 4M7DA 4MDXA 1ZQ1A 2VXEA 3A8MB 3L2ZA 1OI1A 1M1KU 2VYTA 3OYLA 1VQ5A 5GAOq 3INZA 3P8HA 5J26A 2XDBA 3JCMV 4EMKB 1QW1A 5AYFA 1M8VA 1Y96B 4J6YA 4M78B 4GY5A 5DM7R 3OS0A 1QP2A 3OB9A 2V8JA 3QSUA 3ZFJA 1G3TA 2WACA 1O9SA 5GAMe 5GMKm 2K2VA 1JBMA 2EQKA 1M9SA 2X4JA 1VUBA 1OZ3A 2M1HA 2WSFE 4E7LA 2X35A 3JCMd 2L89A 4O6JA 3S3MA 1Q82C 1NJIU 2XK0A 3C95A 5LL6S 3VJPA 3QXEB 3P8BB 3WXMB 4OF1A 4MDWA 3VU3C 3OW2S 3CCET 3CCRT 3P8DA 1JRIA 3GNGA 2BIVA 3HPWA 3OYHA 3M59A 2RA2A 3OS5A 4M7DE 5HK0A 4BE2A 2OAUA 3L42A 3RMQA 5LJ5g 2GF7A 4HT8A 4E7HA 1YITT 1DJ7B 5L8RE 3M4YA 5GAMd 3CMAA 2QDYB 1KQSA 5FU7B 2AHJB 3CCMT 2YLBA 1W4SA 1PSEA 4DOWA 5LJ3e 4LDVA 2JVVA 2CYZB 3SFMA 4C8QE 4C8QF 4PLIA 4PL6A 4C0ZA 2RI3A 3LLRA 5GMKl 3CMET 3CCUA 3A8LB 2R5AA 4JUVA 2PVGB 4FU6A 4C8QD 4LDXA 2FYKA 3J81E 4GLKA 2EYQA 1KHIA 4DOVA 1VQKA 1Q81U 4M78E 3M5AA 2MF2A 3CD6A 5DLOA 4VUBA 4PJOB 3C4SA 4M7DD 3UPUA 1NPRA 4IUTA 3T9NA 4C92A 1Q82U 1U1TA 3HFNA 3X25B 1VQNA 2OTJA 5GANj 3QHSA 3G7ZA 2YRVA 4XTZA 3SWNB 1VQMA 2LRQA 2RHIA 2EIFA 2LVMA 1G3YA 2KAFA 2VGMA 2XDPA 3NTHA 5LJ5d 4N4GA 3I56A 1VQ7A 3QDRB 3GIBA 3L2VA 4FIBA 5LJ3h 4M77E 5M9OA 2DZ9A 2RK2A 3V7CA 1UGPB 1VQPA 4C0DC 4M7AD 3DB3A 2E5QA 5EG2A 2RJDA 1QVPA 2JZ2A 3CCQT 4RG2A 4M77G 3M57A 1N9RA 5HKCA 2PU9B 3ER0A 3JB9J 1WJRA 4II1A 1YIJT 4C92C 2X4YA 2XIDA 4M75E 3EAEA 4XU1A 1WGSA 3CC2T 5CKBA 4M7DF 2O4XB 4YTLA 1SSFA 2E6NA 3TU4K 2DEQA 2E65A 2XDDA 3CXCS 2RH2A 3BW1A 2RI5A 4QQDA 2ZPFB 5CIUA 4RMOA 3X28B 3CC7T 4KUDK 2EJGA 4EPCA 1NZ9A 1FX7A 1I81A 3CC4T 3QBYA 1D3BB 4FL6A 4XTWA 2Y4YA 1VIFA 2RM4A 1KQ1A 3JSCA 4N4IA 2XG8D 1U1SA 1YJNT 2M0OA 2RJEA 4C8QG 4EMGA 4ATOA 3CCMA 3QPHA 4JRIA 4XTYA 2RHXA 3QYGB 1U8RA 2JTMA 3L2RA 4L5GA 3CMEA 2L8DA 1M90U 1NPPA 4Z02A 2RB6A 3QYHB 4M78F 3JB9D 3V8LA 3NTKA 2A7YA 3QIIA 3QG1A 3OS2A 1YI2A 2PUKB 3DKMA 2EKOA 4RKUE 2RHUA 4QVCA 5GANe 2OTLA 3WVDB 1R8OB 5A0LA 2RD1A 3MP6A 1Q86C 4A4HA 3OYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B9W A;  3CEY A;  4X34 A;  2EQK A;  2F5K A;  3S6W A;  4ZTJ A;  1OZ3 A;  2M1H A;  4E7L A;  1OYX A;  3L2W A;  2X35 A;  3E9G A;  2RJC A;  2L89 A;  3OMC A;  5D6X A;  3MEW A;  4BDY A;  3S3M A;  4QVZ A;  2EQU A;  2O4X A;  2XK0 A;  3OYG A;  3L2Q A;  5FRO A;  1H3Z A;  2K3Y A;  2RHZ A;  3FC3 A;  1RI0 A;  3P8D A;  2CKK A;  4A4G A;  4EDU A;  2EQM A;  2MWO A;  1WJQ A;  2R57 A;  2BIV A;  3OYB A;  3LH0 A;  4UC4 A;  3FDR A;  4BD3 A;  3OYE A;  3OYH A;  2RHY A;  5KE3 A;  4BE2 A;  2LDM A;  3L42 A;  3LGF A;  2GF7 A;  4E7H A;  4IKF A;  3QJ6 A;  5D6W A;  2RI2 A;  4LD6 A;  4CRI A;  3OYL A;  4BE0 A;  5IAY A;  4PLI A;  4PL6 A;  4ZTF A;  2RI3 A;  3LLR A;  3LX7 A;  2R5A A;  5C0M A;  4A4F A;  4Q5W A;  4FU6 A;  3MP8 A;  2GFA A;  2PQW A;  4QQG A;  3OY9 A;  3OYN A;  2R5M A;  3ZEH A;  2QQR A;  5FRN A;  4BAC A;  2EQJ A;  2G3R A;  2QQS A;  3OYD A;  3QKJ A;  2M16 A;  3OYC A;  3PNW C;  3OYJ A;  2R58 A;  3PFS A;  3C4S A;  4E7I A;  4IUT A;  2HQX A;  2JTF A;  3FEO A;  3OA6 A;  5KCH A;  1MHN A;  3L2U A;  4IUV A;  2LTO A;  3O8V A;  1KHC A;  2YRV A;  2LRQ A;  2RHI A;  3M9Q A;  2LVM A;  4C5E A;  4E7J A;  2XDP A;  3NTH A;  3DLM A;  5J39 A;  4N4G A;  3S3O A;  3BDL A;  4NS5 A;  3PMI A;  3L2V A;  2RO0 A;  3H8Z A;  3MEV A;  5M9O A;  2P0K A;  3OYI A;  4IUP A;  3DB3 A;  2E5Q A;  4QQ6 A;  2DIG A;  3MEU A;  2BKD N;  2RJD A;  3LYI A;  4IUQ A;  2JZ2 A;  2X4X A;  2B8A A;  4RG2 A;  2DAQ A;  2NLU A;  3Q1J A;  2BUD A;  4IUR A;  4QW2 A;  2MWP A;  5KH6 A;  2IG0 A;  3ME9 A;  2K3X A;  3OS1 A;  2LCC A;  5FRM A;  1WJR A;  3LGL A;  3PMT A;  2DIQ A;  2X4Y A;  4II1 A;  3MET A;  3EAE A;  4C5I A;  2X4W A;  3F70 A;  3OYM A;  4L59 A;  1G5V A;  4A4E A;  1WGS A;  4N4H A;  4IUU A;  2L3R A;  2O4X B;  2RJF A;  1SSF A;  2E6N A;  4PLL A;  2EFI A;  1N27 A;  3SD4 A;  3H6Z A;  5KE2 A;  3OYA A;  1WJS A;  3FLG A;  2RI5 A;  4QQD A;  5CIU A;  3MO8 A;  3MP1 A;  3S3N A;  4OVA A;  4BDZ A;  3QBY A;  4FL6 A;  4N4I A;  3OQ5 A;  3ASK A;  4HCZ A;  3DB4 A;  5IN1 A;  3MEA A;  3UWN A;  4C5H A;  4C5G A;  2M0O A;  2RJE A;  4A4H A;  3UT1 A;  1OZ2 A;  3E9F A;  3KUF A;  2RHX A;  2D9T A;  2FHD A;  3L2R A;  2L8D A;  3NTI A;  4Z02 A;  5C6S A;  4BE1 A;  1OI1 A;  1XNI A;  2GFU A;  4B9X A;  2VYT A;  3NTK A;  3QII A;  5KCO A;  3OS2 A;  4E7K A;  3P8H A;  5J26 A;  3OMG A;  2EKO A;  2RHU A;  4GY5 A;  3OS0 A;  3OYF A;  3OB9 A;  5D6Y A;  2HQE A;  3MP6 A;  3GOX A;  2WAC A;  3OYK A; 
#chains in the Genus database with same CATH topology
 2O01 E;  3S6W A;  2CS7 A;  1XJW B;  3E9G A;  2LX7 A;  4DBH A;  2QAS A;  5IT9 E;  1WHG A;  4RG8 A;  2R57 A;  4M78 G;  3LH0 A;  2M0Y A;  2MMP A;  1FXX A;  3X26 B;  4XK8 E;  1AZE A;  4XAX B;  5CK9 A;  4LD9 K;  4AFS C;  1OQK A;  1LPL A;  1MMD A;  2YT6 A;  1HSQ A;  2CUD A;  3EH2 A;  4FYV B;  3UDC A;  3TEE A;  1K73 C;  2FG0 A;  1SKU B;  4A4F A;  1MMA A;  4DQ2 A;  1I5O B;  3PIO A;  4DA4 A;  1VQM T;  2EJF A;  4M77 C;  3RES A;  2JT4 A;  1QWE A;  1YWP A;  2JTF A;  3FEO A;  3OA6 A;  2ENM A;  2FPF A;  2CP5 A;  1TOV A;  4Y28 E;  2LC4 A;  3M9Q A;  1LNX A;  5J39 A;  3JB9 G;  4J9D A;  3VUZ A;  5LJ3 f;  2RQT A;  3MEV A;  3CBP A;  1TUG B;  3GF5 A;  4O5V A;  2BZY A;  3M53 A;  2HQH A;  4J9I A;  5KH6 A;  5AT1 B;  1O75 A;  4CC4 B;  2RPN A;  2IG0 A;  3OS1 A;  4BI4 A;  4HCK A;  2FRY A;  1WXB A;  4FSX A;  3G71 A;  4BY6 B;  2EKH A;  2NUZ A;  3VKI A;  2QYZ A;  1YJW T;  1V1C A;  4LN2 A;  1UHF A;  2LQ8 A;  3GNF B;  3MP1 A;  3TCJ A;  2YWW A;  3CBO A;  1QVF A;  2D6F A;  1EIF A;  2JMC A;  1Y07 A;  2VXF A;  4E7Z A;  4D6W A;  2QI2 A;  4A54 A;  1RLP C;  1E6G A;  2M9U A;  3RMS A;  2KNB B;  4C5G A;  1V29 B;  2ROL A;  4BE1 A;  2K2M A;  4B9X A;  2YRD A;  2BE7 D;  4C0F A;  1LOJ A;  1LVK A;  2LJ0 A;  3KXT A;  2GQI A;  4JS4 A;  3JCM J;  1ZLM A;  5DLQ E;  2F5K A;  4EMK C;  1WA7 A;  3NGP A;  3TSZ A;  1TU0 B;  2DRK A;  2J7I A;  2DJZ A;  3VYG A;  3AHU A;  1RI0 A;  3LW5 E;  4N0A C;  1IO6 A;  1G3W A;  2QEX T;  2HAX A;  4IKF A;  3PTA A;  2KT1 A;  1Q82 R;  2EYY A;  1IHW A;  1K9M U;  1C1A A;  1VQ9 Q;  5KYU A;  2GTO A;  1WI7 A;  4XTU A;  4M7A C;  2HBW A;  3OYD A;  3LH5 A;  3CC4 A;  3QWY A;  3WVE B;  3I55 A;  4IUV A;  2LTO A;  3EFO B;  4L6V 5;  4F7U E;  1OOT A;  2RQU A;  1MV3 A;  5GAO p;  3DLM A;  3M58 A;  2E41 A;  2EPD A;  2QTX A;  1VQL A;  2COW A;  1YIJ Q;  2FZK B;  4AG1 C;  4ZN1 A;  1AD5 A;  2PVD B;  1X43 A;  1YHQ T;  1PRL C;  2BUD A;  4BY6 C;  2K3X A;  2DLP A;  3SHW A;  2MPX C;  5HY6 A;  4F14 A;  5GAN f;  2V8K A;  3PMT A;  2W10 A;  2K57 A;  3HFO A;  1MGQ A;  4LDY A;  1UDL A;  3D7S B;  4WCI A;  3SB2 A;  4M77 F;  2EWN A;  5CCA A;  1VQO T;  2MYS A;  4OVA A;  1QKX A;  1VOM A;  1ZA2 B;  5A0G A;  2F1L A;  1UFF A;  1E6H A;  3UT1 A;  3OBW A;  3RR6 A;  3CCJ Q;  2DXT A;  3GP8 A;  3G4S Q;  5GAN 8;  4JJC A;  5C6S A;  4E7K A;  1S72 Q;  3CC4 Q;  1X6O A;  1SEM A;  1UJ0 A;  2HSE B;  1QCF A;  4XU0 A;  3EH1 A;  2QAZ A;  2DBM A;  3EHQ A;  3MEW A;  2D8H A;  4EMH A;  4F7U F;  3A98 A;  2O4X A;  2E6Z A;  1ZX6 A;  1YIJ A;  4OB2 B;  3R6O A;  2JN0 A;  1VQN T;  4R0K A;  1RAI B;  2CSQ A;  3FDR A;  4HKE A;  1N9S A;  3EGX A;  4XTX A;  2LDM A;  4PJM A;  5GAN 6;  2Y4X A;  2LQW A;  3RKW A;  2P0Q A;  2QA4 T;  4BE0 A;  4M7D B;  4ZTF A;  1IRE B;  4Y91 A;  2QQB A;  6AT1 B;  2QGG A;  1VQ5 Q;  4BAC A;  2G3R A;  4M7D C;  2QQS A;  3QZ5 B;  1SSH A;  3V7S A;  2R58 A;  3PFS A;  5GAN 5;  4M77 B;  3G6E T;  1OU9 A;  2F5T X;  3HHT B;  1PG5 B;  1KQS P;  3CCJ A;  2M51 A;  3G4S A;  2ECZ A;  3H8Z A;  2I2L A;  4M77 A;  2L2P A;  1QVG S;  3LYI A;  2HD0 A;  2OJ2 A;  1M1K R;  2DAQ A;  1YP5 A;  3MPU B;  5FRM A;  1WQW A;  3HTR A;  5CR2 A;  3NMZ C;  3QDF A;  1UGR B;  2RJF A;  4FW1 A;  4PLL A;  2KT8 A;  2DXC A;  1I0C A;  2E70 A;  1PNJ A;  1KG1 A;  1YBY A;  1M3A A;  1VQN Q;  2CT3 A;  1N8R U;  1GBR A;  1TG0 A;  5LJ3 j;  4DBF A;  3C94 A;  3E1S A;  4V2S A;  2Z0W A;  1X6G A;  3KUF A;  2MK5 A;  3TRE A;  4PJO G;  3FIF A;  1ZQ1 A;  1NLP C;  2VYT A;  3INZ A;  2XDB A;  3JCM V;  2J6F A;  2DF6 A;  2DNU A;  2JTE A;  5DM7 R;  3OS0 A;  1QP2 A;  2V8J A;  3ZFJ A;  1D1C A;  5GAM e;  4RTW A;  2K2V A;  1K9M R;  1VUB A;  2WSF E;  1RAC B;  3JCM d;  3S3M A;  2XK0 A;  2L3P A;  9ATC B;  3QXE B;  4OF1 A;  3CCR T;  1U06 A;  1JRI A;  1HD3 A;  3M0P A;  4BE2 A;  1RAH B;  5LJ5 g;  4HT8 A;  1AZG B;  3CCM T;  1W4S A;  5LJ3 e;  4C8Q E;  3REB B;  4PLI A;  3GBQ A;  3LLR A;  4JZ4 A;  4C0Z A;  5GMK l;  4FU6 A;  4DOV A;  3M5A A;  1OX9 A;  4PJO E;  4IUT A;  3T9N A;  1VQN A;  2OTJ A;  2JMA A;  4XTZ A;  2LRQ A;  1IHV A;  4PJO B;  1G3Y A;  2NYS A;  1VQ7 A;  4FYX B;  3L2V A;  4FIB A;  2QA4 Q;  5LJ3 h;  1WLP B;  4AFU C;  5M9O A;  1UGP B;  2EVR A;  2E5Q A;  1G8X A;  2CP6 A;  1QVP A;  2JZ2 A;  4PJJ A;  3JB9 J;  4C92 C;  2X4Y A;  2XID A;  4DEY A;  4RTU A;  4YTL A;  3TU4 K;  2E6N A;  1Y0M A;  1BBZ A;  2RH2 A;  1C6V X;  3BW1 A;  4PJL A;  4QQD A;  3CC7 T;  4EPC A;  2EYZ A;  3QBY A;  1D3B B;  1VIF A;  1KFZ A;  2D0N A;  4EMG A;  3CCM A;  4JRI A;  2RHX A;  1U8R A;  4QT7 A;  4L5G A;  2L8D A;  1NPP A;  1Z9Z A;  3QII A;  4PFO A;  3VS4 A;  3CD6 Q;  2CP7 A;  3EG3 A;  2EYX A;  2OTL A;  4X34 A;  2QQ9 A;  2XD0 A;  1IZ6 A;  3J80 E;  2CZ6 B;  2KY9 A;  4JLG A;  2KDS A;  2K3Y A;  1OU8 A;  3JCM W;  1AT1 B;  2MI6 A;  1KQ2 A;  2MWO A;  4JJD A;  1D3B A;  4D8D A;  4RCB A;  4J9G A;  3JCM f;  4JS5 A;  1NG2 A;  5GMK j;  2DM1 A;  2W0Z A;  2CZ7 B;  5C0M A;  1Q7Y U;  2E12 A;  1AHJ B;  1YHQ A;  4M7D G;  1N6A A;  2EQJ A;  1M3B A;  1PM3 A;  4PJO D;  2K79 A;  1Q81 C;  5CKE A;  1VQ6 A;  1OUL A;  2KXD A;  4PFZ A;  1MHN A;  2RQR A;  3CQT A;  5GAN d;  3C12 A;  1TUC A;  2ZPE B;  3CCM Q;  3VS5 A;  1I5L A;  2DD4 A;  2RO0 A;  2J6O A;  2EGE A;  4E47 A;  4M75 D;  2SRC A;  1ZBX A;  3A5Z B;  5I11 A;  1YI2 Q;  5A2Q E;  4RTV A;  1AWJ A;  3JCM g;  2YLC A;  4ELZ C;  4QW2 A;  1K73 R;  3ULR B;  3FJ5 A;  1YJ9 A;  5GAN h;  5GMK i;  2MCN A;  4IUU A;  5KE2 A;  2AKK A;  1WJS A;  3FLG A;  1SG5 A;  1W2B A;  4BDZ A;  1VQ4 A;  1BYM A;  3DB4 A;  1BI0 A;  2LT1 A;  2KGT A;  5DY9 A;  1YCS B;  5IH2 A;  5IXB A;  1G2B A;  1GCQ C;  1K8A R;  3BFM A;  3E2U A;  1I4K 1;  1VQ6 Q;  1JXO A;  1W6X A;  3MKD A;  4B9W A;  2HKQ B;  1YJN Q;  1YIT A;  5CVI A;  1B34 B;  1OYX A;  3NHN A;  5FLX E;  1BIA A;  2F2V A;  2DA9 A;  1YJW A;  4J6W A;  1KSW A;  1UGS B;  5GAO m;  2FVU A;  4KGZ B;  3FC3 A;  4A4G A;  3CCQ A;  5FW9 A;  4BD3 A;  1YJ9 T;  5GAN 4;  1WHJ A;  3URG A;  1HK9 A;  1K9M C;  1VIE A;  1QKW A;  1NM7 A;  1QWF A;  1EFN A;  3ZL7 C;  3PGG A;  4JJN K;  5IXF A;  2DK3 A;  3RIR A;  3L1A A;  4QQG A;  2EBP A;  1WIE A;  2VAS A;  1M3C A;  1WYX A;  2DXB A;  3QKJ A;  4OMO A;  2KVQ G;  3CPW A;  4M75 B;  3L2U A;  4M7A B;  1VQ4 Q;  1KHC A;  4RTT A;  1KK7 A;  2NUP A;  3VV0 A;  5KYN A;  1QP3 A;  5GAO r;  3OYY A;  1VQL T;  1GCQ A;  4QVD A;  2O88 A;  3G6E A;  1WFW A;  3MEU A;  1G3S A;  3PT9 A;  1WXT A;  3KFV A;  2A0F B;  5KYW A;  1YIT Q;  1IB8 A;  4OMF B;  1MNE A;  2CUB A;  4ORZ A;  2XI9 A;  4HCC A;  1NEB A;  4A4E A;  2QGF B;  3OSS C;  4N4H A;  3CCV A;  5ECA A;  3SD4 A;  4OB0 B;  3CCQ Q;  3OW2 A;  1SRL A;  1GL5 A;  1VQK T;  5GJW B;  3RUX A;  3EGX B;  3SWN A;  4FM4 B;  1I07 A;  3CC2 A;  3ASK A;  2LQN A;  2YSQ A;  3CCE Q;  2DJQ A;  1OZ2 A;  4F7U A;  2NWM A;  4C8Q C;  1B34 A;  3CXC A;  4HT9 A;  3CCL T;  1X75 C;  1XNI A;  4PNO A;  4C92 E;  4FT4 A;  2XIC A;  1KC8 C;  2C0T A;  4DEX A;  3CC7 A;  2DER A;  2HNI A;  2B86 A;  3L2W A;  3CCS A;  2RJC A;  3GPL A;  3L2Q A;  2KXC A;  1JXM A;  1EZZ B;  4XTV A;  4EDU A;  1H3H A;  3JV3 A;  5GAN 2;  1S72 T;  4D8K A;  1UB4 A;  4LD6 A;  5IHK A;  1R0B G;  1QLY A;  2HSP A;  2DD5 A;  4K11 A;  1VQ6 T;  1HJD A;  4OB3 B;  3JCM c;  4Q5W A;  3CPW P;  1X01 A;  3CCV Q;  2LCS A;  4C0G A;  2H8H A;  3OYC A;  2C06 A;  1WHK A;  5KCH A;  1QVG A;  3OBY A;  2VV5 A;  2JW4 A;  3QUI A;  2XKO C;  1GXI E;  1Q86 U;  4E7J A;  1BI1 A;  2HMA A;  3EG2 A;  1IGU A;  1X6B A;  3BDL A;  2DTI A;  4PJN A;  2LJ1 A;  1KD1 R;  4M78 C;  1LCK A;  2P0K A;  1G83 A;  3JRZ A;  1GBQ A;  5CAI A;  3OYI A;  4NOY A;  1NBE B;  1YN8 A;  3HSB A;  2PUO B;  4C92 F;  4IUQ A;  3TQ7 P;  1TUD A;  3CMA Q;  2B8A A;  2NLU A;  2YDL A;  4ZN3 A;  1ZUU A;  3CC7 Q;  2CGH A;  1NJI C;  2HL5 C;  2DET A;  2VC8 A;  3MET A;  4ZGE B;  3OW2 P;  4PFP A;  4RCC A;  3HRT A;  1SHF A;  2O9V A;  4J9E A;  4DBQ A;  2HZY A;  2OTL T;  4KUI A;  5HCK A;  1M4Z A;  2H3J A;  3VYH B;  2K5I A;  4KBM B;  2BTT A;  4P5N A;  3KBG A;  3MEA A;  5A0D A;  1M30 A;  4FT2 A;  4M7D A;  1D1B A;  1OI1 A;  2KR3 A;  5J26 A;  3UF4 A;  4CC7 A;  5AYF A;  1ZSZ C;  1OEB A;  1M8M A;  2E3H A;  3I35 A;  1TSF A;  3QSU A;  5GMK m;  1JBM A;  1M9S A;  1YNZ A;  1OZ3 A;  2X35 A;  2L89 A;  1JJ2 P;  1IXD A;  1OX8 A;  1NJI U;  5LL6 S;  4E2F B;  3VJP A;  3WXM B;  3CCE T;  3OW2 S;  2EQI A;  3GNG A;  1ZA1 B;  3M59 A;  3OS5 A;  4M7D E;  1TWB A;  2SEM A;  1YIT T;  5GAM d;  2QDY B;  1KQS A;  2V1Q A;  2AHJ B;  5FU7 B;  2YLB A;  1PSE A;  3OYL A;  2CYZ B;  3SFM A;  1YFN A;  3CME T;  3CCU A;  1NYG A;  2VWF A;  2R5A A;  4JUV A;  2PVG B;  1U3O A;  2C0O A;  4C8Q D;  2FYK A;  4LDX A;  1VQK A;  1ARK A;  2OI3 A;  3VS0 A;  5DLO A;  2K6D A;  4M7D D;  4C92 A;  3HFN A;  4QKU A;  4LE9 A;  2FO0 A;  5GAN j;  1H8K A;  2BZX A;  3QHS A;  2YUP A;  2YRV A;  3VS6 A;  2RHI A;  5LJ5 d;  3H0H A;  2L3Q A;  4HVW A;  4C0D C;  1JQQ A;  1OPK A;  4FYY B;  4M7A D;  1B7T A;  1ABQ A;  2O2O A;  2COZ A;  4LXC A;  4RTY A;  2X3W D;  2DYI A;  4RG2 A;  4JZ3 A;  4M77 G;  5HKC A;  1RAG B;  1WJR A;  4II1 A;  1YIJ T;  3EG9 A;  1GRI A;  1MV0 B;  4KRT A;  4M7D F;  2YRC A;  2DEQ A;  2E65 A;  2CP2 A;  5CIU A;  4RMO A;  3X28 B;  3EG1 A;  2AKL A;  1ZUK A;  3CC4 T;  4J9C A;  2RM4 A;  4ANJ A;  1JO8 A;  3JSC A;  2XG8 D;  5GJV B;  1U1S A;  4RUG A;  4ATO A;  2X51 A;  4FCY A;  2IPO B;  4Z02 A;  3QYH B;  4M78 F;  5KYY B;  1CKB A;  2RN8 A;  2RHU A;  1EX4 A;  1FMV A;  3WVD B;  2RD1 A;  1Q86 C;  4CI0 C;  3OYK A;  2LP5 A;  1KJW A;  3CEY A;  3I56 T;  3UA6 A;  2WSE E;  1VQM Q;  5I2M A;  4OMN A;  3VUB A;  3I9Q A;  2JJ9 A;  2CKK A;  1WJQ A;  4BI8 B;  2XHC A;  4PKC C;  5GAO l;  1QVF S;  2RHY A;  5IHI A;  5CO7 A;  5KE3 A;  1IRX A;  4DBR A;  2Y90 A;  2DFU A;  4LDU A;  3EG0 A;  4A63 B;  2YXY A;  4AMC A;  4MMK A;  2RK1 A;  1YWO A;  1WDX A;  2HDA A;  3NPF A;  2GFA A;  2VVK A;  3OY9 A;  3ZEH A;  1K4U S;  2KSS A;  2CP0 A;  2LQK A;  2KE9 A;  4OMP A;  4LUE A;  1FMK A;  3X20 B;  1Y7X A;  3H0F A;  1VQ7 T;  1PKS A;  4C0D B;  4J6X A;  4F7U G;  2VGN A;  1VA7 A;  1GFC A;  2BE9 B;  1UG1 A;  4PK4 A;  1N8R R;  4QQ6 A;  4M75 F;  1I1J A;  2QTV A;  1BB9 A;  2DL7 A;  4X9C A;  2J06 A;  2ZPI B;  3LGL A;  1VQ9 A;  2X4W A;  2XMF A;  2JUF A;  2L3R A;  1Y71 A;  1Y96 A;  3A1P A;  1K76 A;  4M78 A;  5LJ5 f;  2CRE A;  4Z88 A;  1VQP T;  1MUZ A;  2X3X D;  3GLX A;  2D0Q B;  4Y92 A;  3I55 Q;  3QZ9 B;  1QCO A;  2L3S A;  3OQ5 A;  1MND A;  5IN1 A;  4HA8 A;  4J7I A;  2ROT A;  1VQL Q;  2QEX Q;  2V1R A;  2D1X A;  5GAN 3;  1KC8 U;  3M0Q A;  3OMG A;  3CBM A;  3OYF A;  4R56 A;  2HQE A;  3GOX A;  1AEY A;  1UEB A;  3CPF A;  2LX9 A;  3RKX A;  1Q95 G;  3MCA B;  2KQW A;  2LNV A;  3JB9 F;  5FWB A;  1H3Z A;  2VB6 A;  3RER A;  1PSF A;  4PJO F;  4XU2 A;  2PVO B;  3OYE A;  1W70 A;  2QK0 A;  1BK2 A;  4C92 G;  2FEI A;  1SRM A;  2GCX A;  2LCL A;  2ZPB B;  2DL4 A;  4XU3 A;  5FU6 B;  1VQO Q;  3E19 A;  1Q86 R;  3JCM h;  4FYW B;  1T3L A;  5IAY A;  2YUQ A;  1K8A C;  2KYM A;  3MP8 A;  4OGE A;  3G71 Q;  1UTI A;  2QQR A;  1S72 A;  3ZBD A;  4JRK A;  2DEU A;  1ZSZ A;  4E7I A;  1UE9 A;  3NFC A;  2E10 A;  4CC3 A;  4MZP A;  3FJP A;  1C0M A;  2JS0 A;  5I2S A;  4JLI A;  5LJ5 e;  2DVE A;  1RUW A;  4KH0 B;  1QMC A;  2QEX A;  1K0X A;  4OMM A;  3RDV A;  2BKD N;  1WX6 A;  1M2V A;  4M4Z A;  1M1F A;  3OSV A;  4ELY C;  2GBQ A;  2LCC A;  3EFS A;  1KD1 U;  3FB9 A;  1RAD B;  3PIP A;  1TXQ A;  2DZC A;  2CSI A;  1ZSG A;  1G5V A;  3M0U A;  2JM9 A;  2RQV A;  5LJ5 h;  4C92 B;  1X69 A;  3S3N A;  4KUL A;  5CKF A;  4M7A E;  4EIK A;  3VS7 A;  4WTO B;  1VQO A;  2ZGW A;  1M5Q 1;  1NE8 A;  3PVQ A;  3CCL A;  2VKN A;  2AZV A;  2AZS A;  2FHD A;  2ZCF B;  2LZ6 B;  4PJO A;  3CMA T;  3C0C A;  5HK3 A;  4MZT A;  3CCR A;  2JNG A;  2WSC E;  4TVR A;  5KYX B;  3QJY A;  4KH1 B;  1KQS S;  4ZTJ A;  2G6F X;  3TVT A;  4BUG A;  5D6X A;  3EFO A;  2DKG A;  3OYG A;  2FZG B;  5FRO A;  1M2O A;  1Q7Y C;  5CKD A;  2NUT B;  5GAM j;  3HRU A;  4IIM A;  4RTZ A;  4EMK A;  3QJ6 A;  3M55 A;  2KYB A;  5D6W A;  2RI2 A;  5LJ3 g;  4CRI A;  4KGX B;  4J9H A;  5KYX A;  4JRP A;  2VUB A;  1VQ8 T;  2FRW A;  2M02 A;  1LJO A;  1MMG A;  1HXD A;  2R5M A;  1E7O A;  1NYF A;  2E64 A;  2KMT A;  4MZM A;  2V8I A;  3UAT A;  1BI2 A;  5GMK e;  2GNC A;  1WPY A;  4N0A A;  4C5E A;  3HL8 A;  4OMQ A;  3CCL Q;  2COY A;  4JRQ A;  3PMI A;  2ZPH B;  4F7U B;  4RTX A;  3JB9 H;  4PJO C;  4M77 D;  1D0Y A;  1M90 C;  3EFR A;  2C0I A;  1MMN A;  1SF9 A;  2ED1 A;  1YCY A;  4M75 G;  3CCR Q;  3V8J A;  4B6M A;  2MWP A;  1BCO A;  3ME9 A;  4C92 D;  5GAM f;  4OB1 B;  5FU6 C;  1H64 1;  3F70 A;  3OYM A;  4L59 A;  4A4K A;  5LJ3 d;  2EFI A;  3H6Z A;  2OX7 A;  5KYW B;  1J3T A;  3JCM P;  4OML A;  2NUT A;  1BKB A;  3SEM A;  2PZ1 A;  3MHX A;  1M90 R;  2DRM A;  3I56 Q;  3BY7 A;  1ZSZ B;  1NLO C;  1WNL A;  2D9T A;  1WQ7 A;  3NTI A;  4MDX A;  3A8M B;  1M1K U;  1VQ5 A;  3P8H A;  1M8V A;  2MIO A;  4M78 B;  1Y96 B;  4J6Y A;  3OB9 A;  1BU1 A;  1O9S A;  1FYN A;  4E7L A;  1UHC A;  4O6J A;  4ZNX A;  3M0T A;  3M0R A;  2GGR A;  3P8B B;  3VU3 C;  3P8D A;  3HPW A;  3OYH A;  1VYV A;  5HK0 A;  3L42 A;  3RMQ A;  2GF7 A;  4E7H A;  5L8R E;  2ED0 A;  4DOW A;  2JVV A;  4F16 A;  4C8Q F;  3A8L B;  4X1V A;  2EYQ A;  1F1B B;  4AG2 C;  3CXC P;  2DVJ A;  1Q81 U;  1QVF P;  2DBK A;  2AT1 B;  2MF2 A;  3CD6 A;  3C4S A;  3UPU A;  1NPR A;  2OAW A;  1UGV A;  1QQJ A;  2DYB A;  2CP3 A;  3SWN B;  1RAB B;  1CKA A;  2EIF A;  3I56 A;  2XDP A;  2VGM A;  3NTH A;  4F17 A;  3GIB A;  4M77 E;  3O5Z A;  2DZ9 A;  2V26 A;  1PC0 A;  3V7C A;  1AOJ A;  2E5K A;  3DB3 A;  5EG2 A;  2RJD A;  3CCQ T;  2RMO A;  3M57 A;  1N9R A;  2PU9 B;  2L0A A;  3ER0 A;  4M75 E;  1B07 A;  2DX1 A;  1WGS A;  1YHQ Q;  5CKB A;  1RLQ C;  2XDD A;  4JPB W;  2RI5 A;  4KUD K;  3R6N A;  1K9A A;  1FX7 A;  1I81 A;  2Y4Y A;  1KQ1 A;  2X9H A;  1X2Q A;  1YJN T;  4C8Q G;  2RJE A;  3QYG B;  1M90 U;  2JTM A;  3CME A;  5L23 A;  2RB6 A;  3JB9 D;  3NTK A;  2A7Y A;  3OS2 A;  3QG1 A;  1YI2 A;  2PUK B;  3DKM A;  4RKU E;  4QVC A;  5GAN e;  4HVV A;  1R8O B;  5A0L A;  3JB9 I;  1YJ9 Q;  4A4H A;  3X24 B;  2OTJ Q;  3PVL A;  1Y57 A;  2L5Q A;  4C8Q A;  4BDY A;  4BI3 A;  2EQU A;  4LDW A;  1VQ7 Q;  4F04 B;  1M1G A;  4ZGJ B;  4M7A G;  1BI3 A;  2FPE A;  2QA4 A;  1RI9 A;  4HXJ A;  2J05 A;  4UC4 A;  4HCB A;  2JS2 A;  2RNA A;  3CCS T;  4ESR A;  1ABO A;  1NEG A;  1PWT A;  1VYU A;  2QDL A;  1T0J A;  2CH4 A;  1M27 C;  2P4T A;  2YHT A;  1WHH A;  2PQW A;  3RKY A;  5GMK h;  3OYN A;  4FW2 A;  5FRN A;  2RQW A;  2GTJ A;  1Q7Y R;  2EAY A;  4J83 A;  2OTJ T;  2HQX A;  4M75 A;  2K5L A;  1T0H A;  1TH7 A;  1YJN A;  2QQA A;  2QXF A;  3O8V A;  2KI7 A;  4C8Q B;  1UEC A;  3RBB B;  2E1H A;  2E3I A;  3S3O A;  4E6R A;  4BB7 A;  4NS5 A;  5J3B A;  1YJW Q;  1KIK A;  3CME Q;  3SWN C;  1AWW A;  4J8O A;  3U23 A;  2K3B A;  2MAM A;  1TS9 A;  2OTL Q;  3FRN A;  3IQL A;  2X4X A;  2P4R A;  1R0C B;  3HRS A;  2CZ0 B;  5FU7 C;  4C5I A;  2FPD A;  1SPK A;  2DE0 X;  1PKT A;  5GAN g;  4GLM A;  3M0S A;  1ZBJ A;  3SDZ A;  1M1K C;  1D0Z A;  4E7S A;  3BDU A;  3VS2 A;  1FWZ A;  3JAM E;  4HCZ A;  4J5Y A;  3M4G A;  2FB7 A;  3E9F A;  1N8R C;  2EJ9 A;  1XQH A;  5GAM g;  4X9D A;  2F2W A;  2XU8 A;  2D8J A;  1ACM B;  1HYO A;  8AT1 B;  5EC7 A;  1VQ5 T;  3OMC A;  2DMO A;  2HKN A;  2K4Y A;  3VS1 A;  3CCU T;  4M78 D;  4NL3 A;  1IGQ A;  1M2V B;  2PTK A;  3OYB A;  2EQM A;  2J6K A;  1K8A U;  1ZUY A;  3LGF A;  2DXU A;  3A8O B;  4MML A;  4XQ3 A;  5CQY A;  1D0X A;  2O9S A;  2DO3 A;  4FSS A;  2MOX A;  1KD1 C;  2KK4 A;  2P84 A;  1U5S A;  3N5B B;  1WZO A;  2F69 A;  3G4S T;  2LJ3 A;  1X2K A;  3PNW C;  2CZ1 B;  1RL2 A;  4ZGD B;  3CCS Q;  1TTH B;  5I21 A;  3QWX X;  4M7A F;  3H41 A;  2JM8 A;  3I5R A;  3MJX A;  3V8K A;  1X27 A;  2DIG A;  1Q81 R;  3LWH A;  3G71 T;  2PNI A;  1V76 A;  5CQX A;  3PE0 A;  4IUR A;  1W2B S;  5GAO n;  2QG9 B;  2ZAE A;  5GAM h;  2BZ8 A;  2RF0 A;  4R55 A;  1K1Z A;  1JU5 C;  4OGC A;  2DIQ A;  2HEQ A;  1AWO A;  1N27 A;  1QVG P;  1GCP A;  3CCV T;  2P0P A;  1XTD A;  2CDT A;  3HP9 A;  3JCM Q;  2I0N A;  3G1J A;  3UWN A;  2AIR B;  4Z8A A;  4J9F A;  4KT0 E;  1P92 A;  1D1A A;  2IVW A;  2GFU A;  5KCO A;  3J7A F;  1H92 A;  2JXB A;  4M75 C;  2KRO A;  1XOV A;  1GFD A;  3VRZ A;  3REA B;  5D6Y A;  1VYT A;  3VRY A;  5KYU B;  2FL7 A;  4QVZ A;  5LJ5 j;  3H0I A;  1S1N A;  3LWI A;  3M54 A;  2RHZ A;  3EGU A;  1BIB A;  4OP0 A;  1I8F A;  3G6E Q;  1WXU A;  3A8G B;  3V7R A;  5I22 A;  3A8H B;  2NUP B;  2A08 A;  2GQV A;  2ATC B;  1RAF B;  1SHG A;  1KC8 R;  3LX7 A;  4M7A A;  5GAN 7;  2K5F A;  3BE3 A;  2YUN A;  4JDS A;  3M56 A;  3I55 T;  3QO3 A;  2M16 A;  3OYJ A;  2DTO A;  2KRM A;  4A53 A;  4AFQ C;  3HKS A;  4Z89 A;  3CD6 T;  4LNP A;  1UGQ B;  3CC2 Q;  1VQ9 T;  2LT4 A;  1R77 A;  2CT4 A;  2DTH A;  3CCE A;  2DL8 A;  3TSW A;  4J7F A;  2DL3 A;  3THK A;  4JJB A;  3DLL A;  3CCJ T;  4IUP A;  1W1F A;  2ZZD A;  5CKH A;  1PCX A;  2A3L A;  2HCK A;  1RAA B;  1VQ4 T;  3Q1J A;  2JOY A;  1JB0 E;  1JJ2 S;  1PD0 A;  4ME7 A;  4WF2 A;  3CCU Q;  1K73 U;  5KYY A;  3JCM X;  1ZHI A;  2EGA A;  4NL2 A;  1YI2 T;  2ESW A;  3OYA A;  2F2X A;  3CPW S;  3EHR A;  2DPP B;  3MO8 A;  1JJ2 A;  1PD1 A;  2EYW A;  3H9N A;  8ATC B;  4C5H A;  2ABL A;  3JCM b;  2A36 A;  2HBP A;  3EGD B;  3JCM e;  5D7U A;  2ZPG B;  1VQ8 A;  2VXE A;  3L2Z A;  1VQP Q;  4IIO A;  5GAO q;  2KEA A;  4EMK B;  4AFZ C;  1QW1 A;  1A0N B;  4GY5 A;  2EGC A;  2YUO A;  1G3T A;  2WAC A;  1T3S A;  2EQK A;  2X4J A;  3EG9 B;  2M1H A;  1N5Z A;  2DIL A;  1Q82 C;  1WHM A;  3C95 A;  2KRN A;  1UJY A;  4MDW A;  2BIV A;  2RA2 A;  2OAU A;  1DJ7 B;  3M4Y A;  3CMA A;  1FMW A;  4LDV A;  2LMJ A;  4PL6 A;  2RI3 A;  2K7A A;  5FWC A;  2EW3 A;  2LNH B;  1AVZ C;  4GLK A;  3J81 E;  1KHI A;  4CC2 A;  3RNJ A;  4M78 E;  1RAE B;  2DL5 A;  4VUB A;  1Q82 U;  2E4H A;  1U1T A;  3X25 B;  3UA7 A;  2KBT A;  4KGV B;  3G7Z A;  1CSK A;  1PRM C;  2O31 A;  1VQM A;  2LVM A;  1K0S A;  2KAF A;  4N4G A;  3QDR B;  2A37 A;  1VQ8 Q;  2RK2 A;  2AK5 A;  1VQP A;  5IHN A;  1BCM A;  1W2B P;  1PHT A;  4J9B A;  1D09 B;  2FZC B;  1Z9Q A;  1B3Q A;  3EAE A;  4LUD A;  4XU1 A;  3CC2 T;  1UUE A;  2O4X B;  4AT1 B;  1SSF A;  3CXC S;  1JEG A;  1OV3 A;  4HVU A;  1AWX A;  2IIM A;  7AT1 B;  1WHL A;  2ZPF B;  2EJG A;  1NZ9 A;  1QCN A;  2CH4 W;  4FL6 A;  4XTW A;  4N4I A;  2H3E B;  2HL3 A;  1NJI R;  2M0O A;  4GBQ A;  3QPH A;  2K9G A;  4XTY A;  3L2R A;  3EGD A;  3I5S A;  2A28 A;  2KRS A;  1OPL A;  3AT1 B;  3V8L A;  1VQK Q;  2EKO A;  3VS3 A;  3MP6 A; 
#chains in the Genus database with same CATH homology
 3X24 B;  3CEY A;  3I56 T;  4X34 A;  2O01 E;  3S6W A;  2QQ9 A;  2XD0 A;  2CS7 A;  3E9G A;  1IZ6 A;  2WSE E;  2L5Q A;  4C8Q A;  5I2M A;  4BDY A;  4BI3 A;  2EQU A;  3J80 E;  4LDW A;  2CZ6 B;  2KY9 A;  3VUB A;  1M1G A;  4JLG A;  4ZGJ B;  4M7A G;  1BI3 A;  2KDS A;  2QA4 A;  2K3Y A;  5IT9 E;  3JCM W;  2CKK A;  2MI6 A;  4RG8 A;  2R57 A;  2MWO A;  1WJQ A;  4M78 G;  2XHC A;  4PKC C;  3LH0 A;  4UC4 A;  4BI8 B;  5GAO l;  4HCB A;  1QVF S;  2RHY A;  1D3B A;  5CO7 A;  5KE3 A;  3CCS T;  2MMP A;  1FXX A;  4RCB A;  2Y90 A;  4XK8 E;  3X26 B;  4LDU A;  4XAX B;  5CK9 A;  4LD9 K;  3JCM f;  4MMK A;  4JS5 A;  5GMK j;  3UDC A;  2RK1 A;  3TEE A;  1K73 C;  2P4T A;  2CZ7 B;  5C0M A;  1Q7Y U;  4A4F A;  2E12 A;  2YHT A;  1AHJ B;  2GFA A;  2PQW A;  3RKY A;  5GMK h;  4DQ2 A;  3OY9 A;  3PIO A;  3ZEH A;  3OYN A;  4DA4 A;  1VQM T;  1N6A A;  2KSS A;  2EQJ A;  2EJF A;  4M77 C;  5FRN A;  2EAY A;  4PJO D;  3RES A;  1Q81 C;  4J83 A;  2LQK A;  5CKE A;  2OTJ T;  2HQX A;  2JTF A;  2K5L A;  3FEO A;  4M75 A;  3OA6 A;  1VQ6 A;  1MHN A;  1TH7 A;  1YJN A;  2QQA A;  3X20 B;  5GAN d;  1Y7X A;  2QXF A;  3C12 A;  3O8V A;  4Y28 E;  4C8Q B;  1VQ7 T;  4C0D B;  4J6X A;  2LC4 A;  4F7U G;  3M9Q A;  2E1H A;  1LNX A;  5J39 A;  3S3O A;  3JB9 G;  2VGN A;  2ZPE B;  4BB7 A;  4NS5 A;  5J3B A;  3VUZ A;  5LJ3 f;  1I5L A;  2DD4 A;  2RO0 A;  3MEV A;  3CBP A;  3SWN C;  4E47 A;  4M75 D;  1ZBX A;  3A5Z B;  3GF5 A;  4J8O A;  4O5V A;  5A2Q E;  3M53 A;  4QQ6 A;  4M75 F;  2MAM A;  2YLC A;  3JCM g;  3FRN A;  4ELZ C;  2X4X A;  4QW2 A;  5KH6 A;  1O75 A;  1YJ9 A;  2IG0 A;  4X9C A;  3OS1 A;  3HRS A;  2CZ0 B;  4BI4 A;  2ZPI B;  5GAN h;  3LGL A;  1VQ9 A;  5GMK i;  5FU7 C;  4C5I A;  2X4W A;  4FSX A;  2JUF A;  5GAN g;  4IUU A;  2L3R A;  4BY6 B;  1Y71 A;  3G71 A;  1Y96 A;  4M78 A;  5LJ5 f;  3VKI A;  5KE2 A;  3SDZ A;  1YJW T;  1VQP T;  1M1K C;  1WJS A;  3FLG A;  2LQ8 A;  3GNF B;  3MP1 A;  3TCJ A;  1W2B A;  3CBO A;  3GLX A;  2D0Q B;  3BDU A;  4BDZ A;  1QVF A;  1EIF A;  1VQ4 A;  2D6F A;  3QZ9 B;  1BYM A;  1FWZ A;  1Y07 A;  2VXF A;  3OQ5 A;  3JAM E;  3JB9 I;  4D6W A;  2QI2 A;  4A54 A;  4HCZ A;  3DB4 A;  4HA8 A;  1BI0 A;  4J7I A;  2M9U A;  5IN1 A;  3RMS A;  4J5Y A;  4C5G A;  3M4G A;  1V29 B;  2FB7 A;  2LT1 A;  3E9F A;  5DY9 A;  1N8R C;  4BE1 A;  2EJ9 A;  1XQH A;  4B9X A;  5GAM g;  4X9D A;  5GAN 3;  1KC8 U;  3OMG A;  4C0F A;  1LOJ A;  2XU8 A;  3BFM A;  3CBM A;  3OYF A;  3KXT A;  4R56 A;  2HQE A;  1I4K 1;  3GOX A;  4JS4 A;  3JCM J;  4B9W A;  1UEB A;  3CPF A;  5DLQ E;  1YIT A;  2F5K A;  4EMK C;  5CVI A;  1B34 B;  1OYX A;  2LX9 A;  5FLX E;  1VQ5 T;  3OMC A;  3RKX A;  3MCA B;  2KQW A;  1BIA A;  2K4Y A;  2LNV A;  3CCU T;  4M78 D;  3JB9 F;  4NL3 A;  1YJW A;  4J6W A;  1UGS B;  5GAO m;  2DJZ A;  1H3Z A;  3RER A;  1PSF A;  2FVU A;  3VYG A;  3FC3 A;  3AHU A;  4PJO F;  1RI0 A;  4XU2 A;  2PVO B;  4A4G A;  3OYB A;  2EQM A;  3CCQ A;  4BD3 A;  3OYE A;  3LW5 E;  4N0A C;  1YJ9 T;  5GAN 4;  1G3W A;  1K8A U;  4C92 G;  3URG A;  2QEX T;  3LGF A;  1HK9 A;  2DXU A;  2GCX A;  1K9M C;  1VIE A;  2LCL A;  3A8O B;  4MML A;  2HAX A;  2ZPB B;  3PTA A;  4XU3 A;  4IKF A;  5FU6 B;  4XQ3 A;  3E19 A;  5CQY A;  3JCM h;  5IAY A;  1K9M U;  2DO3 A;  3PGG A;  4JJN K;  1K8A C;  2DK3 A;  1KD1 C;  2KK4 A;  3RIR A;  3L1A A;  4OGE A;  3MP8 A;  4QQG A;  3N5B B;  2QQR A;  2F69 A;  1S72 A;  4XTU A;  3ZBD A;  4M7A C;  3G4S T;  3OYD A;  3CC4 A;  4JRK A;  2DXB A;  3QKJ A;  4E7I A;  3PNW C;  3WVE B;  2CZ1 B;  2KVQ G;  3CPW A;  4M75 B;  3NFC A;  3L2U A;  3I55 A;  1RL2 A;  4IUV A;  2LTO A;  2E10 A;  1KHC A;  4M7A B;  4L6V 5;  4F7U E;  4ZGD B;  4MZP A;  5I21 A;  5GAO p;  3DLM A;  4M7A F;  3M58 A;  2E41 A;  2QTX A;  3FJP A;  1VQL A;  3VV0 A;  1QP3 A;  4JLI A;  5I2S A;  4ZN1 A;  5LJ5 e;  2DVE A;  2PVD B;  3OYY A;  5GAO r;  1VQL T;  1YHQ T;  2QEX A;  4QVD A;  3V8K A;  3G6E A;  2DIG A;  3MEU A;  1G3S A;  3LWH A;  3G71 T;  2BKD N;  3PT9 A;  5CQX A;  1W2B S;  4IUR A;  1M1F A;  2BUD A;  5GAO n;  3OSV A;  4BY6 C;  4ELY C;  5GAM h;  2K3X A;  2LCC A;  3EFS A;  1KD1 U;  3FB9 A;  4OMF B;  4R55 A;  5HY6 A;  5GAN f;  2V8K A;  3PMT A;  2DIQ A;  2XI9 A;  4OGC A;  3PIP A;  4HCC A;  2DZC A;  1YHQ A;  2K57 A;  3HFO A;  1G5V A;  4A4E A;  3OSS C;  1MGQ A;  4N4H A;  3CCV A;  4M7D G;  4LDY A;  1N27 A;  3SD4 A;  5LJ5 h;  4OB0 B;  3SB2 A;  4M77 F;  4C92 B;  2EWN A;  3OW2 A;  5CCA A;  3CCV T;  1VQO T;  1VQK T;  3S3N A;  2P0P A;  4KUL A;  5CKF A;  4M7A E;  3RUX A;  4OVA A;  1XTD A;  3SWN A;  4FM4 B;  3HP9 A;  3JCM Q;  3CC2 A;  5A0G A;  1VQO A;  3ASK A;  2ZGW A;  3UWN A;  1M5Q 1;  1NE8 A;  3CCL A;  4KT0 E;  3UT1 A;  1OZ2 A;  3OBW A;  4F7U A;  1P92 A;  2DXT A;  4C8Q C;  2FHD A;  3GP8 A;  1B34 A;  5GAN 8;  3CXC A;  2IVW A;  5C6S A;  4HT9 A;  3CCL T;  1X75 C;  1XNI A;  2GFU A;  4PNO A;  2ZCF B;  5KCO A;  4C92 E;  4E7K A;  3J7A F;  4PJO A;  4M75 C;  3CMA T;  4FT4 A;  5HK3 A;  4MZT A;  1XOV A;  1X6O A;  3CCR A;  2JNG A;  2WSC E;  2XIC A;  1KC8 C;  5D6Y A;  4TVR A;  3CC7 A;  3QJY A;  2HNI A;  4XU0 A;  1KQS S;  4ZTJ A;  4BUG A;  3L2W A;  3CCS A;  5D6X A;  2RJC A;  3MEW A;  2FL7 A;  3GPL A;  4QVZ A;  4EMH A;  4F7U F;  2O4X A;  2DKG A;  5LJ5 j;  3OYG A;  2E6Z A;  3L2Q A;  5FRO A;  3LWI A;  3M54 A;  1YIJ A;  2RHZ A;  4OB2 B;  3R6O A;  2JN0 A;  4XTV A;  1BIB A;  1VQN T;  4OP0 A;  4EDU A;  1I8F A;  4HKE A;  3FDR A;  1Q7Y C;  5CKD A;  1N9S A;  3A8G B;  3V7R A;  4XTX A;  2LDM A;  5GAM j;  5GAN 2;  5GAN 6;  3A8H B;  3HRU A;  1S72 T;  4EMK A;  2Y4X A;  3QJ6 A;  3M55 A;  5D6W A;  1UB4 A;  3RKW A;  2RI2 A;  4LD6 A;  4CRI A;  5LJ3 g;  2P0Q A;  4CI0 C;  2QA4 T;  2DD5 A;  2GQV A;  2VUB A;  4JRP A;  4BE0 A;  4ZTF A;  1VQ8 T;  1VQ6 T;  1IRE B;  4M7D B;  4Y91 A;  2QQB A;  1LJO A;  3LX7 A;  4M7A A;  1HXD A;  5GAN 7;  4OB3 B;  3JCM c;  4Q5W A;  2K5F A;  1X01 A;  2R5M A;  4BAC A;  2G3R A;  4M7D C;  2QQS A;  3QZ5 B;  4JDS A;  2E64 A;  3M56 A;  3I55 T;  4C0G A;  3QO3 A;  2M16 A;  2KMT A;  3V7S A;  3OYC A;  2DTO A;  2R58 A;  3PFS A;  4MZM A;  2V8I A;  4A53 A;  2C06 A;  5KCH A;  1QVG A;  3HKS A;  5GAN 5;  3OBY A;  3CD6 T;  2VV5 A;  4M77 B;  3G6E T;  1BI2 A;  1UGQ B;  3QUI A;  2XKO C;  5GMK e;  1VQ9 T;  4PJO E;  1GXI E;  1WPY A;  4N0A A;  1Q86 U;  2LT4 A;  4E7J A;  1BI1 A;  2F5T X;  4C5E A;  3HHT B;  3HL8 A;  2DTH A;  3CCE A;  4JRQ A;  3BDL A;  3PMI A;  2DTI A;  4J7F A;  3CCJ A;  3DLL A;  4M78 C;  3G4S A;  3H8Z A;  2ZPH B;  2P0K A;  4F7U B;  3OYI A;  3JRZ A;  3CCJ T;  5CAI A;  2I2L A;  4IUP A;  3JB9 H;  2ZZD A;  5CKH A;  4M77 D;  4NOY A;  4PJO C;  4M77 A;  1M90 C;  3HSB A;  2PUO B;  3EFR A;  2A3L A;  1QVG S;  4C92 F;  3LYI A;  2HD0 A;  4IUQ A;  4M75 G;  1YCY A;  1VQ4 T;  2B8A A;  2DAQ A;  2NLU A;  2JOY A;  3Q1J A;  1JB0 E;  3V8J A;  2MWP A;  4ZN3 A;  1JJ2 S;  2CGH A;  3ME9 A;  4ME7 A;  4C92 D;  5GAM f;  1NJI C;  4WF2 A;  5FRM A;  1WQW A;  1K73 U;  5CR2 A;  4OB1 B;  2VC8 A;  3MET A;  5FU6 C;  4ZGE B;  1H64 1;  3JCM X;  3F70 A;  3OYM A;  1ZHI A;  4L59 A;  4A4K A;  4NL2 A;  5LJ3 d;  1UGR B;  3HRT A;  4RCC A;  2RJF A;  4PLL A;  1YI2 T;  2EFI A;  3H6Z A;  2DXC A;  3OYJ A;  2E70 A;  3OYA A;  3CPW S;  2OTL T;  4KUI A;  1KG1 A;  1YBY A;  3MO8 A;  2DPP B;  1JJ2 A;  1N8R U;  3JCM P;  1M4Z A;  2H3J A;  3VYH B;  5LJ3 j;  1BKB A;  2K5I A;  4KBM B;  1KQ2 A;  3C94 A;  3E1S A;  4P5N A;  3MHX A;  4C5H A;  3KBG A;  3MEA A;  5A0D A;  3JCM b;  4V2S A;  3BY7 A;  4FT2 A;  2HBP A;  3KUF A;  2D9T A;  1WNL A;  3TRE A;  1WQ7 A;  2ZPG B;  4PJO G;  3JCM e;  1VQ8 A;  3FIF A;  3NTI A;  4M7D A;  4MDX A;  1ZQ1 A;  2VXE A;  3A8M B;  3L2Z A;  1OI1 A;  1M1K U;  2VYT A;  3OYL A;  1VQ5 A;  5GAO q;  3INZ A;  3P8H A;  5J26 A;  2XDB A;  3JCM V;  4EMK B;  1QW1 A;  5AYF A;  1M8V A;  1Y96 B;  4J6Y A;  4M78 B;  4GY5 A;  5DM7 R;  3OS0 A;  1QP2 A;  3OB9 A;  2V8J A;  3QSU A;  3ZFJ A;  1G3T A;  2WAC A;  1O9S A;  5GAM e;  5GMK m;  2K2V A;  1JBM A;  2EQK A;  1M9S A;  2X4J A;  1VUB A;  1OZ3 A;  2M1H A;  2WSF E;  4E7L A;  2X35 A;  3JCM d;  2L89 A;  4O6J A;  3S3M A;  1Q82 C;  1NJI U;  2XK0 A;  3C95 A;  5LL6 S;  3VJP A;  3QXE B;  3P8B B;  3WXM B;  4OF1 A;  4MDW A;  3VU3 C;  3OW2 S;  3CCE T;  3CCR T;  3P8D A;  1JRI A;  3GNG A;  2BIV A;  3HPW A;  3OYH A;  3M59 A;  2RA2 A;  3OS5 A;  4M7D E;  5HK0 A;  4BE2 A;  2OAU A;  3L42 A;  3RMQ A;  5LJ5 g;  2GF7 A;  4HT8 A;  4E7H A;  1YIT T;  1DJ7 B;  5L8R E;  3M4Y A;  5GAM d;  3CMA A;  2QDY B;  1KQS A;  5FU7 B;  2AHJ B;  3CCM T;  2YLB A;  1W4S A;  1PSE A;  4DOW A;  5LJ3 e;  4LDV A;  2JVV A;  2CYZ B;  3SFM A;  4C8Q E;  4C8Q F;  4PLI A;  4PL6 A;  4C0Z A;  2RI3 A;  3LLR A;  5GMK l;  3CME T;  3CCU A;  3A8L B;  2R5A A;  4JUV A;  2PVG B;  4FU6 A;  4C8Q D;  4LDX A;  2FYK A;  3J81 E;  4GLK A;  2EYQ A;  1KHI A;  4DOV A;  1VQK A;  1Q81 U;  4M78 E;  3M5A A;  2MF2 A;  3CD6 A;  5DLO A;  4VUB A;  4PJO B;  3C4S A;  4M7D D;  3UPU A;  1NPR A;  4IUT A;  3T9N A;  4C92 A;  1Q82 U;  1U1T A;  3HFN A;  3X25 B;  1VQN A;  2OTJ A;  5GAN j;  3QHS A;  3G7Z A;  2YRV A;  4XTZ A;  3SWN B;  1VQM A;  2LRQ A;  2RHI A;  2EIF A;  2LVM A;  1G3Y A;  2KAF A;  2VGM A;  2XDP A;  3NTH A;  5LJ5 d;  4N4G A;  3I56 A;  1VQ7 A;  3QDR B;  3GIB A;  3L2V A;  4FIB A;  5LJ3 h;  4M77 E;  5M9O A;  2DZ9 A;  2RK2 A;  3V7C A;  1UGP B;  1VQP A;  4C0D C;  4M7A D;  3DB3 A;  2E5Q A;  5EG2 A;  2RJD A;  1QVP A;  2JZ2 A;  3CCQ T;  4RG2 A;  4M77 G;  3M57 A;  1N9R A;  5HKC A;  2PU9 B;  3ER0 A;  3JB9 J;  1WJR A;  4II1 A;  1YIJ T;  4C92 C;  2X4Y A;  2XID A;  4M75 E;  3EAE A;  4XU1 A;  1WGS A;  3CC2 T;  5CKB A;  4M7D F;  2O4X B;  4YTL A;  1SSF A;  2E6N A;  3TU4 K;  2DEQ A;  2E65 A;  2XDD A;  3CXC S;  2RH2 A;  3BW1 A;  2RI5 A;  4QQD A;  2ZPF B;  5CIU A;  4RMO A;  3X28 B;  3CC7 T;  4KUD K;  2EJG A;  4EPC A;  1NZ9 A;  1FX7 A;  1I81 A;  3CC4 T;  3QBY A;  1D3B B;  4FL6 A;  4XTW A;  2Y4Y A;  1VIF A;  2RM4 A;  1KQ1 A;  3JSC A;  4N4I A;  2XG8 D;  1U1S A;  1YJN T;  2M0O A;  2RJE A;  4C8Q G;  4EMG A;  4ATO A;  3CCM A;  3QPH A;  4JRI A;  4XTY A;  2RHX A;  3QYG B;  1U8R A;  2JTM A;  3L2R A;  4L5G A;  3CME A;  2L8D A;  1M90 U;  1NPP A;  4Z02 A;  2RB6 A;  3QYH B;  4M78 F;  3JB9 D;  3V8L A;  3NTK A;  2A7Y A;  3QII A;  3QG1 A;  3OS2 A;  1YI2 A;  2PUK B;  3DKM A;  2EKO A;  4RKU E;  2RHU A;  4QVC A;  5GAN e;  2OTL A;  3WVD B;  1R8O B;  5A0L A;  2RD1 A;  3MP6 A;  1Q86 C;  4A4H A;  3OYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...