3OQ5A

Crystal structure of the 3-mbt domain from human l3mbtl1 in complex with p53k382me1
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
313
structure length
309
Chain Sequence
b'WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title The MBT Repeats of L3MBTL1 Link SET8-mediated p53 Methylation at Lysine 382 to Target Gene Repression.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 68
structure length 309
sequence length 313
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oq5A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oq5A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oq5A03
2EQUA 4OVAA 2NLUA 2O4XA 3E9FA 4C5GA 4BDZA 3S3MA 4C5EA 4X34A 2BIVA 4A4GA 3ME9A 3OYNA 4GY5A 3L42A 3OQ5A 2R5MA 3H6ZA 2P0KA 4IKFA 4IUPA 3L2VA 5KH6A 1SSFA 2EKOA 2IG0A 3DB3A 2RHZA 3P8HA 4C5HA 2WACA 3SD4A 1WGSA 4BE1A 2G3RA 4BE2A 3F70A 4LD6A 2GFAA 2JZ2A 5D6XA 3OA6A 3OS0A 2X35A 2GFUA 2RI3A 2DIQA 4HCZA 4BDYA 3MP1A 3CEYA 3UWNA 2RO0A 4NS5A 2RHXA 4PLLA 3OYCA 2M16A 5FROA 2RJDA 4B9WA 3OMCA 4RG2A 3OYGA 3OYHA 2XDPA 2D9TA 3QJ6A 2X4WA 3L2RA 3S3NA 1KHCA 2CKKA 3MEVA 3FEOA 1OZ2A 2RHUA 2L89A 3PMIA 4IURA 4QQGA 5D6WA 5C0MA 4IUTA 4A4HA 3L2WA 1H3ZA 3MO8A 2XK0A 5C6SA 2O4XB 2PQWA 3DB4A 5IN1A 3OYAA 3FC3A 4E7LA 4FL6A 3QIIA 3S3OA 5J26A 5J39A 2F5KA 3PNWC 3LGFA 3META 2R58A 4B9XA 1N27A 2RJEA 2LVMA 1OI1A 4PLIA 3Q1JA 3OY9A 2E6NA 2RHYA 2BUDA 2X4XA 4E7IA 3OS1A 4ZTFA 3OS2A 3OYDA 3ASKA 3LLRA 3O8VA 3MEWA 3OMGA 4BD3A 4Q5WA 3EAEA 3PMTA 1G5VA 2EFIA 2K3YA 3OYFA 3ZEHA 2LRQA 5FRMA 1WJSA 2DAQA 2M0OA 4IUUA 3OYLA 2LTOA 3OB9A 2K3XA 5IAYA 1OZ3A 1MHNA 3GOXA 2E5QA 4ZTJA 3FDRA 3OYJA 3LYIA 5KE2A 2HQEA 4E7KA 2QQRA 3OYIA 3PFSA 3LH0A 4CRIA 3NTHA 1RI0A 3FLGA 4PL6A 3QBYA 4QQ6A 3MP6A 2RJFA 2FHDA 3M9QA 2EQJA 3MP8A 3E9GA 1XNIA 4IUQA 3P8DA 5D6YA 5KCHA 4N4GA 3L2QA 3LGLA 2GF7A 3NTKA 3OYKA 5M9OA 1WJQA 2EQKA 2L8DA 5KE3A 3OYMA 4A4FA 2JTFA 2DIGA 2QQSA 3OYEA 4E7HA 4E7JA 4UC4A 2LCCA 3QKJA 4QVZA 4A4EA 2R57A 2HQXA 3MEAA 3MEUA 2M1HA 3NTIA 2L3RA 3DLMA 2MWPA 3LX7A 3OYBA 4IUVA 4FU6A 4BACA 4Z02A 5CIUA 5KCOA 3S6WA 2EQMA 2LDMA 3KUFA 2B8AA 5FRNA 3H8ZA 4BE0A 1WJRA 2RHIA 3UT1A 3BDLA 4C5IA 2RI2A 2VYTA 4II1A 4QQDA 4N4HA 3C4SA 4L59A 1OYXA 4EDUA 2RJCA 2BKDN 2MWOA 2X4YA 2R5AA 2RI5A 4N4IA 2YRVA 3L2UA 4QW2A
chains in the Genus database with same CATH superfamily
2FPFA 4RTVA 3VS3A 2NLUA 3ZL7C 4M7DC 1K8AC 1UB4A 3ME9A 2OAWA 2LJ0A 3H6ZA 2CGHA 2QYZA 3I5SA 1RAIB 2JW4A 1QVGA 5J3BA 1WHGA 4M4ZA 2WACA 2JUFA 1JEGA 1R8OB 3G6EA 3EGXB 4J8OA 4IIOA 1WFWA 1TUDA 1VA7A 4HCZA 3ZBDA 3X24B 1D09B 2M16A 4M77F 2RJDA 2ED0A 4OGCA 2QA4A 2L89A 1Q86U 2E64A 4FW2A 3VS2A 3FC3A 2NUTB 4XU2A 5J39A 1TS9A 3LGFA 2CDTA 5KYNA 3OY9A 1Z9ZA 1K73R 2HKQB 4E7IA 3WXMB 2QEXT 1RLPC 1M90U 3PMTA 3VS7A 3HRTA 2K3YA 1Q7YU 5GMKe 4D8KA 3E2UA 1VQKA 3H0FA 2DD4A 2E1HA 3EH1A 1NJIC 4FCYA 5GANg 3A8OB 2E65A 3HL8A 2X3WD 1LCKA 3EHQA 3UPUA 2XIDA 1HXDA 4LNPA 2HDAA 2CZ6B 3BY7A 4A54A 2JTMA 3AHUA 2EKHA 3L2ZA 3EG9B 3VRZA 4NL3A 1QCNA 3CCEA 4M7AD 2QQSA 5FRMA 4PFOA 3BW1A 2L3RA 1UHCA 4IUVA 5GAN2 1RAFB 3X20B 3SWNA 1RAAB 2H8HA 4OMPA 3BDLA 2EJGA 1VQMA 1D0YA 1BI1A 4JUVA 5GAN4 3CC4Q 5CK9A 4C5EA 1X27A 1R0CB 1SHFA 4M7DB 1GL5A 3H0HA 1UJYA 2K79A 3JCMJ 5D6XA 1M5Q1 5FWBA 1VQPT 3M0TA 2A36A 3RR6A 3TSZA 1KHCA 1NM7A 2HKNA 1KD1C 1KIKA 4LUEA 2EWNA 4F7UE 1VQOT 3CD6T 2NWMA 3SEMA 4R0KA 4B9XA 2QEXA 3CCLQ 1Z9QA 1ZUYA 3EH2A 5GAOn 4CC3A 3OW2S 5GAMg 2WSEE 4Q5WA 1WPYA 2KE9A 1BCOA 4DQ2A 4ESRA 5IAYA 3NFCA 1GFDA 2QASA 3L1AA 2OTLT 1D1BA 1QP2A 3RERA 2EBPA 2CUBA 5LJ5f 1SF9A 1K9MU 1RAGB 2YLCA 4OB0B 2EQJA 4FSSA 3E9GA 4AFSC 1Y96A 3HP9A 2ABLA 3CCVT 2V1RA 3L2QA 2MYSA 2GF7A 1WI7A 4X9CA 3JB9J 1WJQA 1QQJA 2LCCA 1WHKA 2EPDA 2K5LA 4JJNK 4KGVB 4XQ3A 2LMJA 3I55A 3TQ7P 2EGAA 2B8AA 4HT8A 1M9SA 2VYTA 3VRYA 2KVQG 2R5AA 5LJ5d 1YI2T 2IPOB 3L2UA 1X69A 1JXMA 2O4XA 5LJ3f 4A4GA 4C0ZA 4Y28E 3PVLA 4M7AC 1WGSA 1OU9A 4XTUA 3CMEQ 1VQPA 1Q82U 4RUGA 4PJMA 3VYGA 4AFUC 2RI3A 1VQ7Q 3A98A 4CC4B 4PJOD 4FIBA 4J7IA 2D9TA 4D6WA 3RDVA 1S72A 2RHUA 1VQOA 4A4HA 2KT1A 2RNAA 1AT1B 2O4XB 5IN1A 5LJ3d 1BK2A 3CCST 2ED1A 1OU8A 4F14A 1JB0E 2RJEA 3VU3C 4OB2B 3CC7Q 2E6NA 1YJ9Q 1Q81R 2X4XA 1PM3A 1VIEA 5DLOA 5L23A 3VS6A 1FWZA 1VIFA 3RMQA 2YXYA 5GAOr 1I81A 2OTLA 4Z88A 1BI3A 2QDYB 1UTIA 4MZMA 3JCMe 3CCQA 1ARKA 2AZSA 2D8JA 3EFOA 2C0TA 3TVTA 4ZGEB 4M75C 1NLOC 2RJFA 1G2BA 2CH4W 4M78A 3RBBB 1G3SA 4N4GA 2ZPBB 3KFVA 2L8DA 4IKFA 2DL7A 2OX7A 2CP3A 5A0LA 1X43A 3NTIA 4M7DE 2IVWA 3I56A 3DLMA 3GP8A 2O2OA 3D7SB 4KT0E 1M4ZA 5CQYA 3JAME 4KH1B 1K8AR 2KGTA 2PTKA 4TVRA 2GQIA 5D7UA 4BE0A 3UA6A 4II1A 4N4HA 1ACMB 5IHIA 3KBGA 1MMGA 2M9UA 5KYYA 4K11A 3DLLA 2FL7A 1W2BA 2RM4A 2CS7A 5FWCA 4DBRA 3L42A 1KHIA 3NHNA 3G7ZA 2ESWA 2YSQA 1QVFA 3C94A 3CCRT 3HSBA 1YITA 4M7AB 2CZ1B 4GLKA 1WA7A 2VV5A 5FROA 2NUPA 1H8KA 5IHKA 5FW9A 4C8QG 1N8RC 2PQWA 5L8RE 1O75A 4XU1A 1X6BA 1NJIR 2M0YA 4AFQC 1VQ4Q 2OJ2A 2PUKB 1N5ZA 2XI9A 2JTEA 4M7AG 1BYMA 1WJSA 3JV3A 1UGQB 2CP0A 3QYHB 1WQ7A 1UGRB 5A2QE 4PJOC 3HRUA 2CZ7B 1RABB 1C0MA 4M77A 3M57A 3CCJT 1ZLMA 3FDRA 4E6RA 2LCSA 2V26A 2CP5A 2LJ3A 2O9SA 2FRWA 5CCAA 1XNIA 1PCXA 3PGGA 4M75B 4PNOA 2KEAA 5IXBA 2KI7A 2K9GA 1M3BA 3OYEA 3MJXA 1OQKA 1MV0B 2K5IA 4PFZA 4FSXA 2KQWA 3A1PA 2MIOA 1YJWT 2COYA 1MV3A 2CSIA 4E7SA 2VGNA 4PJNA 1OULA 2HMAA 3G71Q 2EVRA 2DZ9A 1W70A 2RI2A 2HD0A 1MMAA 2LJ1A 1VQNT 4AG2C 4X34A 2FZGB 2MOXA 2ZCFB 3SD4A 1KD1R 1YJNQ 2H3EB 1AZEA 1HK9A 3OS0A 2EYWA 4KULA 1QKXA 4MMLA 1YIJQ 3CEYA 3MCAB 4RTYA 1FMWA 2KRSA 3CCUQ 3S3NA 4ZN1A 2DXUA 2K3BA 4QQGA 1EX4A 2FG0A 1VQ6T 1KQ1A 4A63B 5GANf 2DRKA 2V8IA 2ZPEB 1KC8C 1VQ5Q 2HQHA 3J80E 3CC2Q 2P4RA 4R56A 2EFIA 4JDSA 2L5QA 3ZEHA 2L3PA 4EPCA 3OYLA 2LTOA 4C0DC 4FT4A 1WHHA 1VQ8Q 3FB9A 3DKMA 4RTWA 2DL4A 2QTVA 1WYXA 2DEUA 5IXFA 3EG3A 1QWFA 3HTRA 3GOXA 4PJOB 5CVIA 1JJ2S 4FYVB 2RD1A 2GNCA 4BI8B 2YUQA 3FLGA 4QQ6A 1UGPB 5GANd 3JCMV 3PT9A 5KCHA 1FX7A 5LJ5h 3RKXA 2QTXA 2VASA 4KUIA 5KE3A 3GIBA 2JTFA 1AOJA 4E2FB 4UC4A 4C8QF 4EMHA 3CC4A 5LJ5j 3LX7A 4FU6A 3G1JA 1VQKT 2KT8A 3QWXX 1GRIA 5KCOA 4JJCA 1KG1A 2HZYA 3UT1A 2A7YA 4BY6C 1U5SA 3C4SA 4EDUA 2E3HA 2BKDN 1ZA1B 3QYGB 2EQUA 1RAEB 3CXCS 3RESA 3JB9D 5KYXB 5LL6S 1SSFA 3UF4A 3CCET 5LJ3h 4JS4A 2KAFA 3P8BB 2DRMA 4F7UG 5LJ3j 4PLLA 3NPFA 3FRNA 1Y07A 2XDPA 1M90C 2X4WA 1VQ6A 3OBWA 1VQMT 1M1KU 3ULRB 1Q7YC 3V7SA 2QQ9A 4XU3A 3DB4A 1O9SA 3J81E 2O9VA 1X2QA 5CQXA 1QVGS 2CP2A 3SWNC 4P5NA 1QCOA 1VQ9T 1SSHA 3RKYA 4M75E 3QXEB 2C0IA 1SRLA 3OYFA 4HA8A 1X6OA 1Q81U 1YWOA 2DE0X 4C92C 3CBOA 3OB9A 3CMAQ 1OPLA 2DBMA 1NLPC 2BE7D 4C0DB 3TSWA 4LDUA 1BIBA 1KQSS 2QQRA 3QBYA 1QKWA 3MP8A 4J9BA 2DTOA 3CCRQ 3CPFA 3CCMQ 3LGLA 1NYFA 4JZ3A 2RA2A 1QWEA 4A4FA 1BIAA 4BDYA 4F04B 1AZGB 4EIKA 4JRIA 4M78D 1NYGA 3CMEA 5CKHA 1VQLT 3JCMg 1E7OA 1R77A 1LNXA 2LC4A 4XTYA 2QK0A 1WX6A 3CPWA 4JRPA 4DBQA 1VQ7A 3NMZC 1SPKA 4WF2A 3S3MA 3M4YA 2F5TX 2R5MA 5IT9E 3DB3A 2XICA 3BDUA 4RCBA 1CSKA 2J05A 1N8RR 1S1NA 2YWWA 3I55T 1ZBJA 2DIQA 1UUEA 3CC7A 1SHGA 1IGUA 4LN2A 3OYCA 5FU6C 3OYGA 4LDWA 3A8GB 4J6XA 1D0ZA 1NG2A 4C92A 1WDXA 4PKCC 1IREB 4PJOE 4FL6A 4QT7A 4EMKC 1R0BG 2AKKA 1N27A 2JNGA 3OSSC 1VQ9A 2PUOB 5GMKi 4BD3A 1G5VA 3EAEA 2A0FB 1T3SA 4RMOA 1KFZA 4LDVA 3SWNB 2KYMA 4ORZA 2G6FX 1PKTA 4OGEA 4C0FA 3BFMA 2K3XA 1IXDA 2RQRA 2QDLA 3G4SA 1S72T 2E5QA 3OYJA 3LYIA 5KE2A 1XQHA 2K7AA 2PVDB 1NE8A 4M75D 2QG9B 1WLPB 3VKIA 5FU7C 2AHJB 4M7DG 1U06A 2P0QA 5I11A 1CKAA 4F7UF 3M56A 2YRCA 3EFSA 1TOVA 2EGCA 3QPHA 3JB9H 4XTXA 1BI2A 3RKWA 4M77D 5HY6A 3VS0A 1IGQA 2DIGA 4OMMA 2OTJA 2R57A 1U8RA 3JCMW 1PHTA 4BI4A 1YBYA 2LT1A 2SEMA 3H9NA 3HHTB 1VQLA 2LQKA 3RMSA 2KRNA 3CCQT 1G3YA 5HK0A 4QQDA 1VUBA 2L3QA 2YRDA 1Q82C 3A8HB 2DXCA 1QW1A 3M54A 3HFOA 3P8HA 1TG0A 1B34A 4EMKA 2H3JA 3G6EQ 4KUDK 4HT9A 2MCNA 1WXBA 4MMKA 3I56T 4ME7A 2KK4A 5GAN7 2X35A 1XJWB 4M78C 2QA4Q 1BB9A 1KC8R 1I07A 2W0ZA 2PZ1A 4OB3B 1YHQQ 1TH7A 1Y96B 5FU6B 1H3ZA 1KK7A 3GNGA 1I1JA 4N0AA 4LXCA 1ZUKA 4XK8E 6AT1B 4AT1B 2JMCA 4VUBA 3VS1A 2JXBA 3QDFA 3EGUA 1OV3A 2COZA 1YITT 5GANh 5HKCA 1AD5A 2DPPB 5GANj 2KNBB 4C0GA 5CKEA 3X26B 3QZ5B 2KY9A 1G8XA 1HD3A 4F16A 3M4GA 2A37A 3A8LB 1QP3A 2RMOA 3QUIA 3PVQA 5FU7B 3CCEQ 2PVGB 2LNHB 1GFCA 2QQBA 5M9OA 2HAXA 2DJZA 1RUWA 4ZGJB 2KR3A 3TREA 2HNIA 2KSSA 3TEEA 4OP0A 2LDMA 4J9FA 2FYKA 5DM7R 1YJNA 2RQTA 4NL2A 2RJCA 1UGVA 1M8VA 1WZOA 1YIJA 3E9FA 2SRCA 3E19A 3CCUA 4M77C 1M90R 2DILA 2JMAA 4OMLA 4Z89A 1B07A 4J9HA 1Q7YR 2FEIA 4C8QA 3EGDA 4RTTA 3OA6A 4HCCA 2B86A 3JCMQ 4M7DF 3EFOB 1JRIA 4J9GA 2RH2A 5CAIA 3M0QA 2RO0A 5KYUA 1VQ5A 3R6NA 1JJ2P 3JCMb 3C0CA 4RG2A 2F1LA 3CBPA 3L2RA 1A0NB 4M78B 3MEVA 3FEOA 4RKUE 1RLQC 2GQVA 2QEXQ 4C92E 2BZYA 2XU8A 5GAMh 1W2BS 5J26A 4FW1A 2LP5A 3VV0A 4PLIA 1MMNA 5AYFA 1QVFS 3KXTA 1M2VA 4HCBA 5GAMj 2LNVA 1UJ0A 1YWPA 3OS2A 2DL3A 2MMPA 4GLMA 4RTUA 1TXQA 4DOVA 2JM8A 5DY9A 1EFNA 2J6KA 1T0JA 2LRQA 1Y71A 1K76A 2EGEA 2EIFA 3URGA 2Y4YA 5KYYB 1FXXA 4Z8AA 1TUGB 2AZVA 2EYXA 3PFSA 2RK2A 3EHRA 2PU9B 3FJ5A 2DMOA 2JT4A 3CXCP 1H641 2JJ9A 5GAN5 2KXDA 2FHDA 1M3AA 2DVJA 3E1SA 2LQWA 4ATOA 2D8HA 1K73U 1T3LA 2MAMA 3FJPA 4E7HA 2DF6A 3VYHB 1C1AA 2GTOA 3QKJA 2NUPB 2KROA 2BTTA 1G83A 1AWJA 2E5KA 3QWYA 4Y92A 4FYWB 2DYIA 2P84A 4JZ4A 3A8MB 2YRVA 2VUBA 2P4TA 3VS5A 1QVGP 2HBWA 1DJ7B 2KXCA 2DZCA 4OB1B 2P0KA 4IUPA 1VQPQ 2IG0A 1T0HA 3WVDB 2G3RA 3CC4T 4M77B 4XTZA 2JZ2A 1AWOA 4KGZB 2GFUA 1V29B 1VQOQ 3CD6Q 1OOTA 1N9SA 1KQSP 1LVKA 1TWBA 1OZ2A 4AFZC 3L2WA 3MO8A 4KH0B 4M75G 2CT3A 3CMAA 3V7CA 2F69A 2GGRA 2CREA 3Q1JA 3H0IA 1TTHB 1KSWA 3OS1A 3M0UA 3ASKA 2OTLQ 3T9NA 4C92D 3PIOA 2HSEB 4LDYA 3CCQQ 3CCMA 2PVOB 4J83A 2DFUA 4ZNXA 4YTLA 2K2VA 3O5ZA 1K0SA 3CCVQ 1ZSZA 1D3BA 1IB8A 3GF5A 3JCMX 1IHVA 2YUPA 2X51A 2AKLA 4A4KA 1GCQA 4XAXB 1Q82R 1VYUA 2W10A 4GBQA 4B6MA 2CSQA 4X9DA 1WXTA 3LWHA 1V76A 2RQUA 5EC7A 3GNFB 1Y57A 2ZPHB 5I22A 1YI2Q 3EFRA 1LOJA 2Y4XA 2DEQA 3UATA 2CYZB 3C95A 4HVVA 2VWFA 4CC7A 2D1XA 2E12A 2KDSA 3I9QA 4M78E 2Y90A 2AT1B 1HJDA 4C5GA 1QMCA 4F7UA 4MDXA 3L2VA 5KH6A 3RIRA 2DL8A 2WSCE 4C5HA 1M1KC 1BI0A 4PK4A 3V8JA 1EIFA 3CBMA 3JCMP 4DOWA 2F2VA 4PJOG 3FIFA 4PJJA 1ZSGA 2NUZA 3CCSQ 3CMET 3JRZA 3M53A 4HVUA 4M7AF 1BU1A 2COWA 3QG1A 2HL3A 5D6WA 4IUTA 1KC8U 2RQWA 1VQ7T 3OW2P 2K6DA 3MKDA 3S3OA 3META 2ENMA 1Q86C 2DA9A 3ER0A 1D1AA 1ZX6A 2MPXC 1I8FA 7AT1B 3CQTA 5GAOm 2MF2A 4J6YA 3CCLA 1YNZA 4J9EA 3VS4A 2M02A 1NZ9A 3CXCA 4ZGDB 5GAMf 1W4SA 4JRQA 3CC7T 2ATCB 5LJ5e 1YJ9T 1U1TA 2EQIA 3JB9I 1RL2A 4HCKA 4DEYA 2O88A 3EGXA 2HQEA 3AT1B 5DLQE 1E6HA 8ATCB 5GAN3 2JM9A 1C6VX 1PSFA 1MNDA 3EG1A 2ZGWA 3M9QA 4JJBA 4ELZC 5GMKh 1LPLA 1PG5B 1NEBA 5GMKm 4LUDA 2NUTA 1X2KA 2CZ0B 2RB6A 5GMKj 5GAMd 1V1CA 1OX9A 4M75F 1VOMA 4BACA 4OMOA 4HXJA 3RNJA 4M77E 3G4ST 5LJ3e 2EQMA 2DBKA 5IHNA 3KUFA 2A08A 2RI5A 1H3HA 1K0XA 4J6WA 1QVPA 1VYTA 1X75C 1RACB 1KQSA 2KBTA 1YHQA 4J9DA 4MDWA 5I21A 1Y7XA 2OTJT 3F70A 4WCIA 4JRKA 1U3OA 2BE9B 4AMCA 1UE9A 3EG9A 2DJQA 4NS5A 2K57A 2RHXA 2KYBA 1K8AU 2VKNA 3OMCA 4BY6B 4IURA 1AHJB 4J7FA 3CPWS 2XK0A 4CI0C 4E7LA 3QIIA 3PNWC 4C8QD 1YN8A 4A53A 5AT1B 3M0RA 2RF0A 5EG2A 1PD1A 2D0NA 2LX9A 3CCJQ 2E4HA 1YJ9A 3MHXA 4M7DA 1VQ4T 1BKBA 2XDDA 3R6OA 1KJWA 1SRMA 4E7KA 2HEQA 4MZPA 3OYIA 1HYOA 5CKFA 2J06A 2WSFE 1NPPA 1PRMC 1XOVA 4PJOF 3V8LA 2ROLA 2DETA 1VYVA 1M3CA 1FMVA 1NJIU 1YJWQ 1K9MC 2VGMA 2QXFA 2CP7A 1WHMA 3JSCA 1ABOA 4E7JA 4A4EA 4N0AC 2M1HA 4O5VA 2OI3A 2GCXA 2FB7A 4C92B 3OYBA 1BCMA 4JLIA 2JVVA 1VQNQ 1SEMA 2JS0A 5GAN8 1EZZB 2HSPA 1WJRA 2I0NA 1MGQA 4C5IA 1W2BP 2EYQA 4L59A 2FZKB 1W1FA 4E47A 2DKGA 1GBQA 1QVFP 2O01E 2L3SA 1W6XA 4OVAA 3M0PA 3G71T 5GJWB 2QGGA 2DXBA 4GY5A 1WHLA 9ATCB 1N6AA 2AIRB 2EKOA 3GBQA 3LWIA 2M51A 5CO7A 1ZQ1A 2LQ8A 2BZ8A 3OW2A 2DYBA 1AVZC 2KRMA 1ZA2B 4LD6A 4C92G 5GAOq 2YLBA 3V7RA 3M58A 2ROTA 2NYSA 1WIEA 4J5YA 1VQ6Q 2FRYA 2IIMA 2QI2A 2J7IA 3OBYA 2HCKA 3QJ6A 5HCKA 1YJNT 2O31A 2X4JA 5C6SA 1YIJT 2DTHA 4BI3A 2R58A 3CCUT 1F1BB 2V8JA 1OI1A 2ECZA 1PSEA 2DL5A 1I0CA 4ZTFA 1K4US 2HBPA 2VC8A 1KD1U 1VQ4A 5CR2A 2EYYA 1X01A 3QHSA 3PE0A 4IUUA 1VQ5T 3OSVA 1G3WA 3CC2T 2CP6A 1OZ3A 4JS5A 3SB2A 2CT4A 2C06A 1ZUUA 1PNJA 2ZAEA 2HL5C 1YCSB 4XTWA 4C8QC 3NTHA 1B34B 4EMKB 4MZTA 1VQ8T 3MP6A 3I5RA 3PIPA 2XMFA 3P8DA 2X3XD 5D6YA 3SDZA 1VQKQ 2J6FA 3HPWA 3UA7A 4L6V5 2EQKA 1ABQA 4OF1A 2FVUA 3LW5E 4PJLA 4Y91A 3JCMh 2CUDA 3THKA 2MWPA 1GBRA 1I5OB 2E3IA 5CIUA 1RADB 2V8KA 1JU5C 2E6ZA 2YUOA 2RHIA 1M1KR 1UDLA 1X6GA 2FO0A 4N4IA 3G71A 4NOYA 2V1QA 4F17A 2DX1A 3JB9G 3NGPA 4BDZA 3CD6A 2DNUA 5CKDA 2JN0A 3OQ5A 3VUBA 1N9RA 2AK5A 2CH4A 2EAYA 2I2LA 4LDXA 2E10A 2GFAA 1VQMQ 1H92A 2GBQA 1Q86R 4FT2A 3MP1A 3TU4K 5GANe 4B9WA 3X25B 1J3TA 1JXOA 3PMIA 5C0MA 4J9CA 2VXFA 3OS5A 2A28A 2BZXA 3SFMA 3OYAA 1VQ9Q 4CC2A 1M8MA 1ZBXA 3M59A 2E70A 4RTXA 2XD0A 1IRXA 4BB7A 4LE9A 3CCVA 2BUDA 1G3TA 3O8VA 2L2PA 5IH2A 2K2MA 3RUXA 1UG1A 3G4SQ 2DAQA 2M0OA 3INZA 3CC2A 1M2OA 1M1GA 5KYWA 1K73C 4JLGA 3QSUA 4M7AA 2ZZDA 3GPLA 3HRSA 1VQ8A 4AG1C 4FYXB 1RI9A 2D6FA 3LH0A 3CMAT 1RI0A 2F2WA 4C92F 1YI2A 1NPRA 1E6GA 3VJPA 3QZ9B 2X9HA 4OMNA 4C8QB 4IUQA 3EGDB 1MNEA 2MK5A 2OTJQ 2RPNA 3NTKA 2PNIA 1U1SA 5KYUB 4OMFB 3OYMA 3BE3A 2QGFB 1IZ6A 1UFFA 2RK1A 2YUNA 4KRTA 4XU0A 1VQLQ 5CKBA 2OAUA 1NBEB 1TUCA 3QDRB 3CCMT 4M78G 1PD0A 5KYWB 2XDBA 2J6OA 5LJ5g 3OYYA 5HK3A 1OPKA 8AT1B 2DK3A 4DEXA 1UECA 2MI6A 2FPDA 1M2VB 3M55A 4HVWA 2LCLA 1PWTA 4FYYB 2Z0WA 3PTAA 3ZFJA 5GAN6 3CCSA 3OYNA 3X28B 3I55Q 4OMQA 3N5BB 2RHZA 5GAMe 3I35A 2DXTA 4J9IA 1ZSZC 2ZPGB 1BBZA 2DLPA 2F2XA 2K5FA 3M0SA 2DM1A 2D0QB 1ZHIA 4M75A 1PC0A 3V8KA 5GAOp 5LJ3g 3OYHA 1NEGA 2E41A 4X1VA 4DBHA 1GCQC 1FYNA 2C0OA 1OX8A 3JCMc 2JS2A 3J7AF 2DVEA 2LVMA 2RHYA 4JJDA 1UEBA 3LLRA 3A5ZB 1IHWA 5ECAA 1S72Q 2GTJA 1P92A 2QAZA 2YT6A 2LT4A 1N8RU 3JB9F 1MUZA 1LJOA 1TSFA 1M30A 4WTOB 3MPUB 4XTVA 1AWXA 5GJVB 1K9MR 4ZTJA 1PKSA 1D0XA 1PRLC 4R55A 3REBB 3UDCA 2RQVA 1Q95G 2LZ6B 4PL6A 2XG8D 4RCCA 4KGXB 4M7DD 1I5LA 1M1FA 4M77G 3CCLT 3QO3A 1GXIE 1I4K1 2EJFA 3HFNA 1HSQA 1QCFA 3CCRA 4V2SA 4QVZA 4QVCA 1WNLA 4LD9K 1QLYA 2A3LA 2ZPIB 4Z02A 4HKEA 1D1CA 2LX7A 2ZPFB 3M5AA 4EMGA 3CPWP 1WQWA 1B3QA 1SG5A 2MWOA 1UGSB 2X4YA 2YHTA 3WVEB 3JCMf 2RN8A 1M27C 3I56Q 4PJOA 4JPBW 2P0PA 2L0AA 2BIVA 4QVDA 4IIMA 5A0GA 5I2SA 4E7ZA 4BE1A 1JQQA 4BE2A 1RAHB 2YDLA 4KBMB 3LH5A 3SHWA 1KQ2A 2DTIA 1K1ZA 1ZSZB 1D3BB 1IO6A 1SKUB 2DO3A 3UWNA 3C12A 3G6ET 1K9AA 2XKOC 3H41A 1YFNA 2CKKA 1OEBA 3REAB 2EJ9A 3CCJA 4BUGA 3JCMd 1JJ2A 2QA4T 1Y0MA 2FZCB 5GAOl 4FM4B 4PFPA 1YITQ 1WXUA 2F5KA 2QQAA 4M78F 1MMDA 1YHQT 1GCPA 2VXEA 2EYZA 2EW3A 3OYDA 3OMGA 3MEWA 4C8QE 5A0DA 2DERA 3GLXA 1UHFA 4DA4A 4ZN3A 4L5GA 5KYXA 3EG2A 2DD5A 2VVKA 1YJWA 1CKBA 3HKSA 1MHNA 1YCYA 1Q81C 4RG8A 2KMTA 4F7UB 1JO8A 2XHCA 5FLXE 4M7AE 1WHJA 5GMKl 4CRIA 4O6JA 1VQNA 1B7TA 4ANJA 2K4YA 1XTDA 1YP5A 3VUZA 3OYKA 4ELYC 1TU0B 2JOYA 4RTZA 2HQXA 3MEAA 3MEUA 3U23A 2LQNA 4D8DA 4QKUA 3EG0A 3QJYA 3S6WA 5I2MA 2FPEA 1AWWA 5FRNA 3H8ZA 1JBMA 2VB6A 3IQLA 1OYXA 4DBFA 1AEYA 3TCJA 4QW2A 1FMKA
chains in the Genus database with same CATH topology
1YIJA 1VQNT 2O01E 4OVAA 2NLUA 3E9FA 3E19A 4M7DC 3G71T 4X34A 1UB4A 1K8AC 3ME9A 3CCUA 2DXBA 4GY5A 3H6ZA 2CGHA 1N6AA 4M77C 1QVGA 2EKOA 5J3BA 3LWIA 2WACA 2ZCFB 2JUFA 3SD4A 5CO7A 1ZQ1A 1R8OB 2LQ8A 3OW2A 4C8QA 4LD6A 3OA6A 4C92G 3G6EA 3JCMQ 5GAOq 4HCCA 1HK9A 2YLBA 4J8OA 3V7RA 1JRIA 3OS0A 4KULA 4M7DF 2RH2A 3M58A 4MMLA 4HCZA 3ZBDA 5CAIA 4J5YA 3CEYA 3X24B 2RO0A 3MCAB 1VQ5A 2QI2A 3JCMb 2M16A 3OBYA 2RJDA 4M77F 4RG2A 3CBPA 4OGCA 3QJ6A 3L2RA 3S3NA 4M78B 4ZN1A 1YJNT 3MEVA 2DXUA 2QA4A 3FEOA 4RKUE 2L89A 4QQGA 1Q86U 2GQVA 2E64A 2X4JA 4C92E 5C6SA 2XU8A 1YIJT 5GAMh 1VQ6T 1W2BS 3FC3A 2DTHA 4XU2A 1KQ1A 5J26A 4BI3A 5J39A 3LGFA 2R58A 3CCUT 5GANf 3VV0A 2V8IA 2ZPEB 2V8JA 4PLIA 1OI1A 3OY9A 1KC8C 5AYFA 1QVFS 1PSEA 3KXTA 4HCBA 5GAMj 2LNVA 4E7IA 4ZTFA 3WXMB 2QEXT 3OS2A 1M90U 2HBPA 3J80E 2MMPA 3PMTA 4R56A 2EFIA 4JDSA 3HRTA 2K3YA 2VC8A 1VQ4A 1KD1U 5CR2A 2L5QA 4DOVA 3ZEHA 5DY9A 1Q7YU 5GMKe 2LRQA 1X01A 3QHSA 1Y71A 4EPCA 2EIFA 4IUUA 3URGA 3OYLA 2LTOA 4C0DC 1VQ5T 3OSVA 2Y4YA 1VQKA 1G3WA 4FT4A 2DD4A 2E1HA 3FB9A 3DKMA 1NJIC 3CC2T 1OZ3A 4JS5A 3SB2A 5GANg 3A8OB 3GOXA 2E65A 1FXXA 4PJOB 2C06A 5CVIA 3HL8A 1JJ2S 3UPUA 2XIDA 2RD1A 1HXDA 4XTWA 3PFSA 2RK2A 4BI8B 2PU9B 3NTHA 4C8QC 1B34B 2CZ6B 3FLGA 3BY7A 4MZTA 4QQ6A 1H641 1UGPB 2JTMA 3MP6A 4A54A 5GANd 1VQ8T 5GAN5 2FHDA 3AHUA 3JCMV 3PIPA 3PT9A 3P8DA 5D6YA 3SDZA 3E1SA 5KCHA 1FX7A 3L2ZA 4ATOA 1K73U 5LJ5h 2MAMA 3FJPA 3HPWA 4NL3A 4L6V5 3RKXA 2QTXA 4KUIA 2EQKA 5KE3A 4E7HA 3GIBA 2JTFA 4OF1A 2QQSA 3VYHB 2FVUA 3LW5E 4UC4A 3QKJA 4C8QF 3CCEA 4EMHA 5FRMA 3BW1A 3JCMh 4Y91A 3CC4A 2L3RA 5LJ5j 2MWPA 3LX7A 4IUVA 4FU6A 1VQKT 5CIUA 5GAN2 5KCOA 2V8KA 3X20B 1KG1A 2E6ZA 3SWNA 2RHIA 3A8MB 2A7YA 3BDLA 3UT1A 4BY6C 2EJGA 3C4SA 4EDUA 2BKDN 1VQMA 4N4IA 3G71A 2YRVA 4NOYA 2VUBA 2P4TA 1BI1A 4JUVA 3QYGB 5GAN4 2EQUA 3JB9G 5CK9A 1DJ7B 4BDZA 3CD6A 2DZCA 4OB1B 4C5EA 3CXCS 5CKDA 2JN0A 3RESA 3OQ5A 3JB9D 2P0KA 5LL6S 4IUPA 3VUBA 1SSFA 2IG0A 4M7DB 1N9RA 3WVDB 3CCET 5LJ3h 2EAYA 2I2LA 4JS4A 2G3RA 4LDXA 3CC4T 4M77B 4XTZA 2E10A 2KAFA 2GFAA 2JZ2A 3P8BB 5D6XA 3JCMJ 4M7DE 1M5Q1 2GFUA 1VQPT 4F7UG 5LJ3j 4FT2A 3MP1A 1V29B 4PLLA 3TU4K 3FRNA 5GANe 4B9WA 1N9SA 1Y07A 3X25B 2XDPA 1M90C 2X4WA 1KHCA 1VQ6A 1OZ2A 3PMIA 3OBWA 1KD1C 5C0MA 3L2WA 1VQMT 1M1KU 1Q7YC 2VXFA 3MO8A 3OS5A 3V7SA 2QQ9A 3SFMA 4XU3A 2EWNA 3DB4A 4M75G 3OYAA 4F7UE 3CMAA 1O9SA 1VQOT 1ZBXA 3M59A 3J81E 3CD6T 3V7CA 2F69A 4B9XA 2E70A 5CQXA 2QEXA 2XD0A 1QVGS 3Q1JA 4BB7A 3CCVA 2BUDA 3SWNC 4P5NA 3OS1A 1G3TA 5GAOn 3ASKA 3OW2S 3O8VA 5GAMg 1VQ9T 2WSEE 4Q5WA 3RKYA 3T9NA 4C92D 4M75E 3QXEB 1WPYA 3PIOA 3OYFA 4LDYA 4HA8A 3RUXA 1X6OA 1Q81U 2DAQA 2M0OA 4C92C 4DQ2A 3INZA 3CBOA 3CC2A 3OB9A 3CCMA 5IAYA 3NFCA 2PVOB 1M1GA 1K73C 4JLGA 3L1AA 4J83A 2OTLT 1QP2A 4C0DB 4YTLA 3QSUA 4M7AA 4LDUA 2K2VA 2ZZDA 3RERA 3GPLA 3HRSA 1BIBA 1VQ8A 1KQSS 2QQRA 1D3BA 3GF5A 3JCMX 2D6FA 3LH0A 3CMAT 5LJ5f 1RI0A 4C92F 1K9MU 3QBYA 1YI2A 2YLCA 1NPRA 3VJPA 4OB0B 2EQJA 3MP8A 3QZ9B 2DTOA 3E9GA 4C8QB 4IUQA 1Y96A 3HP9A 3CCVT 3CPFA 3L2QA 4A4KA 3LGLA 2GF7A 3NTKA 4X9CA 3JB9J 2RA2A 1U1SA 1WJQA 4OMFB 4XAXB 3OYMA 4A4FA 1BIAA 1IZ6A 2LCCA 2RK1A 4XU0A 4BDYA 4X9DA 5CKBA 3LWHA 2K5LA 2OAUA 4JJNK 3QDRB 3CCMT 4M78G 4XQ3A 3GNFB 2ZPHB 2XDBA 3I55A 3EFRA 1LOJA 2Y4XA 3OYYA 4JRIA 5LJ5g 5HK3A 4M78D 2DEQA 2CYZB 3C95A 2DK3A 2B8AA 3CMEA 4HT8A 5CKHA 1VQLT 2MI6A 3JCMg 1M9SA 2VYTA 1LNXA 2KVQG 3M55A 2E12A 2KDSA 2LC4A 2R5AA 4XTYA 5LJ5d 1YI2T 3L2UA 2LCLA 4M78E 3CPWA 4JRPA 2Y90A 1VQ7A 2O4XA 5LJ3f 4C5GA 3PTAA 3ZFJA 4WF2A 5GAN6 4F7UA 3M4YA 2F5TX 3CCSA 3S3MA 4A4GA 4C0ZA 3OYNA 4Y28E 3X28B 2R5MA 4MDXA 5IT9E 3L2VA 5KH6A 3RIRA 3DB3A 2WSCE 3N5BB 2RHZA 2XICA 4C5HA 5GAMe 4M7AC 1M1KC 1BI0A 2DXTA 1WGSA 4XTUA 3BDUA 4RCBA 2ZPGB 3V8JA 1VQPA 1Q82U 1EIFA 3CBMA 3JCMP 4M75A 4DOWA 2K5FA 2D0QB 1ZHIA 3VYGA 3I55T 2RI3A 2DIQA 4PJOG 3FIFA 3V8KA 3CC7A 3OYCA 5GAOp 5FU6C 4FIBA 4PJOD 4J7IA 4LDWA 5LJ3g 3OYGA 3OYHA 3A8GB 3JRZA 2D9TA 3M53A 4J6XA 3CMET 4M7AF 4D6WA 4C92A 2E41A 3QG1A 1S72A 2RHUA 5D6WA 1VQOA 4IUTA 4A4HA 1KC8U 4PKCC 2O4XB 1VQ7T 5IN1A 1IREB 4PJOE 4FL6A 5LJ3d 3JCMc 4EMKC 3S3OA 3CCST 3META 1Q86C 3J7AF 2DVEA 3ER0A 1N27A 1JB0E 2LVMA 2JNGA 2RJEA 3OSSC 3VU3C 4OB2B 1VQ9A 1I8FA 2E6NA 2PUOB 2RHYA 2X4XA 5GAOm 2MF2A 1UEBA 5GMKi 1VIEA 3LLRA 3A5ZB 4J6YA 3CCLA 4BD3A 1G5VA 3EAEA 5DLOA 4RMOA 1FWZA 1NZ9A 1VIFA 4LDVA 3SWNB 4ZGDB 3CXCA 5GAMf 3RMQA 1P92A 2LT4A 5GAOr 1N8RU 1W4SA 3JB9F 1I81A 4JRQA 3CC7T 2OTLA 5LJ5e 4OGEA 1LJOA 4C0FA 3BFMA 1YJ9T 2K3XA 1U1TA 3JB9I 1BI3A 4XTVA 3G4SA 2QDYB 1RL2A 4MZMA 1S72T 2E5QA 3JCMe 3CCQA 4ZTJA 3OYJA 3LYIA 5KE2A 2HQEA 1XQHA 2PVDB 4R55A 5DLQE 1NE8A 4M75D 5GAN3 3UDCA 1PSFA 3VKIA 5FU7C 4PL6A 2AHJB 2XG8D 4M75C 4ZGEB 2ZGWA 4M7DG 2RJFA 2P0QA 4RCCA 4M78A 4F7UF 3M9QA 4ELZC 3M56A 4M7DD 5GMKh 1G3SA 1M1FA 1I5LA 3EFSA 4N4GA 2ZPBB 4M77G 5GMKm 3QPHA 3CCLT 4XTXA 1BI2A 3QO3A 3RKWA 3JB9H 1GXIE 2CZ0B 1I4K1 2EJFA 2RB6A 3HFNA 2L8DA 4M77D 5HY6A 3CCRA 2DIGA 5GMKj 4IKFA 4V2SA 5GAMd 2OTJA 4QVZA 5A0LA 2R57A 3NTIA 1U8RA 4QVCA 2IVWA 4M75F 3I56A 1WNLA 3DLMA 3GP8A 3JCMW 4LD9K 4KT0E 4BI4A 1YBYA 2A3LA 2ZPIB 4BACA 4Z02A 2LT1A 1M4ZA 5CQYA 3HHTB 4HKEA 3JAME 4M77E 1VQLA 3G4ST 2LQKA 5LJ3e 3RMSA 2EQMA 2ZPFB 3CCQT 3KUFA 3M5AA 1G3YA 4TVRA 4EMGA 4BE0A 5HK0A 1WQWA 4II1A 4QQDA 4N4HA 1VUBA 1Q82C 2MWOA 1UGSB 2X4YA 2RI5A 2YHTA 3WVEB 3A8HB 4J6WA 3JCMf 2DXCA 3KBGA 1QW1A 2M9UA 1QVPA 3M54A 3DLLA 2FL7A 1W2BA 4PJOA 2RM4A 1X75C 2P0PA 2CS7A 2BIVA 4QVDA 3L42A 1KHIA 1KQSA 3G7ZA 3HFOA 3P8HA 1YHQA 1QVFA 1B34A 4EMKA 2H3JA 3C94A 4MDWA 5A0GA 5I21A 5I2SA 1Y7XA 3CCRT 4KUDK 4BE1A 3HSBA 4HT9A 2OTJT 4BE2A 3F70A 4MMKA 4KBMB 3I56T 4JRKA 1YITA 4ME7A 1KQ2A 4M7AB 2KK4A 2CZ1B 5GAN7 2DTIA 2X35A 4GLKA 4M78C 1D3BB 4EMKB 2DO3A 2VV5A 4NS5A 3UWNA 2K57A 2RHXA 3C12A 3G6ET 1K8AU 5FROA 2XKOC 3OMCA 2CKKA 4OB3B 4BY6B 2EJ9A 4IURA 3CCJA 1TH7A 1AHJB 1Y96B 5FU6B 4BUGA 4J7FA 3CPWS 3JCMd 3GNGA 1JJ2A 2XK0A 4N0AA 4C8QG 1H3ZA 4CI0C 5GAOl 2PQWA 5L8RE 2QA4T 1N8RC 4E7LA 3QIIA 4FM4B 4XK8E 2F5KA 2QQAA 3PNWC 1O75A 4M78F 4C8QD 4VUBA 4XU1A 1YHQT 4A53A 2VXEA 3OYDA 2PUKB 5EG2A 3OMGA 3MEWA 4C8QE 5A0DA 1YITT 5GANh 3GLXA 2LX9A 2XI9A 5HKCA 4DA4A 1YJ9A 4ZN3A 4L5GA 4M7AG 1BYMA 1WJSA 2DPPB 1UGQB 3MHXA 3QYHB 4M7DA 1WQ7A 1UGRB 2DD5A 5A2QE 1VQ4T 4PJOC 5GANj 1BKBA 2XDDA 3R6OA 1YJWA 3HRUA 2CZ7B 3HKSA 4C0GA 5CKEA 4M77A 1MHNA 1YCYA 1Q81C 3X26B 3M57A 3CCJT 4RG8A 3FDRA 2KMTA 3QZ5B 4F7UB 2XHCA 2KY9A 5FLXE 4E7KA 3M4GA 4MZPA 4M7AE 3OYIA 5GMKl 3A8LB 5CKFA 4CRIA 2WSFE 1NPPA 4O6JA 1QP3A 1XOVA 4PJOF 3V8LA 1VQNA 3QUIA 5CCAA 1XNIA 5FU7B 3PGGA 4M75B 2PVGB 2K4YA 1XTDA 3VUZA 1NJIU 4PNOA 1K9MC 3OYKA 2VGMA 4ELYC 2QXFA 2QQBA 5M9OA 2JOYA 3JSCA 2HAXA 2DJZA 4E7JA 3OYEA 4ZGJB 4A4EA 2K5IA 4N0AC 2HQXA 3MEAA 3MEUA 2M1HA 4FSXA 2HNIA 4O5VA 2GCXA 2FB7A 3TREA 4C92B 2KQWA 2KSSA 3OYBA 3QJYA 4JLIA 1YJWT 3S6WA 5I2MA 2JVVA 3TEEA 2VGNA 4OP0A 2LDMA 5FRNA 3H8ZA 5GAN8 2DZ9A 1WJRA 2FYKA 1MGQA 4C5IA 5DM7R 1JBMA 1YJNA 2RI2A 2EYQA 2HD0A 4L59A 1OYXA 4NL2A 2RJCA 4M7AD 1M8VA 4E47A 3TCJA 2DKGA 4QW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQU A;  4OVA A;  2NLU A;  2O4X A;  3E9F A;  4C5G A;  4BDZ A;  3S3M A;  4C5E A;  4X34 A;  2BIV A;  4A4G A;  3ME9 A;  3OYN A;  4GY5 A;  3L42 A;  3OQ5 A;  2R5M A;  3H6Z A;  2P0K A;  4IKF A;  4IUP A;  3L2V A;  5KH6 A;  1SSF A;  2EKO A;  2IG0 A;  3DB3 A;  2RHZ A;  3P8H A;  4C5H A;  2WAC A;  3SD4 A;  1WGS A;  4BE1 A;  2G3R A;  4BE2 A;  3F70 A;  4LD6 A;  2GFA A;  2JZ2 A;  5D6X A;  3OA6 A;  3OS0 A;  2X35 A;  2GFU A;  2RI3 A;  2DIQ A;  4HCZ A;  4BDY A;  3MP1 A;  3CEY A;  3UWN A;  2RO0 A;  4NS5 A;  2RHX A;  4PLL A;  3OYC A;  2M16 A;  5FRO A;  2RJD A;  4B9W A;  3OMC A;  4RG2 A;  3OYG A;  3OYH A;  2XDP A;  2D9T A;  3QJ6 A;  2X4W A;  3L2R A;  3S3N A;  1KHC A;  2CKK A;  3MEV A;  3FEO A;  1OZ2 A;  2RHU A;  2L89 A;  3PMI A;  4IUR A;  4QQG A;  5D6W A;  5C0M A;  4IUT A;  4A4H A;  3L2W A;  1H3Z A;  3MO8 A;  2XK0 A;  5C6S A;  2O4X B;  2PQW A;  3DB4 A;  5IN1 A;  3OYA A;  3FC3 A;  4E7L A;  4FL6 A;  3QII A;  3S3O A;  5J26 A;  5J39 A;  2F5K A;  3PNW C;  3LGF A;  3MET A;  2R58 A;  4B9X A;  1N27 A;  2RJE A;  2LVM A;  1OI1 A;  4PLI A;  3Q1J A;  3OY9 A;  2E6N A;  2RHY A;  2BUD A;  2X4X A;  4E7I A;  3OS1 A;  4ZTF A;  3OS2 A;  3OYD A;  3ASK A;  3LLR A;  3O8V A;  3MEW A;  3OMG A;  4BD3 A;  4Q5W A;  3EAE A;  3PMT A;  1G5V A;  2EFI A;  2K3Y A;  3OYF A;  3ZEH A;  2LRQ A;  5FRM A;  1WJS A;  2DAQ A;  2M0O A;  4IUU A;  3OYL A;  2LTO A;  3OB9 A;  2K3X A;  5IAY A;  1OZ3 A;  1MHN A;  3GOX A;  2E5Q A;  4ZTJ A;  3FDR A;  3OYJ A;  3LYI A;  5KE2 A;  2HQE A;  4E7K A;  2QQR A;  3OYI A;  3PFS A;  3LH0 A;  4CRI A;  3NTH A;  1RI0 A;  3FLG A;  4PL6 A;  3QBY A;  4QQ6 A;  3MP6 A;  2RJF A;  2FHD A;  3M9Q A;  2EQJ A;  3MP8 A;  3E9G A;  1XNI A;  4IUQ A;  3P8D A;  5D6Y A;  5KCH A;  4N4G A;  3L2Q A;  3LGL A;  2GF7 A;  3NTK A;  3OYK A;  5M9O A;  1WJQ A;  2EQK A;  2L8D A;  5KE3 A;  3OYM A;  4A4F A;  2JTF A;  2DIG A;  2QQS A;  3OYE A;  4E7H A;  4E7J A;  4UC4 A;  2LCC A;  3QKJ A;  4QVZ A;  4A4E A;  2R57 A;  2HQX A;  3MEA A;  3MEU A;  2M1H A;  3NTI A;  2L3R A;  3DLM A;  2MWP A;  3LX7 A;  3OYB A;  4IUV A;  4FU6 A;  4BAC A;  4Z02 A;  5CIU A;  5KCO A;  3S6W A;  2EQM A;  2LDM A;  3KUF A;  2B8A A;  5FRN A;  3H8Z A;  4BE0 A;  1WJR A;  2RHI A;  3UT1 A;  3BDL A;  4C5I A;  2RI2 A;  2VYT A;  4II1 A;  4QQD A;  4N4H A;  3C4S A;  4L59 A;  1OYX A;  4EDU A;  2RJC A;  2BKD N;  2MWO A;  2X4Y A;  2R5A A;  2RI5 A;  4N4I A;  2YRV A;  3L2U A;  4QW2 A; 
#chains in the Genus database with same CATH topology
 2FPF A;  4RTV A;  3VS3 A;  2NLU A;  3ZL7 C;  4M7D C;  1K8A C;  1UB4 A;  3ME9 A;  2OAW A;  2LJ0 A;  3H6Z A;  2CGH A;  2QYZ A;  3I5S A;  1RAI B;  2JW4 A;  1QVG A;  5J3B A;  1WHG A;  4M4Z A;  2WAC A;  2JUF A;  1JEG A;  1R8O B;  3G6E A;  3EGX B;  4J8O A;  4IIO A;  1WFW A;  1TUD A;  1VA7 A;  4HCZ A;  3ZBD A;  3X24 B;  1D09 B;  2M16 A;  4M77 F;  2RJD A;  2ED0 A;  4OGC A;  2QA4 A;  2L89 A;  1Q86 U;  2E64 A;  4FW2 A;  3VS2 A;  3FC3 A;  2NUT B;  4XU2 A;  5J39 A;  1TS9 A;  3LGF A;  2CDT A;  5KYN A;  3OY9 A;  1Z9Z A;  1K73 R;  2HKQ B;  4E7I A;  3WXM B;  2QEX T;  1RLP C;  1M90 U;  3PMT A;  3VS7 A;  3HRT A;  2K3Y A;  1Q7Y U;  5GMK e;  4D8K A;  3E2U A;  1VQK A;  3H0F A;  2DD4 A;  2E1H A;  3EH1 A;  1NJI C;  4FCY A;  5GAN g;  3A8O B;  2E65 A;  3HL8 A;  2X3W D;  1LCK A;  3EHQ A;  3UPU A;  2XID A;  1HXD A;  4LNP A;  2HDA A;  2CZ6 B;  3BY7 A;  4A54 A;  2JTM A;  3AHU A;  2EKH A;  3L2Z A;  3EG9 B;  3VRZ A;  4NL3 A;  1QCN A;  3CCE A;  4M7A D;  2QQS A;  5FRM A;  4PFO A;  3BW1 A;  2L3R A;  1UHC A;  4IUV A;  5GAN 2;  1RAF B;  3X20 B;  3SWN A;  1RAA B;  2H8H A;  4OMP A;  3BDL A;  2EJG A;  1VQM A;  1D0Y A;  1BI1 A;  4JUV A;  5GAN 4;  3CC4 Q;  5CK9 A;  4C5E A;  1X27 A;  1R0C B;  1SHF A;  4M7D B;  1GL5 A;  3H0H A;  1UJY A;  2K79 A;  3JCM J;  5D6X A;  1M5Q 1;  5FWB A;  1VQP T;  3M0T A;  2A36 A;  3RR6 A;  3TSZ A;  1KHC A;  1NM7 A;  2HKN A;  1KD1 C;  1KIK A;  4LUE A;  2EWN A;  4F7U E;  1VQO T;  3CD6 T;  2NWM A;  3SEM A;  4R0K A;  4B9X A;  2QEX A;  3CCL Q;  1Z9Q A;  1ZUY A;  3EH2 A;  5GAO n;  4CC3 A;  3OW2 S;  5GAM g;  2WSE E;  4Q5W A;  1WPY A;  2KE9 A;  1BCO A;  4DQ2 A;  4ESR A;  5IAY A;  3NFC A;  1GFD A;  2QAS A;  3L1A A;  2OTL T;  1D1B A;  1QP2 A;  3RER A;  2EBP A;  2CUB A;  5LJ5 f;  1SF9 A;  1K9M U;  1RAG B;  2YLC A;  4OB0 B;  2EQJ A;  4FSS A;  3E9G A;  4AFS C;  1Y96 A;  3HP9 A;  2ABL A;  3CCV T;  2V1R A;  3L2Q A;  2MYS A;  2GF7 A;  1WI7 A;  4X9C A;  3JB9 J;  1WJQ A;  1QQJ A;  2LCC A;  1WHK A;  2EPD A;  2K5L A;  4JJN K;  4KGV B;  4XQ3 A;  2LMJ A;  3I55 A;  3TQ7 P;  2EGA A;  2B8A A;  4HT8 A;  1M9S A;  2VYT A;  3VRY A;  2KVQ G;  2R5A A;  5LJ5 d;  1YI2 T;  2IPO B;  3L2U A;  1X69 A;  1JXM A;  2O4X A;  5LJ3 f;  4A4G A;  4C0Z A;  4Y28 E;  3PVL A;  4M7A C;  1WGS A;  1OU9 A;  4XTU A;  3CME Q;  1VQP A;  1Q82 U;  4RUG A;  4PJM A;  3VYG A;  4AFU C;  2RI3 A;  1VQ7 Q;  3A98 A;  4CC4 B;  4PJO D;  4FIB A;  4J7I A;  2D9T A;  4D6W A;  3RDV A;  1S72 A;  2RHU A;  1VQO A;  4A4H A;  2KT1 A;  2RNA A;  1AT1 B;  2O4X B;  5IN1 A;  5LJ3 d;  1BK2 A;  3CCS T;  2ED1 A;  1OU8 A;  4F14 A;  1JB0 E;  2RJE A;  3VU3 C;  4OB2 B;  3CC7 Q;  2E6N A;  1YJ9 Q;  1Q81 R;  2X4X A;  1PM3 A;  1VIE A;  5DLO A;  5L23 A;  3VS6 A;  1FWZ A;  1VIF A;  3RMQ A;  2YXY A;  5GAO r;  1I81 A;  2OTL A;  4Z88 A;  1BI3 A;  2QDY B;  1UTI A;  4MZM A;  3JCM e;  3CCQ A;  1ARK A;  2AZS A;  2D8J A;  3EFO A;  2C0T A;  3TVT A;  4ZGE B;  4M75 C;  1NLO C;  2RJF A;  1G2B A;  2CH4 W;  4M78 A;  3RBB B;  1G3S A;  4N4G A;  2ZPB B;  3KFV A;  2L8D A;  4IKF A;  2DL7 A;  2OX7 A;  2CP3 A;  5A0L A;  1X43 A;  3NTI A;  4M7D E;  2IVW A;  3I56 A;  3DLM A;  3GP8 A;  2O2O A;  3D7S B;  4KT0 E;  1M4Z A;  5CQY A;  3JAM E;  4KH1 B;  1K8A R;  2KGT A;  2PTK A;  4TVR A;  2GQI A;  5D7U A;  4BE0 A;  3UA6 A;  4II1 A;  4N4H A;  1ACM B;  5IHI A;  3KBG A;  1MMG A;  2M9U A;  5KYY A;  4K11 A;  3DLL A;  2FL7 A;  1W2B A;  2RM4 A;  2CS7 A;  5FWC A;  4DBR A;  3L42 A;  1KHI A;  3NHN A;  3G7Z A;  2ESW A;  2YSQ A;  1QVF A;  3C94 A;  3CCR T;  3HSB A;  1YIT A;  4M7A B;  2CZ1 B;  4GLK A;  1WA7 A;  2VV5 A;  5FRO A;  2NUP A;  1H8K A;  5IHK A;  5FW9 A;  4C8Q G;  1N8R C;  2PQW A;  5L8R E;  1O75 A;  4XU1 A;  1X6B A;  1NJI R;  2M0Y A;  4AFQ C;  1VQ4 Q;  2OJ2 A;  2PUK B;  1N5Z A;  2XI9 A;  2JTE A;  4M7A G;  1BYM A;  1WJS A;  3JV3 A;  1UGQ B;  2CP0 A;  3QYH B;  1WQ7 A;  1UGR B;  5A2Q E;  4PJO C;  3HRU A;  2CZ7 B;  1RAB B;  1C0M A;  4M77 A;  3M57 A;  3CCJ T;  1ZLM A;  3FDR A;  4E6R A;  2LCS A;  2V26 A;  2CP5 A;  2LJ3 A;  2O9S A;  2FRW A;  5CCA A;  1XNI A;  1PCX A;  3PGG A;  4M75 B;  4PNO A;  2KEA A;  5IXB A;  2KI7 A;  2K9G A;  1M3B A;  3OYE A;  3MJX A;  1OQK A;  1MV0 B;  2K5I A;  4PFZ A;  4FSX A;  2KQW A;  3A1P A;  2MIO A;  1YJW T;  2COY A;  1MV3 A;  2CSI A;  4E7S A;  2VGN A;  4PJN A;  1OUL A;  2HMA A;  3G71 Q;  2EVR A;  2DZ9 A;  1W70 A;  2RI2 A;  2HD0 A;  1MMA A;  2LJ1 A;  1VQN T;  4AG2 C;  4X34 A;  2FZG B;  2MOX A;  2ZCF B;  3SD4 A;  1KD1 R;  1YJN Q;  2H3E B;  1AZE A;  1HK9 A;  3OS0 A;  2EYW A;  4KUL A;  1QKX A;  4MML A;  1YIJ Q;  3CEY A;  3MCA B;  4RTY A;  1FMW A;  2KRS A;  3CCU Q;  3S3N A;  4ZN1 A;  2DXU A;  2K3B A;  4QQG A;  1EX4 A;  2FG0 A;  1VQ6 T;  1KQ1 A;  4A63 B;  5GAN f;  2DRK A;  2V8I A;  2ZPE B;  1KC8 C;  1VQ5 Q;  2HQH A;  3J80 E;  3CC2 Q;  2P4R A;  4R56 A;  2EFI A;  4JDS A;  2L5Q A;  3ZEH A;  2L3P A;  4EPC A;  3OYL A;  2LTO A;  4C0D C;  4FT4 A;  1WHH A;  1VQ8 Q;  3FB9 A;  3DKM A;  4RTW A;  2DL4 A;  2QTV A;  1WYX A;  2DEU A;  5IXF A;  3EG3 A;  1QWF A;  3HTR A;  3GOX A;  4PJO B;  5CVI A;  1JJ2 S;  4FYV B;  2RD1 A;  2GNC A;  4BI8 B;  2YUQ A;  3FLG A;  4QQ6 A;  1UGP B;  5GAN d;  3JCM V;  3PT9 A;  5KCH A;  1FX7 A;  5LJ5 h;  3RKX A;  2QTX A;  2VAS A;  4KUI A;  5KE3 A;  3GIB A;  2JTF A;  1AOJ A;  4E2F B;  4UC4 A;  4C8Q F;  4EMH A;  3CC4 A;  5LJ5 j;  3LX7 A;  4FU6 A;  3G1J A;  1VQK T;  2KT8 A;  3QWX X;  1GRI A;  5KCO A;  4JJC A;  1KG1 A;  2HZY A;  3UT1 A;  2A7Y A;  4BY6 C;  1U5S A;  3C4S A;  4EDU A;  2E3H A;  2BKD N;  1ZA1 B;  3QYG B;  2EQU A;  1RAE B;  3CXC S;  3RES A;  3JB9 D;  5KYX B;  5LL6 S;  1SSF A;  3UF4 A;  3CCE T;  5LJ3 h;  4JS4 A;  2KAF A;  3P8B B;  2DRM A;  4F7U G;  5LJ3 j;  4PLL A;  3NPF A;  3FRN A;  1Y07 A;  2XDP A;  1M90 C;  2X4W A;  1VQ6 A;  3OBW A;  1VQM T;  1M1K U;  3ULR B;  1Q7Y C;  3V7S A;  2QQ9 A;  4XU3 A;  3DB4 A;  1O9S A;  3J81 E;  2O9V A;  1X2Q A;  5CQX A;  1QVG S;  2CP2 A;  3SWN C;  4P5N A;  1QCO A;  1VQ9 T;  1SSH A;  3RKY A;  4M75 E;  3QXE B;  2C0I A;  1SRL A;  3OYF A;  4HA8 A;  1X6O A;  1Q81 U;  1YWO A;  2DE0 X;  4C92 C;  3CBO A;  3OB9 A;  3CMA Q;  1OPL A;  2DBM A;  1NLP C;  2BE7 D;  4C0D B;  3TSW A;  4LDU A;  1BIB A;  1KQS S;  2QQR A;  3QBY A;  1QKW A;  3MP8 A;  4J9B A;  2DTO A;  3CCR Q;  3CPF A;  3CCM Q;  3LGL A;  1NYF A;  4JZ3 A;  2RA2 A;  1QWE A;  4A4F A;  1BIA A;  4BDY A;  4F04 B;  1AZG B;  4EIK A;  4JRI A;  4M78 D;  1NYG A;  3CME A;  5CKH A;  1VQL T;  3JCM g;  1E7O A;  1R77 A;  1LNX A;  2LC4 A;  4XTY A;  2QK0 A;  1WX6 A;  3CPW A;  4JRP A;  4DBQ A;  1VQ7 A;  3NMZ C;  1SPK A;  4WF2 A;  3S3M A;  3M4Y A;  2F5T X;  2R5M A;  5IT9 E;  3DB3 A;  2XIC A;  3BDU A;  4RCB A;  1CSK A;  2J05 A;  1N8R R;  1S1N A;  2YWW A;  3I55 T;  1ZBJ A;  2DIQ A;  1UUE A;  3CC7 A;  1SHG A;  1IGU A;  4LN2 A;  3OYC A;  5FU6 C;  3OYG A;  4LDW A;  3A8G B;  4J6X A;  1D0Z A;  1NG2 A;  4C92 A;  1WDX A;  4PKC C;  1IRE B;  4PJO E;  4FL6 A;  4QT7 A;  4EMK C;  1R0B G;  2AKK A;  1N27 A;  2JNG A;  3OSS C;  1VQ9 A;  2PUO B;  5GMK i;  4BD3 A;  1G5V A;  3EAE A;  2A0F B;  1T3S A;  4RMO A;  1KFZ A;  4LDV A;  3SWN B;  2KYM A;  4ORZ A;  2G6F X;  1PKT A;  4OGE A;  4C0F A;  3BFM A;  2K3X A;  1IXD A;  2RQR A;  2QDL A;  3G4S A;  1S72 T;  2E5Q A;  3OYJ A;  3LYI A;  5KE2 A;  1XQH A;  2K7A A;  2PVD B;  1NE8 A;  4M75 D;  2QG9 B;  1WLP B;  3VKI A;  5FU7 C;  2AHJ B;  4M7D G;  1U06 A;  2P0Q A;  5I11 A;  1CKA A;  4F7U F;  3M56 A;  2YRC A;  3EFS A;  1TOV A;  2EGC A;  3QPH A;  3JB9 H;  4XTX A;  1BI2 A;  3RKW A;  4M77 D;  5HY6 A;  3VS0 A;  1IGQ A;  2DIG A;  4OMM A;  2OTJ A;  2R57 A;  1U8R A;  3JCM W;  1PHT A;  4BI4 A;  1YBY A;  2LT1 A;  2SEM A;  3H9N A;  3HHT B;  1VQL A;  2LQK A;  3RMS A;  2KRN A;  3CCQ T;  1G3Y A;  5HK0 A;  4QQD A;  1VUB A;  2L3Q A;  2YRD A;  1Q82 C;  3A8H B;  2DXC A;  1QW1 A;  3M54 A;  3HFO A;  3P8H A;  1TG0 A;  1B34 A;  4EMK A;  2H3J A;  3G6E Q;  4KUD K;  4HT9 A;  2MCN A;  1WXB A;  4MMK A;  3I56 T;  4ME7 A;  2KK4 A;  5GAN 7;  2X35 A;  1XJW B;  4M78 C;  2QA4 Q;  1BB9 A;  1KC8 R;  1I07 A;  2W0Z A;  2PZ1 A;  4OB3 B;  1YHQ Q;  1TH7 A;  1Y96 B;  5FU6 B;  1H3Z A;  1KK7 A;  3GNG A;  1I1J A;  4N0A A;  4LXC A;  1ZUK A;  4XK8 E;  6AT1 B;  4AT1 B;  2JMC A;  4VUB A;  3VS1 A;  2JXB A;  3QDF A;  3EGU A;  1OV3 A;  2COZ A;  1YIT T;  5GAN h;  5HKC A;  1AD5 A;  2DPP B;  5GAN j;  2KNB B;  4C0G A;  5CKE A;  3X26 B;  3QZ5 B;  2KY9 A;  1G8X A;  1HD3 A;  4F16 A;  3M4G A;  2A37 A;  3A8L B;  1QP3 A;  2RMO A;  3QUI A;  3PVQ A;  5FU7 B;  3CCE Q;  2PVG B;  2LNH B;  1GFC A;  2QQB A;  5M9O A;  2HAX A;  2DJZ A;  1RUW A;  4ZGJ B;  2KR3 A;  3TRE A;  2HNI A;  2KSS A;  3TEE A;  4OP0 A;  2LDM A;  4J9F A;  2FYK A;  5DM7 R;  1YJN A;  2RQT A;  4NL2 A;  2RJC A;  1UGV A;  1M8V A;  1WZO A;  1YIJ A;  3E9F A;  2SRC A;  3E19 A;  3CCU A;  4M77 C;  1M90 R;  2DIL A;  2JMA A;  4OML A;  4Z89 A;  1B07 A;  4J9H A;  1Q7Y R;  2FEI A;  4C8Q A;  3EGD A;  4RTT A;  3OA6 A;  4HCC A;  2B86 A;  3JCM Q;  4M7D F;  3EFO B;  1JRI A;  4J9G A;  2RH2 A;  5CAI A;  3M0Q A;  2RO0 A;  5KYU A;  1VQ5 A;  3R6N A;  1JJ2 P;  3JCM b;  3C0C A;  4RG2 A;  2F1L A;  3CBP A;  3L2R A;  1A0N B;  4M78 B;  3MEV A;  3FEO A;  4RKU E;  1RLQ C;  2GQV A;  2QEX Q;  4C92 E;  2BZY A;  2XU8 A;  5GAM h;  1W2B S;  5J26 A;  4FW1 A;  2LP5 A;  3VV0 A;  4PLI A;  1MMN A;  5AYF A;  1QVF S;  3KXT A;  1M2V A;  4HCB A;  5GAM j;  2LNV A;  1UJ0 A;  1YWP A;  3OS2 A;  2DL3 A;  2MMP A;  4GLM A;  4RTU A;  1TXQ A;  4DOV A;  2JM8 A;  5DY9 A;  1EFN A;  2J6K A;  1T0J A;  2LRQ A;  1Y71 A;  1K76 A;  2EGE A;  2EIF A;  3URG A;  2Y4Y A;  5KYY B;  1FXX A;  4Z8A A;  1TUG B;  2AZV A;  2EYX A;  3PFS A;  2RK2 A;  3EHR A;  2PU9 B;  3FJ5 A;  2DMO A;  2JT4 A;  3CXC P;  1H64 1;  2JJ9 A;  5GAN 5;  2KXD A;  2FHD A;  1M3A A;  2DVJ A;  3E1S A;  2LQW A;  4ATO A;  2D8H A;  1K73 U;  1T3L A;  2MAM A;  3FJP A;  4E7H A;  2DF6 A;  3VYH B;  1C1A A;  2GTO A;  3QKJ A;  2NUP B;  2KRO A;  2BTT A;  1G83 A;  1AWJ A;  2E5K A;  3QWY A;  4Y92 A;  4FYW B;  2DYI A;  2P84 A;  4JZ4 A;  3A8M B;  2YRV A;  2VUB A;  2P4T A;  3VS5 A;  1QVG P;  2HBW A;  1DJ7 B;  2KXC A;  2DZC A;  4OB1 B;  2P0K A;  4IUP A;  1VQP Q;  2IG0 A;  1T0H A;  3WVD B;  2G3R A;  3CC4 T;  4M77 B;  4XTZ A;  2JZ2 A;  1AWO A;  4KGZ B;  2GFU A;  1V29 B;  1VQO Q;  3CD6 Q;  1OOT A;  1N9S A;  1KQS P;  1LVK A;  1TWB A;  1OZ2 A;  4AFZ C;  3L2W A;  3MO8 A;  4KH0 B;  4M75 G;  2CT3 A;  3CMA A;  3V7C A;  2F69 A;  2GGR A;  2CRE A;  3Q1J A;  3H0I A;  1TTH B;  1KSW A;  3OS1 A;  3M0U A;  3ASK A;  2OTL Q;  3T9N A;  4C92 D;  3PIO A;  2HSE B;  4LDY A;  3CCQ Q;  3CCM A;  2PVO B;  4J83 A;  2DFU A;  4ZNX A;  4YTL A;  2K2V A;  3O5Z A;  1K0S A;  3CCV Q;  1ZSZ A;  1D3B A;  1IB8 A;  3GF5 A;  3JCM X;  1IHV A;  2YUP A;  2X51 A;  2AKL A;  4A4K A;  1GCQ A;  4XAX B;  1Q82 R;  1VYU A;  2W10 A;  4GBQ A;  4B6M A;  2CSQ A;  4X9D A;  1WXT A;  3LWH A;  1V76 A;  2RQU A;  5EC7 A;  3GNF B;  1Y57 A;  2ZPH B;  5I22 A;  1YI2 Q;  3EFR A;  1LOJ A;  2Y4X A;  2DEQ A;  3UAT A;  2CYZ B;  3C95 A;  4HVV A;  2VWF A;  4CC7 A;  2D1X A;  2E12 A;  2KDS A;  3I9Q A;  4M78 E;  2Y90 A;  2AT1 B;  1HJD A;  4C5G A;  1QMC A;  4F7U A;  4MDX A;  3L2V A;  5KH6 A;  3RIR A;  2DL8 A;  2WSC E;  4C5H A;  1M1K C;  1BI0 A;  4PK4 A;  3V8J A;  1EIF A;  3CBM A;  3JCM P;  4DOW A;  2F2V A;  4PJO G;  3FIF A;  4PJJ A;  1ZSG A;  2NUZ A;  3CCS Q;  3CME T;  3JRZ A;  3M53 A;  4HVU A;  4M7A F;  1BU1 A;  2COW A;  3QG1 A;  2HL3 A;  5D6W A;  4IUT A;  1KC8 U;  2RQW A;  1VQ7 T;  3OW2 P;  2K6D A;  3MKD A;  3S3O A;  3MET A;  2ENM A;  1Q86 C;  2DA9 A;  3ER0 A;  1D1A A;  1ZX6 A;  2MPX C;  1I8F A;  7AT1 B;  3CQT A;  5GAO m;  2MF2 A;  4J6Y A;  3CCL A;  1YNZ A;  4J9E A;  3VS4 A;  2M02 A;  1NZ9 A;  3CXC A;  4ZGD B;  5GAM f;  1W4S A;  4JRQ A;  3CC7 T;  2ATC B;  5LJ5 e;  1YJ9 T;  1U1T A;  2EQI A;  3JB9 I;  1RL2 A;  4HCK A;  4DEY A;  2O88 A;  3EGX A;  2HQE A;  3AT1 B;  5DLQ E;  1E6H A;  8ATC B;  5GAN 3;  2JM9 A;  1C6V X;  1PSF A;  1MND A;  3EG1 A;  2ZGW A;  3M9Q A;  4JJB A;  4ELZ C;  5GMK h;  1LPL A;  1PG5 B;  1NEB A;  5GMK m;  4LUD A;  2NUT A;  1X2K A;  2CZ0 B;  2RB6 A;  5GMK j;  5GAM d;  1V1C A;  1OX9 A;  4M75 F;  1VOM A;  4BAC A;  4OMO A;  4HXJ A;  3RNJ A;  4M77 E;  3G4S T;  5LJ3 e;  2EQM A;  2DBK A;  5IHN A;  3KUF A;  2A08 A;  2RI5 A;  1H3H A;  1K0X A;  4J6W A;  1QVP A;  1VYT A;  1X75 C;  1RAC B;  1KQS A;  2KBT A;  1YHQ A;  4J9D A;  4MDW A;  5I21 A;  1Y7X A;  2OTJ T;  3F70 A;  4WCI A;  4JRK A;  1U3O A;  2BE9 B;  4AMC A;  1UE9 A;  3EG9 A;  2DJQ A;  4NS5 A;  2K57 A;  2RHX A;  2KYB A;  1K8A U;  2VKN A;  3OMC A;  4BY6 B;  4IUR A;  1AHJ B;  4J7F A;  3CPW S;  2XK0 A;  4CI0 C;  4E7L A;  3QII A;  3PNW C;  4C8Q D;  1YN8 A;  4A53 A;  5AT1 B;  3M0R A;  2RF0 A;  5EG2 A;  1PD1 A;  2D0N A;  2LX9 A;  3CCJ Q;  2E4H A;  1YJ9 A;  3MHX A;  4M7D A;  1VQ4 T;  1BKB A;  2XDD A;  3R6O A;  1KJW A;  1SRM A;  4E7K A;  2HEQ A;  4MZP A;  3OYI A;  1HYO A;  5CKF A;  2J06 A;  2WSF E;  1NPP A;  1PRM C;  1XOV A;  4PJO F;  3V8L A;  2ROL A;  2DET A;  1VYV A;  1M3C A;  1FMV A;  1NJI U;  1YJW Q;  1K9M C;  2VGM A;  2QXF A;  2CP7 A;  1WHM A;  3JSC A;  1ABO A;  4E7J A;  4A4E A;  4N0A C;  2M1H A;  4O5V A;  2OI3 A;  2GCX A;  2FB7 A;  4C92 B;  3OYB A;  1BCM A;  4JLI A;  2JVV A;  1VQN Q;  1SEM A;  2JS0 A;  5GAN 8;  1EZZ B;  2HSP A;  1WJR A;  2I0N A;  1MGQ A;  4C5I A;  1W2B P;  2EYQ A;  4L59 A;  2FZK B;  1W1F A;  4E47 A;  2DKG A;  1GBQ A;  1QVF P;  2O01 E;  2L3S A;  1W6X A;  4OVA A;  3M0P A;  3G71 T;  5GJW B;  2QGG A;  2DXB A;  4GY5 A;  1WHL A;  9ATC B;  1N6A A;  2AIR B;  2EKO A;  3GBQ A;  3LWI A;  2M51 A;  5CO7 A;  1ZQ1 A;  2LQ8 A;  2BZ8 A;  3OW2 A;  2DYB A;  1AVZ C;  2KRM A;  1ZA2 B;  4LD6 A;  4C92 G;  5GAO q;  2YLB A;  3V7R A;  3M58 A;  2ROT A;  2NYS A;  1WIE A;  4J5Y A;  1VQ6 Q;  2FRY A;  2IIM A;  2QI2 A;  2J7I A;  3OBY A;  2HCK A;  3QJ6 A;  5HCK A;  1YJN T;  2O31 A;  2X4J A;  5C6S A;  1YIJ T;  2DTH A;  4BI3 A;  2R58 A;  3CCU T;  1F1B B;  2V8J A;  1OI1 A;  2ECZ A;  1PSE A;  2DL5 A;  1I0C A;  4ZTF A;  1K4U S;  2HBP A;  2VC8 A;  1KD1 U;  1VQ4 A;  5CR2 A;  2EYY A;  1X01 A;  3QHS A;  3PE0 A;  4IUU A;  1VQ5 T;  3OSV A;  1G3W A;  3CC2 T;  2CP6 A;  1OZ3 A;  4JS5 A;  3SB2 A;  2CT4 A;  2C06 A;  1ZUU A;  1PNJ A;  2ZAE A;  2HL5 C;  1YCS B;  4XTW A;  4C8Q C;  3NTH A;  1B34 B;  4EMK B;  4MZT A;  1VQ8 T;  3MP6 A;  3I5R A;  3PIP A;  2XMF A;  3P8D A;  2X3X D;  5D6Y A;  3SDZ A;  1VQK Q;  2J6F A;  3HPW A;  3UA7 A;  4L6V 5;  2EQK A;  1ABQ A;  4OF1 A;  2FVU A;  3LW5 E;  4PJL A;  4Y91 A;  3JCM h;  2CUD A;  3THK A;  2MWP A;  1GBR A;  1I5O B;  2E3I A;  5CIU A;  1RAD B;  2V8K A;  1JU5 C;  2E6Z A;  2YUO A;  2RHI A;  1M1K R;  1UDL A;  1X6G A;  2FO0 A;  4N4I A;  3G71 A;  4NOY A;  2V1Q A;  4F17 A;  2DX1 A;  3JB9 G;  3NGP A;  4BDZ A;  3CD6 A;  2DNU A;  5CKD A;  2JN0 A;  3OQ5 A;  3VUB A;  1N9R A;  2AK5 A;  2CH4 A;  2EAY A;  2I2L A;  4LDX A;  2E10 A;  2GFA A;  1VQM Q;  1H92 A;  2GBQ A;  1Q86 R;  4FT2 A;  3MP1 A;  3TU4 K;  5GAN e;  4B9W A;  3X25 B;  1J3T A;  1JXO A;  3PMI A;  5C0M A;  4J9C A;  2VXF A;  3OS5 A;  2A28 A;  2BZX A;  3SFM A;  3OYA A;  1VQ9 Q;  4CC2 A;  1M8M A;  1ZBX A;  3M59 A;  2E70 A;  4RTX A;  2XD0 A;  1IRX A;  4BB7 A;  4LE9 A;  3CCV A;  2BUD A;  1G3T A;  3O8V A;  2L2P A;  5IH2 A;  2K2M A;  3RUX A;  1UG1 A;  3G4S Q;  2DAQ A;  2M0O A;  3INZ A;  3CC2 A;  1M2O A;  1M1G A;  5KYW A;  1K73 C;  4JLG A;  3QSU A;  4M7A A;  2ZZD A;  3GPL A;  3HRS A;  1VQ8 A;  4AG1 C;  4FYX B;  1RI9 A;  2D6F A;  3LH0 A;  3CMA T;  1RI0 A;  2F2W A;  4C92 F;  1YI2 A;  1NPR A;  1E6G A;  3VJP A;  3QZ9 B;  2X9H A;  4OMN A;  4C8Q B;  4IUQ A;  3EGD B;  1MNE A;  2MK5 A;  2OTJ Q;  2RPN A;  3NTK A;  2PNI A;  1U1S A;  5KYU B;  4OMF B;  3OYM A;  3BE3 A;  2QGF B;  1IZ6 A;  1UFF A;  2RK1 A;  2YUN A;  4KRT A;  4XU0 A;  1VQL Q;  5CKB A;  2OAU A;  1NBE B;  1TUC A;  3QDR B;  3CCM T;  4M78 G;  1PD0 A;  5KYW B;  2XDB A;  2J6O A;  5LJ5 g;  3OYY A;  5HK3 A;  1OPK A;  8AT1 B;  2DK3 A;  4DEX A;  1UEC A;  2MI6 A;  2FPD A;  1M2V B;  3M55 A;  4HVW A;  2LCL A;  1PWT A;  4FYY B;  2Z0W A;  3PTA A;  3ZFJ A;  5GAN 6;  3CCS A;  3OYN A;  3X28 B;  3I55 Q;  4OMQ A;  3N5B B;  2RHZ A;  5GAM e;  3I35 A;  2DXT A;  4J9I A;  1ZSZ C;  2ZPG B;  1BBZ A;  2DLP A;  2F2X A;  2K5F A;  3M0S A;  2DM1 A;  2D0Q B;  1ZHI A;  4M75 A;  1PC0 A;  3V8K A;  5GAO p;  5LJ3 g;  3OYH A;  1NEG A;  2E41 A;  4X1V A;  4DBH A;  1GCQ C;  1FYN A;  2C0O A;  1OX8 A;  3JCM c;  2JS2 A;  3J7A F;  2DVE A;  2LVM A;  2RHY A;  4JJD A;  1UEB A;  3LLR A;  3A5Z B;  1IHW A;  5ECA A;  1S72 Q;  2GTJ A;  1P92 A;  2QAZ A;  2YT6 A;  2LT4 A;  1N8R U;  3JB9 F;  1MUZ A;  1LJO A;  1TSF A;  1M30 A;  4WTO B;  3MPU B;  4XTV A;  1AWX A;  5GJV B;  1K9M R;  4ZTJ A;  1PKS A;  1D0X A;  1PRL C;  4R55 A;  3REB B;  3UDC A;  2RQV A;  1Q95 G;  2LZ6 B;  4PL6 A;  2XG8 D;  4RCC A;  4KGX B;  4M7D D;  1I5L A;  1M1F A;  4M77 G;  3CCL T;  3QO3 A;  1GXI E;  1I4K 1;  2EJF A;  3HFN A;  1HSQ A;  1QCF A;  3CCR A;  4V2S A;  4QVZ A;  4QVC A;  1WNL A;  4LD9 K;  1QLY A;  2A3L A;  2ZPI B;  4Z02 A;  4HKE A;  1D1C A;  2LX7 A;  2ZPF B;  3M5A A;  4EMG A;  3CPW P;  1WQW A;  1B3Q A;  1SG5 A;  2MWO A;  1UGS B;  2X4Y A;  2YHT A;  3WVE B;  3JCM f;  2RN8 A;  1M27 C;  3I56 Q;  4PJO A;  4JPB W;  2P0P A;  2L0A A;  2BIV A;  4QVD A;  4IIM A;  5A0G A;  5I2S A;  4E7Z A;  4BE1 A;  1JQQ A;  4BE2 A;  1RAH B;  2YDL A;  4KBM B;  3LH5 A;  3SHW A;  1KQ2 A;  2DTI A;  1K1Z A;  1ZSZ B;  1D3B B;  1IO6 A;  1SKU B;  2DO3 A;  3UWN A;  3C12 A;  3G6E T;  1K9A A;  2XKO C;  3H41 A;  1YFN A;  2CKK A;  1OEB A;  3REA B;  2EJ9 A;  3CCJ A;  4BUG A;  3JCM d;  1JJ2 A;  2QA4 T;  1Y0M A;  2FZC B;  5GAO l;  4FM4 B;  4PFP A;  1YIT Q;  1WXU A;  2F5K A;  2QQA A;  4M78 F;  1MMD A;  1YHQ T;  1GCP A;  2VXE A;  2EYZ A;  2EW3 A;  3OYD A;  3OMG A;  3MEW A;  4C8Q E;  5A0D A;  2DER A;  3GLX A;  1UHF A;  4DA4 A;  4ZN3 A;  4L5G A;  5KYX A;  3EG2 A;  2DD5 A;  2VVK A;  1YJW A;  1CKB A;  3HKS A;  1MHN A;  1YCY A;  1Q81 C;  4RG8 A;  2KMT A;  4F7U B;  1JO8 A;  2XHC A;  5FLX E;  4M7A E;  1WHJ A;  5GMK l;  4CRI A;  4O6J A;  1VQN A;  1B7T A;  4ANJ A;  2K4Y A;  1XTD A;  1YP5 A;  3VUZ A;  3OYK A;  4ELY C;  1TU0 B;  2JOY A;  4RTZ A;  2HQX A;  3MEA A;  3MEU A;  3U23 A;  2LQN A;  4D8D A;  4QKU A;  3EG0 A;  3QJY A;  3S6W A;  5I2M A;  2FPE A;  1AWW A;  5FRN A;  3H8Z A;  1JBM A;  2VB6 A;  3IQL A;  1OYX A;  4DBF A;  1AEY A;  3TCJ A;  4QW2 A;  1FMK A; 
#chains in the Genus database with same CATH homology
 1YIJ A;  1VQN T;  2O01 E;  4OVA A;  2NLU A;  3E9F A;  3E19 A;  4M7D C;  3G71 T;  4X34 A;  1UB4 A;  1K8A C;  3ME9 A;  3CCU A;  2DXB A;  4GY5 A;  3H6Z A;  2CGH A;  1N6A A;  4M77 C;  1QVG A;  2EKO A;  5J3B A;  3LWI A;  2WAC A;  2ZCF B;  2JUF A;  3SD4 A;  5CO7 A;  1ZQ1 A;  1R8O B;  2LQ8 A;  3OW2 A;  4C8Q A;  4LD6 A;  3OA6 A;  4C92 G;  3G6E A;  3JCM Q;  5GAO q;  4HCC A;  1HK9 A;  2YLB A;  4J8O A;  3V7R A;  1JRI A;  3OS0 A;  4KUL A;  4M7D F;  2RH2 A;  3M58 A;  4MML A;  4HCZ A;  3ZBD A;  5CAI A;  4J5Y A;  3CEY A;  3X24 B;  2RO0 A;  3MCA B;  1VQ5 A;  2QI2 A;  3JCM b;  2M16 A;  3OBY A;  2RJD A;  4M77 F;  4RG2 A;  3CBP A;  4OGC A;  3QJ6 A;  3L2R A;  3S3N A;  4M78 B;  4ZN1 A;  1YJN T;  3MEV A;  2DXU A;  2QA4 A;  3FEO A;  4RKU E;  2L89 A;  4QQG A;  1Q86 U;  2GQV A;  2E64 A;  2X4J A;  4C92 E;  5C6S A;  2XU8 A;  1YIJ T;  5GAM h;  1VQ6 T;  1W2B S;  3FC3 A;  2DTH A;  4XU2 A;  1KQ1 A;  5J26 A;  4BI3 A;  5J39 A;  3LGF A;  2R58 A;  3CCU T;  5GAN f;  3VV0 A;  2V8I A;  2ZPE B;  2V8J A;  4PLI A;  1OI1 A;  3OY9 A;  1KC8 C;  5AYF A;  1QVF S;  1PSE A;  3KXT A;  4HCB A;  5GAM j;  2LNV A;  4E7I A;  4ZTF A;  3WXM B;  2QEX T;  3OS2 A;  1M90 U;  2HBP A;  3J80 E;  2MMP A;  3PMT A;  4R56 A;  2EFI A;  4JDS A;  3HRT A;  2K3Y A;  2VC8 A;  1VQ4 A;  1KD1 U;  5CR2 A;  2L5Q A;  4DOV A;  3ZEH A;  5DY9 A;  1Q7Y U;  5GMK e;  2LRQ A;  1X01 A;  3QHS A;  1Y71 A;  4EPC A;  2EIF A;  4IUU A;  3URG A;  3OYL A;  2LTO A;  4C0D C;  1VQ5 T;  3OSV A;  2Y4Y A;  1VQK A;  1G3W A;  4FT4 A;  2DD4 A;  2E1H A;  3FB9 A;  3DKM A;  1NJI C;  3CC2 T;  1OZ3 A;  4JS5 A;  3SB2 A;  5GAN g;  3A8O B;  3GOX A;  2E65 A;  1FXX A;  4PJO B;  2C06 A;  5CVI A;  3HL8 A;  1JJ2 S;  3UPU A;  2XID A;  2RD1 A;  1HXD A;  4XTW A;  3PFS A;  2RK2 A;  4BI8 B;  2PU9 B;  3NTH A;  4C8Q C;  1B34 B;  2CZ6 B;  3FLG A;  3BY7 A;  4MZT A;  4QQ6 A;  1H64 1;  1UGP B;  2JTM A;  3MP6 A;  4A54 A;  5GAN d;  1VQ8 T;  5GAN 5;  2FHD A;  3AHU A;  3JCM V;  3PIP A;  3PT9 A;  3P8D A;  5D6Y A;  3SDZ A;  3E1S A;  5KCH A;  1FX7 A;  3L2Z A;  4ATO A;  1K73 U;  5LJ5 h;  2MAM A;  3FJP A;  3HPW A;  4NL3 A;  4L6V 5;  3RKX A;  2QTX A;  4KUI A;  2EQK A;  5KE3 A;  4E7H A;  3GIB A;  2JTF A;  4OF1 A;  2QQS A;  3VYH B;  2FVU A;  3LW5 E;  4UC4 A;  3QKJ A;  4C8Q F;  3CCE A;  4EMH A;  5FRM A;  3BW1 A;  3JCM h;  4Y91 A;  3CC4 A;  2L3R A;  5LJ5 j;  2MWP A;  3LX7 A;  4IUV A;  4FU6 A;  1VQK T;  5CIU A;  5GAN 2;  5KCO A;  2V8K A;  3X20 B;  1KG1 A;  2E6Z A;  3SWN A;  2RHI A;  3A8M B;  2A7Y A;  3BDL A;  3UT1 A;  4BY6 C;  2EJG A;  3C4S A;  4EDU A;  2BKD N;  1VQM A;  4N4I A;  3G71 A;  2YRV A;  4NOY A;  2VUB A;  2P4T A;  1BI1 A;  4JUV A;  3QYG B;  5GAN 4;  2EQU A;  3JB9 G;  5CK9 A;  1DJ7 B;  4BDZ A;  3CD6 A;  2DZC A;  4OB1 B;  4C5E A;  3CXC S;  5CKD A;  2JN0 A;  3RES A;  3OQ5 A;  3JB9 D;  2P0K A;  5LL6 S;  4IUP A;  3VUB A;  1SSF A;  2IG0 A;  4M7D B;  1N9R A;  3WVD B;  3CCE T;  5LJ3 h;  2EAY A;  2I2L A;  4JS4 A;  2G3R A;  4LDX A;  3CC4 T;  4M77 B;  4XTZ A;  2E10 A;  2KAF A;  2GFA A;  2JZ2 A;  3P8B B;  5D6X A;  3JCM J;  4M7D E;  1M5Q 1;  2GFU A;  1VQP T;  4F7U G;  5LJ3 j;  4FT2 A;  3MP1 A;  1V29 B;  4PLL A;  3TU4 K;  3FRN A;  5GAN e;  4B9W A;  1N9S A;  1Y07 A;  3X25 B;  2XDP A;  1M90 C;  2X4W A;  1KHC A;  1VQ6 A;  1OZ2 A;  3PMI A;  3OBW A;  1KD1 C;  5C0M A;  3L2W A;  1VQM T;  1M1K U;  1Q7Y C;  2VXF A;  3MO8 A;  3OS5 A;  3V7S A;  2QQ9 A;  3SFM A;  4XU3 A;  2EWN A;  3DB4 A;  4M75 G;  3OYA A;  4F7U E;  3CMA A;  1O9S A;  1VQO T;  1ZBX A;  3M59 A;  3J81 E;  3CD6 T;  3V7C A;  2F69 A;  4B9X A;  2E70 A;  5CQX A;  2QEX A;  2XD0 A;  1QVG S;  3Q1J A;  4BB7 A;  3CCV A;  2BUD A;  3SWN C;  4P5N A;  3OS1 A;  1G3T A;  5GAO n;  3ASK A;  3OW2 S;  3O8V A;  5GAM g;  1VQ9 T;  2WSE E;  4Q5W A;  3RKY A;  3T9N A;  4C92 D;  4M75 E;  3QXE B;  1WPY A;  3PIO A;  3OYF A;  4LDY A;  4HA8 A;  3RUX A;  1X6O A;  1Q81 U;  2DAQ A;  2M0O A;  4C92 C;  4DQ2 A;  3INZ A;  3CBO A;  3CC2 A;  3OB9 A;  3CCM A;  5IAY A;  3NFC A;  2PVO B;  1M1G A;  1K73 C;  4JLG A;  3L1A A;  4J83 A;  2OTL T;  1QP2 A;  4C0D B;  4YTL A;  3QSU A;  4M7A A;  4LDU A;  2K2V A;  2ZZD A;  3RER A;  3GPL A;  3HRS A;  1BIB A;  1VQ8 A;  1KQS S;  2QQR A;  1D3B A;  3GF5 A;  3JCM X;  2D6F A;  3LH0 A;  3CMA T;  5LJ5 f;  1RI0 A;  4C92 F;  1K9M U;  3QBY A;  1YI2 A;  2YLC A;  1NPR A;  3VJP A;  4OB0 B;  2EQJ A;  3MP8 A;  3QZ9 B;  2DTO A;  3E9G A;  4C8Q B;  4IUQ A;  1Y96 A;  3HP9 A;  3CCV T;  3CPF A;  3L2Q A;  4A4K A;  3LGL A;  2GF7 A;  3NTK A;  4X9C A;  3JB9 J;  2RA2 A;  1U1S A;  1WJQ A;  4OMF B;  4XAX B;  3OYM A;  4A4F A;  1BIA A;  1IZ6 A;  2LCC A;  2RK1 A;  4XU0 A;  4BDY A;  4X9D A;  5CKB A;  3LWH A;  2K5L A;  2OAU A;  4JJN K;  3QDR B;  3CCM T;  4M78 G;  4XQ3 A;  3GNF B;  2ZPH B;  2XDB A;  3I55 A;  3EFR A;  1LOJ A;  2Y4X A;  3OYY A;  4JRI A;  5LJ5 g;  5HK3 A;  4M78 D;  2DEQ A;  2CYZ B;  3C95 A;  2DK3 A;  2B8A A;  3CME A;  4HT8 A;  5CKH A;  1VQL T;  2MI6 A;  3JCM g;  1M9S A;  2VYT A;  1LNX A;  2KVQ G;  3M55 A;  2E12 A;  2KDS A;  2LC4 A;  2R5A A;  4XTY A;  5LJ5 d;  1YI2 T;  3L2U A;  2LCL A;  4M78 E;  3CPW A;  4JRP A;  2Y90 A;  1VQ7 A;  2O4X A;  5LJ3 f;  4C5G A;  3PTA A;  3ZFJ A;  4WF2 A;  5GAN 6;  4F7U A;  3M4Y A;  2F5T X;  3CCS A;  3S3M A;  4A4G A;  4C0Z A;  3OYN A;  4Y28 E;  3X28 B;  2R5M A;  4MDX A;  5IT9 E;  3L2V A;  5KH6 A;  3RIR A;  3DB3 A;  2WSC E;  3N5B B;  2RHZ A;  2XIC A;  4C5H A;  5GAM e;  4M7A C;  1M1K C;  1BI0 A;  2DXT A;  1WGS A;  4XTU A;  3BDU A;  4RCB A;  2ZPG B;  3V8J A;  1VQP A;  1Q82 U;  1EIF A;  3CBM A;  3JCM P;  4M75 A;  4DOW A;  2K5F A;  2D0Q B;  1ZHI A;  3VYG A;  3I55 T;  2RI3 A;  2DIQ A;  4PJO G;  3FIF A;  3V8K A;  3CC7 A;  3OYC A;  5GAO p;  5FU6 C;  4FIB A;  4PJO D;  4J7I A;  4LDW A;  5LJ3 g;  3OYG A;  3OYH A;  3A8G B;  3JRZ A;  2D9T A;  3M53 A;  4J6X A;  3CME T;  4M7A F;  4D6W A;  4C92 A;  2E41 A;  3QG1 A;  1S72 A;  2RHU A;  5D6W A;  1VQO A;  4IUT A;  4A4H A;  1KC8 U;  4PKC C;  2O4X B;  1VQ7 T;  5IN1 A;  1IRE B;  4PJO E;  4FL6 A;  5LJ3 d;  3JCM c;  4EMK C;  3S3O A;  3CCS T;  3MET A;  1Q86 C;  3J7A F;  2DVE A;  3ER0 A;  1N27 A;  1JB0 E;  2LVM A;  2JNG A;  2RJE A;  3OSS C;  3VU3 C;  4OB2 B;  1VQ9 A;  1I8F A;  2E6N A;  2PUO B;  2RHY A;  2X4X A;  5GAO m;  2MF2 A;  1UEB A;  5GMK i;  1VIE A;  3LLR A;  3A5Z B;  4J6Y A;  3CCL A;  4BD3 A;  1G5V A;  3EAE A;  5DLO A;  4RMO A;  1FWZ A;  1NZ9 A;  1VIF A;  4LDV A;  3SWN B;  4ZGD B;  3CXC A;  5GAM f;  3RMQ A;  1P92 A;  2LT4 A;  5GAO r;  1N8R U;  1W4S A;  3JB9 F;  1I81 A;  4JRQ A;  3CC7 T;  2OTL A;  5LJ5 e;  4OGE A;  1LJO A;  4C0F A;  3BFM A;  1YJ9 T;  2K3X A;  1U1T A;  3JB9 I;  1BI3 A;  4XTV A;  3G4S A;  2QDY B;  1RL2 A;  4MZM A;  1S72 T;  2E5Q A;  3JCM e;  3CCQ A;  4ZTJ A;  3OYJ A;  3LYI A;  5KE2 A;  2HQE A;  1XQH A;  2PVD B;  4R55 A;  5DLQ E;  1NE8 A;  4M75 D;  5GAN 3;  3UDC A;  1PSF A;  3VKI A;  5FU7 C;  4PL6 A;  2AHJ B;  2XG8 D;  4M75 C;  4ZGE B;  2ZGW A;  4M7D G;  2RJF A;  2P0Q A;  4RCC A;  4M78 A;  4F7U F;  3M9Q A;  4ELZ C;  3M56 A;  4M7D D;  5GMK h;  1G3S A;  1M1F A;  1I5L A;  3EFS A;  4N4G A;  2ZPB B;  4M77 G;  5GMK m;  3QPH A;  3CCL T;  4XTX A;  1BI2 A;  3QO3 A;  3RKW A;  3JB9 H;  1GXI E;  2CZ0 B;  1I4K 1;  2EJF A;  2RB6 A;  3HFN A;  2L8D A;  4M77 D;  5HY6 A;  3CCR A;  2DIG A;  5GMK j;  4IKF A;  4V2S A;  5GAM d;  2OTJ A;  4QVZ A;  5A0L A;  2R57 A;  3NTI A;  1U8R A;  4QVC A;  2IVW A;  4M75 F;  3I56 A;  1WNL A;  3DLM A;  3GP8 A;  3JCM W;  4LD9 K;  4KT0 E;  4BI4 A;  1YBY A;  2A3L A;  2ZPI B;  4BAC A;  4Z02 A;  2LT1 A;  1M4Z A;  5CQY A;  3HHT B;  4HKE A;  3JAM E;  4M77 E;  1VQL A;  3G4S T;  2LQK A;  5LJ3 e;  3RMS A;  2EQM A;  2ZPF B;  3CCQ T;  3KUF A;  3M5A A;  1G3Y A;  4TVR A;  4EMG A;  4BE0 A;  5HK0 A;  1WQW A;  4II1 A;  4QQD A;  4N4H A;  1VUB A;  1Q82 C;  2MWO A;  1UGS B;  2X4Y A;  2RI5 A;  2YHT A;  3WVE B;  3A8H B;  4J6W A;  3JCM f;  2DXC A;  3KBG A;  1QW1 A;  2M9U A;  1QVP A;  3M54 A;  3DLL A;  2FL7 A;  1W2B A;  4PJO A;  2RM4 A;  1X75 C;  2P0P A;  2CS7 A;  2BIV A;  4QVD A;  3L42 A;  1KHI A;  1KQS A;  3G7Z A;  3HFO A;  3P8H A;  1YHQ A;  1QVF A;  1B34 A;  4EMK A;  2H3J A;  3C94 A;  4MDW A;  5A0G A;  5I21 A;  5I2S A;  1Y7X A;  3CCR T;  4KUD K;  4BE1 A;  3HSB A;  4HT9 A;  2OTJ T;  4BE2 A;  3F70 A;  4MMK A;  4KBM B;  3I56 T;  4JRK A;  1YIT A;  4ME7 A;  1KQ2 A;  4M7A B;  2KK4 A;  2CZ1 B;  5GAN 7;  2DTI A;  2X35 A;  4GLK A;  4M78 C;  1D3B B;  4EMK B;  2DO3 A;  2VV5 A;  4NS5 A;  3UWN A;  2K57 A;  2RHX A;  3C12 A;  3G6E T;  1K8A U;  5FRO A;  2XKO C;  3OMC A;  2CKK A;  4OB3 B;  4BY6 B;  2EJ9 A;  4IUR A;  3CCJ A;  1TH7 A;  1AHJ B;  1Y96 B;  5FU6 B;  4BUG A;  4J7F A;  3CPW S;  3JCM d;  3GNG A;  1JJ2 A;  2XK0 A;  4N0A A;  4C8Q G;  1H3Z A;  4CI0 C;  5GAO l;  2PQW A;  5L8R E;  2QA4 T;  1N8R C;  4E7L A;  3QII A;  4FM4 B;  4XK8 E;  2F5K A;  2QQA A;  3PNW C;  1O75 A;  4M78 F;  4C8Q D;  4VUB A;  4XU1 A;  1YHQ T;  4A53 A;  2VXE A;  3OYD A;  2PUK B;  5EG2 A;  3OMG A;  3MEW A;  4C8Q E;  5A0D A;  1YIT T;  5GAN h;  3GLX A;  2LX9 A;  2XI9 A;  5HKC A;  4DA4 A;  1YJ9 A;  4ZN3 A;  4L5G A;  4M7A G;  1BYM A;  1WJS A;  2DPP B;  1UGQ B;  3MHX A;  3QYH B;  4M7D A;  1WQ7 A;  1UGR B;  2DD5 A;  5A2Q E;  1VQ4 T;  4PJO C;  5GAN j;  1BKB A;  2XDD A;  3R6O A;  1YJW A;  3HRU A;  2CZ7 B;  3HKS A;  4C0G A;  5CKE A;  4M77 A;  1MHN A;  1YCY A;  1Q81 C;  3X26 B;  3M57 A;  3CCJ T;  4RG8 A;  3FDR A;  2KMT A;  3QZ5 B;  4F7U B;  2XHC A;  2KY9 A;  5FLX E;  4E7K A;  3M4G A;  4MZP A;  4M7A E;  3OYI A;  5GMK l;  3A8L B;  5CKF A;  4CRI A;  2WSF E;  1NPP A;  4O6J A;  1QP3 A;  1XOV A;  4PJO F;  3V8L A;  1VQN A;  3QUI A;  5CCA A;  1XNI A;  5FU7 B;  3PGG A;  4M75 B;  2PVG B;  2K4Y A;  1XTD A;  3VUZ A;  1NJI U;  4PNO A;  1K9M C;  3OYK A;  2VGM A;  4ELY C;  2QXF A;  2QQB A;  5M9O A;  2JOY A;  3JSC A;  2HAX A;  2DJZ A;  4E7J A;  3OYE A;  4ZGJ B;  4A4E A;  2K5I A;  4N0A C;  2HQX A;  3MEA A;  3MEU A;  2M1H A;  4FSX A;  2HNI A;  4O5V A;  2GCX A;  2FB7 A;  3TRE A;  4C92 B;  2KQW A;  2KSS A;  3OYB A;  3QJY A;  4JLI A;  1YJW T;  3S6W A;  5I2M A;  2JVV A;  3TEE A;  2VGN A;  4OP0 A;  2LDM A;  5FRN A;  3H8Z A;  5GAN 8;  2DZ9 A;  1WJR A;  2FYK A;  1MGQ A;  4C5I A;  5DM7 R;  1JBM A;  1YJN A;  2RI2 A;  2EYQ A;  2HD0 A;  4L59 A;  1OYX A;  4NL2 A;  2RJC A;  4M7A D;  1M8V A;  4E47 A;  3TCJ A;  2DKG A;  4QW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...