3OQ5A

Crystal structure of the 3-mbt domain from human l3mbtl1 in complex with p53k382me1
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
313
structure length
309
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The MBT Repeats of L3MBTL1 Link SET8-mediated p53 Methylation at Lysine 382 to Target Gene Repression.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
total genus 68
structure length 309
sequence length 313
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oq5A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oq5A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3oq5A03
1WJRA 4BD3A 1OI1A 2X4YA 3FDRA 3OS1A 2LVMA 5D6XA 5KCHA 2O4XA 3SD4A 2RHIA 4E7LA 3LYIA 3M9QA 3F70A 3LX7A 4N4GA 3MP8A 3OS2A 4BE0A 2NLUA 2YRVA 3MEVA 2G3RA 5J39A 3L2WA 4ZTFA 3CEYA 4QQDA 3OYHA 3Q1JA 4BE2A 3L2RA 2F5KA 4Q5WA 2PQWA 3C4SA 5KH6A 4IURA 2LDMA 4N4IA 4FU6A 4GY5A 4OVAA 3OYLA 4IKFA 4C5GA 2K3XA 2LRQA 4PLIA 4QQGA 3L2VA 3GOXA 3L2UA 2WACA 4B9XA 3OYKA 3OYFA 3OYGA 4IUUA 3QIIA 5J26A 2X35A 4A4GA 3S3NA 2R58A 5D6YA 2EQKA 1SSFA 3O8VA 4IUPA 3OYIA 2EQMA 2HQXA 3S3MA 2EQUA 4UC4A 1MHNA 3LGFA 2RJCA 5M9OA 3PMIA 4NS5A 4ZTJA 2EFIA 3NTHA 2RHXA 3H8ZA 2RHYA 3OQ5A 4Z02A 2MWPA 3S3OA 3MP1A 3OYCA 2LCCA 3BDLA 4CRIA 3QBYA 3MEWA 4C5IA 3L42A 2L89A 2RI3A 2CKKA 3DB3A 2RJDA 4RG2A 5CIUA 3L2QA 2E6NA 2M0OA 1G5VA 2JTFA 4QVZA 3OMGA 3H6ZA 2RI5A 4IUTA 2RHUA 2MWOA 1N27A 2EKOA 3MEUA 3QKJA 3UT1A 2L3RA 2RHZA 1KHCA 4BDYA 5IAYA 2RJEA 1OZ3A 3ME9A 3S6WA 5KE3A 1OZ2A 3UWNA 2RI2A 3KUFA 4HCZA 3E9GA 1H3ZA 4PL6A 2FHDA 2R5AA 3OYBA 2HQEA 2RO0A 3OY9A 3OYJA 2O4XB 2GFUA 5FROA 4PLLA 3QJ6A 4C5HA 4E7JA 3P8DA 3LGLA 5C0MA 2BKDN 3E9FA 2D9TA 5KE2A 3FLGA 4II1A 4E7HA 3DLMA 3OYAA 2K3YA 2DIQA 5C6SA 3PFSA 1RI0A 3FEOA 4N4HA 2L8DA 5FRNA 4A4EA 3NTKA 3MO8A 1OYXA 3ASKA 3NTIA 2X4XA 5D6WA 3OYDA 2X4WA 3MP6A 3PMTA 4X34A 2M1HA 2QQRA 4EDUA 2EQJA 2DAQA 4IUVA 4QQ6A 2QQSA 3OYNA 3PNWC 4C5EA 2GF7A 2JZ2A 1WGSA 3LLRA 2BUDA 3LH0A 4BE1A 5IN1A 5KCOA 4BACA 1WJSA 2B8AA 2RJFA 2VYTA 4QW2A 4A4HA 2M16A 3META 4LD6A 4E7KA 4L59A 2R5MA 1WJQA 2GFAA 3OA6A 3OYEA 4IUQA 2BIVA 3P8HA 5FRMA 4E7IA 3OB9A 3EAEA 2E5QA 3DB4A 3OYMA 4FL6A 3MEAA 2XDPA 2DIGA 2LTOA 4B9WA 3FC3A 4A4FA 3ZEHA 2P0KA 2IG0A 2R57A 2XK0A 3OMCA 3OS0A 4BDZA 1XNIA
chains in the Genus database with same CATH superfamily
2LCSA 1HJDA 5GMKe 2DPPB 5KCHA 3QUIA 1RAGB 2DM1A 1KC8U 2LJ1A 1FWZA 3L2RA 2ZPGB 2KY9A 1U1TA 2DXBA 4OVAA 4M7AG 2ROLA 4PKCC 4M78C 3L2VA 1HK9A 1ZSGA 1Q7YR 3BY7A 4A4GA 4KT0E 3H0FA 2RQVA 4PK4A 2WSFE 2HBPA 2J7IA 3M0TA 1IGQA 2LCCA 3BDLA 3G6EA 1AEYA 2I0NA 4DA4A 1VIEA 1WHGA 2LCLA 3QKJA 2KGTA 2QDYB 3EG0A 1PD1A 3CCRQ 2RI2A 2O9SA 2HQEA 3VS0A 3HRUA 3QZ9B 1S72Q 4JRPA 2CZ7B 3UDCA 1MMNA 2K79A 1YIJT 2DD5A 1HD3A 1QWEA 4OMMA 4CC2A 2VV5A 1W2BS 4JRQA 4XTUA 1MNDA 3ASKA 4XU3A 3A5ZB 2EGEA 5LJ5e 2QTVA 3I5SA 3MPUB 5GANe 3X24B 3SB2A 4FSSA 1UHCA 1IZ6A 3JCMP 3CCMA 4PJOD 1ABQA 2HEQA 5GAN5 3EAEA 2LT4A 1RAIB 3OS0A 1K9MC 4BI3A 2J05A 1M90C 1JB0E 4EMKA 2CGHA 2FYKA 2VXEA 2RHIA 3RNJA 2KRNA 1KD1C 1BIAA 3GNGA 2JS2A 4F04B 2HBWA 1UGVA 2EQIA 3Q1JA 3QDFA 2EYYA 2C0IA 1D1BA 2RQRA 4PJOG 2JM9A 3TEEA 3OYKA 4M75G 4PJOC 1IXDA 4ELYC 1U8RA 3O8VA 3N5BB 4ME7A 1D0XA 4FSXA 3CCST 4DBFA 2W0ZA 1K4US 1Z9QA 4OMQA 4CRIA 2FEIA 4B6MA 4J9EA 4F17A 4JLGA 2PUOB 3HTRA 1RLQC 9ATCB 2CP3A 2D0NA 2JUFA 1XJWB 3CC7A 3UT1A 1QCOA 1KHCA 4J6WA 5KE3A 5IHNA 3CBOA 1W1FA 2QQ9A 2WSEE 5DLOA 3EFRA 2RO0A 1QKXA 2DVEA 3I56Q 3G6ET 3EGDB 4JS4A 5GANh 1X6GA 1MMDA 1VQ6A 2FPEA 4BY6C 2LQ8A 2V1QA 1M9SA 2MOXA 5CKBA 2M1HA 1H8KA 2HSEB 1NJIC 3EG2A 3QHSA 1FMVA 2MI6A 2X51A 3EGDA 1G2BA 1NYGA 3A8MB 1VQ7Q 4F7UE 4L59A 4RTXA 1ZBJA 3EH1A 2DX1A 1XTDA 1BCOA 1R0CB 3GPLA 2CT4A 4LD9K 1OX8A 5LJ3e 4PFPA 1PD0A 1WHJA 3M0RA 4RTYA 4LN2A 1Q82U 1WJRA 1BCMA 2X4YA 4KGZB 4HT9A 4GBQA 2L2PA 4RTZA 2CDTA 3QJYA 3ZBDA 4Q5WA 2KRMA 2HL3A 4F7UB 2ZPHB 1YHQQ 2EGCA 4J9GA 4OGEA 1VQLQ 4ZNXA 4XTYA 1YJ9Q 3PVLA 3S3MA 4NS5A 1U06A 3FB9A 2AIRB 1OPKA 1JQQA 2FPDA 3MKDA 3FJPA 3RUXA 4ZGEB 4DEYA 2MWOA 4BDYA 4M78F 1M2OA 3JB9I 2KR3A 8ATCB 1TOVA 5LJ3f 2DL8A 2K9GA 4R56A 4AFQC 1TWBA 3INZA 3VUZA 4M7DF 4M77B 4V2SA 2KSSA 3DKMA 1YJNA 4M7AB 4EMHA 4N0AA 2JMAA 4HVUA 1LNXA 4TVRA 1RAAB 2O88A 2QA4A 1OYXA 4M78G 3PMTA 4BI8B 2IIMA 1K9AA 4CC7A 5FLXE 2M9UA 2YWWA 5I2MA 1YFNA 2LJ0A 3SEMA 4C92B 5IN1A 3RMSA 1M90R 4J9HA 1E6GA 2ZGWA 1VQOT 1M1KU 2XU8A 4LDWA 1ZX6A 1M3CA 5GAMh 1QVFA 3SFMA 1ZHIA 5KYWA 4LDUA 1SRLA 4JRKA 1I0CA 3RR6A 2EYZA 4PNOA 2PVDB 4PJLA 1BI1A 1K73C 4M7DE 2QEXA 3AHUA 1JXMA 1UGSB 1K9MU 4IIOA 2ESWA 3OYGA 1QP3A 1ZUUA 1Q86R 1XQHA 2DJQA 2H3EB 2KT8A 1ACMB 2DILA 3HP9A 1FYNA 2ROTA 2DL7A 3O5ZA 2MWPA 3CXCP 1QW1A 1NE8A 2EYWA 3QBYA 3L2QA 1WXBA 1X43A 3RKWA 2O2OA 2RJEA 3ME9A 3OYJA 2VGNA 1FMWA 5FROA 1K73U 3EGUA 4FW1A 2JNGA 1JXOA 2D9TA 3PFSA 1B7TA 1B07A 5L23A 1U3OA 2QEXT 5KYUA 2XDDA 4C0ZA 1T0JA 2MCNA 3VS3A 1WJSA 3JCMW 4X9DA 4XTVA 2MYSA 1T0HA 2C06A 1D3BA 3REBB 2DTHA 1X01A 1YJWT 3BDUA 4M75B 3E19A 1KG1A 4RTTA 3QYHB 1SSHA 1AWOA 3THKA 5CO7A 3ZEHA 4PJOB 1JJ2S 4LE9A 5EC7A 4BD3A 1G8XA 2DZCA 3CQTA 4JUVA 1AVZC 2MF2A 3SDZA 3FRNA 3M5AA 2HKNA 1C1AA 5LJ5j 5GANf 2V8KA 2LMJA 2F69A 3C4SA 4IURA 3CCET 4HA8A 3VV0A 2OTLQ 1M1FA 1N8RC 4KH1B 1M30A 3JV3A 1ARKA 3VU3C 2R58A 5D6YA 1JBMA 1JJ2P 2RJCA 2YHTA 4OMFB 3S3OA 2E4HA 5GAMf 2EKHA 3TQ7P 4QVZA 4HT8A 1VQOA 2CZ1B 3OS5A 1D0ZA 4M7AD 4M78A 1OZ3A 3S6WA 1VQKQ 8AT1B 3E9GA 2KK4A 3M54A 2JT4A 5D7UA 3OYBA 3CCRT 1BB9A 2QK0A 4HXJA 2BZYA 4FYYB 1VQNA 3FJ5A 4M7AF 3PE0A 3CCJA 3KFVA 4II1A 2RN8A 2K6DA 1RI0A 1X2KA 1UE9A 2OX7A 2DE0X 1JJ2A 4A4EA 3G7ZA 5GAN3 1VQ8Q 2KE9A 3IQLA 1NZ9A 4M7AC 3NFCA 4IUVA 1YJ9T 2O31A 2DO3A 2EGAA 1PKTA 3OYNA 1NLPC 3D7SB 2DF6A 3RBBB 4MDWA 1Q81C 4NL2A 2OAWA 2G6FX 5GMKj 1OU9A 2XDBA 3V7RA 2M16A 1KQSP 1B34A 5DY9A 4RTUA 5A2QE 1KD1U 1MV0B 2L0AA 3URGA 2ENMA 3MEAA 5GAOq 1M3AA 3HRTA 2DMOA 1Y96A 1K1ZA 5HK0A 4ELZC 3EHQA 4XTXA 2EW3A 1YI2T 2BZXA 2O4XA 2JM8A 2FZCB 4C0DB 4PJNA 5GAN8 2VASA 4AG2C 1VQPA 4M77A 1VQKA 3CCUQ 3V8LA 1VQNT 3OYYA 3A98A 3KXTA 3CCQA 3HFOA 3CCLQ 2X35A 4PJOA 1LPLA 5LL6S 1WNLA 4ZGDB 1YITQ 3M57A 1IGUA 2KMTA 3UATA 5CQYA 4HVVA 1VQ8A 1KK7A 2CS7A 3H8ZA 3JCMX 2EJGA 3C94A 3QO3A 4J7FA 3M58A 1VQ5Q 2DJZA 2ECZA 2AK5A 4C8QF 3CCVT 5I22A 3CC2A 1GBQA 1JU5C 4KULA 2MMPA 2JMCA 1VQ9T 2HMAA 1AT1B 1KQSA 3KUFA 1H3ZA 2KNBB 2FHDA 2DXCA 4FW2A 3G4SA 2O4XB 2BZ8A 1AWJA 3AT1B 1M1KC 2CT3A 1EFNA 4FT2A 1ABOA 3J7AF 4C0FA 2AKLA 1ZBXA 2CH4A 4XU0A 1TS9A 3G71T 2XHCA 1W6XA 2FRYA 1QCFA 5HKCA 1TSFA 1Y96B 1ZLMA 3QYGB 1D1AA 2DBMA 1VQ7T 1LVKA 2RJFA 1FX7A 1KSWA 5AYFA 4E7KA 2CP7A 4OMLA 1PKSA 1YI2Q 5EG2A 4A4FA 1D3BB 5FW9A 4BB7A 1WQ7A 2E41A 2V8JA 2CH4W 2QTXA 5GAN4 5GAOn 2QYZA 2LVMA 2SRCA 2D0QB 3C95A 3LYIA 3PTAA 2K7AA 4KBMB 4X1VA 1QLYA 3CPFA 3OYHA 4MZTA 1OX9A 3A8LB 3JB9D 1GL5A 4MDXA 3HRSA 1GFCA 5CAIA 3RKXA 5HCKA 4PLIA 4AFUC 2YUNA 3I55Q 2DYIA 1RAEB 1X6OA 2Y4XA 2LJ3A 3CD6A 4J7IA 2A7YA 3OYIA 3TREA 2WSCE 1MHNA 2PZ1A 2JVVA 1VOMA 2A28A 2FB7A 1E7OA 3MEWA 4F7UF 3CPWA 3OMGA 1VA7A 2JOYA 1W2BP 2ABLA 3MEUA 3PIPA 2EVRA 5L8RE 1BI2A 2L3QA 4HCZA 2V26A 1H3HA 1GCPA 2CZ6B 3VKIA 2LNVA 3V8KA 1R8OB 1I5OB 5IH2A 3VS1A 5GMKm 3GIBA 1YWPA 2CSQA 1OV3A 2KYMA 3CC7Q 5AT1B 3RMQA 2MPXC 1IB8A 2DK3A 2ZZDA 3QG1A 1ZUKA 1WZOA 3J80E 4MZMA 3CMET 2HCKA 2COWA 1VQ9Q 1WDXA 2EQJA 2GBQA 2QAZA 3SWNB 2QQSA 2ZCFB 3CCJQ 3X25B 2DL3A 2I2LA 3H41A 3OA6A 3I55A 3T9NA 4KUIA 2DERA 1QVPA 4DOWA 2QQBA 2E6ZA 2XDPA 1NPRA 3EG1A 4B9WA 1YJ9A 4M7AE 1K73R 2FVUA 1KQSS 4E7SA 4OMNA 2P4TA 1J3TA 2L3SA 3JSCA 1N8RR 1OI1A 2F1LA 4M78B 3OS1A 3EGXA 1K8AR 4E7LA 3VJPA 1H641 3M9QA 5KYXA 2NWMA 3LX7A 4C8QC 4J9FA 1QVFS 4JLIA 1MGQA 4Z88A 5FWCA 3RERA 2E10A 5LJ5h 2EYQA 3PT9A 3CCSA 2YRDA 4M77F 4BE2A 3HFNA 2FZGB 2K3XA 4X9CA 3GOXA 2D8HA 2YUPA 3V8JA 2KT1A 2DA9A 3QIIA 2B86A 2KQWA 1VYUA 3CBMA 1WHKA 2HQHA 1IREB 1SSFA 5IHIA 1BBZA 2QDLA 5FU6B 3JB9F 4DEXA 3P8BB 1VYVA 2NUTA 5A0DA 4C92F 3QSUA 2RHXA 1VQ4A 3CCRA 1R77A 4J9BA 1NEBA 1W70A 2KVQG 1M2VB 1ZA2B 1VQLA 2KYBA 1MUZA 4PFOA 2A08A 2RHUA 1SG5A 4HCBA 2HNIA 1T3LA 3QWYA 3JCMf 3OY9A 1D09B 4QVCA 1O75A 3CCEA 3JCMV 1D0YA 3CMEQ 3CCUT 2K57A 2DL4A 1E6HA 1N9RA 3CBPA 1PC0A 1UJYA 2Y90A 3JB9H 4XK8E 2JXBA 2X4XA 1UEBA 4Y91A 5KYWB 2HAXA 1VUBA 2OI3A 2VGMA 2RQWA 1OQKA 2MAMA 3ZFJA 1FXXA 5GMKh 2BE7D 2KI7A 3G1JA 1QWFA 3CC2T 2ED1A 1TUGB 1OOTA 1AD5A 2OJ2A 2RQTA 4M77C 6AT1B 1QCNA 2YSQA 3U23A 2LTOA 2C0OA 3J81E 2KXCA 3OBYA 1VQPT 4J8OA 1D1CA 2R57A 4BDZA 5GAMg 1UG1A 4BI4A 1A0NB 5DM7R 4WTOB 2ZPEB 1YIJQ 2CREA 1YCYA 3LW5E 3F70A 5LJ5g 4M75E 4LXCA 2LQKA 2XG8D 1Q81U 4JPBW 4E7ZA 4M7DA 1R0BG 4MMLA 2JTMA 2PNIA 3L2WA 3OYLA 5LJ5d 4OF1A 5GJWB 3BW1A 2NUTB 3R6OA 3L2UA 3VRZA 2ED0A 3C0CA 2XD0A 2GGRA 1KD1R 4RTVA 3PMIA 5IXBA 3CMAQ 1K0XA 1KC8C 2E65A 2L5QA 1GCQC 1UTIA 1TU0B 1I81A 1G5VA 4M75F 1IHVA 2YLBA 4CC4B 3CC4Q 1WQWA 5GANj 5LJ3h 4NL3A 4LDYA 2L3RA 3NPFA 2VWFA 2JJ9A 2HZYA 3JCMe 1PSFA 4PLLA 1PG5B 4C92A 2E64A 3M0UA 3E9FA 2E12A 5KE2A 4E47A 1ZSZC 4M7DD 1NPPA 4LUEA 3JRZA 4Z8AA 1TUDA 2X4WA 2AKKA 2HD0A 4XAXB 5GMKl 1EIFA 2FPFA 4QQ6A 3QZ5B 4AFSC 2GF7A 2YUQA 2DXUA 3LH0A 4BACA 1WHHA 4XTWA 2ZPFB 1YN8A 4LD6A 3GP8A 1WI7A 1UB4A 1QP2A 3GF5A 3VS4A 4IUQA 2BIVA 4FCYA 3EG3A 5GAMd 1S72A 3OW2A 2LQWA 1WX6A 3M53A 4KH0B 4RCCA 1K0SA 1KIKA 1G3TA 4OB3B 2M02A 2P0KA 4M4ZA 4HCKA 3FDRA 4M77G 2XI9A 1UDLA 1TTHB 5KYUB 1P92A 4AMCA 2NLUA 1SRMA 2RF0A 3CC2Q 3CEYA 4QQDA 5CVIA 5I11A 2P4RA 3GNFB 2CP2A 3M0PA 1YNZA 3LWIA 2JS0A 1TH7A 2RK1A 1T3SA 1VYTA 2PTKA 2ZAEA 4RKUE 3V7CA 2FZKB 4F14A 4UC4A 2HDAA 2VVKA 4ZTJA 3VS6A 2RHYA 1M1GA 1X69A 3VS7A 1QMCA 2PVGB 1UGPB 3RKYA 1JEGA 2RJDA 5GANg 1Y71A 2QI2A 5KYXB 2RHZA 2YRCA 1S72T 4PL6A 2RA2A 1M3BA 1NJIR 5KYYB 2BKDN 1KJWA 1UGQB 2K5IA 3NTIA 4KGXB 4X34A 2M51A 3KBGA 2FL7A 2JW4A 4KRTA 1K8AC 4C5EA 3ER0A 5KYYA 2W10A 1UUEA 2Y4YA 3L1AA 4FM4B 1QVFP 2E5QA 2P0QA 5ECAA 4M78E 4QKUA 2J6KA 2LX9A 4J9DA 1I07A 4PJOF 1LJOA 2KXDA 4FYXB 5D6XA 4AT1B 5CR2A 4M75D 4BE0A 5J39A 5GAN6 2CSIA 3I35A 3BE3A 3I5RA 2X3XD 3QPHA 4LNPA 1YIJA 1LCKA 2XICA 4DBRA 4ORZA 5J26A 2OTJA 3SHWA 5GAOp 2EQKA 4J83A 2EJFA 4LUDA 4QT7A 2DLPA 3LGFA 1YJWA 5CKDA 3M55A 3CPWS 4JZ4A 1SHFA 2OTLA 2EPDA 5DLQE 1OULA 2PUKB 1Y07A 2COZA 4C5IA 1N8RU 2L89A 4RG8A 2M0OA 3CCQT 1K8AU 3UA6A 4PJMA 2E5KA 1ZSZB 4WCIA 4HCCA 2C0TA 1IHWA 2KDSA 2CP6A 1VQMA 2DVJA 2PU9B 4JJCA 1YITT 1CSKA 2DZ9A 1Y7XA 2RK2A 4HKEA 2GTJA 3P8DA 2PVOB 4OMOA 4EPCA 1YI2A 1I5LA 1C6VX 2J06A 3LH5A 2V1RA 2VB6A 3FEOA 4N4HA 1ZQ1A 3PGGA 2IPOB 2J6FA 5D6WA 3G4SQ 4OB0B 2FRWA 3CCMQ 4JJNK 2DAQA 5GJVB 1VQ4T 5GAN2 3PNWC 2K2VA 1X2QA 3EG9A 1QQJA 1VQLT 3OBWA 3H0HA 2RQUA 3META 2F2WA 3M0QA 1NYFA 2LC4A 1G3YA 4MMKA 2OTJQ 1DJ7B 1Q82C 4FL6A 1RL2A 3HSBA 2DIGA 1WIEA 5HK3A 2DYBA 3OMCA 3M4YA 1RLPC 3DLLA 1PRLC 1N5ZA 5FU7B 1AHJB 1VQ7A 1NLOC 2E3IA 3CXCS 2MIOA 3EG9B 2HKQB 2EWNA 3CMAT 4F16A 2DEUA 4CI0C 2XIDA 2YLCA 3VS2A 1M8MA 3I9QA 2GQIA 1Y0MA 2E1HA 1YBYA 4DBHA 1M2VA 3FIFA 2COYA 5I21A 3R6NA 5CQXA 2LP5A 1WYXA 2VC8A 2CUBA 2P0PA 3VYHB 3WXMB 3G71A 5CKFA 5M9OA 3CCMT 2XKOC 1I4K1 1WLPB 3OQ5A 4Z02A 2DNUA 2QGGA 1RAFB 3DB3A 4PJJA 5A0GA 2O01E 4C8QB 2BTTA 2KROA 2RI5A 4RUGA 1YWOA 3RDVA 1Q81R 1VQ6Q 3UWNA 1TG0A 5FU6C 2KAFA 2OTLT 2GFUA 4O5VA 1PWTA 2F2XA 1VQKT 4C5HA 4E7JA 2DTOA 1M8VA 5C0MA 4JJBA 1X75C 1RACB 2X9HA 3WVEB 1GCQA 5GANd 4J6XA 2L3PA 3MO8A 4M77E 1HYOA 5CKEA 3MP6A 3EGXB 1I1JA 3G6EQ 3C12A 3VUBA 4C8QE 1ZUYA 2JZ2A 1LOJA 3LLRA 4J9CA 3CCSQ 4BE1A 4EMKB 1YJNT 2VYTA 4QW2A 2D6FA 2RNAA 7AT1B 2R5MA 2GFAA 1G3SA 1RAHB 1U5SA 1SEMA 2H3JA 3ZL7C 4AFZC 3OYMA 1TUCA 2RM4A 3MHXA 1PCXA 3FC3A 1CKAA 4M78D 1HXDA 4D8DA 4A54A 3TVTA 1XNIA 2YXYA 1VQPQ 1VQ4Q 1VIFA 3H0IA 4RTWA 4WF2A 3CCJT 3I55T 3EFSA 4N4GA 3OW2S 4FT4A 3MP8A 2QG9B 2YRVA 1VQOQ 2BE9B 3CC4A 1EZZB 5GAMj 1YITA 3E2UA 4IKFA 2NUZA 2LRQA 4FYWB 1FMKA 4RCBA 3OYFA 4IUUA 1VQNQ 3VRYA 2X3WD 4J5YA 3CMEA 2DEQA 1CKBA 2EQMA 4IIMA 4OP0A 2QEXQ 1Q86C 1Q7YC 4C92G 5CKHA 5GAMe 3OYCA 1WXUA 5GAOr 2K3BA 2X4JA 4RG2A 5CIUA 3PIOA 3CD6Q 4EMGA 3H6ZA 2RPNA 4IUTA 1QVGS 1PSEA 1N9SA 1NEGA 1WHLA 2KEAA 3NGPA 4J6YA 2EJ9A 2FO0A 1YJNQ 1YJWQ 2VUBA 1RADB 5LJ3d 3ULRB 1UGRB 1OPLA 2FG0A 3QJ6A 1W2BA 1ZA1B 3LGLA 1YP5A 5HY6A 2LX7A 4E7HA 1KQ2A 1NBEB 4A4KA 5C6SA 1EX4A 1WXTA 1KC8R 4JS5A 2NUPB 4XU1A 2F2VA 3OYDA 4L5GA 3QDRB 3SWNA 1Q95G 4P5NA 3CCEQ 2V8IA 3NHNA 4J9IA 2A0FB 4XQ3A 1PHTA 1WGSA 3CCUA 4DBQA 1IO6A 2B8AA 4ESRA 4A4HA 2DL5A 1Q7YU 3CCVQ 2VXFA 5GMKi 3CCQQ 3P8HA 2QQAA 4M7DC 1G83A 2K4YA 4JDSA 2E3HA 2HL5C 2M0YA 4M75A 4R55A 1NJIU 1F1BB 2P84A 4ZGJB 4C92E 3UPUA 2QXFA 1U1SA 2NYSA 1VQ5A 1YCSB 5LJ3g 1HSQA 4KUDK 2OTJT 2LZ6B 1UFFA 3CD6T 1NG2A 1H92A 2DETA 2A36A 3M0SA 1V76A 2KRSA 3TCJA 5KH6A 4N4IA 2LDMA 3RIRA 4FU6A 4GY5A 4E2FB 2DTIA 4M75C 1B3QA 4DQ2A 2A3LA 2WACA 4QVDA 3X28B 1GFDA 3QXEB 3V7SA 2LT1A 2SEMA 1SHGA 2NUPA 4AG1C 1AZEA 2O9VA 3NTHA 2AHJB 2K5LA 5FWBA 2Z0WA 4N0AC 4BUGA 3L42A 2LNHB 3QWXX 1OU8A 4GLMA 2AT1B 2EYXA 2CUDA 2EKOA 3JCMh 4DOVA 4Y92A 4OB2B 5IAYA 4A53A 1OZ2A 4M7AA 1BU1A 3NMZC 1YHQA 4M7DG 3A8HB 5I2SA 2IVWA 1JRIA 2ZPIB 1NM7A 3DLMA 4PJOE 1KFZA 3TSWA 2L8DA 3CPWP 2EIFA 4L6V5 4M77D 3NTKA 5FRNA 3UA7A 1BK2A 2QQRA 1MV3A 4C0GA 5CK9A 2YT6A 5KCOA 1BIBA 1AWXA 2OAUA 4NOYA 4Z89A 1PM3A 2DBKA 2JTEA 3HHTB 2D1XA 1X6BA 1AZGB 4GLKA 1KHIA 5FRMA 3CCLT 1MNEA 3OB9A 1QVGA 1VQ8T 1UJ0A 3VS5A 5GAOl 4OMPA 2RMOA 1VQMT 4PFZA 2CP5A 2DKGA 5GAOm 1UECA 2GQVA 2YUOA 1M5Q1 1M27C 1X27A 2QA4Q 1S1NA 5IT9E 1C0MA 3BFMA 3CC7T 4E6RA 3GLXA 3OS2A 4XU2A 3MEVA 1BKBA 4LDVA 2D8JA 3M4GA 2PQWA 4MZPA 2DFUA 2KBTA 4BY6B 1JO8A 5J3BA 3A8OB 4OGCA 1SF9A 3X20B 1V29B 1BI0A 4OB1B 1RABB 4R0KA 4IUPA 2HQXA 2EQUA 3CC4T 3M59A 2EFIA 2EAYA 1UHFA 1ZSZA 2GCXA 4JRIA 1AOJA 1WPYA 5CCAA 3JCMg 1BI3A 1N27A 2K5FA 2DXTA 2QGFB 4K11A 3UF4A 2JN0A 3WVDB 2LQNA 4C8QD 3CMAA 1XOVA 3HKSA 3JCMd 3TSZA 4KGVB 1K76A 2R5AA 4CC3A 3REAB 4C92C 1QVGP 5A0LA 3PVQA 1Z9ZA 3JCMc 1Q82R 3L2ZA 1W4SA 3OYAA 3GBQA 1Y57A 2F5TX 2XMFA 3H9NA 1GRIA 1SKUB 1RUWA 1PRMC 2DRMA 4F7UG 2ZPBB 2BUDA 4ZN1A 3VYGA 4D8KA 4EIKA 4HVWA 2ATCB 5IXFA 2EBPA 5GAN7 4M7DB 1WHMA 3I56T 2VKNA 1WJQA 1SPKA 4A63B 4E7IA 3LWHA 2CP0A 3MJXA 3JCMJ 3G71Q 4D6WA 2XK0A 1N6AA 3JB9G 2E70A 1PNJA 4O6JA 3CCVA 1RI9A 2MK5A 3SD4A 3HL8A 3MCAB 4JZ3A 1VQ9A 2RB6A 3A8GB 3CCLA 1BYMA 4ZTFA 2G3RA 2H8HA 3CXCA 3JB9J 3EFOA 2A37A 5KYNA 4C0DC 2F5KA 2J6OA 1VQMQ 4C5GA 1G3WA 4QQGA 4B9XA 3E1SA 3OSSC 1OEBA 1AWWA 3S3NA 3JCMQ 2DD4A 1B34B 1V1CA 2QA4T 5LJ3j 4EMKC 1WA7A 4ZN3A 4VUBA 2AZSA 3RESA 1O9SA 5FU7C 3MP1A 3X26B 4ATOA 1MMGA 1GBRA 4C8QG 2RI3A 2CKKA 1KQ1A 5IHKA 2CYZB 3JAME 2E6NA 2YDLA 3I56A 2JTFA 3EHRA 3JCMb 1M90U 1VQ6T 4LDXA 1M1KR 4YTLA 3OW2P 1QKWA 1GXIE 4C8QA 3EH2A 3TU4K 2HSPA 4XTZA 2DRKA 3OSVA 3M56A 3HPWA 3FLGA 3A1PA 3EFOB 2K3YA 4F7UA 2DIQA 1IRXA 5LJ5f 2GNCA 4EDUA 2QASA 4C92D 1YHQT 4RMOA 1WFWA 1I8FA 1TXQA 4Y28E 1K9MR 1M4ZA 1MMAA 2K2MA 1VQ5T 2RD1A 1Q86U 4JJDA 3OYEA 2AZVA 2RH2A 4FIBA 3DB4A 4FYVB 3SWNC 2CZ0B 4ANJA 3G4ST 2IG0A 2GTOA
chains in the Genus database with same CATH topology
4BD3A 1VIFA 5GAMg 4BI4A 5GMKe 4WF2A 2DPPB 2DZCA 5KCHA 4JUVA 5DM7R 3QUIA 2ZPEB 3CCJT 1YCYA 3LW5E 3F70A 3I55T 3EFSA 4N4GA 5LJ5g 4FT4A 3MP8A 3OW2S 1KC8U 4M75E 2YRVA 2MF2A 2LQKA 2XG8D 3CC4A 1Q81U 3SDZA 5GAMj 3FRNA 1YITA 4M7DA 3M5AA 1FWZA 5LJ5j 3L2RA 5GANf 2V8KA 4MMLA 2JTMA 2F69A 2ZPGB 2KY9A 3L2WA 1U1TA 2DXBA 3C4SA 4IURA 4OVAA 5LJ5d 3OYLA 3CCET 4OF1A 4IKFA 3BW1A 4M7AG 3R6OA 4PKCC 2LRQA 4HA8A 4M78C 3VV0A 3L2VA 3L2UA 1M1FA 4RCBA 1N8RC 3OYFA 4IUUA 1HK9A 3BY7A 4A4GA 2XD0A 4J5YA 4KT0E 3VU3C 2R58A 2DEQA 5D6YA 3CMEA 1JBMA 2EQMA 4OP0A 2WSFE 2RJCA 2YHTA 4OMFB 1Q86C 2HBPA 1Q7YC 3PMIA 4C92G 3S3OA 5CKHA 5GAMe 3OYCA 2LCCA 1KC8C 3BDLA 2E65A 2L5QA 5GAMf 3G6EA 5GAOr 2X4JA 4RG2A 5CIUA 1I81A 1G5VA 3PIOA 4DA4A 4QVZA 4EMGA 4HT8A 3H6ZA 1VQOA 4M75F 4IUTA 2YLBA 2CZ1B 5GANj 1QVGS 1PSEA 1VIEA 1WQWA 3OS5A 1N9SA 5LJ3h 2LCLA 4J6YA 4LDYA 3QKJA 2EJ9A 2L3RA 4NL3A 2QDYB 4M7AD 2VUBA 1OZ3A 4M78A 3S6WA 5LJ3d 2RI2A 3E9GA 2KK4A 3M54A 3OYBA 2HQEA 1UGRB 3CCRT 3HRUA 3QZ9B 3JCMe 1PSFA 4PLLA 3QJ6A 2CZ7B 4JRPA 4C92A 2E64A 3UDCA 1W2BA 3LGLA 1VQNA 5HY6A 4M7AF 3E9FA 2E12A 1YIJT 5KE2A 2DD5A 3CCJA 4II1A 4E7HA 1KQ2A 4E47A 4A4KA 5C6SA 1RI0A 4M7DD 1JJ2A 2VV5A 1NPPA 3G7ZA 4A4EA 5GAN3 3JRZA 4XTUA 4JRQA 4JS5A 1W2BS 3ASKA 4XU1A 4XU3A 3A5ZB 3OYDA 1NZ9A 2X4WA 2HD0A 4L5GA 4XAXB 5LJ5e 4M7AC 5GMKl 3QDRB 3NFCA 3SWNA 1EIFA 4P5NA 4IUVA 1YJ9T 4QQ6A 2V8IA 2DO3A 3QZ5B 3OYNA 4XQ3A 2GF7A 5GANe 1WGSA 3X24B 2DXUA 3LH0A 3SB2A 4MDWA 3CCUA 4BACA 1Q81C 4NL2A 2B8AA 5GMKj 4A4HA 4XTWA 2XDBA 2ZPFB 3V7RA 2M16A 4LD6A 1Q7YU 3GP8A 1B34A 1IZ6A 1UB4A 1QP2A 2VXFA 3GF5A 4IUQA 2BIVA 5DY9A 5GMKi 3P8HA 2QQAA 5A2QE 3CCMA 1KD1U 4M7DC 4PJOD 2K4YA 3URGA 3EAEA 4JDSA 5GAMd 5GAN5 3OW2A 1S72A 3M53A 3MEAA 4M75A 4R55A 4RCCA 2LT4A 1G3TA 5GAOq 4OB3B 2P0KA 1NJIU 4ZGJB 3HRTA 4C92E 3UPUA 3OS0A 1Y96A 4BI3A 1K9MC 2QXFA 1U1SA 5HK0A 4ELZC 1M90C 1JB0E 4XTXA 3FDRA 4M77G 4EMKA 1YI2T 2CGHA 2FYKA 2VXEA 2XI9A 1VQ5A 2O4XA 5LJ3g 2RHIA 4KUDK 2OTJT 1P92A 4C0DB 3CD6T 2NLUA 5GAN8 1KD1C 1BIAA 3CEYA 3GNGA 4QQDA 3Q1JA 1VQPA 4M77A 1VQKA 5CVIA 3V8LA 1VQNT 3TCJA 3OYYA 4N4IA 2LDMA 3RIRA 4FU6A 3GNFB 4GY5A 4PJOG 5KH6A 3KXTA 2DTIA 4M75C 4DQ2A 4QVDA 2A3LA 2WACA 3TEEA 3OYKA 3X28B 3LWIA 3CCQA 1TH7A 2RK1A 3HFOA 4M75G 3QXEB 2X35A 4PJOA 5LL6S 4RKUE 3V7CA 3V7SA 2LT1A 4ELYC 1WNLA 4PJOC 1U8RA 3O8VA 3N5BB 4ZGDB 3M57A 4ME7A 2KMTA 4UC4A 4FSXA 5CQYA 4ZTJA 3NTHA 3CCST 1VQ8A 2CS7A 2RHYA 2AHJB 2K5LA 3H8ZA 2EJGA 3JCMX 1M1GA 4CRIA 3C94A 3QO3A 4J7FA 3M58A 2DJZA 2PVGB 1UGPB 3RKYA 4N0AC 4BUGA 4C8QF 3L42A 2RJDA 4JLGA 2PUOB 5GANg 1Y71A 3CCVT 2QI2A 3CC2A 4KULA 2JUFA 2MMPA 3CC7A 2EKOA 3JCMh 3UT1A 4DOVA 2RHZA 1KHCA 4J6WA 4OB2B 5IAYA 1VQ9T 1S72T 4A53A 1OZ2A 5KE3A 4M7AA 3CBOA 1KQSA 3KUFA 1H3ZA 2QQ9A 2FHDA 2WSEE 4PL6A 3EFRA 2DXCA 5DLOA 2RO0A 1YHQA 3G4SA 2O4XB 2RA2A 4M7DG 2DVEA 1M1KC 3A8HB 5I2SA 3G6ET 2IVWA 1JRIA 4FT2A 4JS4A 2ZPIB 2BKDN 5GANh 3DLMA 4PJOE 3J7AF 1VQ6A 4C0FA 1UGQB 2K5IA 4BY6C 2L8DA 2LQ8A 2EIFA 4L6V5 4M77D 1ZBXA 3NTKA 5FRNA 3NTIA 4XU0A 1M9SA 5CKBA 3G71T 4X34A 2M1HA 2QQRA 2XHCA 3KBGA 2FL7A 1K8AC 4C0GA 1NJIC 5HKCA 5CK9A 1Y96B 4C5EA 3ER0A 2MI6A 3QHSA 3QYGB 5KCOA 1BIBA 1VQ7T 2Y4YA 2RJFA 2OAUA 4NOYA 3A8MB 1FX7A 3L1AA 4F7UE 5AYFA 4E7KA 4L59A 4FM4B 3HHTB 4GLKA 1KHIA 1XTDA 3CCLT 5FRMA 3OB9A 3GPLA 1QVGA 1VQ8T 2E5QA 2P0QA 5GAOl 4LD9K 4M78E 5LJ3e 5EG2A 4A4FA 1VQMT 1D3BB 2DKGA 2LX9A 4BB7A 1WQ7A 2E41A 5GAOm 2V8JA 4PJOF 2GQVA 1LJOA 1WJRA 2QTXA 5GAN4 1M5Q1 1Q82U 5GAOn 2X4YA 2LVMA 5D6XA 5IT9E 2D0QB 3BFMA 3C95A 3CC7T 4HT9A 3LYIA 5CR2A 3PTAA 4M75D 3GLXA 4KBMB 3OS2A 4XU2A 4BE0A 3MEVA 5J39A 3CPFA 5GAN6 3OYHA 3QJYA 3ZBDA 1BKBA 4MZTA 3A8LB 3JB9D 4Q5WA 4MDXA 4LDVA 3HRSA 3M4GA 5CAIA 2PQWA 4MZPA 3RKXA 3QPHA 4BY6B 4F7UB 2ZPHB 1YIJA 2XICA 4PLIA 4OGEA 5J3BA 3A8OB 4OGCA 1X6OA 2Y4XA 5J26A 3X20B 1V29B 1BI0A 2OTJA 4OB1B 5GAOp 4XTYA 3CD6A 4J7IA 2A7YA 2EQKA 4J83A 2EJFA 4IUPA 3OYIA 3TREA 2HQXA 3S3MA 2EQUA 2WSCE 1MHNA 3LGFA 3CC4T 2JVVA 1YJWA 4NS5A 3M59A 2EFIA 3M55A 5CKDA 3CPWS 3FB9A 2OTLA 2FB7A 5DLQE 2EAYA 3FJPA 2GCXA 1Y07A 2PUKB 3MEWA 1WPYA 4JRIA 3RUXA 4C5IA 1N8RU 4F7UF 2L89A 5CCAA 4RG8A 3JCMg 2M0OA 3CCQT 1K8AU 3CPWA 3OMGA 4ZGEB 1BI3A 2MWOA 1N27A 2K5FA 2DXTA 2JOYA 3MEUA 4BDYA 3PIPA 4HCCA 2JN0A 4M78F 3WVDB 4C8QD 3CMAA 5L8RE 1XOVA 1BI2A 3HKSA 3JB9I 2KDSA 4HCZA 3JCMd 1VQMA 2R5AA 5LJ3f 2PU9B 4C92C 1YITT 2DZ9A 1Y7XA 2RK2A 2CZ6B 4HKEA 5A0LA 3VKIA 4R56A 2LNVA 3INZA 1R8OB 3P8DA 2PVOB 3V8KA 4EPCA 5GMKm 1YI2A 3VUZA 1I5LA 3JCMc 4M7DF 3GIBA 4M77B 4V2SA 2KSSA 3DKMA 1YJNA 3L2ZA 1W4SA 4N0AA 4M7AB 3RMQA 4EMHA 3OYAA 2DK3A 2ZZDA 3QG1A 1LNXA 4TVRA 3FEOA 4N4HA 3J80E 4MZMA 2F5TX 3CMET 1ZQ1A 3PGGA 2QA4A 1OYXA 4M78G 5D6WA 4OB0B 3PMTA 4BI8B 4JJNK 5FLXE 2EQJA 2DAQA 2M9UA 1VQ4T 5GAN2 3SWNB 2QQSA 3PNWC 4F7UG 5I2MA 2ZCFB 2ZPBB 2BUDA 4ZN1A 4C92B 3VYGA 5IN1A 2K2VA 3RMSA 1VQLT 3OBWA 5GAN7 4M7DB 3I56T 3X25B 3META 2I2LA 2ZGWA 1VQOT 1M1KU 1WJQA 2LC4A 3OA6A 3I55A 1G3YA 2XU8A 4LDWA 4MMKA 3T9NA 4KUIA 1QVPA 4E7IA 3JCMP 1DJ7B 3LWHA 4DOWA 1Q82C 4FL6A 1RL2A 2QQBA 3HSBA 2E6ZA 2DIGA 1NPRA 2XDPA 4B9WA 3JCMJ 1YJ9A 5HK3A 5GAMh 4M7AE 4D6WA 2FVUA 2XK0A 1KQSS 3OMCA 1N6AA 3M4YA 3JB9G 3DLLA 1QVFA 2P4TA 5FU7B 3JSCA 2E70A 1AHJB 1VQ7A 4O6JA 1OI1A 3SFMA 3CCVA 4M78B 3OS1A 3CXCS 1ZHIA 3SD4A 4LDUA 4E7LA 3VJPA 1H641 3HL8A 3MCAB 2EWNA 3M9QA 3LX7A 4C8QC 4JRKA 1VQ9A 3CMAT 2RB6A 3A8GB 4CI0C 3CCLA 1QVFS 1BYMA 4JLIA 1MGQA 4ZTFA 2G3RA 2XIDA 4PNOA 3RERA 3CXCA 3JB9J 2E10A 2PVDB 5LJ5h 2EYQA 3PT9A 2YLCA 3CCSA 4C0DC 1BI1A 4M77F 2F5KA 4BE2A 3HFNA 1K73C 4M7DE 2QEXA 3AHUA 2E1HA 1UGSB 1YBYA 1K9MU 4C5GA 2K3XA 1G3WA 4QQGA 3FIFA 4X9CA 3GOXA 4B9XA 5I21A 3OYGA 1QP3A 3E1SA 5CQXA 1XQHA 3QIIA 2KQWA 2VC8A 3OSSC 3V8JA 3S3NA 3JCMQ 2DD4A 2P0PA 1B34B 3CBMA 1IREB 2QA4T 3VYHB 1SSFA 3WXMB 5LJ3j 3G71A 5FU6B 3JB9F 4EMKC 3HP9A 3P8BB 5CKFA 5M9OA 4ZN3A 5A0DA 4VUBA 3CCMT 2XKOC 1I4K1 4C92F 3QSUA 2RHXA 1VQ4A 3CCRA 3OQ5A 4Z02A 2MWPA 1O9SA 5FU7C 3RESA 3MP1A 3X26B 4ATOA 1QW1A 1NE8A 2KVQG 4C8QG 3QBYA 1VQLA 2RI3A 2CKKA 1KQ1A 3DB3A 2CYZB 5A0GA 2O01E 2E6NA 3JAME 3I56A 2JTFA 3JCMb 4C8QB 3L2QA 1M90U 2RI5A 2RHUA 4HCBA 1VQ6T 2HNIA 3RKWA 4LDXA 2RJEA 3ME9A 4YTLA 3UWNA 1GXIE 4C8QA 3JCMf 3OY9A 3OYJA 5FU6C 2KAFA 2VGNA 2OTLT 3TU4K 2GFUA 4O5VA 5FROA 4XTZA 1O75A 4C5HA 4QVCA 4E7JA 1K73U 2DTOA 1VQKT 1M8VA 3CCEA 3OSVA 3JCMV 2JNGA 3M56A 5C0MA 3CCUT 2K57A 2D9TA 3HPWA 1N9RA 1X75C 3FLGA 3WVEB 2K3YA 3CBPA 4F7UA 2DIQA 3PFSA 2Y90A 5GANd 3JB9H 4J6XA 4XK8E 3MO8A 4M77E 5LJ5f 2X4XA 1UEBA 4Y91A 5CKEA 3MP6A 4EDUA 4C92D 1YHQT 2HAXA 2QEXT 4RMOA 3C12A 3VUBA 1VUBA 4C8QE 2XDDA 2VGMA 1I8FA 4C0ZA 2JZ2A 1LOJA 4Y28E 3LLRA 4BE1A 2MAMA 1M4ZA 3ZFJA 1FXXA 1WJSA 4EMKB 5GMKh 2VYTA 4QW2A 4X9DA 4XTVA 3JCMW 1YJNT 2D6FA 1VQ5T 2RD1A 1Q86U 3CC2T 2R5MA 2GFAA 2C06A 1D3BA 3OYEA 4M77C 1G3SA 2H3JA 2DTHA 1X01A 1YJWT 3BDUA 2RH2A 4FIBA 3DB4A 4M75B 3E19A 3OYMA 1KG1A 2LTOA 2RM4A 3MHXA 3QYHB 3J81E 3FC3A 3OBYA 1VQPT 3ZEHA 4M78D 1HXDA 5CO7A 3SWNC 2CZ0B 4J8OA 4A54A 2IG0A 2R57A 3G4ST 4BDZA 1JJ2S 4PJOB 1XNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJR A;  4BD3 A;  1OI1 A;  2X4Y A;  3FDR A;  3OS1 A;  2LVM A;  5D6X A;  5KCH A;  2O4X A;  3SD4 A;  2RHI A;  4E7L A;  3LYI A;  3M9Q A;  3F70 A;  3LX7 A;  4N4G A;  3MP8 A;  3OS2 A;  4BE0 A;  2NLU A;  2YRV A;  3MEV A;  2G3R A;  5J39 A;  3L2W A;  4ZTF A;  3CEY A;  4QQD A;  3OYH A;  3Q1J A;  4BE2 A;  3L2R A;  2F5K A;  4Q5W A;  2PQW A;  3C4S A;  5KH6 A;  4IUR A;  2LDM A;  4N4I A;  4FU6 A;  4GY5 A;  4OVA A;  3OYL A;  4IKF A;  4C5G A;  2K3X A;  2LRQ A;  4PLI A;  4QQG A;  3L2V A;  3GOX A;  3L2U A;  2WAC A;  4B9X A;  3OYK A;  3OYF A;  3OYG A;  4IUU A;  3QII A;  5J26 A;  2X35 A;  4A4G A;  3S3N A;  2R58 A;  5D6Y A;  2EQK A;  1SSF A;  3O8V A;  4IUP A;  3OYI A;  2EQM A;  2HQX A;  3S3M A;  2EQU A;  4UC4 A;  1MHN A;  3LGF A;  2RJC A;  5M9O A;  3PMI A;  4NS5 A;  4ZTJ A;  2EFI A;  3NTH A;  2RHX A;  3H8Z A;  2RHY A;  3OQ5 A;  4Z02 A;  2MWP A;  3S3O A;  3MP1 A;  3OYC A;  2LCC A;  3BDL A;  4CRI A;  3QBY A;  3MEW A;  4C5I A;  3L42 A;  2L89 A;  2RI3 A;  2CKK A;  3DB3 A;  2RJD A;  4RG2 A;  5CIU A;  3L2Q A;  2E6N A;  2M0O A;  1G5V A;  2JTF A;  4QVZ A;  3OMG A;  3H6Z A;  2RI5 A;  4IUT A;  2RHU A;  2MWO A;  1N27 A;  2EKO A;  3MEU A;  3QKJ A;  3UT1 A;  2L3R A;  2RHZ A;  1KHC A;  4BDY A;  5IAY A;  2RJE A;  1OZ3 A;  3ME9 A;  3S6W A;  5KE3 A;  1OZ2 A;  3UWN A;  2RI2 A;  3KUF A;  4HCZ A;  3E9G A;  1H3Z A;  4PL6 A;  2FHD A;  2R5A A;  3OYB A;  2HQE A;  2RO0 A;  3OY9 A;  3OYJ A;  2O4X B;  2GFU A;  5FRO A;  4PLL A;  3QJ6 A;  4C5H A;  4E7J A;  3P8D A;  3LGL A;  5C0M A;  2BKD N;  3E9F A;  2D9T A;  5KE2 A;  3FLG A;  4II1 A;  4E7H A;  3DLM A;  3OYA A;  2K3Y A;  2DIQ A;  5C6S A;  3PFS A;  1RI0 A;  3FEO A;  4N4H A;  2L8D A;  5FRN A;  4A4E A;  3NTK A;  3MO8 A;  1OYX A;  3ASK A;  3NTI A;  2X4X A;  5D6W A;  3OYD A;  2X4W A;  3MP6 A;  3PMT A;  4X34 A;  2M1H A;  2QQR A;  4EDU A;  2EQJ A;  2DAQ A;  4IUV A;  4QQ6 A;  2QQS A;  3OYN A;  3PNW C;  4C5E A;  2GF7 A;  2JZ2 A;  1WGS A;  3LLR A;  2BUD A;  3LH0 A;  4BE1 A;  5IN1 A;  5KCO A;  4BAC A;  1WJS A;  2B8A A;  2RJF A;  2VYT A;  4QW2 A;  4A4H A;  2M16 A;  3MET A;  4LD6 A;  4E7K A;  4L59 A;  2R5M A;  1WJQ A;  2GFA A;  3OA6 A;  3OYE A;  4IUQ A;  2BIV A;  3P8H A;  5FRM A;  4E7I A;  3OB9 A;  3EAE A;  2E5Q A;  3DB4 A;  3OYM A;  4FL6 A;  3MEA A;  2XDP A;  2DIG A;  2LTO A;  4B9W A;  3FC3 A;  4A4F A;  3ZEH A;  2P0K A;  2IG0 A;  2R57 A;  2XK0 A;  3OMC A;  3OS0 A;  4BDZ A;  1XNI A; 
#chains in the Genus database with same CATH topology
 2LCS A;  1HJD A;  5GMK e;  2DPP B;  5KCH A;  3QUI A;  1RAG B;  2DM1 A;  1KC8 U;  2LJ1 A;  1FWZ A;  3L2R A;  2ZPG B;  2KY9 A;  1U1T A;  2DXB A;  4OVA A;  4M7A G;  2ROL A;  4PKC C;  4M78 C;  3L2V A;  1HK9 A;  1ZSG A;  1Q7Y R;  3BY7 A;  4A4G A;  4KT0 E;  3H0F A;  2RQV A;  4PK4 A;  2WSF E;  2HBP A;  2J7I A;  3M0T A;  1IGQ A;  2LCC A;  3BDL A;  3G6E A;  1AEY A;  2I0N A;  4DA4 A;  1VIE A;  1WHG A;  2LCL A;  3QKJ A;  2KGT A;  2QDY B;  3EG0 A;  1PD1 A;  3CCR Q;  2RI2 A;  2O9S A;  2HQE A;  3VS0 A;  3HRU A;  3QZ9 B;  1S72 Q;  4JRP A;  2CZ7 B;  3UDC A;  1MMN A;  2K79 A;  1YIJ T;  2DD5 A;  1HD3 A;  1QWE A;  4OMM A;  4CC2 A;  2VV5 A;  1W2B S;  4JRQ A;  4XTU A;  1MND A;  3ASK A;  4XU3 A;  3A5Z B;  2EGE A;  5LJ5 e;  2QTV A;  3I5S A;  3MPU B;  5GAN e;  3X24 B;  3SB2 A;  4FSS A;  1UHC A;  1IZ6 A;  3JCM P;  3CCM A;  4PJO D;  1ABQ A;  2HEQ A;  5GAN 5;  3EAE A;  2LT4 A;  1RAI B;  3OS0 A;  1K9M C;  4BI3 A;  2J05 A;  1M90 C;  1JB0 E;  4EMK A;  2CGH A;  2FYK A;  2VXE A;  2RHI A;  3RNJ A;  2KRN A;  1KD1 C;  1BIA A;  3GNG A;  2JS2 A;  4F04 B;  2HBW A;  1UGV A;  2EQI A;  3Q1J A;  3QDF A;  2EYY A;  2C0I A;  1D1B A;  2RQR A;  4PJO G;  2JM9 A;  3TEE A;  3OYK A;  4M75 G;  4PJO C;  1IXD A;  4ELY C;  1U8R A;  3O8V A;  3N5B B;  4ME7 A;  1D0X A;  4FSX A;  3CCS T;  4DBF A;  2W0Z A;  1K4U S;  1Z9Q A;  4OMQ A;  4CRI A;  2FEI A;  4B6M A;  4J9E A;  4F17 A;  4JLG A;  2PUO B;  3HTR A;  1RLQ C;  9ATC B;  2CP3 A;  2D0N A;  2JUF A;  1XJW B;  3CC7 A;  3UT1 A;  1QCO A;  1KHC A;  4J6W A;  5KE3 A;  5IHN A;  3CBO A;  1W1F A;  2QQ9 A;  2WSE E;  5DLO A;  3EFR A;  2RO0 A;  1QKX A;  2DVE A;  3I56 Q;  3G6E T;  3EGD B;  4JS4 A;  5GAN h;  1X6G A;  1MMD A;  1VQ6 A;  2FPE A;  4BY6 C;  2LQ8 A;  2V1Q A;  1M9S A;  2MOX A;  5CKB A;  2M1H A;  1H8K A;  2HSE B;  1NJI C;  3EG2 A;  3QHS A;  1FMV A;  2MI6 A;  2X51 A;  3EGD A;  1G2B A;  1NYG A;  3A8M B;  1VQ7 Q;  4F7U E;  4L59 A;  4RTX A;  1ZBJ A;  3EH1 A;  2DX1 A;  1XTD A;  1BCO A;  1R0C B;  3GPL A;  2CT4 A;  4LD9 K;  1OX8 A;  5LJ3 e;  4PFP A;  1PD0 A;  1WHJ A;  3M0R A;  4RTY A;  4LN2 A;  1Q82 U;  1WJR A;  1BCM A;  2X4Y A;  4KGZ B;  4HT9 A;  4GBQ A;  2L2P A;  4RTZ A;  2CDT A;  3QJY A;  3ZBD A;  4Q5W A;  2KRM A;  2HL3 A;  4F7U B;  2ZPH B;  1YHQ Q;  2EGC A;  4J9G A;  4OGE A;  1VQL Q;  4ZNX A;  4XTY A;  1YJ9 Q;  3PVL A;  3S3M A;  4NS5 A;  1U06 A;  3FB9 A;  2AIR B;  1OPK A;  1JQQ A;  2FPD A;  3MKD A;  3FJP A;  3RUX A;  4ZGE B;  4DEY A;  2MWO A;  4BDY A;  4M78 F;  1M2O A;  3JB9 I;  2KR3 A;  8ATC B;  1TOV A;  5LJ3 f;  2DL8 A;  2K9G A;  4R56 A;  4AFQ C;  1TWB A;  3INZ A;  3VUZ A;  4M7D F;  4M77 B;  4V2S A;  2KSS A;  3DKM A;  1YJN A;  4M7A B;  4EMH A;  4N0A A;  2JMA A;  4HVU A;  1LNX A;  4TVR A;  1RAA B;  2O88 A;  2QA4 A;  1OYX A;  4M78 G;  3PMT A;  4BI8 B;  2IIM A;  1K9A A;  4CC7 A;  5FLX E;  2M9U A;  2YWW A;  5I2M A;  1YFN A;  2LJ0 A;  3SEM A;  4C92 B;  5IN1 A;  3RMS A;  1M90 R;  4J9H A;  1E6G A;  2ZGW A;  1VQO T;  1M1K U;  2XU8 A;  4LDW A;  1ZX6 A;  1M3C A;  5GAM h;  1QVF A;  3SFM A;  1ZHI A;  5KYW A;  4LDU A;  1SRL A;  4JRK A;  1I0C A;  3RR6 A;  2EYZ A;  4PNO A;  2PVD B;  4PJL A;  1BI1 A;  1K73 C;  4M7D E;  2QEX A;  3AHU A;  1JXM A;  1UGS B;  1K9M U;  4IIO A;  2ESW A;  3OYG A;  1QP3 A;  1ZUU A;  1Q86 R;  1XQH A;  2DJQ A;  2H3E B;  2KT8 A;  1ACM B;  2DIL A;  3HP9 A;  1FYN A;  2ROT A;  2DL7 A;  3O5Z A;  2MWP A;  3CXC P;  1QW1 A;  1NE8 A;  2EYW A;  3QBY A;  3L2Q A;  1WXB A;  1X43 A;  3RKW A;  2O2O A;  2RJE A;  3ME9 A;  3OYJ A;  2VGN A;  1FMW A;  5FRO A;  1K73 U;  3EGU A;  4FW1 A;  2JNG A;  1JXO A;  2D9T A;  3PFS A;  1B7T A;  1B07 A;  5L23 A;  1U3O A;  2QEX T;  5KYU A;  2XDD A;  4C0Z A;  1T0J A;  2MCN A;  3VS3 A;  1WJS A;  3JCM W;  4X9D A;  4XTV A;  2MYS A;  1T0H A;  2C06 A;  1D3B A;  3REB B;  2DTH A;  1X01 A;  1YJW T;  3BDU A;  4M75 B;  3E19 A;  1KG1 A;  4RTT A;  3QYH B;  1SSH A;  1AWO A;  3THK A;  5CO7 A;  3ZEH A;  4PJO B;  1JJ2 S;  4LE9 A;  5EC7 A;  4BD3 A;  1G8X A;  2DZC A;  3CQT A;  4JUV A;  1AVZ C;  2MF2 A;  3SDZ A;  3FRN A;  3M5A A;  2HKN A;  1C1A A;  5LJ5 j;  5GAN f;  2V8K A;  2LMJ A;  2F69 A;  3C4S A;  4IUR A;  3CCE T;  4HA8 A;  3VV0 A;  2OTL Q;  1M1F A;  1N8R C;  4KH1 B;  1M30 A;  3JV3 A;  1ARK A;  3VU3 C;  2R58 A;  5D6Y A;  1JBM A;  1JJ2 P;  2RJC A;  2YHT A;  4OMF B;  3S3O A;  2E4H A;  5GAM f;  2EKH A;  3TQ7 P;  4QVZ A;  4HT8 A;  1VQO A;  2CZ1 B;  3OS5 A;  1D0Z A;  4M7A D;  4M78 A;  1OZ3 A;  3S6W A;  1VQK Q;  8AT1 B;  3E9G A;  2KK4 A;  3M54 A;  2JT4 A;  5D7U A;  3OYB A;  3CCR T;  1BB9 A;  2QK0 A;  4HXJ A;  2BZY A;  4FYY B;  1VQN A;  3FJ5 A;  4M7A F;  3PE0 A;  3CCJ A;  3KFV A;  4II1 A;  2RN8 A;  2K6D A;  1RI0 A;  1X2K A;  1UE9 A;  2OX7 A;  2DE0 X;  1JJ2 A;  4A4E A;  3G7Z A;  5GAN 3;  1VQ8 Q;  2KE9 A;  3IQL A;  1NZ9 A;  4M7A C;  3NFC A;  4IUV A;  1YJ9 T;  2O31 A;  2DO3 A;  2EGA A;  1PKT A;  3OYN A;  1NLP C;  3D7S B;  2DF6 A;  3RBB B;  4MDW A;  1Q81 C;  4NL2 A;  2OAW A;  2G6F X;  5GMK j;  1OU9 A;  2XDB A;  3V7R A;  2M16 A;  1KQS P;  1B34 A;  5DY9 A;  4RTU A;  5A2Q E;  1KD1 U;  1MV0 B;  2L0A A;  3URG A;  2ENM A;  3MEA A;  5GAO q;  1M3A A;  3HRT A;  2DMO A;  1Y96 A;  1K1Z A;  5HK0 A;  4ELZ C;  3EHQ A;  4XTX A;  2EW3 A;  1YI2 T;  2BZX A;  2O4X A;  2JM8 A;  2FZC B;  4C0D B;  4PJN A;  5GAN 8;  2VAS A;  4AG2 C;  1VQP A;  4M77 A;  1VQK A;  3CCU Q;  3V8L A;  1VQN T;  3OYY A;  3A98 A;  3KXT A;  3CCQ A;  3HFO A;  3CCL Q;  2X35 A;  4PJO A;  1LPL A;  5LL6 S;  1WNL A;  4ZGD B;  1YIT Q;  3M57 A;  1IGU A;  2KMT A;  3UAT A;  5CQY A;  4HVV A;  1VQ8 A;  1KK7 A;  2CS7 A;  3H8Z A;  3JCM X;  2EJG A;  3C94 A;  3QO3 A;  4J7F A;  3M58 A;  1VQ5 Q;  2DJZ A;  2ECZ A;  2AK5 A;  4C8Q F;  3CCV T;  5I22 A;  3CC2 A;  1GBQ A;  1JU5 C;  4KUL A;  2MMP A;  2JMC A;  1VQ9 T;  2HMA A;  1AT1 B;  1KQS A;  3KUF A;  1H3Z A;  2KNB B;  2FHD A;  2DXC A;  4FW2 A;  3G4S A;  2O4X B;  2BZ8 A;  1AWJ A;  3AT1 B;  1M1K C;  2CT3 A;  1EFN A;  4FT2 A;  1ABO A;  3J7A F;  4C0F A;  2AKL A;  1ZBX A;  2CH4 A;  4XU0 A;  1TS9 A;  3G71 T;  2XHC A;  1W6X A;  2FRY A;  1QCF A;  5HKC A;  1TSF A;  1Y96 B;  1ZLM A;  3QYG B;  1D1A A;  2DBM A;  1VQ7 T;  1LVK A;  2RJF A;  1FX7 A;  1KSW A;  5AYF A;  4E7K A;  2CP7 A;  4OML A;  1PKS A;  1YI2 Q;  5EG2 A;  4A4F A;  1D3B B;  5FW9 A;  4BB7 A;  1WQ7 A;  2E41 A;  2V8J A;  2CH4 W;  2QTX A;  5GAN 4;  5GAO n;  2QYZ A;  2LVM A;  2SRC A;  2D0Q B;  3C95 A;  3LYI A;  3PTA A;  2K7A A;  4KBM B;  4X1V A;  1QLY A;  3CPF A;  3OYH A;  4MZT A;  1OX9 A;  3A8L B;  3JB9 D;  1GL5 A;  4MDX A;  3HRS A;  1GFC A;  5CAI A;  3RKX A;  5HCK A;  4PLI A;  4AFU C;  2YUN A;  3I55 Q;  2DYI A;  1RAE B;  1X6O A;  2Y4X A;  2LJ3 A;  3CD6 A;  4J7I A;  2A7Y A;  3OYI A;  3TRE A;  2WSC E;  1MHN A;  2PZ1 A;  2JVV A;  1VOM A;  2A28 A;  2FB7 A;  1E7O A;  3MEW A;  4F7U F;  3CPW A;  3OMG A;  1VA7 A;  2JOY A;  1W2B P;  2ABL A;  3MEU A;  3PIP A;  2EVR A;  5L8R E;  1BI2 A;  2L3Q A;  4HCZ A;  2V26 A;  1H3H A;  1GCP A;  2CZ6 B;  3VKI A;  2LNV A;  3V8K A;  1R8O B;  1I5O B;  5IH2 A;  3VS1 A;  5GMK m;  3GIB A;  1YWP A;  2CSQ A;  1OV3 A;  2KYM A;  3CC7 Q;  5AT1 B;  3RMQ A;  2MPX C;  1IB8 A;  2DK3 A;  2ZZD A;  3QG1 A;  1ZUK A;  1WZO A;  3J80 E;  4MZM A;  3CME T;  2HCK A;  2COW A;  1VQ9 Q;  1WDX A;  2EQJ A;  2GBQ A;  2QAZ A;  3SWN B;  2QQS A;  2ZCF B;  3CCJ Q;  3X25 B;  2DL3 A;  2I2L A;  3H41 A;  3OA6 A;  3I55 A;  3T9N A;  4KUI A;  2DER A;  1QVP A;  4DOW A;  2QQB A;  2E6Z A;  2XDP A;  1NPR A;  3EG1 A;  4B9W A;  1YJ9 A;  4M7A E;  1K73 R;  2FVU A;  1KQS S;  4E7S A;  4OMN A;  2P4T A;  1J3T A;  2L3S A;  3JSC A;  1N8R R;  1OI1 A;  2F1L A;  4M78 B;  3OS1 A;  3EGX A;  1K8A R;  4E7L A;  3VJP A;  1H64 1;  3M9Q A;  5KYX A;  2NWM A;  3LX7 A;  4C8Q C;  4J9F A;  1QVF S;  4JLI A;  1MGQ A;  4Z88 A;  5FWC A;  3RER A;  2E10 A;  5LJ5 h;  2EYQ A;  3PT9 A;  3CCS A;  2YRD A;  4M77 F;  4BE2 A;  3HFN A;  2FZG B;  2K3X A;  4X9C A;  3GOX A;  2D8H A;  2YUP A;  3V8J A;  2KT1 A;  2DA9 A;  3QII A;  2B86 A;  2KQW A;  1VYU A;  3CBM A;  1WHK A;  2HQH A;  1IRE B;  1SSF A;  5IHI A;  1BBZ A;  2QDL A;  5FU6 B;  3JB9 F;  4DEX A;  3P8B B;  1VYV A;  2NUT A;  5A0D A;  4C92 F;  3QSU A;  2RHX A;  1VQ4 A;  3CCR A;  1R77 A;  4J9B A;  1NEB A;  1W70 A;  2KVQ G;  1M2V B;  1ZA2 B;  1VQL A;  2KYB A;  1MUZ A;  4PFO A;  2A08 A;  2RHU A;  1SG5 A;  4HCB A;  2HNI A;  1T3L A;  3QWY A;  3JCM f;  3OY9 A;  1D09 B;  4QVC A;  1O75 A;  3CCE A;  3JCM V;  1D0Y A;  3CME Q;  3CCU T;  2K57 A;  2DL4 A;  1E6H A;  1N9R A;  3CBP A;  1PC0 A;  1UJY A;  2Y90 A;  3JB9 H;  4XK8 E;  2JXB A;  2X4X A;  1UEB A;  4Y91 A;  5KYW B;  2HAX A;  1VUB A;  2OI3 A;  2VGM A;  2RQW A;  1OQK A;  2MAM A;  3ZFJ A;  1FXX A;  5GMK h;  2BE7 D;  2KI7 A;  3G1J A;  1QWF A;  3CC2 T;  2ED1 A;  1TUG B;  1OOT A;  1AD5 A;  2OJ2 A;  2RQT A;  4M77 C;  6AT1 B;  1QCN A;  2YSQ A;  3U23 A;  2LTO A;  2C0O A;  3J81 E;  2KXC A;  3OBY A;  1VQP T;  4J8O A;  1D1C A;  2R57 A;  4BDZ A;  5GAM g;  1UG1 A;  4BI4 A;  1A0N B;  5DM7 R;  4WTO B;  2ZPE B;  1YIJ Q;  2CRE A;  1YCY A;  3LW5 E;  3F70 A;  5LJ5 g;  4M75 E;  4LXC A;  2LQK A;  2XG8 D;  1Q81 U;  4JPB W;  4E7Z A;  4M7D A;  1R0B G;  4MML A;  2JTM A;  2PNI A;  3L2W A;  3OYL A;  5LJ5 d;  4OF1 A;  5GJW B;  3BW1 A;  2NUT B;  3R6O A;  3L2U A;  3VRZ A;  2ED0 A;  3C0C A;  2XD0 A;  2GGR A;  1KD1 R;  4RTV A;  3PMI A;  5IXB A;  3CMA Q;  1K0X A;  1KC8 C;  2E65 A;  2L5Q A;  1GCQ C;  1UTI A;  1TU0 B;  1I81 A;  1G5V A;  4M75 F;  1IHV A;  2YLB A;  4CC4 B;  3CC4 Q;  1WQW A;  5GAN j;  5LJ3 h;  4NL3 A;  4LDY A;  2L3R A;  3NPF A;  2VWF A;  2JJ9 A;  2HZY A;  3JCM e;  1PSF A;  4PLL A;  1PG5 B;  4C92 A;  2E64 A;  3M0U A;  3E9F A;  2E12 A;  5KE2 A;  4E47 A;  1ZSZ C;  4M7D D;  1NPP A;  4LUE A;  3JRZ A;  4Z8A A;  1TUD A;  2X4W A;  2AKK A;  2HD0 A;  4XAX B;  5GMK l;  1EIF A;  2FPF A;  4QQ6 A;  3QZ5 B;  4AFS C;  2GF7 A;  2YUQ A;  2DXU A;  3LH0 A;  4BAC A;  1WHH A;  4XTW A;  2ZPF B;  1YN8 A;  4LD6 A;  3GP8 A;  1WI7 A;  1UB4 A;  1QP2 A;  3GF5 A;  3VS4 A;  4IUQ A;  2BIV A;  4FCY A;  3EG3 A;  5GAM d;  1S72 A;  3OW2 A;  2LQW A;  1WX6 A;  3M53 A;  4KH0 B;  4RCC A;  1K0S A;  1KIK A;  1G3T A;  4OB3 B;  2M02 A;  2P0K A;  4M4Z A;  4HCK A;  3FDR A;  4M77 G;  2XI9 A;  1UDL A;  1TTH B;  5KYU B;  1P92 A;  4AMC A;  2NLU A;  1SRM A;  2RF0 A;  3CC2 Q;  3CEY A;  4QQD A;  5CVI A;  5I11 A;  2P4R A;  3GNF B;  2CP2 A;  3M0P A;  1YNZ A;  3LWI A;  2JS0 A;  1TH7 A;  2RK1 A;  1T3S A;  1VYT A;  2PTK A;  2ZAE A;  4RKU E;  3V7C A;  2FZK B;  4F14 A;  4UC4 A;  2HDA A;  2VVK A;  4ZTJ A;  3VS6 A;  2RHY A;  1M1G A;  1X69 A;  3VS7 A;  1QMC A;  2PVG B;  1UGP B;  3RKY A;  1JEG A;  2RJD A;  5GAN g;  1Y71 A;  2QI2 A;  5KYX B;  2RHZ A;  2YRC A;  1S72 T;  4PL6 A;  2RA2 A;  1M3B A;  1NJI R;  5KYY B;  2BKD N;  1KJW A;  1UGQ B;  2K5I A;  3NTI A;  4KGX B;  4X34 A;  2M51 A;  3KBG A;  2FL7 A;  2JW4 A;  4KRT A;  1K8A C;  4C5E A;  3ER0 A;  5KYY A;  2W10 A;  1UUE A;  2Y4Y A;  3L1A A;  4FM4 B;  1QVF P;  2E5Q A;  2P0Q A;  5ECA A;  4M78 E;  4QKU A;  2J6K A;  2LX9 A;  4J9D A;  1I07 A;  4PJO F;  1LJO A;  2KXD A;  4FYX B;  5D6X A;  4AT1 B;  5CR2 A;  4M75 D;  4BE0 A;  5J39 A;  5GAN 6;  2CSI A;  3I35 A;  3BE3 A;  3I5R A;  2X3X D;  3QPH A;  4LNP A;  1YIJ A;  1LCK A;  2XIC A;  4DBR A;  4ORZ A;  5J26 A;  2OTJ A;  3SHW A;  5GAO p;  2EQK A;  4J83 A;  2EJF A;  4LUD A;  4QT7 A;  2DLP A;  3LGF A;  1YJW A;  5CKD A;  3M55 A;  3CPW S;  4JZ4 A;  1SHF A;  2OTL A;  2EPD A;  5DLQ E;  1OUL A;  2PUK B;  1Y07 A;  2COZ A;  4C5I A;  1N8R U;  2L89 A;  4RG8 A;  2M0O A;  3CCQ T;  1K8A U;  3UA6 A;  4PJM A;  2E5K A;  1ZSZ B;  4WCI A;  4HCC A;  2C0T A;  1IHW A;  2KDS A;  2CP6 A;  1VQM A;  2DVJ A;  2PU9 B;  4JJC A;  1YIT T;  1CSK A;  2DZ9 A;  1Y7X A;  2RK2 A;  4HKE A;  2GTJ A;  3P8D A;  2PVO B;  4OMO A;  4EPC A;  1YI2 A;  1I5L A;  1C6V X;  2J06 A;  3LH5 A;  2V1R A;  2VB6 A;  3FEO A;  4N4H A;  1ZQ1 A;  3PGG A;  2IPO B;  2J6F A;  5D6W A;  3G4S Q;  4OB0 B;  2FRW A;  3CCM Q;  4JJN K;  2DAQ A;  5GJV B;  1VQ4 T;  5GAN 2;  3PNW C;  2K2V A;  1X2Q A;  3EG9 A;  1QQJ A;  1VQL T;  3OBW A;  3H0H A;  2RQU A;  3MET A;  2F2W A;  3M0Q A;  1NYF A;  2LC4 A;  1G3Y A;  4MMK A;  2OTJ Q;  1DJ7 B;  1Q82 C;  4FL6 A;  1RL2 A;  3HSB A;  2DIG A;  1WIE A;  5HK3 A;  2DYB A;  3OMC A;  3M4Y A;  1RLP C;  3DLL A;  1PRL C;  1N5Z A;  5FU7 B;  1AHJ B;  1VQ7 A;  1NLO C;  2E3I A;  3CXC S;  2MIO A;  3EG9 B;  2HKQ B;  2EWN A;  3CMA T;  4F16 A;  2DEU A;  4CI0 C;  2XID A;  2YLC A;  3VS2 A;  1M8M A;  3I9Q A;  2GQI A;  1Y0M A;  2E1H A;  1YBY A;  4DBH A;  1M2V A;  3FIF A;  2COY A;  5I21 A;  3R6N A;  5CQX A;  2LP5 A;  1WYX A;  2VC8 A;  2CUB A;  2P0P A;  3VYH B;  3WXM B;  3G71 A;  5CKF A;  5M9O A;  3CCM T;  2XKO C;  1I4K 1;  1WLP B;  3OQ5 A;  4Z02 A;  2DNU A;  2QGG A;  1RAF B;  3DB3 A;  4PJJ A;  5A0G A;  2O01 E;  4C8Q B;  2BTT A;  2KRO A;  2RI5 A;  4RUG A;  1YWO A;  3RDV A;  1Q81 R;  1VQ6 Q;  3UWN A;  1TG0 A;  5FU6 C;  2KAF A;  2OTL T;  2GFU A;  4O5V A;  1PWT A;  2F2X A;  1VQK T;  4C5H A;  4E7J A;  2DTO A;  1M8V A;  5C0M A;  4JJB A;  1X75 C;  1RAC B;  2X9H A;  3WVE B;  1GCQ A;  5GAN d;  4J6X A;  2L3P A;  3MO8 A;  4M77 E;  1HYO A;  5CKE A;  3MP6 A;  3EGX B;  1I1J A;  3G6E Q;  3C12 A;  3VUB A;  4C8Q E;  1ZUY A;  2JZ2 A;  1LOJ A;  3LLR A;  4J9C A;  3CCS Q;  4BE1 A;  4EMK B;  1YJN T;  2VYT A;  4QW2 A;  2D6F A;  2RNA A;  7AT1 B;  2R5M A;  2GFA A;  1G3S A;  1RAH B;  1U5S A;  1SEM A;  2H3J A;  3ZL7 C;  4AFZ C;  3OYM A;  1TUC A;  2RM4 A;  3MHX A;  1PCX A;  3FC3 A;  1CKA A;  4M78 D;  1HXD A;  4D8D A;  4A54 A;  3TVT A;  1XNI A;  2YXY A;  1VQP Q;  1VQ4 Q;  1VIF A;  3H0I A;  4RTW A;  4WF2 A;  3CCJ T;  3I55 T;  3EFS A;  4N4G A;  3OW2 S;  4FT4 A;  3MP8 A;  2QG9 B;  2YRV A;  1VQO Q;  2BE9 B;  3CC4 A;  1EZZ B;  5GAM j;  1YIT A;  3E2U A;  4IKF A;  2NUZ A;  2LRQ A;  4FYW B;  1FMK A;  4RCB A;  3OYF A;  4IUU A;  1VQN Q;  3VRY A;  2X3W D;  4J5Y A;  3CME A;  2DEQ A;  1CKB A;  2EQM A;  4IIM A;  4OP0 A;  2QEX Q;  1Q86 C;  1Q7Y C;  4C92 G;  5CKH A;  5GAM e;  3OYC A;  1WXU A;  5GAO r;  2K3B A;  2X4J A;  4RG2 A;  5CIU A;  3PIO A;  3CD6 Q;  4EMG A;  3H6Z A;  2RPN A;  4IUT A;  1QVG S;  1PSE A;  1N9S A;  1NEG A;  1WHL A;  2KEA A;  3NGP A;  4J6Y A;  2EJ9 A;  2FO0 A;  1YJN Q;  1YJW Q;  2VUB A;  1RAD B;  5LJ3 d;  3ULR B;  1UGR B;  1OPL A;  2FG0 A;  3QJ6 A;  1W2B A;  1ZA1 B;  3LGL A;  1YP5 A;  5HY6 A;  2LX7 A;  4E7H A;  1KQ2 A;  1NBE B;  4A4K A;  5C6S A;  1EX4 A;  1WXT A;  1KC8 R;  4JS5 A;  2NUP B;  4XU1 A;  2F2V A;  3OYD A;  4L5G A;  3QDR B;  3SWN A;  1Q95 G;  4P5N A;  3CCE Q;  2V8I A;  3NHN A;  4J9I A;  2A0F B;  4XQ3 A;  1PHT A;  1WGS A;  3CCU A;  4DBQ A;  1IO6 A;  2B8A A;  4ESR A;  4A4H A;  2DL5 A;  1Q7Y U;  3CCV Q;  2VXF A;  5GMK i;  3CCQ Q;  3P8H A;  2QQA A;  4M7D C;  1G83 A;  2K4Y A;  4JDS A;  2E3H A;  2HL5 C;  2M0Y A;  4M75 A;  4R55 A;  1NJI U;  1F1B B;  2P84 A;  4ZGJ B;  4C92 E;  3UPU A;  2QXF A;  1U1S A;  2NYS A;  1VQ5 A;  1YCS B;  5LJ3 g;  1HSQ A;  4KUD K;  2OTJ T;  2LZ6 B;  1UFF A;  3CD6 T;  1NG2 A;  1H92 A;  2DET A;  2A36 A;  3M0S A;  1V76 A;  2KRS A;  3TCJ A;  5KH6 A;  4N4I A;  2LDM A;  3RIR A;  4FU6 A;  4GY5 A;  4E2F B;  2DTI A;  4M75 C;  1B3Q A;  4DQ2 A;  2A3L A;  2WAC A;  4QVD A;  3X28 B;  1GFD A;  3QXE B;  3V7S A;  2LT1 A;  2SEM A;  1SHG A;  2NUP A;  4AG1 C;  1AZE A;  2O9V A;  3NTH A;  2AHJ B;  2K5L A;  5FWB A;  2Z0W A;  4N0A C;  4BUG A;  3L42 A;  2LNH B;  3QWX X;  1OU8 A;  4GLM A;  2AT1 B;  2EYX A;  2CUD A;  2EKO A;  3JCM h;  4DOV A;  4Y92 A;  4OB2 B;  5IAY A;  4A53 A;  1OZ2 A;  4M7A A;  1BU1 A;  3NMZ C;  1YHQ A;  4M7D G;  3A8H B;  5I2S A;  2IVW A;  1JRI A;  2ZPI B;  1NM7 A;  3DLM A;  4PJO E;  1KFZ A;  3TSW A;  2L8D A;  3CPW P;  2EIF A;  4L6V 5;  4M77 D;  3NTK A;  5FRN A;  3UA7 A;  1BK2 A;  2QQR A;  1MV3 A;  4C0G A;  5CK9 A;  2YT6 A;  5KCO A;  1BIB A;  1AWX A;  2OAU A;  4NOY A;  4Z89 A;  1PM3 A;  2DBK A;  2JTE A;  3HHT B;  2D1X A;  1X6B A;  1AZG B;  4GLK A;  1KHI A;  5FRM A;  3CCL T;  1MNE A;  3OB9 A;  1QVG A;  1VQ8 T;  1UJ0 A;  3VS5 A;  5GAO l;  4OMP A;  2RMO A;  1VQM T;  4PFZ A;  2CP5 A;  2DKG A;  5GAO m;  1UEC A;  2GQV A;  2YUO A;  1M5Q 1;  1M27 C;  1X27 A;  2QA4 Q;  1S1N A;  5IT9 E;  1C0M A;  3BFM A;  3CC7 T;  4E6R A;  3GLX A;  3OS2 A;  4XU2 A;  3MEV A;  1BKB A;  4LDV A;  2D8J A;  3M4G A;  2PQW A;  4MZP A;  2DFU A;  2KBT A;  4BY6 B;  1JO8 A;  5J3B A;  3A8O B;  4OGC A;  1SF9 A;  3X20 B;  1V29 B;  1BI0 A;  4OB1 B;  1RAB B;  4R0K A;  4IUP A;  2HQX A;  2EQU A;  3CC4 T;  3M59 A;  2EFI A;  2EAY A;  1UHF A;  1ZSZ A;  2GCX A;  4JRI A;  1AOJ A;  1WPY A;  5CCA A;  3JCM g;  1BI3 A;  1N27 A;  2K5F A;  2DXT A;  2QGF B;  4K11 A;  3UF4 A;  2JN0 A;  3WVD B;  2LQN A;  4C8Q D;  3CMA A;  1XOV A;  3HKS A;  3JCM d;  3TSZ A;  4KGV B;  1K76 A;  2R5A A;  4CC3 A;  3REA B;  4C92 C;  1QVG P;  5A0L A;  3PVQ A;  1Z9Z A;  3JCM c;  1Q82 R;  3L2Z A;  1W4S A;  3OYA A;  3GBQ A;  1Y57 A;  2F5T X;  2XMF A;  3H9N A;  1GRI A;  1SKU B;  1RUW A;  1PRM C;  2DRM A;  4F7U G;  2ZPB B;  2BUD A;  4ZN1 A;  3VYG A;  4D8K A;  4EIK A;  4HVW A;  2ATC B;  5IXF A;  2EBP A;  5GAN 7;  4M7D B;  1WHM A;  3I56 T;  2VKN A;  1WJQ A;  1SPK A;  4A63 B;  4E7I A;  3LWH A;  2CP0 A;  3MJX A;  3JCM J;  3G71 Q;  4D6W A;  2XK0 A;  1N6A A;  3JB9 G;  2E70 A;  1PNJ A;  4O6J A;  3CCV A;  1RI9 A;  2MK5 A;  3SD4 A;  3HL8 A;  3MCA B;  4JZ3 A;  1VQ9 A;  2RB6 A;  3A8G B;  3CCL A;  1BYM A;  4ZTF A;  2G3R A;  2H8H A;  3CXC A;  3JB9 J;  3EFO A;  2A37 A;  5KYN A;  4C0D C;  2F5K A;  2J6O A;  1VQM Q;  4C5G A;  1G3W A;  4QQG A;  4B9X A;  3E1S A;  3OSS C;  1OEB A;  1AWW A;  3S3N A;  3JCM Q;  2DD4 A;  1B34 B;  1V1C A;  2QA4 T;  5LJ3 j;  4EMK C;  1WA7 A;  4ZN3 A;  4VUB A;  2AZS A;  3RES A;  1O9S A;  5FU7 C;  3MP1 A;  3X26 B;  4ATO A;  1MMG A;  1GBR A;  4C8Q G;  2RI3 A;  2CKK A;  1KQ1 A;  5IHK A;  2CYZ B;  3JAM E;  2E6N A;  2YDL A;  3I56 A;  2JTF A;  3EHR A;  3JCM b;  1M90 U;  1VQ6 T;  4LDX A;  1M1K R;  4YTL A;  3OW2 P;  1QKW A;  1GXI E;  4C8Q A;  3EH2 A;  3TU4 K;  2HSP A;  4XTZ A;  2DRK A;  3OSV A;  3M56 A;  3HPW A;  3FLG A;  3A1P A;  3EFO B;  2K3Y A;  4F7U A;  2DIQ A;  1IRX A;  5LJ5 f;  2GNC A;  4EDU A;  2QAS A;  4C92 D;  1YHQ T;  4RMO A;  1WFW A;  1I8F A;  1TXQ A;  4Y28 E;  1K9M R;  1M4Z A;  1MMA A;  2K2M A;  1VQ5 T;  2RD1 A;  1Q86 U;  4JJD A;  3OYE A;  2AZV A;  2RH2 A;  4FIB A;  3DB4 A;  4FYV B;  3SWN C;  2CZ0 B;  4ANJ A;  3G4S T;  2IG0 A;  2GTO A; 
#chains in the Genus database with same CATH homology
 4BD3 A;  1VIF A;  5GAM g;  4BI4 A;  5GMK e;  4WF2 A;  2DPP B;  2DZC A;  5KCH A;  4JUV A;  5DM7 R;  3QUI A;  2ZPE B;  3CCJ T;  1YCY A;  3LW5 E;  3F70 A;  3I55 T;  3EFS A;  4N4G A;  5LJ5 g;  4FT4 A;  3MP8 A;  3OW2 S;  1KC8 U;  4M75 E;  2YRV A;  2MF2 A;  2LQK A;  2XG8 D;  3CC4 A;  1Q81 U;  3SDZ A;  5GAM j;  3FRN A;  1YIT A;  4M7D A;  3M5A A;  1FWZ A;  5LJ5 j;  3L2R A;  5GAN f;  2V8K A;  4MML A;  2JTM A;  2F69 A;  2ZPG B;  2KY9 A;  3L2W A;  1U1T A;  2DXB A;  3C4S A;  4IUR A;  4OVA A;  5LJ5 d;  3OYL A;  3CCE T;  4OF1 A;  4IKF A;  3BW1 A;  4M7A G;  3R6O A;  4PKC C;  2LRQ A;  4HA8 A;  4M78 C;  3VV0 A;  3L2V A;  3L2U A;  1M1F A;  4RCB A;  1N8R C;  3OYF A;  4IUU A;  1HK9 A;  3BY7 A;  4A4G A;  2XD0 A;  4J5Y A;  4KT0 E;  3VU3 C;  2R58 A;  2DEQ A;  5D6Y A;  3CME A;  1JBM A;  2EQM A;  4OP0 A;  2WSF E;  2RJC A;  2YHT A;  4OMF B;  1Q86 C;  2HBP A;  1Q7Y C;  3PMI A;  4C92 G;  3S3O A;  5CKH A;  5GAM e;  3OYC A;  2LCC A;  1KC8 C;  3BDL A;  2E65 A;  2L5Q A;  5GAM f;  3G6E A;  5GAO r;  2X4J A;  4RG2 A;  5CIU A;  1I81 A;  1G5V A;  3PIO A;  4DA4 A;  4QVZ A;  4EMG A;  4HT8 A;  3H6Z A;  1VQO A;  4M75 F;  4IUT A;  2YLB A;  2CZ1 B;  5GAN j;  1QVG S;  1PSE A;  1VIE A;  1WQW A;  3OS5 A;  1N9S A;  5LJ3 h;  2LCL A;  4J6Y A;  4LDY A;  3QKJ A;  2EJ9 A;  2L3R A;  4NL3 A;  2QDY B;  4M7A D;  2VUB A;  1OZ3 A;  4M78 A;  3S6W A;  5LJ3 d;  2RI2 A;  3E9G A;  2KK4 A;  3M54 A;  3OYB A;  2HQE A;  1UGR B;  3CCR T;  3HRU A;  3QZ9 B;  3JCM e;  1PSF A;  4PLL A;  3QJ6 A;  2CZ7 B;  4JRP A;  4C92 A;  2E64 A;  3UDC A;  1W2B A;  3LGL A;  1VQN A;  5HY6 A;  4M7A F;  3E9F A;  2E12 A;  1YIJ T;  5KE2 A;  2DD5 A;  3CCJ A;  4II1 A;  4E7H A;  1KQ2 A;  4E47 A;  4A4K A;  5C6S A;  1RI0 A;  4M7D D;  1JJ2 A;  2VV5 A;  1NPP A;  3G7Z A;  4A4E A;  5GAN 3;  3JRZ A;  4XTU A;  4JRQ A;  4JS5 A;  1W2B S;  3ASK A;  4XU1 A;  4XU3 A;  3A5Z B;  3OYD A;  1NZ9 A;  2X4W A;  2HD0 A;  4L5G A;  4XAX B;  5LJ5 e;  4M7A C;  5GMK l;  3QDR B;  3NFC A;  3SWN A;  1EIF A;  4P5N A;  4IUV A;  1YJ9 T;  4QQ6 A;  2V8I A;  2DO3 A;  3QZ5 B;  3OYN A;  4XQ3 A;  2GF7 A;  5GAN e;  1WGS A;  3X24 B;  2DXU A;  3LH0 A;  3SB2 A;  4MDW A;  3CCU A;  4BAC A;  1Q81 C;  4NL2 A;  2B8A A;  5GMK j;  4A4H A;  4XTW A;  2XDB A;  2ZPF B;  3V7R A;  2M16 A;  4LD6 A;  1Q7Y U;  3GP8 A;  1B34 A;  1IZ6 A;  1UB4 A;  1QP2 A;  2VXF A;  3GF5 A;  4IUQ A;  2BIV A;  5DY9 A;  5GMK i;  3P8H A;  2QQA A;  5A2Q E;  3CCM A;  1KD1 U;  4M7D C;  4PJO D;  2K4Y A;  3URG A;  3EAE A;  4JDS A;  5GAM d;  5GAN 5;  3OW2 A;  1S72 A;  3M53 A;  3MEA A;  4M75 A;  4R55 A;  4RCC A;  2LT4 A;  1G3T A;  5GAO q;  4OB3 B;  2P0K A;  1NJI U;  4ZGJ B;  3HRT A;  4C92 E;  3UPU A;  3OS0 A;  1Y96 A;  4BI3 A;  1K9M C;  2QXF A;  1U1S A;  5HK0 A;  4ELZ C;  1M90 C;  1JB0 E;  4XTX A;  3FDR A;  4M77 G;  4EMK A;  1YI2 T;  2CGH A;  2FYK A;  2VXE A;  2XI9 A;  1VQ5 A;  2O4X A;  5LJ3 g;  2RHI A;  4KUD K;  2OTJ T;  1P92 A;  4C0D B;  3CD6 T;  2NLU A;  5GAN 8;  1KD1 C;  1BIA A;  3CEY A;  3GNG A;  4QQD A;  3Q1J A;  1VQP A;  4M77 A;  1VQK A;  5CVI A;  3V8L A;  1VQN T;  3TCJ A;  3OYY A;  4N4I A;  2LDM A;  3RIR A;  4FU6 A;  3GNF B;  4GY5 A;  4PJO G;  5KH6 A;  3KXT A;  2DTI A;  4M75 C;  4DQ2 A;  4QVD A;  2A3L A;  2WAC A;  3TEE A;  3OYK A;  3X28 B;  3LWI A;  3CCQ A;  1TH7 A;  2RK1 A;  3HFO A;  4M75 G;  3QXE B;  2X35 A;  4PJO A;  5LL6 S;  4RKU E;  3V7C A;  3V7S A;  2LT1 A;  4ELY C;  1WNL A;  4PJO C;  1U8R A;  3O8V A;  3N5B B;  4ZGD B;  3M57 A;  4ME7 A;  2KMT A;  4UC4 A;  4FSX A;  5CQY A;  4ZTJ A;  3NTH A;  3CCS T;  1VQ8 A;  2CS7 A;  2RHY A;  2AHJ B;  2K5L A;  3H8Z A;  2EJG A;  3JCM X;  1M1G A;  4CRI A;  3C94 A;  3QO3 A;  4J7F A;  3M58 A;  2DJZ A;  2PVG B;  1UGP B;  3RKY A;  4N0A C;  4BUG A;  4C8Q F;  3L42 A;  2RJD A;  4JLG A;  2PUO B;  5GAN g;  1Y71 A;  3CCV T;  2QI2 A;  3CC2 A;  4KUL A;  2JUF A;  2MMP A;  3CC7 A;  2EKO A;  3JCM h;  3UT1 A;  4DOV A;  2RHZ A;  1KHC A;  4J6W A;  4OB2 B;  5IAY A;  1VQ9 T;  1S72 T;  4A53 A;  1OZ2 A;  5KE3 A;  4M7A A;  3CBO A;  1KQS A;  3KUF A;  1H3Z A;  2QQ9 A;  2FHD A;  2WSE E;  4PL6 A;  3EFR A;  2DXC A;  5DLO A;  2RO0 A;  1YHQ A;  3G4S A;  2O4X B;  2RA2 A;  4M7D G;  2DVE A;  1M1K C;  3A8H B;  5I2S A;  3G6E T;  2IVW A;  1JRI A;  4FT2 A;  4JS4 A;  2ZPI B;  2BKD N;  5GAN h;  3DLM A;  4PJO E;  3J7A F;  1VQ6 A;  4C0F A;  1UGQ B;  2K5I A;  4BY6 C;  2L8D A;  2LQ8 A;  2EIF A;  4L6V 5;  4M77 D;  1ZBX A;  3NTK A;  5FRN A;  3NTI A;  4XU0 A;  1M9S A;  5CKB A;  3G71 T;  4X34 A;  2M1H A;  2QQR A;  2XHC A;  3KBG A;  2FL7 A;  1K8A C;  4C0G A;  1NJI C;  5HKC A;  5CK9 A;  1Y96 B;  4C5E A;  3ER0 A;  2MI6 A;  3QHS A;  3QYG B;  5KCO A;  1BIB A;  1VQ7 T;  2Y4Y A;  2RJF A;  2OAU A;  4NOY A;  3A8M B;  1FX7 A;  3L1A A;  4F7U E;  5AYF A;  4E7K A;  4L59 A;  4FM4 B;  3HHT B;  4GLK A;  1KHI A;  1XTD A;  3CCL T;  5FRM A;  3OB9 A;  3GPL A;  1QVG A;  1VQ8 T;  2E5Q A;  2P0Q A;  5GAO l;  4LD9 K;  4M78 E;  5LJ3 e;  5EG2 A;  4A4F A;  1VQM T;  1D3B B;  2DKG A;  2LX9 A;  4BB7 A;  1WQ7 A;  2E41 A;  5GAO m;  2V8J A;  4PJO F;  2GQV A;  1LJO A;  1WJR A;  2QTX A;  5GAN 4;  1M5Q 1;  1Q82 U;  5GAO n;  2X4Y A;  2LVM A;  5D6X A;  5IT9 E;  2D0Q B;  3BFM A;  3C95 A;  3CC7 T;  4HT9 A;  3LYI A;  5CR2 A;  3PTA A;  4M75 D;  3GLX A;  4KBM B;  3OS2 A;  4XU2 A;  4BE0 A;  3MEV A;  5J39 A;  3CPF A;  5GAN 6;  3OYH A;  3QJY A;  3ZBD A;  1BKB A;  4MZT A;  3A8L B;  3JB9 D;  4Q5W A;  4MDX A;  4LDV A;  3HRS A;  3M4G A;  5CAI A;  2PQW A;  4MZP A;  3RKX A;  3QPH A;  4BY6 B;  4F7U B;  2ZPH B;  1YIJ A;  2XIC A;  4PLI A;  4OGE A;  5J3B A;  3A8O B;  4OGC A;  1X6O A;  2Y4X A;  5J26 A;  3X20 B;  1V29 B;  1BI0 A;  2OTJ A;  4OB1 B;  5GAO p;  4XTY A;  3CD6 A;  4J7I A;  2A7Y A;  2EQK A;  4J83 A;  2EJF A;  4IUP A;  3OYI A;  3TRE A;  2HQX A;  3S3M A;  2EQU A;  2WSC E;  1MHN A;  3LGF A;  3CC4 T;  2JVV A;  1YJW A;  4NS5 A;  3M59 A;  2EFI A;  3M55 A;  5CKD A;  3CPW S;  3FB9 A;  2OTL A;  2FB7 A;  5DLQ E;  2EAY A;  3FJP A;  2GCX A;  1Y07 A;  2PUK B;  3MEW A;  1WPY A;  4JRI A;  3RUX A;  4C5I A;  1N8R U;  4F7U F;  2L89 A;  5CCA A;  4RG8 A;  3JCM g;  2M0O A;  3CCQ T;  1K8A U;  3CPW A;  3OMG A;  4ZGE B;  1BI3 A;  2MWO A;  1N27 A;  2K5F A;  2DXT A;  2JOY A;  3MEU A;  4BDY A;  3PIP A;  4HCC A;  2JN0 A;  4M78 F;  3WVD B;  4C8Q D;  3CMA A;  5L8R E;  1XOV A;  1BI2 A;  3HKS A;  3JB9 I;  2KDS A;  4HCZ A;  3JCM d;  1VQM A;  2R5A A;  5LJ3 f;  2PU9 B;  4C92 C;  1YIT T;  2DZ9 A;  1Y7X A;  2RK2 A;  2CZ6 B;  4HKE A;  5A0L A;  3VKI A;  4R56 A;  2LNV A;  3INZ A;  1R8O B;  3P8D A;  2PVO B;  3V8K A;  4EPC A;  5GMK m;  1YI2 A;  3VUZ A;  1I5L A;  3JCM c;  4M7D F;  3GIB A;  4M77 B;  4V2S A;  2KSS A;  3DKM A;  1YJN A;  3L2Z A;  1W4S A;  4N0A A;  4M7A B;  3RMQ A;  4EMH A;  3OYA A;  2DK3 A;  2ZZD A;  3QG1 A;  1LNX A;  4TVR A;  3FEO A;  4N4H A;  3J80 E;  4MZM A;  2F5T X;  3CME T;  1ZQ1 A;  3PGG A;  2QA4 A;  1OYX A;  4M78 G;  5D6W A;  4OB0 B;  3PMT A;  4BI8 B;  4JJN K;  5FLX E;  2EQJ A;  2DAQ A;  2M9U A;  1VQ4 T;  5GAN 2;  3SWN B;  2QQS A;  3PNW C;  4F7U G;  5I2M A;  2ZCF B;  2ZPB B;  2BUD A;  4ZN1 A;  4C92 B;  3VYG A;  5IN1 A;  2K2V A;  3RMS A;  1VQL T;  3OBW A;  5GAN 7;  4M7D B;  3I56 T;  3X25 B;  3MET A;  2I2L A;  2ZGW A;  1VQO T;  1M1K U;  1WJQ A;  2LC4 A;  3OA6 A;  3I55 A;  1G3Y A;  2XU8 A;  4LDW A;  4MMK A;  3T9N A;  4KUI A;  1QVP A;  4E7I A;  3JCM P;  1DJ7 B;  3LWH A;  4DOW A;  1Q82 C;  4FL6 A;  1RL2 A;  2QQB A;  3HSB A;  2E6Z A;  2DIG A;  1NPR A;  2XDP A;  4B9W A;  3JCM J;  1YJ9 A;  5HK3 A;  5GAM h;  4M7A E;  4D6W A;  2FVU A;  2XK0 A;  1KQS S;  3OMC A;  1N6A A;  3M4Y A;  3JB9 G;  3DLL A;  1QVF A;  2P4T A;  5FU7 B;  3JSC A;  2E70 A;  1AHJ B;  1VQ7 A;  4O6J A;  1OI1 A;  3SFM A;  3CCV A;  4M78 B;  3OS1 A;  3CXC S;  1ZHI A;  3SD4 A;  4LDU A;  4E7L A;  3VJP A;  1H64 1;  3HL8 A;  3MCA B;  2EWN A;  3M9Q A;  3LX7 A;  4C8Q C;  4JRK A;  1VQ9 A;  3CMA T;  2RB6 A;  3A8G B;  4CI0 C;  3CCL A;  1QVF S;  1BYM A;  4JLI A;  1MGQ A;  4ZTF A;  2G3R A;  2XID A;  4PNO A;  3RER A;  3CXC A;  3JB9 J;  2E10 A;  2PVD B;  5LJ5 h;  2EYQ A;  3PT9 A;  2YLC A;  3CCS A;  4C0D C;  1BI1 A;  4M77 F;  2F5K A;  4BE2 A;  3HFN A;  1K73 C;  4M7D E;  2QEX A;  3AHU A;  2E1H A;  1UGS B;  1YBY A;  1K9M U;  4C5G A;  2K3X A;  1G3W A;  4QQG A;  3FIF A;  4X9C A;  3GOX A;  4B9X A;  5I21 A;  3OYG A;  1QP3 A;  3E1S A;  5CQX A;  1XQH A;  3QII A;  2KQW A;  2VC8 A;  3OSS C;  3V8J A;  3S3N A;  3JCM Q;  2DD4 A;  2P0P A;  1B34 B;  3CBM A;  1IRE B;  2QA4 T;  3VYH B;  1SSF A;  3WXM B;  5LJ3 j;  3G71 A;  5FU6 B;  3JB9 F;  4EMK C;  3HP9 A;  3P8B B;  5CKF A;  5M9O A;  4ZN3 A;  5A0D A;  4VUB A;  3CCM T;  2XKO C;  1I4K 1;  4C92 F;  3QSU A;  2RHX A;  1VQ4 A;  3CCR A;  3OQ5 A;  4Z02 A;  2MWP A;  1O9S A;  5FU7 C;  3RES A;  3MP1 A;  3X26 B;  4ATO A;  1QW1 A;  1NE8 A;  2KVQ G;  4C8Q G;  3QBY A;  1VQL A;  2RI3 A;  2CKK A;  1KQ1 A;  3DB3 A;  2CYZ B;  5A0G A;  2O01 E;  2E6N A;  3JAM E;  3I56 A;  2JTF A;  3JCM b;  4C8Q B;  3L2Q A;  1M90 U;  2RI5 A;  2RHU A;  4HCB A;  1VQ6 T;  2HNI A;  3RKW A;  4LDX A;  2RJE A;  3ME9 A;  4YTL A;  3UWN A;  1GXI E;  4C8Q A;  3JCM f;  3OY9 A;  3OYJ A;  5FU6 C;  2KAF A;  2VGN A;  2OTL T;  3TU4 K;  2GFU A;  4O5V A;  5FRO A;  4XTZ A;  1O75 A;  4C5H A;  4QVC A;  4E7J A;  1K73 U;  2DTO A;  1VQK T;  1M8V A;  3CCE A;  3OSV A;  3JCM V;  2JNG A;  3M56 A;  5C0M A;  3CCU T;  2K57 A;  2D9T A;  3HPW A;  1N9R A;  1X75 C;  3FLG A;  3WVE B;  2K3Y A;  3CBP A;  4F7U A;  2DIQ A;  3PFS A;  2Y90 A;  5GAN d;  3JB9 H;  4J6X A;  4XK8 E;  3MO8 A;  4M77 E;  5LJ5 f;  2X4X A;  1UEB A;  4Y91 A;  5CKE A;  3MP6 A;  4EDU A;  4C92 D;  1YHQ T;  2HAX A;  2QEX T;  4RMO A;  3C12 A;  3VUB A;  1VUB A;  4C8Q E;  2XDD A;  2VGM A;  1I8F A;  4C0Z A;  2JZ2 A;  1LOJ A;  4Y28 E;  3LLR A;  4BE1 A;  2MAM A;  1M4Z A;  3ZFJ A;  1FXX A;  1WJS A;  4EMK B;  5GMK h;  2VYT A;  4QW2 A;  4X9D A;  4XTV A;  3JCM W;  1YJN T;  2D6F A;  1VQ5 T;  2RD1 A;  1Q86 U;  3CC2 T;  2R5M A;  2GFA A;  2C06 A;  1D3B A;  3OYE A;  4M77 C;  1G3S A;  2H3J A;  2DTH A;  1X01 A;  1YJW T;  3BDU A;  2RH2 A;  4FIB A;  3DB4 A;  4M75 B;  3E19 A;  3OYM A;  1KG1 A;  2LTO A;  2RM4 A;  3MHX A;  3QYH B;  3J81 E;  3FC3 A;  3OBY A;  1VQP T;  3ZEH A;  4M78 D;  1HXD A;  5CO7 A;  3SWN C;  2CZ0 B;  4J8O A;  4A54 A;  2IG0 A;  2R57 A;  3G4S T;  4BDZ A;  1JJ2 S;  4PJO B;  1XNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...