3OQBA

Crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
380
structure length
376
Chain Sequence
TTQRLGLIMNGVTGRMGLNQHLIRSIVAIRDQGGVRLKNGDRIMPDPILVGRSAEKVEALAKRFNIARWTTDLDAALADKNDTMFFDAATTQARPGLLTQAINAGKHVYCEKPIATNFEEALEVVKLANSKGVKHGTVQDKLFLPGLKKIAFLRDSGFFGRILSVRGEFGYWVFEGGWQEAQRPSWNYRDEDGGGIILDMVCHWRYVLDNLFGNVQSVVCIGNTDIPERFDEQGKKYKATADDSAYATFQLEGGVIAHINMSWVTRVYRDDLVTFQVDGTHGSAVAGLSDCMIQARQATPRPVWNPLHDFYGDWQKLPDNVSYDNGFKEQWEMFIRHVYEDAPYKFTLLEGAKGVQLAECALKSWKERRWIDVAPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxidoreductase
publication title CRYSTAL STRUCTURE OF putative oxidoreductase from Bradyrhizobium japonicum USDA 110
rcsb
source organism Bradyrhizobium japonicum
molecule tags Oxidoreductase
total genus 108
structure length 376
sequence length 380
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3oqbA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3oqbA01
1DJNA 2CUKA 4PG7A 4OH1A 3WS7A 2Y67A 2V6BA 2X9GA 4QFCA 2VZ9A 1R4MB 1O95A 4XYGA 3HG7A 3V1UA 2Q99A 1T2FA 3WMWA 1N92A 3ZWWA 4PVCA 4YJFA 5CFZA 5U9CA 2QW8A 3EC7A 3WGZA 1MLDA 5JAZA 4R51A 1JKIA 1HDOA 4WCDA 5THKA 2NUAA 2HRBA 2O3TA 4NBRA 2X22A 4O63O 3ZV4A 1EVYA 3UUWA 3VAZA 3IMFA 3INGA 1PJ4A 2I5PO 5JS6A 3N74A 4K6CA 4IDGA 4E5KA 3COSA 3VPSA 1I10A 4ND3A 1PIWA 1ZK4A 4TRRA 2J5QA 1YGYA 4LGVA 3QVXA 5J9GA 5T67A 4WCFA 4NH4A 4WK6A 3UF0A 2PLAA 4DBZA 1A4IA 5HRUA 1D3AA 3JQ7B 3ANLA 4DPKA 2BRUA 3GNQA 3FCOA 1KY5A 2VZ8A 2E6UX 2GDZA 4YRDA 1AXGA 1GUZA 2PGJA 2D59A 1NAIA 4R1SA 1BWSA 1O89A 5C7OO 2P4QA 2QRLA 1R4NA 4YEDA 4CMKA 1TI7A 4JROA 2NTVA 2GLXA 2O3JA 5CPFA 4ZQHA 2GO1A 5KJEA 3Q9NA 2CVQA 2NSDA 4UEOA 3S8MA 1XA0A 1HLDA 2QX7A 4AICA 1K6JA 3I52A 2HJRA 4YB8A 4R9RA 3SX2A 1RYEA 1JLLA 1OC4A 1JVBA 1D1TA 2A94A 2JKVA 3KLPX 4L4RA 3ANMA 3M2PA 1X0VA 1GADO 4J91A 5BNFA 4NHEA 3FR8A 1JVSA 1PEDA 5AXAA 1O0SA 4YVFA 2VYVD 4DTIA 2SCUA 3ZU5A 3LT4A 3RWBA 4BMSA 2OL4A 5FI5A 4OIMA 1XG5A 2TMGA 2DC1A 1YONA 1KVTA 2IE0A 3GZNA 3KSUA 1IOLA 2CD9A 2PGLA 3UCEA 5G0VA 4NJMA 2VUTA 1A5ZA 1RM3A 1I3KA 4PLVA 2IEDA 3DTTA 4OOFA 2HCTA 4YACA 1YJ8A 5GY7A 1PS9A 3RCBA 3RU7A 1ISIA 1SCUA 3ADOA 3CEAA 2E82A 1XQ6A 1IHYA 4K26A 1LLQA 2HMSA 4NPCA 4R16A 5TJ9A 3ZW8A 4RJTA 2GNAA 3CIFA 4UEKA 1KS9A 4WASA 3VVCA 2NU6A 3W4JA 1O8CA 2GN4A 1C1DA 3E9MA 1I36A 3H9QA 3JV7A 4K1LA 2VHYA 4FDAA 3PFFA 4QO8A 4BNKA 3FWNA 5MGBA 3RUCA 1N5DA 3H8VA 2DUUA 4BB5A 1PZEA 4NDNE 1FDVA 1GL3A 3WDSA 2V6MA 2HMVA 4HY3A 3ZW9A 1BW9B 4JP3A 4MKZA 4B7XA 9LDTA 5KVCA 2I76A 1Z45A 1LLUA 3GUCA 4E5NA 3LT1A 4FPXA 3HQ4O 4IZHA 3WOHA 5KCZA 3U4HA 2QZZA 4KWIA 3H5NA 1KETA 3QRWA 1LLDA 1X1TA 4OAQA 5CEEA 2BHLA 3CPSA 3PHJA 4XCVA 4C7JA 4LVUA 5DCUA 3S55A 3VVBA 4HXYA 1WP4A 2YQ4A 1VL6A 2W90A 4DVJA 1YO6A 4Q3CA 1UXKA 2JHGA 3HDJA 3ICCA 3JQ6A 4IS3A 1T2CA 2AHRA 1IUKA 3TQHA 3I23A 3ZV6A 4RF5A 1DLJA 2Q49A 1BXKA 2W2KB 2DPHA 2VHZA 3DHNA 3VDQA 4D45A 1GCUA 1E3SA 4CV3A 1RM4A 4DLBA 4FBGA 2GSDA 1SEPA 4KUEA 4U7WA 4D0SA 1KEVA 1WZIA 1GTMA 5EPOA 1OBFO 3RSHA 1YJQA 2JHFA 4J16A 4J4TA 3IQDB 7MDHA 2V6GA 3W4IA 2VYND 1M66A 1YKFA 5A02A 4FJ1A 1BG6A 5IXSA 3DB2A 1YE3A 2O3SA 2PKQO 1VRWA 3WYCA 3AUSA 3LT0A 1YXMA 2AMFA 3CINA 3Q11A 5A03A 1LDYA 1WMAA 1FMCA 3G49A 3JQGA 5JSFA 3IIEA 1HTBA 1FF9A 1SZJG 5HS6A 3ZHZA 4AJEA 1TXGA 4BNVA 4FR5A 2CZCA 3BIOA 2CSUA 2NU7A 2VQ3A 5C7IO 1N9GA 2NM0A 3ZWOA 4EGFA 1KEPA 1M2WA 4BOYA 3VC7A 4AG3A 5I7SA 4PRLA 4FB5A 1LLCA 3H65A 1LDNA 1VC2A 1P3DA 3TZ6A 3ZNQA 4E12A 3PYLA 4E0BA 4W4TA 1DFGA 1ZFNA 4YCAA 2QYTA 2AEFA 2Q1SA 2Q2WA 1X0XA 4WEQA 3ZWAA 5DCWA 1SOVA 2B4TO 5H82A 3V2GA 3TF5A 2ZKLA 1NAHA 1NHGA 3TZKA 4CL8A 3JD2A 3NTRA 1ID1A 5BNTA 1P1HA 1X7HA 1DLIA 4CLXA 4RDIA 2AE2A 3EAGA 2V7PA 4CLHA 1ZK3A 3EK2A 2Y1FA 4ROSA 4CMIB 1G1AA 2FRDA 3ZU3A 4GMFA 4OXNA 2D2IA 5JAIA 1W73A 1P77A 4WLEA 1BDMA 4L75A 2HSDA 3RFXA 4CODB 3ETDA 1QLJA 3TFOA 3KYDA 3OIDA 5CDTA 3E18A 3K8ZA 4QXMA 1HDYA 2X0NA 3HDHA 4GH5A 1HF3A 1V3TA 2BFAA 4BNHA 1E7SA 1ORRA 3H9EO 5B4VA 3LVFO 1YB5A 3BMQB 1HZZA 4IBOA 3LT2A 1P9LA 3K9QO 3K2EA 1JTVA 1PZFA 1XU9A 1UDBA 1T2EA 1QV7A 1LDGA 1ZXLA 4L74A 3FTNA 4M49A 2OO5A 3JQAA 3BMCA 2PWZA 5EERA 1GQYA 3L77A 5JDCC 1Z74A 2O4CA 3NTOA 3GF4A 3OJ0A 4BGIA 1JA9A 2ZB7A 3HADA 5L95A 1VJTA 5JYAA 1GZ6A 4Q3EA 4IQGA 3NRCA 4DUPA 3CMMA 4A27A 3PQFA 2VHXA 1ADBA 2FN7A 3OFSA 5ENDA 4XJSA 1UP6A 3HHPA 1ISGA 4TROA 5JO0A 1X7GA 2F00A 2E48A 4YJGA 5TLSA 3RUAA 5IG2A 2GR9A 1IZ9A 3PGXA 2DPGA 1Y8RA 2PNFA 3PEFA 4I5GA 3TZCA 3AI2A 5GZ6A 3NGLA 4A26A 5ICMA 3KV3O 1SMKA 4KZPA 3KYCA 1GY8A 3JQCA 3O4RA 2DM6A 2NU9A 4IY1A 1X7DA 3HSKA 5IN4A 4TSKA 4FFRA 4ZQFA 4B4OA 2BI8A 3MOGA 4FFNA 4P4NA 2AQ8A 1E3WB 4CLRB 5AYVA 2OMEA 1RJWA 3GVCA 3UCXA 5ADHA 3MJCA 1MC5A 1X15A 3AU9A 4MKXA 2LDBA 3FBGA 1E7WA 2VWHA 4JLWA 1D8AA 3DZJA 1Q0QA 2O3QA 4J2OA 4IINA 5ER6A 3SBOA 1QMGA 2I6TA 3EY4A 3T4EA 3EVNA 1KY4A 4BS9A 4L8VA 2NV6A 3DTYA 4NBVA 2J6IA 2DAPA 5CHEA 3W8FA 1NQAO 2JCVA 4J3FA 1E5QA 3ONDA 1KOLA 5A5EA 1HRDA 3PXXA 2G0TA 1DSSG 2AEMA 4UUNA 4ESOA 1EK6A 3ZU4A 3WTCA 3K2BA 2I99A 3GPIA 3VZSA 2Y99A 4BNTA 4ZRNA 3Q2IA 2HMWA 1YBVA 4XKJA 2OGUA 1XYGA 4PLHA 3GGPA 3N7UA 1ISJA 3KHUA 1LC3A 5KVVA 1UZMA 3JQFC 1ISFA 4PG5A 4UEJA 1M67A 4FJ0A 3HB5X 4Y6RA 1PS0A 4LMPA 4DWVA 4AJIA 3BTUA 5COBA 3VH3A 4IQ0A 2VWQA 1RPNA 1R37A 1EBFA 2ZYAA 1E3LA 4WLOA 3ZWXA 4XYBA 3CSDA 4IJWA 4Q9NA 4KUHA 1EE9A 5JYDA 2GGSA 3OA0A 2Y1CA 4HP8A 3WGYA 5CEFA 4A2CA 5H83A 1Z7BA 3EVTA 3IUSA 4IDEA 2XXBA 4RVDA 3LC2O 1Y6JA 4BO2A 4CMEC 4J9UE 3F1LA 3ETEA 1P45A 4DIOA 2Q45A 1F12A 1LXCA 3I9KA 1MGOA 5IZCA 1HL3A 4XA8A 3NEPX 4M54A 1NR7A 1EK5A 4CPDA 1FXSA 2QQ5A 1YQDA 2VNSA 3DBLA 5T57A 3O26A 1A7KA 1EUDA 5KWEA 1Z82A 2IRWA 2W8ZA 3PIIA 3GEDA 4EJMA 3KUXA 1BXGA 3U0BA 3FI9A 4DPMA 1ULUA 3S2GA 3D5TA 1HXHA 4BV8A 1NWHA 4D46A 5I7EA 2A92A 2J3HA 3NJ8A 3LDHA 4MO2A 1MXHA 4F45A 1GU7A 1QYXA 4LSMA 4TVBA 3UICA 1NFFA 4XJTA 5L9AA 3A14A 4GX5A 5A3JA 3ANNA 2X0IA 4I1IA 1DPGA 2HK7A 1CQJA 1F17A 2D8AA 2G17A 2OORA 3DBRA 3PFWO 3JD3A 1TT5A 1Y8QB 5IJZA 2EEZA 1P44A 1OOEA 3RD5A 3TL3A 1PL8A 1PGOA 4O0LA 4JP2A 3GG2A 3GUYA 2FOIA 2JD1A 5IXYA 3AY6A 4D44A 2VT2A 1ONOA 2WM3A 3IJRA 4XWYA 3ZU2A 1T4BA 3AK4A 3DBHA 4AJLA 5T64A 2J3JA 1V0JA 2Y05A 3PJFA 2FSVA 2W2LD 2B0JA 5L45A 3WMXA 4BKQA 4K6FA 4N5LA 1QKIA 3PPIA 3Q9UA 2O48X 4Y6PA 1NWCA 1PJTA 4RLHA 4W7HA 4YAKA 3D3WB 2GN6A 1HE4A 2QG4A 3MEQA 1T4DA 3QWBA 1A7AA 4ALIA 1B3RA 1T2AA 4PGFA 1ENOA 4ALKA 1Y9AA 1LDMA 2JD0A 3DFZA 3WWYA 4CJXA 1GV1A 2Q1WA 4Y98A 1NQTA 1QLHA 2DTDA 2EP5A 3ROQA 3ETGA 1VLLA 3VTZA 1NVMB 1A9ZA 1N1EA 3GVPA 3KRTA 2DQ4A 3RBXA 4I5DA 4ZN6A 3ZWBA 2BFMA 4R54A 4A03A 1Q7CA 5A9SA 1U3UA 1QORA 4EZBA 1QSGA 1IY8A 5AOVA 4E2XA 1KC1A 4CM9D 5F3RA 4WKGA 2O7SA 1EUZA 2I67A 3U4IA 4MVJE 3DR3A 2EW2A 1T25A 3OICA 2FY8A 4W6ZA 4BIIA 2DBVO 5G0SA 5IZCC 1HETA 3H5RA 5I8ZA 2BGMA 2EWMA 3Q3CA 2DBRA 3PHGA 4NZ9A 3M1AA 3H4VA 5DT9A 3VZQA 1UXIA 3ONFA 2AG5A 1ENZA 3K73O 2CDBA 3LLSA 4R3WA 1D1SA 2HU2A 3QWHA 3ZWCA 4IJVA 4NNJA 4D3FA 5ICSA 1AGNA 1B2LA 4CM8A 1F14A 4PLGA 4OOEA 3P2OA 3RC9A 3ZWYA 1NM5A 5AXBA 2AQKA 1FDTA 1UZNA 3S2FA 4JXKA 2B37A 2X7HA 4B8WA 5KVSA 3DZIA 5EMHA 1WXDA 1YH3A 5F1PA 3TDKA 4XQGA 1F0YA 5LDHA 1MFZA 3OMLA 4QO7A 4E2YA 4M1QA 2FP4A 1GYRA 1LNQA 1GD1O 2X5KO 5CDYA 2C2YA 3LQFA 5TRTA 1ZK1A 3G1TA 4YT5A 1DAOA 4ND5A 3U49A 5ITWA 1XR3A 2YHIB 2I65A 2OOSA 2OBYA 4XIYA 3VZRA 1QR6A 1HYGA 3ZI0A 2YV1A 1EVIA 4JJGA 4W82A 1DAPA 3KVOA 1YBMA 3PZRA 1WWKA 1QYCA 1XDWA 4CM4B 2O23A 4H7PA 3S1LA 5IDXA 4I5FA 3BMNA 4IIVA 5AVOA 1DIGA 3DZBA 1B8UA 5B37A 3DZKA 1YDWA 1P1RA 2DVMA 4LISA 3A9WA 4CLOA 1LRKA 3PDJA 5TJHA 2PZMA 5JMWA 3L9XA 3BMOA 1C0PA 5A1TA 2GERA 5G0UA 3QWIA 1AUPA 3BHIA 3W1VA 4BKUA 2RHCA 4IM7A 4J1NA 4BQPA 4E21A 4EYEA 5JCJD 3AY3A 5TGDA 1MG5A 4DGSA 3D3EA 3ZNPA 1YB1A 4LSWA 4WPGA 4K28A 4CV0A 4TKLA 1JQBA 4JCOA 5G0WA 3L6DA 3OHSX 3GLQA 4J7XA 5COAA 1PJ2A 9LDBA 2RH8A 4DREA 1JU9A 4EITA 4J43A 1GYQA 4GVLA 3VPXA 3C1TA 1DOHA 1LQTA 4DXHA 1R4NB 2B36A 1MB4A 2Y1GA 5K9ZA 2BFPA 4Z0HO 1ADCA 1XSEA 3HN2A 4RVUA 4PLWA 1E1KA 4NMHA 1I33A 2JAPA 4XR4A 1ZJYA 2WWRA 4ZQGA 2GZ2A 1WAMA 3HUDA 3R1IA 2C5AA 2FPPA 1PTJA 3GY0A 4O1MA 3SJUA 2BGKA 1UR5A 2JJYA 1PJ3A 4BNXA 3MTJA 1ZZEA 2Y68A 4DMLA 4RL6A 3VTFA 3INRA 3UCFA 3D7LA 4HADA 4DBVO 2IXAA 3RIHA 3TSCA 2W98A 2Q2VA 3WQRA 3GNTA 2HJSA 3DZFA 3ZHYA 1P74A 4IJKA 1PL6A 2RH4A 4PRKA 3H6KA 2X5JO 2X9VA 3D4PA 1EBUA 4NJMB 6LDHA 2H1SA 1ZEMA 3WBBA 4MVJI 1Y81A 3C7DB 4A10A 4AJPA 1I5RA 1PR9A 1D7OA 5KIAA 3DMTC 1X13A 3GG9A 1G0NA 1PJLA 4UUOA 4B7CA 3UAGA 5L4NA 5IAAA 4XGIA 1EVJA 3VH1A 2G1UA 4NR0A 3MCVA 1UP4A 2ZJ0A 3BHJA 4G5HA 3QSGA 5JAMA 3P19A 2ZCVA 1DXYA 3ZN2A 1ADGA 1XEAA 1B8PA 1OMOA 4BNZA 2UDPA 4PLYA 3JQ8A 1I0ZA 4F6LA 5I9NA 3NGXA 1IB6A 2O2YA 1CRWG 1DIRA 3GHYA 2DUWA 4FN4A 3JYNA 3RJ5A 4DIBA 5BSGA 3JQEA 1TT7A 1UDAA 4O5OA 3B1FA 4CV1A 4OMUA 1TB4A 3AM3A 3BXXA 3F6YA 1LRLA 1ONNA 3JD1A 4Z0TA 4O59O 2C5EA 1R4MA 5CP8A 2DTEA 3HWRA 3K30A 4EDFA 2EKLA 4BNIA 5BR7A 2EG9A 4FFMA 3U62A 4EEXA 4Q3AA 1H2BA 4YQZA 4HNHA 3VZPA 4BO9A 5JC1A 1HYEA 4GI2A 5JY1A 3QE3A 4EI2A 4GGPA 3S2EA 1Q0LA 3QLJA 4YDRA 1LSJA 1VPDA 3PYXA 2X0JA 4Y67A 4YT8A 1U5AA 3JQ7A 4MKRA 1NVGA 3WYBA 3NUGA 1NBOA 2CMDA 2Y0EA 4AJ4A 3PHHA 4DRYA 5B12A 1ADFA 5IFLA 4FC6A 3PHIA 4XB2A 2IEBA 1JKJA 1V35A 4IIUA 1XELA 3SLGA 4BNNA 2AW5A 2O4UX 3OJFA 3DHYA 2VRCD 4BO4A 2VUUA 1T2DA 1BRMA 1NQOA 1PGPA 5IZ4A 3ENKA 1V3VA 5F21A 3WNVA 2JAHA 3IL2A 5CG2A 4WCFC 2FWMX 1ZO8A 4DA9A 2YZ7A 1GEGA 5JO9A 3WBFA 5JW6A 2ZB4A 1ZW1A 2BI7A 2TMDA 1IHXA 2ZTMA 3HN7A 1YOVB 3ULKA 1PS8A 3U9LA 2AQIA 3QV1A 2GD1O 3DO5A 1U9JA 4TVOA 3WGOA 4Z9XA 2YJZA 3F9IA 3L4SO 4CQMD 3DFUA 4MIEA 1GCOA 4NK5A 3NX4A 3ZGYA 5MDHA 2Y0DA 2J5RA 4CLEA 3E9NA 1GPJA 3PRJA 4RF4A 5A4DA 1ZXBA 4IPTA 4DIFA 1JWAB 4IXWA 4RPGA 1E92A 3C7CB 1DFIA 4M87A 1LBEA 3WNQA 5KOIA 4AFNA 1U3VA 4PLZA 1VSUA 1BSVA 1GYPA 3MOIA 1DB3A 4NFSA 2B83A 1H6BA 4HNGA 3CMCO 4IS2A 1GZ3A 3T7EA 1KBZA 1A9YA 5IDWA 1XCBA 4EEZA 1H6DA 3KOUA 1VKOA 1DJQA 3JYLA 4ID9A 3KXDA 5CPBA 2DTXA 4OO3A 2DFVA 5DCYA 2J3KA 4PG6A 2QYSA 2WD7A 1TLTA 1G6KA 3GMDA 4NFYA 4R1NA 3A1NA 4ND2A 4BV9A 2WD8A 4I8XA 2BLLA 3OP4A 2FPIA 4UVHA 3PYMA 2OFPA 3DDNA 5K6AA 2Q50A 3BTOA 4D43A 3G1UA 1PGJA 3WX0A 3TL2A 2Q46A 3ABIA 3OQBA 8LDHA 3RC1A 4XRRA 2C20A 3GEGA 5HA5A 3DL2A 2Y1OA 3C85A 3F4BA 4WOJA 2BELA 4OL9A 1N1GA 1BW9A 3W8EA 1UUFA 2VCYA 3AM5A 3VHRA 2NVUA 4A5OA 4JQCA 2ZJ1A 1LC0A 2HK8A 1CIVA 1I01A 1ZH8A 2Z95A 3IKTA 4FOSA 2QZ9A 4EUFA 4WOKA 3KSDO 3WG9A 3AOGA 4JGBA 1QYDA 3OM9A 4RLSA 3OECA 5BSEA 2D3TA 3OEWA 4DLLA 4CR6A 4RVHA 3UXYA 1PSDA 3E5MA 4TKMA 1YVEI 3TRIA 2QHXA 2HLPA 3AU8A 3ORFA 1U1IA 3ROKA 3WSVA 1I3LA 1VL0A 4MVJD 1FJHA 4HKTA 3V1TC 4BNMA 2HO5A 2X6TA 1CJCA 3F5SA 4NBWA 3O38A 1YS4A 5HWSA 2R2GA 4PZDA 4A7PA 2B4QA 5AXDA 5L4SA 4UVEA 4XYLA 4P8RA 1UJMA 3JYOA 2W4QA 4BO0A 1N7GA 4U6SA 3U4CA 3F46A 4OSOA 1R6DA 3K5PA 1QP8A 4BMVA 5AQ1A 1SEVA 3D0OA 4ALNA 3DONA 1NFQA 4RPHA 3WLEA 5JCXA 3W6UA 1VJ0A 3I9LA 3MJSA 4AJNA 1LSSA 4R3NA 3PQDA 5ES3A 3GFGA 2Z1MA 5JLAA 3QVTA 4NFHA 5GMOA 4E2ZA 1NTOA 2YV2A 3EUWA 3RKRA 1K6IA 3CTMA 4CM1A 1K89A 3EHEA 1P1KA 2GCGA 4AJ1A 4Z9FA 2IXBA 3GAZA 5TIIA 2X58A 5F5LA 4KDEA 3WWZA 1VI2A 4LK3A 1BVRA 3M2TA 4MVJP 4GPD1 5JFOA 1DFHA 5K6AC 4OKNA 2AQHA 3AFNA 1K0UA 3AJRA 2O7QA 1PZHA 2ZYDA 3HFSA 4YAIA 2YQ5A 4LRTB 5BT9A 3WTBA 4EUHA 2C7GA 2D1YA 1KIFA 2BD0A 3GN2A 2EKQA 4BNWA 3A28A 3VPGA 2GZ3A 3RC2A 3FNHA 4UVIA 2OP1A 2QRJA 3UGKA 3I5MA 4G81A 3LLVA 3V8BA 3MTGA 1VSVA 3E6AA 1NPTO 1JAYA 4E5YA 3D1LA 3CXRA 3ROPA 1C0KA 4YJHB 3ONEA 4M89A 4KQWA 4B8ZA 4DQXA 3GVXA 2X9NA 1HE2A 1E6WA 5KKAA 3KLMX 4LCEA 1PQWA 3C1AA 4QTZA 2Y1DA 3GRPA 3DHEA 1R15A 5B4UA 4BNYA 3NDIA 4NQZA 3BHMA 4JX8A 5T5QA 5KVQA 2EJVA 1IYZA 3GQVA 5G2OA 1MC4A 4IXTA 1TA4A 1GDHA 1J0XO 4BUCA 1CYDA 4CM7A 3JQBA 3L6EA 5A3VA 3SVTA 2PZKA 3W6ZA 1WPQA 2H9IA 2YW9A 3Q2KA 1VJ1A 2VOEA 5A06A 4FOOA 4UREA 2Z1NA 3OETA 3PJDA 1DDOA 3ASUA 1YL5A 3IP3A 3AFMA 1V6AA 4RPJA 5LDGA 4NK4A 1GR0A 2GZ1A 3WJAA 3Q1LA 3JD4A 1GFSA 2PZJA 2R6JA 3EZLA 3W8DA 5JNLA 3O03A 4BHTA 5GZ3A 4MJLA 5DP2A 1UDCA 4BKRA 5BSFA 4KUGA 1B8VA 3H9UA 1JDJA 3ITKA 3ZHXA 4HFJA 4CUKA 2BMAA 4C4OA 3GK3A 3OSUA 2FZEA 3DBLB 4J0FA 1M76A 3CUKA 3OQ6A 4HFNA 4L76A 4N5NA 1DIHA 1Z6ZA 4F3YA 2Q1UA 2ZK7A 4TWRA 3SC4A 4IGEA 4YXFA 3FNEA 4FGSA 4PLPA 3KEQA 3PGJA 1SOWA 4R9SA 5DN9A 1XHLA 4U0JA 4BGEA 2HQ1A 1VKNA 1K3TA 1F8FA 3HJAA 4XQEA 1ZK2A 2P5UA 4L9RA 2P91A 4CUJA 3GRKA 2Q22A 1V9LA 4QEDA 4YJDA 1QYWA 1J4AA 1CQIA 5HS4A 3VPFA 4OXKA 3H9GA 3OJLA 1E3WA 4WLFA 4D7AA 4CLRA 3CH6A 1YDEA 4NG5A 3PWSA 4XYMA 1EFLA 2G5CA 1H9AA 3AWDA 2VTEA 3KM0A 2X0RA 1C0IA 4HFRA 2PH5A 3KB6A 2OUIA 3X2FA 2EHDA 3UKOA 2BF7A 5HBRA 3GAFA 4Z6KA 3JSAA 2WE7A 3BAZA 3WFIA 5A9TA 5DNAA 4WNIA 3FNGA 4B4UA 1P1JA 4WLNA 4XZ3A 1C14A 1GUFA 3FWZA 4PZEA 3KTDA 1E6EA 2I3AA 1IULA 4KWHA 2Y66A 4I9UA 1R66A 2ZTUA 1XU7A 4JJIA 3WICA 1DIBA 3HFGA 4J90A 5B1YA 1OAAA 1T26A 1O9BA 4RVFA 5ER9A 3GPDG 3JQBC 1Y9EA 2EV9A 3HDQA 1CDOA 2YV3A 5TNXA 4R69A 3DAFA 3VKVA 4WJZA 5KJ1A 1SAYA 2OBNA 4MINA 2XOXA 5C7LO 1ZSYA 1I2ZA 1VL8A 1DC4A 4UAGA 4I5EA 4R01A 4IDCA 4F46A 1UXHA 1DIAA 1QRRA 5C37A 2O2SA 4BKPA 3A4VA 1KC3A 1EZ4A 5F1KA 4XYEA 3JTMA 3WIEA 3GGGA 2V65A 5DBFA 3F3SA 4CQMB 4NU5A 2X1HA 3EMKA 4IQ8A 1UAYA 3IC5A 3E9QA 1E3IA 2C2XA 4BMNA 4XRGA 2ZYGA 3PDUA 4ZRMA 4ALLA 2VYVA 4RCVA 5I8WA 3ZV5A 3TN7A 2J8ZA 2PGDA 2DBQA 2PA3A 2ZB8A 3FBTA 4INAA 1EDOA 5J23A 4EUEA 5TX7A 3IKVA 3B70A 5L53A 2ZB3A 4J1TA 2UAGA 1IZ0A 1U8FO 3RFTA 4JK3A 3OIFA 1U2DA 3MJ4A 1C1XB 2FR1A 4D3SA 2VWPA 3HNPA 4CQLB 2HKIA 4MIYA 3O8QB 3P2YA 4XQ9A 2GN8A 1J6UA 1HE5A 4RO0A 3H2ZA 3NTQA 4YRBA 5G4KB 1KVQA 3STHA 4DMMA 4BO1A 1I32A 3RJ9A 1MXFA 2I66A 2WMDA 1Q7GA 3WGQA 3WFJA 3R3SA 4LMRA 4RPLA 3G17A 3E8XA 4GLLA 4IDDA 1MUUA 3JQAD 4ZJUA 4U0KA 2G76A 1U2GA 2NADA 2EIHA 3DZGA 1EDZA 1ZIDA 2NWQA 1ZSVA 5CEJA 1AE1A 1CWUA 1KEWA 1T1SA 3DBVO 1LRJA 1NNUA 3FD8A 1GQ2A 1NPYA 2C07A 1Y8QA 4WE3A 4PFJA 5JC8A 2NQTA 1K6XA 5A05A 4YAEA 1SO8A 2ILTA 3NDJA 3V2HA 3C1OA 1HZJA 4IJUA 4MVJM 2XF8A 2DFDA 4JIGA 2GF2A 5C3MA 5I9MA 1U3TA 1KERA 1UXJA 1ML3A 3E1KA 3N58A 1ZVMA 4IMRA 4WLVA 4PIVA 1H5QA 2NVWA 4HV4A 3KSZO 4J2HA 4UUPA 1WDMA 3RASA 1ONPA 3FRJA 2FMUA 1GV0A 4OQYA 4P4GA 3QW2A 4II3A 2WJPA 4O6VA 3TOZA 2Q2QA 4BVAA 4EJ0A 1YBAA 4F6CA 1HWYA 4R41A 5A04A 1Q0HA 3D3WA 3GVIA 4NBUA 3H9JA 1HDCA 3M6IA 1RWBA 1U5CA 4GLOA 1AXEA 2H5LA 3K92A 5L3ZA 2PY6A 4BO6A 4JNKA 3RQSA 1AHHA 1ISMA 3QA9A 7ADHA 2HMUA 5KNLA 1I30A 1X1EA 4RGBA 4MPDA 4YJFB 3AUAA 2VOJA 2NVBA 5U4QA 1E6UA 3OJEA 1SPXA 3DOOA 3JQ9A 3PQEA 4OYRA 2VYNA 4L73A 1RYDA 5H81A 1R0KA 4KTTE 4RZIA 5DP1A 3B6ZA 3ZNOA 4E3ZA 1GAEO 1NXQA 5JYEA 2X8LA 5JY6A 4D41A 4XEHA 3FPCA 4WCFB 1HDZA 5L4LA 2C59A 3RUEA 2OP0A 5DOVA 1NPDA 4TRMA 4GKVA 1PJCA 4FW8A 1D4FA 4AJJA 4FD3A 4X54A 2V6FA 4AL4A 1YWGO 1DRUA 1T1RA 1UXGA 2G82A 1U4SA 4HWKA 4TRJA 3FPLA 4KQXA 4RF3A 4B7UA 3QHAA 1DC5A 4TZKA 3WIDA 2EP7A 3TOXA 3TZQA 3HE3A 4EBFA 2P68A 4I9NA 3QWAA 3KO8A 1DRVA 1P31A 3PLRA 2YFQA 5ILOA 2B69A 4PCVA 1E1MA 1NYTA 3LU1A 4W99A 1U28A 5T8KA 4M8SA 2RAFA 3WLFA 4BO7A 1PX0A 4ZA2A 2IZZA 1EEHA 4TRNA 4PN3A 2DT5A 3PWKA 2JCYA 1L7DA 3DQPA 3VDRA 4P22A 2YHIA 4Q3NA 4CMAA 4UVGA 3ZWNA 4LW8A 4WUVA 4UUMA 3V2UA 4JBHA 2P9CA 2WTBA 4BNLA 4YQYA 4CM4A 2QIOA 2EW8A 4GAEA 4HFMA 1SB8A 1K2WA 3ROMA 4DYDA 2Z5LA 1R0SA 3NYWA 3AI3A 3VPHA 4CM5A 3GZNB 3UVEA 3OIGA 4OKIA 2PD4A 3WJ7A 5IF3A 3DXFA 4MIOA 3LZ6A 3MJEA 4BO3A 1P1IA 3U3XA 3A06A 5HTOA 1B14A 4RORA 4KP7A 3OQ1A 2VHWA 4XQCA 3ZWMA 4DLAA 5A5FA 5HM8A 1M6HA 2UVDA 4YT2A 2PD3A 1C0LA 1YL6A 1ENYA 1DC3A 3DOCA 1NFRA 4ONEA 2FHSA 3AUTA 5JXWA 3BZUA 2HAEA 1LX6A 3WYEA 1I2CA 3GA0A 2ZTLA 4BKOA 3B1JA 2CDCA 3DMYA 4OM8A 3JYQA 1XQ1A 4Q39A 5THQA 1GUYA 3LYLA 5K0ZA 2EXXA 3JQ9C 3W4KA 1KYQA 3RBVA 1CEQA 4IDFA 4J7CA 4D79A 1JAXA 1EVZA 4GL4A 1C1DB 1H0KA 1O94A 2FPGA 4K9DA 5IDQA 2EGGA 3C3XA 4KTVE 5L51A 1B0AA 2AE1A 4E2WA 1HDRA 1U7TA 4QUKA 4RQTA 3FHLA 1J5PA 4R1UA 1PWZA 4B3HA 5C5IA 2R00A 1Z73A 3C24A 3TNLA 5ENVA 4PLTA 4B3JA 1P33A 1JKFA 1O5IA 4KOAA 2H6EA 2B35A 5COQA 4JN6B 3IOYA 3Q6IA 2Q4EA 4BO8A 4E31A 1WNTA 2IZ0A 2VWGA 5KJCA 1ZCJA 4Q3BA 3V1YA 5FYDA 2PKRA 3ZCXA 4UULA 3CKYA 1E7RA 1N7HA 2PR2A 3ENNA 1W8DA 4OJNA 1XKQA 4ND1A 2IODA 3IUPA 1PJQA 3QVWA 1QYVA 1TEHA 1LU9A 4ILKA 4XX0A 5DULA 3RFVA 4YWJA 4EW6A 1DC6A 1HDXA 5L7WA 3WXBA 4CMCA 2P4HX 3FNFA 3H7AA 2ZTVA 1NX6A 2J5KA 4IDAA 4OQZA 4NIMA 4PLCA 5T8KC 4NI5A 1ZEJA 3R0IA 1C3VA 2XAAA 4RVSA 4GVXA 3ZDFA 2ZATA 4LN1A 4LVCA 2CNBA 2WEKA 4GBJA 5KTKA 4MDHA 4XR9A 2NLOA 3AM4A 5KJ6A 3R3JA 1A72A 4OXYA 1BHSA 4U5QA 4ALMA 4CV2A 3U09A 2WD7B 2E37A 4YRAA 5BSHA 2ZIZA 5JAQA 3SLKA 2EF1A 3L9WA 1IPEA 1H2HA 4D3DA 2JFGA 3JQGB 3DC2A 2RIRA 4IDBA 1NASA 3H5AA 3I6QA 5G0TA 1HE3A 1FDWA 1SB9A 1WLYA 5EINA 3I1JA 3I4CA 3MWEB 5ITVA 1S7CA 3MWDB 2CDAA 3PJEA 2VT3A 5TT0A 1ZKMA 4ND4A 1FDUA 1N9GB 4RPKA 1E1NA 3UH1A 5CDUA 4A73A 3QIVA 2NACA 3UW3A 4YAJA 3ZZNA 4TMFA 2NVUB 4Z3DA 2CY0A 4BL5A 3RAJA 2PTGA 3HB4X 3I9OA 3R6DA 4URFA 4AJ2A 6ADHA 2DU8A 2D0IA 3ITDA 1R0LA 2Y93A 1ULSA 3F5QA 3GNSA 3TPCA 1WZEA 3IAHA 4GWGA 2HMTA 2LDXA 1L1FA 3GZ4A 3WQSB 4CM6A 3NT5A 1PR3A 2AG8A 3EDMA 4GX0A 2R00C 2E4AA 4NBTA 1TVEA 5I9LA 3KYBA 3AOEA 1NHWA 3GFBA 3RUFA 3I3OA 3PWZA 3OJOA 4E6PA 3C7AA 4E30A 4M55A 3T4XA 3OA2A 4CMBA 4BNUA 3P7MA 1XLTA 3CZRA 3HZZA 1IL0A 2C0CA 5FWNA 4C7KA 3PVZA 4MP6A 4W9NA 4QX6A 5AXCA 4PVDA 4N5MA 4J6FA 3K96A 3E5RA 3NDRA 4AVYA 4ZGWA 1P0CA 4ALJA 3DOJA 2XXJA 1ZNQO 3I9MA 5BNIA 3I6IA 4R4JA 1DHTA 2JFFA 2YY7A 3D64A 4S1VA 4J7UA 3KYDB 1Z7EA 5JDCA 1ZMOA 1YOVA 4G65A 1OI7A 2PH3A 4GGOA 4ZVVA 3X2EA 4U6QA 4QT0A 2PK3A 3ZV3A 1HDGO 4M86A 1R16A 3WR5A 4CL3A 4YR9A 5EJ2A 4GQAA 5LC1A 1PU2A 1LDBA 1BDBA 5T73A 1ENPA 3GR6A 1WMBA 3JQAB 3BMCB 2Q4BA 4MOWA 5I7VA 1MA0A 2W2KA 4DC0A 1L7EA 1MG0A 3L4BA 5EN4A 4DC1A 2ET6A 4QQRA 1W6UA 5DDIP 3UN1A 1HYHA 1EQUA 1V8BA 4OSPA 5DBGA 2EKPA 2FSSA 1EFKA 4N54A 5DZSA 5EL0A 2IDZA 4ZHSA 2WYWA 4WNCA 3PJGA 1RKXA 3C8MA 1EE2A 1LA2A 4YJGB 4FGWA 2UYYA 2C82A 4YA6A 2W2LA 2P9GA 3U4DA 2IYOA 3RC7A 3BYZA 2JCXA 3IS3A 1RM0A 1Y8RB 4B3IA 1XWFA 4BGVA 1H9BA 4KDFA 2WSBA 1E7YA 2C54A 3KYCB 1XGKA 3T7CA 3S2IA 4L0QA 3GH3A 2FR8A 4RVGA 1MV8A 2Q3EA 2F1KA 3FSRA 2JL1A 1LDEA 2VNAA 4U8GA 2O50A 3PHLA 3TJRA 1ZK0A 2UUOA 2CF5A 5JPIA 2WDZA 2ZQYA 3WB9A 3AOEC 3FF4A 3GEMA 5T6BA 1PJBA 5L7YA 4FIZA 4ZQEA 4ZD6A 4DL9A 3QVOA 3GN1A 4DPLA 1G0OA 3D5QA 4J4HA 1LEHA 3E82A 2OZPA 3RVDA 1FK8A 1DRWA 2I9PA 1NP3A 4E33A 1Y5MA 4W9NC 4N7RA 3AY7A 4XIJA 5EESA 4CM9A 1BTOA 2CFCA 3ZWVA 3CZMA 3FN4A 4HBGA 1P0FA 3FR7A 2BGLA 3PI7A 4DQUA 1CETA 3SC6A 4AJOA 1P1FA 3JQFA 1CF2O 1ARZA 4HX5A 3WGGA 3NT2A 4OGWA 1E7MA 1Y1PA 2ZCUA 2VN8A 3MZ0A 1I2BA 2A9FA 1SNYA 4CMIA 1PQPA 3U5TA 4L4XA 1H6CA 3DAGA 4YPOA 4JBGA 1T24A 3TFQA 3GGOA 4Z0PA 4B79A 1ZMTA 2BFOA 1B7GO 2Y1EA 3P5SA 1VE9A 2VZ0A 4WLUA 3TZHA 4E4YA 3L4BC 3VKUA 5DBIA 1NQ5A 3LC7O 5TSDA 2OHXA 2Q1TA 5IDYA 1I8TA 4CMEA 3AUUA 3BTSA 5JDIA 1Y7TA 5FFFA 3BMQA 4UVDA 5FF9A 4J9VA 2RBEA 1B16A 2YYYA 1GEEA 3G79A 1WVGA 4DYVA 1Q1NA 5G4LA 3ZHBA 2E49A 2UV8A 3ICPA 1J49A 1E3JA 1PGQA 4YBZA 3WGIA 1KVUA 1U3WA 2GRAA 2PZLA 3GDFA 1N2SA 4XB1A 1NR1A 1BVUA 1NVTA 2B4RO 1U8XX 2X5OA 1F8GA 2D4AA 3EW7A 4BNGA 1B3BA 2CF6A 4CMHA 2NU8A 2RCYA 3SJ7A 1KEUA 4YTEA 4LRSB 1OC2A 3PLNA 3RBZA 1Q2XA 3PK0A 4FFLA 2HK9A 5L40A 3VH4A 5JCJA 3RUHA 1BXGB 4B4WA 4E5PA 4FJ2A 5IN5A 3AW9A 1SC6A 4CMJA 1GQQA 2IZ1A 3RU9A 2JD2A 3GVHA 2D5CA 3PIDA 5CDSA 2B5VA 2BKAA 1H94A 4RZHA 4YJHA 2O3UA 4J1QA 4BNFA 1H6AA 3I83A 3SXPA 3RI3A 1B26A 2P2SA 4R1TA 5JMPA 2B5WA 1ZUD1 4CR7A 5EQDA 3EZYA 3TWOA 1YL7A 3DBRB 2DLDA 1TT5B 4I08A 4Q3DA 1JN0A 3QQPA 4NJOA 3MJVA 1YRLA 3DAPA 2IYPA 2UUPA 3ST7A 3PP8A 1M75A 4D0RA 1LUAA 2NNLD 3AI1A 3PTZA 1AN9A 1U7HA 2X4GA 2XPCA 1X14A 3DBHB 4GSLA 3RUDA 4YT4A 5U1PA 3E03A 1XIVA 4ZQBA 2CVZA 4H16A 1S6YA 3D4NA 2X23A 4Y8VA 1BXZA 3OH8A 1A71A 1MFPA 4BQRA 1LSUA 1QG6A 3PZBA 5I7FA 4H3VA 3KZVA 5JBIA 2J3IA 1ZSNA 5CG1A 4Y6SA 3Q0EA 3DZHA 3K31A 3K6JA 5TC4A 3IP1A 1HSOA 4XGKA 1OZAA 3LF1A 5F1OA 4MVJF 4HUJA 3GMSA 2GPTA 4I9HA 4E5MA 5JDIC 1E5LA 5JE8A 4CM3A 2POQX 5F5NA 4P4LA 4BO5A 3LSYA 1HEUA 1A27A 3JQDA 4WGGA 3NT4A 3NAQA 4YAGA 1MP0A 2C7VA 3NJ4A 1PQUA 4PLFA 4MP3A 2HDHA 3L6OO 3MJTA 4FFPA 4IMPA 5A9SB 3WGHA 3OF2A 1KVRA 3D4OA 1PJSA 3G0OA 4J1SA 3LC1O 1UZLA 4LCJA 4YYZA 1YQGA 4XGNA 2PKQP 4QECA 1OFGA 1DBVO 3FTPA 4P38A 3WSWA 4QFDA 2YHUA 1FDSA 4PZCA 1IE3A 3LK7A 1BMDA 1E7QA 2GASA 3F47A 1PZGA 3RKUA 1QXSA 2FZWA 2WYUA 1WDLA 5DOZA 1ISHA 3GOHA 3EGOA 3CE6A 1PL7A 2VRBA 4GKBA 2YUTA 5GZ1A 2YDYA 4DQVA 1H93A 2H63A 4J4BA 4CM8B 3HDYA 4GMGA 2GUGA 2JFHA 3UHAA 1YB4A 4XD2A 4RV9A 2NTJA 4ITUA 2NTNA 4MP8A 2PV7A 4ZICA 3I4FA 5EIOA 4FCCA 2HUNA 5B4TA 2X86A 4MVJG 3B1KA 5L7TA 4G2NA 3ZH2A 2P9EA 4J49A 3EYWA 2EERA 4Z9YA 3B20A 3H3FA 3GDGA 4WECA 3RROA 4E13A 3NV9A 3L0DA 3RUIA 2NQ8A 4GX2A 2AA3A 2VTDA 1B15A 1K5HA 4RF2A 2EJWA 3G3EA 2DBZA 3F1KA 4OHUA 4R5MA 3KBOA 1ZJZA 1JWBB 5ILGA 4XDYA 3H3JA 1N8KA 2WYVA 3KETA 2VRCA 5EQFA 1PGNA 3H2SA 3BMNB 3JCZA 5FI3A 1VM6A 5KJFA 1DO8A 4FFOA 2A35A 1W4ZA 2GYYA 2D5AA 5TQVA 5TT1A 4CLOB 4FC7A 5KKCA 4MVJH 2C29D 3BMOB 5DF1A 4GSKA 2BH9A 3JD0A 5LCXA 4AJHA 3ADPA 4JJFA 2YFHA 1EMDA 3F4LA 1E1LA 2OXIA 1A4UA 3JYPA 4CQMA 3GHHA 1R12A 1M6WA 4S3MA 2O3RA 1W0CA 4JBIA 3WGTA 4TQGA 3SEFA 2Y0CA 4B4VA 4CMGA 1DEHA 4XDZA 1LI4A 3L07A 4GX1A 1QV6A 3ZNNA 1CERA 4PG4A 5M6DA 4QSMA 3I9NA 3UOGA 2ZQZA 4RQUA 3OEYA 1EUCA 1KVSA 1F06A 2AXQA 2P5YA 1WDKA 4TZTA 2WE8A 3VH2A 3O9ZA 4BB6A 3QY9A 3INTA 1Z75A 1AHIA 1HSZA 1C1XA 3QVSA 1V3UA 4FQ8A 4CQLA 3ZWPA 3O8QA 2DKNA 3GC6A 1Y5RA 3ASVA 4PG8A 3VOSA 3V5NA 5TS3A 3GDOA 4GWKA 3NKLA 5G4KA 1LJ8A 4IUYA 5CAEA 3DMTA 1LSOA 1E3EA 1DHRA 3LF2A 2PFGA 3IJPA 3OBBA 2EGHA 2GN9A 4EJ6A 4ZU3A 1UP7A 4BNJA 2CVOA 3QJ5A 1GZ4A 4KMSA 2I3GA 4IGFA 3DWFA 4W7IA 4L4SA 4RDHA 1LQUA 3ON5A 3E48A 3DEYX 3GT0A 3WQQA 4Y9DA 2AEJA 1RM5A 5BQFA 3QP9A 1O6ZA 3M1LA 2VHVA 4II2A 4E32A 4R5HA 4Z3KA 4H15A 1HT0A 4CR8A 2VUSA 5CDGA 1E77A 2YDXA 1Q7BA 1UAGA 1YQXA 4FS3A 1GPDG 4R68A 8ADHA 2HRZA 2A4KA 4CUZA 1BGVA 1PWXA 3BA1A 1I3MA 1E0DA 1ZBQA 4J0EA 1I24A 4FSHA 1EQ2A 2FR0A 4D42A 1IPFA 4N18A 4CLDA 1MX3A 1HKUA 4BGUA 3JQ8B 3IDSA 2RHRA 1WW8A 3UFXA 2QRKA 4IZIA 3BTVA 5FEUA 4AJKA 5A9RA 4NU6A 2PD6A 4WEOA 1UH5A 5TF4A 1I3NA 1LTHR 4MVJA 1HLPA 3QWFA 5JYFA 1SBYA 3KEOA 3I9JA 4A0SA 1U4OA 1JW9B
chains in the Genus database with same CATH superfamily
2Z3VA 2PXHA 2HCJB 4PG7A 3EH2A 4PHTA 3HJGA 4BGDA 2BZGA 2V6BA 4QFCA 3UJNA 1Y9JA 3A32A 1O95A 4MICA 4XYGA 3ZWWA 2J6CA 1SVIA 2PRKA 2XDQA 3T9DA 1JIKA 1KAOA 3Q9LA 5SY9A 2V5AA 4AN1A 4BP3A 3EC7A 3EPJA 2NQ2C 2XRYA 4E46A 1JKIA 2J3MA 2NUAA 4R1PA 1Z83A 2HRBA 2O3TA 4NBRA 3ZV4A 1MW8X 4QJ5A 3VAZA 1SQFA 2VJLA 2XNDD 1FTNA 1PJ4A 2ZRIA 3FYUA 2PKYX 4K6CA 4IDGA 4CGYA 3FHJA 3HMKA 3STYA 2ID9A 5J4YA 4O1IA 4NCIA 5T3UA 2D4HA 5DN6A 4OHPA 2SNIE 4LPSA 3LRPA 3TJZA 2BMVA 4XARA 3T4UA 3DLBA 4NH4A 4Q15A 3OOSA 4J2TA 4XCXA 3TEMA 2I8LA 1F0KA 2VNJA 1RQXA 2OLJA 3JQ7B 4OIFA 3J7AC 5DB4A 1UPAA 4DPKA 4I9FA 1Z6PA 3PXAA 3MRTA 2EYUA 5GVRA 4DDVA 1QFMA 1OLSA 4ARAA 4K6GA 3BE4A 2VZ8A 1A76A 2E6UX 2ZZMA 1FFYA 1OI3A 2WWTA 4BE4A 1I4DD 2PGJA 3RABA 4C3OB 4H1VA 3BFJA 2A5GA 3UUEA 3AUKA 5DNYB 4A16A 8OHMA 1O89A 1YCFA 4QSHA 1A9PA 5L6MB 4EPVA 1OZFA 4L28A 1L8QA 1K68A 4PYMA 3NBZC 3TTYA 3CJTA 4G1VA 4BN5A 1MB0A 3GEIA 3TPFA 4AY2A 3H13A 3PVCA 1UFVA 1DKLA 1MZVA 2GO1A 1ICEA 5KJEA 4G0UA 2DHRA 5AJVB 5FWXA 1K3FA 2R8OA 4PX2A 3AGQA 1XA0A 4X8HA 1VMEA 3E70C 5EIXA 5ESXA 2Z3WA 4ODIA 2HJRA 1GRQA 1RYEA 4H7JA 4RJKA 5ALUA 2GHIA 3T52A 4ZK2A 3EA0A 3KLBA 3P9RA 1U0GA 4BWGA 1K0FA 1QG2A 2JKVA 3A4IA 3EVAA 3KLPX 3ANMA 1PDOA 3I12A 3IIKA 3JPYA 4F11A 5BURA 3FR8A 3DXZA 3TCKA 3UPDA 4DCMA 1O0SA 1O3YA 1R5JA 3CRQA 3VR3D 3ZWQA 1VSBA 5GJCA 1NVFA 1GSIA 1KVTA 2IE0A 2VT6A 3IIMA 5F7OA 1XRJA 2CNWD 1I6WA 4MQLA 2CD9A 1GUAA 1EK2A 1UKYA 1Q0UA 3FIUA 5G0VA 4AW9A 1T9GS 3AVVA 2ZLBA 1RWVA 1SCDA 5L3SB 1KFKB 3BFXA 2GXUA 2JBHA 3D8UA 1DAEA 1ODFA 3N3BC 4YACA 1Z2DA 3RC3A 3WKAA 2PNJA 3WL3A 1TAUA 4QE3A 1GPMA 3P4UA 3VHXA 1ISIA 4AQYB 2E82A 1XQ6A 1IHYA 2EJBA 3TRDA 2O8FA 3MB5A 2HMSA 1F7VA 5HCNA 1Y48E 2REOA 1LTKA 4R16A 4XWTA 5H68A 3JU3A 4WW0A 5IKEA 3VVCA 2H2DA 3TAHA 1VLZA 1L7VC 2PZGA 2AK2A 3AEUA 3KXPA 1G6HA 2FPIB 4EG3A 4QO8A 3OJXA 4BNKA 3PFFA 1V1JA 3IOCA 4CEJA 1XNGA 3GLSA 2J0QA 1E0KA 2DUUA 1IM8A 1JE1A 3R9KA 2BHSA 4G63A 3SM9A 4IDHA 1PZEA 4AY6A 1FDVA 2FSUA 5I7UA 2V6MA 3LFHA 3RUPA 3FW1A 1ABFA 2G40A 2IYUA 5KVCA 3LUHA 2P65A 4X85A 1TYAE 1LLUA 1UXOA 1XEWY 2FLVA 3EFOA 3JRWA 4S1OA 4CKEA 5IFKA 3HQ4O 5KCZA 4DV7B 1O96A 1DKUA 2DHEA 2QZZA 2BTEA 2XQKA 1KETA 3QKRB 3QRWA 4I1SA 2IV2X 3FHTA 3PQ5A 3PHJA 3CPSA 1UWKA 4X64B 4C7JA 4LVUA 3HM9A 3EN0A 3TGPA 3BERA 2JGIA 5D5PA 1VFNA 4HXYA 5KDDA 2V3CC 1WP4A 3EXEA 5AW8A 1UPCA 4KC0A 5FTNA 2G8LA 5NULA 2D2XA 4Q3CA 5F35A 3MQ2A 2HR1A 4IS3A 2FPLA 2IHYA 1GNLA 1IUKA 3KHKA 4TX1A 1Z3CA 3I23A 4BV3A 3KJXA 4DXAA 4FMPA 4B76A 1DLJA 1VBKA 2QAJA 4GEGA 1BXKA 4U2FA 2DPHA 1SKYE 3U0VA 2XLCA 4RETA 5JS2A 2QYOA 5LOVB 5SZJA 4MPJA 1V71A 1UBTS 4CV3A 1R6XA 1W29A 4MITA 2C9MA 2ZXFA 3HI6A 1SEPA 5ALHA 3VX4A 5BSKA 3CNBA 2AV6A 4FNMA 3C5VA 3VDMA 3RSHA 4B3TB 4RHCA 4G0QA 3RTCA 4J16A 1N9KA 4CTOA 2V6GA 3L7AA 3I73A 4MA5A 2PUTA 3GPLA 2P2CA 2LRHA 2QORA 3AL3A 5DCLA 3G2HA 5IXSA 4N12A 4UQOA 1YE3A 2O3SA 5IVHA 2L82A 5TQ2A 1RS0A 1VRWA 3NH6A 1SG0A 3REOA 1TKCA 4BN4A 5IU6A 3FX2A 1EXNA 3Q72A 1CUCA 1DQYA 1XXLA 2A67A 2EQ5A 2VJAA 3FBWA 3GJRA 3PGA1 2BIFA 4NYMQ 3CINA 3Q11A 2AMFA 4PQFA 2UUCB 4M0UA 4B87A 4TQ9A 3ZWDA 5JOQA 3ZBPA 3HCNA 3SM3A 3IIEA 1FF9A 1OY1A 2N9UA 2P0EA 4P80A 3JAWA 4RIHA 2V0NA 4GICA 4ZO7A 5HS6A 3ZHZA 3QTLA 1TXGA 2DWQA 3RG2A 4X6LA 5CVCA 4FR5A 4AJEA 5JS8A 1ORWA 2VQ3A 5C7IO 1N9GA 4LBWA 3W79A 4ENRA 1B6GA 1JDNA 1M2WA 2B94A 2V7QA 3TTTA 3WIBA 1VHDA 1Q1BA 5I7SA 2IS6A 4PRLA 1LLCA 2CC2A 1G7SA 3H65A 3NONA 5C1BA 3BRSA 1VC2A 2Z6UA 1GL6A 5AW7A 5BN3B 5T4BA 5MN4A 4FNAA 4B3BA 3PYLA 4YMGA 2P75A 5DO9A 1EX6A 4D9EA 3QLVC 1QFXA 2N1MA 2QX8A 3GLHA 3P27A 1L3IA 2R8ZA 2RI0A 2VPPA 4MUMA 5AKLA 2AEFA 1YFZA 5IVPA 1Z25A 3SR4A 5EFOA 1YHZA 3A1CA 4OHXA 5ED4A 3RADC 2A78A 1SOVA 5LBIA 2AFIA 2A5YB 4M7RA 1LW7A 5H82A 4DF3A 3O8LA 4ZCIA 4CIAA 1HYQA 2ES4A 2OHHA 3KZMA 5JNSA 3FCYA 1MDBA 3EP8B 2RBGA 3ETCA 2J67A 2AJBA 2ZKLA 3WLMA 1L1RA 1KY2A 1DRKA 4LOKA 3NTRA 3OZIA 1P1HA 2EBWA 1GNQA 3N0VA 3U19A 3VHQA 2I6SA 3ORRA 2FZ5A 1OIXA 4ZYVA 3CNOA 1YZFA 1B0UA 2Y1FA 2FPUA 3EK2A 4K9RA 4ROSA 4XDHA 5B7NA 3I92A 4UHKA 2WPDA 5H02A 3ZU3A 2A5LA 2O8EB 5AW0A 2FUG1 2V03A 1W581 2H4WA 2YN2A 3OTIA 1P77A 2I0FA 1Z26A 4KLCA 4OJKA 1BDMA 3BKXA 2HSDA 2O57A 3RFXA 1N4AA 4PBSA 4R81A 3TFOA 1AKMA 2BF4A 5D3QA 1A4XA 1GSHA 3HBAA 3EFHA 3WA6A 2CLDX 3K8ZA 3DZCA 2XCRB 3LCRA 1SCBA 3KYJB 4QXMA 3HDHA 3Q3JB 1TIPA 4KZKA 2R8YA 1E7SA 3SD7A 2XVZA 3H9EO 5B4VA 1VHWA 4Z9AA 1OYWA 1RBZA 2AZTA 1XTUA 5FBKA 1HZZA 721PA 2WSLA 2YC4C 1F9EA 1XU9A 4G0MA 5DM60 3LY5A 1UDBA 3EF3A 2QD2A 4MUYA 4CG0A 3KPUA 3OEHA 3FTNA 4MGKR 6CHYA 3FROA 5TPZA 1APBA 3BWVA 4MXDA 1GTSA 3B13B 1J70A 5EERA 5JDCC 2WWWA 5TY0A 2Z2JA 4M0DA 2HSGA 4IYRA 5REQB 1N6RA 1RLIA 2FDXA 2Z6QA 5EGNA 5EG5A 4Q3EA 4AZ3A 4IQGA 1E99A 4YJKA 1XNHA 4A27A 4KLNA 5MN6A 1ZS9A 2ONZA 4XJSA 2R97A 4IIJA 4KHPB 3RANA 2PS3A 2J3QA 2V4MA 1ISGA 4TROA 4G84A 1KHTA 1JQDA 1P9RA 2O2IA 3IVAA 5LYJB 1OASA 4G86A 4I81A 2I6GA 1UFKA 4YJGA 5DGXA 1YVPA 5ALQA 5IG2A 1M54A 1KNQA 2GR9A 2NT4A 3GD7A 3PQCA 4G97A 3T9FA 4F04A 2BGNA 1XTBA 1Y8RA 4LHYA 4V02A 1YUBA 4ETIA 1NT4A 3F8TA 1NY5A 4G0YA 1FDRA 5GZ6A 1W4AA 4LSGA 3TR0A 1QVZA 1IBCA 3LBAA 1GNRA 1IWPB 2NU9A 4A0GA 4IY1A 4M8KA 1L5HA 3LOPA 3QBTA 5TF0A 3HSKA 1F2DA 3EARA 4A23A 2BVNA 4W1SA 1E4YA 1P9NA 4QC2A 5EKUA 1UQTA 2BI8A 1CQIB 2D6FA 2J9YB 4FFNA 1IHDA 1QFYA 1OFHA 1W47A 2ZETA 3JWPA 2WJAA 1E3WB 3K4QA 3TE6A 2OMEA 1KMCA 4V0NA 4KB5A 1L4NA 1S3FA 3L5OA 3UCXA 5CFQA 1VG8A 1Z0FA 1Z15A 3HA3A 4KE7A 3ZHUA 2OHIA 4C78A 2DOKA 2UXDB 2PUEA 5IC5A 1PK8A 1XK6A 2HQBA 4CKYA 4YREA 1MX5A 3ESBA 3IP6A 4X00A 1XAJA 1N5KA 2ZROA 5AM0A 1Q0QA 2O3QA 3M33A 1C4XA 1W4LA 4J2OA 1XAGA 4IINA 5ER6A 3VNUA 4RY8A 1KP3A 3G2OA 3EXAA 4EB8A 1QMGA 2I6TA 3I76A 5BV0A 5CCXA 1KY4A 4BS9A 1R8SA 4CIXA 2VHTA 2DAPA 3H1TA 2JI8A 4O3FA 4EA8A 1QIEA 5E6SB 2ENWA 2QLMA 2H1WA 1GO2A 3QXJA 2BFCA 4OYYA 4YECA 1RWQA 4OHOA 4KQFA 1E5QA 1GITA 3ONDA 2G9RA 5DNUA 1GLNA 2IYTA 5EHNA 3W2FA 4UBKA 1KU6A 5DLQC 4CDGA 3NM4A 3ZU4A 2D5IA 4JY7A 5EZ5A 2O2EA 3D5EA 4WKOA 3PL1A 2YWDA 3E58A 2HMWA 1XU4A 1Z6TA 2BC9A 2XNCA 1BE0A 1YBVA 4XKJA 3ZD9A 1PD1A 2P40A 1YVRA 3AGPA 1XYGA 1VBNA 3KHTA 4FFVA 3R76A 1XBTA 2PT6A 1E3MA 3HKBB 1J33A 1NOIA 2OQVA 5EP4A 3UMYA 2ZBGA 1ISJA 1AKWA 1EKXA 2ZUSA 1UZMA 5K8LA 1AKUA 1ISFA 4PG5A 1NXOA 5DYIA 2OV6A 1AKEA 1YU6A 1M67A 1SUPA 3HB5X 4ZOLB 1OLUB 1UBSB 2A1TR 1QGYA 4Y6RA 1LCIA 4LMPA 1H8HA 3BTUA 5DI9A 4LNUB 3WL8A 4BQIA 3AIKA 4GSYA 1AO3A 1RPNA 1R37A 1NJ1A 2RGBA 2VJCA 2ZYAA 4IICA 4RPCA 4X90A 1TCUA 2H2WA 3H1BA 1TGYA 3N2GA 3X1ZA 3REFA 4XYBA 1G3QA 2WUDA 1EB8A 1U11A 4B6JA 2FEPA 3S81A 3WA7A 3VRHA 4GOMD 4DUGD 1RZRA 3C41J 3ENWA 3AKCA 4QQ8A 5K8CA 3IHWA 1RI1A 3OA0A 2PU5A 3U7EB 3KZNA 1NG1A 5IJ0B 4EYKA 5JD6A 2KE5A 3PQ8A 1CIJA 3Q10A 3OT4A 4QGSA 3UUGA 4NDAA 4EHIA 4C3ZA 4RVDA 5EOVA 3LC2O 2P1DA 4E2FA 3LKVA 2XE7A 3GIDA 4RMIA 4HMOA 4PXSA 1H2ZA 1MGOA 3S2YA 1WOMA 2MSLA 4XA8A 3AR5A 3R7FA 3TCNA 3R41A 6YASA 4DSTA 1SUCA 2ZIAA 5CB4F 1YIDA 3CEHA 2QQ5A 1YQDA 3DBLA 4FEAA 1EB9A 1A7KA 1M6YA 2O52A 2IRWA 3ZKWA 1UKCA 3ZE0B 1BFDA 3PIIA 3GEDA 1NBHA 1LVGA 1DEOA 2V3VA 1G9TA 4DPMA 4LXIA 3KUUA 3S2GA 5JZ9A 2KB0A 3M6WA 4D46A 5I7EA 1N6PA 3PEEA 1I1HA 3NJ8A 3LDHA 4KYUA 4BJ1A 1MXHA 4TPKA 3ZC3A 4HAYA 3OHMA 1IDN1 2LGJA 1NFFA 4LJRA 1FU7A 5JSFA 3H11A 1OXXK 2GJAA 1CQXA 2X0IA 3IELA 4TVKA 2QXYA 5M2QA 4HTFA 1K06A 5KDLA 1CS4C 3DOFA 5EMJA 2C7BA 2JATA 3T5BA 5D1HA 3CRZA 1ZD9A 2ATEA 2QTAA 1OOEA 1EU1A 1Y7LA 3MG9A 5HFNA 3AF5A 1DKOA 3RREA 3K5HA 5I7OA 2B8TA 3EZ9A 3AJ8A 3C3DA 4KQKA 4JP2A 1K5GA 3GUYA 3GAAA 5EVCA 4ZVRA 2QGNA 3F5DA 3HJCA 1KI1A 3IJRA 1J2YA 4IFBA 1P7YA 4PR0A 4XWYA 5DHAA 4D4MA 4MMXB 4J0HA 1M72A 1FQKA 4HLUC 5EJFA 2O2ZA 1S96A 4AJLA 1V0JA 1C4WA 4AU1A 3CZCA 5AW1A 3ADBA 4RU1A 3WMXA 2I62A 4F2DA 2M9MA 3CUSA 5EMNA 1NXSA 1CY6A 3D81A 3K0CA 1ZD3A 1ZVKA 1IEXA 4FONA 5ECYA 3WADA 4UM9D 4UNRA 1NWCA 1PJTA 4RLHA 4YAKA 3RF6A 2L42A 5KWVA 4D3XA 1KI7A 1C80A 1N9ZA 3MEQA 5A6VA 1T4DA 3OTOB 3SS8A 1B3RA 2BUAA 1LDMA 2JD0A 1FYFA 2XD9A 2XRMA 1SZDA 3OY2A 1JEYA 1NQTA 2J46A 4KGZA 2EP5A 5HIMA 1W2GA 1U7DA 2YBDA 3ETGA 1K7XB 4DQKA 3H4MA 1QO7A 4POAA 5TPWA 5BUCA 2WB4A 1P39A 1NVMB 2ZIXB 3BUSA 1N1EA 3HM2A 4BEBA 1UM9B 2FQ1A 3GVPA 3WRYC 4KNWA 1KH3A 3B1WA 1Z56C 3MW8A 4X60A 1XEFA 2FH5B 1M1XB 5IEJA 3E9DA 4DKXA 5LMNB 1VPWA 1IY8A 4MS3A 1N2HA 3H5OA 4NVRA 1UDRA 1CG6A 3DZ4B 4Q7EA 4ZVLA 4MVJE 1P7PA 1T25A 3DLTA 4OL0A 1JHQA 4GXQA 4M2LA 1LWOA 1H85A 3SKXA 4KRGA 1XCLA 2QEQA 3PHGA 4JMLA 4NZ9A 4FT4A 1GGHA 3RYCA 2I71A 4EKEA 3W9BA 2BM1A 3KVYA 1UXIA 1RWXA 1G59A 2IP1A 4HS9A 4V2IA 2HU2A 4D98A 3I34X 3COPA 4Q4LA 4K1XA 4D8XA 2KLBA 3COJA 2QSUA 1H1LB 3IUBA 3TBFA 1B2LA 4CM8A 4L2IA 4OUDB 2A58A 3BREA 4EAAA 3K20A 4MQFA 1Y3FE 1NM5A 5AXBA 3K70D 5EZ6B 3HCPA 3LXXA 2JC3A 2BPOA 2X7HA 2XB9A 4JKIA 2FDCA 5EMHA 2K5UA 3ADCA 1W49A 1YH3A 2W6MA 3GPBA 2JANA 1F0YA 2REBA 1MFZA 4QO7A 2WTUA 2HADA 1MABB 3KPJA 3SZMA 4G0ZA 4UFPA 4AKHA 2B99A 1CUUA 2X5KO 1GA4A 3NCTA 5DM4A 4N9WA 3RVJA 5CDYA 1YB6A 1II8A 3B9PA 5TRTA 5TV2A 5AUOB 1KO7A 3ZS8A 5HKAA 5HQ3B 1A7JA 3EDOA 2BHTA 3U9SA 4ND5A 1PFUA 1KHHA 4LDJA 4FHFA 3PUHA 4HG2A 4JP1A 2C88A 2GVNA 4XIYA 1JQ5A 1QR6A 1HYGA 1RQLA 3QMVA 3ZI0A 2HLDA 1IN1A 1MOQA 4JJGA 4RE6A 3ZKAA 1P18A 1W88A 2DULA 2OAGA 1GT6A 3KVOA 4EUNA 4RNDB 7YASA 5IMSA 1GG8A 3HXTA 1VI5A 2O23A 1YUNA 2FN3A 2V9CA 1RMYA 1D04A 2DRIA 2XDQB 4YMHA 5KYYB 2GBLC 2H4FA 2UVPA 3CEPB 3SKVA 1WZ2A 1B8UA 5JJKA 1RYYA 5HRAA 3J7TA 1BO6A 5ERYA 3L8YA 3NNDA 4HNRA 3IQWA 4WT7A 4KE8A 4L7VA 2PZMA 3DUFA 2O8NA 2JH8A 2VP0A 3NFRA 1WW3A 1XCMA 3BMOA 4NBNA 1N3YA 4S1TA 2VEDA 1YMUA 5G0UA 4AZSA 4CIWA 1AUPA 1G5RA 1JQAA 3AR3A 4IM7A 3W1VA 4BQPA 2X2PA 1Z39A 4KFSA 5TGDA 5LVAA 1MG5A 1P6UA 4RVOA 1E9CA 1Q19A 2VP2A 3UWPA 4BX8A 1YB1A 4LSWA 4WPGA 4F3RA 4K9LA 1JQBA 2ADFA 2V0CA 1NV8A 3L6DA 5D5HA 5CITA 2VJBA 1CC1S 3OHSX 3GLQA 5FRDA 3RHSA 5HFAA 1FFSA 3DNPA 3TLCA 2FW9A 3D2LA 2ZSJA 4DSZA 3N2ZB 3NLLA 2FSIA 1JU9A 3G8BA 1NW9B 1QHSA 3KQPA 4J43A 3C8DA 4OGGA 4XIIA 2HUPA 2HNBA 3VPXA 3C1TA 3CUTA 4L5CA 2VF5X 1TU0A 4TT3D 1SQ0A 1MPXA 5L6LB 4K40A 1FQWA 4QODA 5HZGA 5I51A 5CM2Z 4RANA 1D4AA 2SECE 4NMHA 1I33A 1OYOA 3G5TA 3OT1B 3EPKA 3RU3A 2WG2A 3FDZA 3EXG1 4ZQGA 2GZ2A 2AXPA 2JLQA 3LLCA 2EQBA 2C5AA 2X4LA 3HO8A 4O1HA 3SJUA 4F2WA 1XLUA 2BGKA 4L6CA 5DGTA 1M2KA 1J2TA 3B7GA 4BNXA 5JR3A 1R00A 3MTJA 1ZZEA 2QQ0A 5IVIA 4EKNB 4ZHQA 3ER8A 2R65A 3F78A 3INRA 3UCFA 3DOIA 3D7LA 4C14A 4XX0B 4HADA 1QK3A 421PA 3KJHA 2HLNA 3LCMA 1JL3A 2W98A 2Q2VA 1ETHA 2O6HA 3C70A 3IURA 5DTQA 3GNTA 2HJSA 1LPPA 2Q41A 2UZAA 4BZPA 1B73A 3BAFA 4A8HA 4AI6A 1QQAA 1IUNA 3KEMA 4QLAA 2JJ8A 3ZHYA 1N2OA 5EJEA 1OLXB 2E18A 2IFTA 1DBIA 1K9SA 4PRKA 1M8KA 3G2NA 1EPUA 2X5JO 1JDTA 1RRFA 1EBUA 3M5DA 5ALGA 3TW8A 1ZEMA 3WBBA 3C7DB 4A10A 5DK4A 1JKXA 4AJPA 4HSEA 4WK0B 1K7EB 4XWGA 2I6QA 1WKCA 2OYSA 1GU1A 4H1WA 2JLBA 1PJLA 2C7RA 5L4NA 2YYZA 3BXHA 1FJXA 2HT6A 3VH1A 4NR0A 1XVVA 1UP4A 2O8FB 2W8BB 1MOSA 4P0QB 4HJXA 3WLNA 4YH1A 1H42A 3UMSA 3ZN2A 1THMA 4BNZA 1B8PA 5J2TB 3ID6C 1RQPA 3NNNA 3JQ8A 2H54A 3EMVA 4EOGA 4F6LA 3FVTA 2PQMA 1J97A 2XYQA 3DD5A 2MDTA 3F6EX 8AT1A 4RTLA 1PJRA 3PU6A 2O2YA 4NATA 4MW1A 5DV9A 1DIRA 1YF3A 4DNPA 1UWLA 5K0GA 5JTUA 2I7XA 3I6ZA 4N3AA 4L5YA 4WKBA 3U7GA 5E38A 1CEEA 3AP2A 1UDAA 4NH0A 4CV1A 1RE0A 1E61A 3E3AA 2JGRA 2RHOA 4Y7CA 3KWFA 2REXB 5LNK6 1YRHA 3JD1A 4QULA 4Z0TA 1H4TA 4R8LA 4CKEB 1CDZA 2WPNA 2EKLA 3K30A 3LQ1A 3QF7A 4BNIA 1N3BA 3BXPA 4H7KA 4IHQA 2NPOA 3ER6A 4LTDA 4ADSG 4I55B 3KFLA 4MZXA 4RGQA 1KPHA 1Y80A 4YQZA 3A4LA 3O8NA 4INZA 4KAFA 4RK6A 5ALLA 4YIKA 4QJ4A 5F73A 1OPRA 3FJ1A 1KSGA 3EXEB 3MSCA 2QVGA 1JJFA 4BO9A 3PQ7A 1U0RA 1VSQA 5LQMA 5IT4A 4I50A 1JAZA 3QE3A 2VEOA 3K35A 1XD9A 4GGPA 2IPOA 4DBLC 4EI2A 3DW3X 1LSJA 1QC5B 2OBBA 3MELA 5KTPA 1T2VA 1O08A 3PSAA 4E22A 2QVZX 4P36A 1N7IA 2AZDA 5ALOA 1Q5PA 5FLXA 3A26A 2WTXA 5LP6B 2QQEA 2ZS8A 4X71A 4OF4A 5ITZA 1VLMA 2QTHA 1FX0A 3HLTA 2RKOA 3PHHA 1PFKA 1U7PA 4RPIA 2IEBA 1JKJA 1V35A 3BCUA 4L8WB 2NOAA 4KIJA 3FYUC 1X1SA 3SY8A 3FUXA 2O4UX 3OJFA 3OKAA 3DHYA 4KQIA 2XB8A 2Y2VA 2J9XB 2VUUA 4Q4AB 4BO4A 3AVWA 5FQOA 2A7QA 4EMSA 1TJPB 3IV9A 3GLHE 4DMHA 5LFAA 4N0QA 1YOBA 2FV8A 3L7CA 3IL2A 3JR3A 3OM0A 3EH1A 1ZO8A 4M7OA 1EM8A 1KFEB 2H1RA 3ETHA 5JW6A 1SURA 3K0AA 4P83A 4U7FA 1GILA 1U0SY 2AFIE 1XO1A 1ZW1A 2RG7A 2XZTA 3CSUA 3HRKA 3OZSA 1IHXA 5CNMA 1N34B 3WP0A 2C92A 4HNUA 1XDZA 3THYA 3JARB 3KSAC 2FKNA 2YL2A 1U9JA 3HJTA 3GRVA 5FP0A 2CE7A 4I4TA 2QX6A 1MW9X 2YJZA 3DPUA 3F9IA 3HZOA 1JEQB 3JAWB 1ZN9A 4LQ4A 3ZGYA 2CHUA 2J5RA 3Q0TA 2JLXA 3NBXX 1PFQA 3VJKA 4WD3A 1KEEB 1J20A 1T9ZA 2OC9A 3E9NA 1Q3TA 1Z5UA 3GEPA 3O2JA 4HGQA 4KI7A 4M83A 3T3PB 4US2R 2XMPA 3ORHA 3FCXA 4B2YA 5EIEA 3QBVA 1GGJA 4RPGA 2XCOA 3E5HA 5KOIA 2KS6A 4LBZA 3E2IA 4AFNA 2QG9A 3E7PA 5KTNA 1BSVA 4NFSA 4AURA 1XZQA 2VDPB 1XI2A 3ESCA 5FAKA 4NICA 5IASA 2CL0X 4HNGA 4MVWA 3G2PA 1GZ3A 4QUEA 4MS4B 1A9YA 3QGMA 5IDWA 3BSYA 1CP3A 3GLHB 3RYFA 4EEZA 5I7WA 1A95A 4DS3A 1WQ1R 3OCXA 4FFBA 4MHSA 3PPVA 5K05A 1CR2A 4KXQA 4UDXX 5FADA 3EPBB 2O7VA 2DFVA 2UZ3A 4K9KA 4PZYA 2AFIB 2J3KA 3G9XA 3H0KA 4PG6A 2QYSA 1L1QA 2ZJ6A 2FZLA 3E84A 1U2ZA 4F8JA 1XTRA 3L06A 1QHEA 2DFPA 2ID7A 2B4KA 5CRIA 3SBXA 5AI9A 5HSGA 3EFEA 3HEBA 1NRIA 2C4MA 2Q6VA 3PDCA 4BV9A 1UDWA 3RIGA 4DJTA 3NWPA 3NPAA 4K5QA 2IYWA 5FPTA 4ARBA 4HJRA 1ZITA 1EFRA 1RT9A 3PYMA 4UVHA 5K6AA 3BTOA 4D43A 3MS4A 2UZ0A 2RD2A 1VECA 5ADVA 1JG1A 1L8LA 2YJTD 3GJ7A 2VQEB 3DLHA 4M0FA 2Q46A 1LLFA 1KI8A 3LUGA 1HLFA 1ZRSA 4UARA 3FUVA 5HQ3A 2G5TA 5KYGA 1C8BA 1JLMA 1J25A 3SQLA 5BWCA 9GPBA 3GEGA 5HA5A 1W34A 3DL2A 1O77A 3U5ZB 2BELA 3C7TA 1BKSB 1GQFA 3THRA 5J1SB 3L8ZA 3IEMA 4QPDA 1I6LA 1SIUA 2ZJ2A 3W8EA 2NVUA 3R5HA 1SBHA 1JQEA 2ZJ1A 2ZR7A 3AG5A 4JQCA 4N3NA 1GPBA 3HWWA 3V4PB 2A9QA 1FIUA 4PSCA 3EGXA 3IKTA 1SK8A 1ZH8A 2DH6A 4YUYA 4QYIB 4EUFA 3KSDO 2B1QA 1G291 3AOGA 3F0TA 3EFBA 1P5HA 1QYDA 3P9NA 4DLZA 3CWZA 5TS2A 2DSNA 5JD5A 2C3YA 2P30A 4CR6A 4RVHA 1MJFA 4W1RA 1U63A 5C5DA 1YVEI 1XJQA 2FJ0A 2HLPA 3ORFA 1U1IA 4RZ2A 2AYYA 2YNMD 3OX3A 2H31A 4LS3A 5H9WA 2YS6A 1ELOA 3W04A 3HU2A 2FLKA 2W2MA 4MVJD 3H86A 5BR4A 3D2BA 2FETA 2X6TA 4FKMA 3FLEA 1UMDB 4NBWA 1T6BY 2IOFK 1M5RA 2UVQA 3IPXA 3OPYI 4AZ3B 3NUZA 1O95D 5K3DA 5L4SA 2C2HA 1TM4E 1Z68A 2DWUA 4P8RA 3TX6A 4BO0A 2W4QA 4B82A 3Q41A 4K9MA 1N7GA 4U6SA 4IIJB 3U4CA 1EXVA 3PC2A 3D6UA 1FQJA 2MR5A 1M34A 2JGAA 1XJ5A 3WVNA 4EF6A 4FDTA 4FHZA 4ALNA 4B4KA 1Y6FA 4RAQA 1NFQA 3ED1A 3L1JA 4LDNA 2KYRA 4RPHA 3RJTA 2AN3A 3V48A 3W6UA 5LD2B 3IJEB 3UGQA 3I9LA 1M2GA 10MHA 1U2TA 2RGYA 1LSSA 3B51X 3BVPA 3VM6A 1NVUQ 3PQDA 2BY4A 2Q9UA 1HL7A 1ZA1A 1ZGBA 4MV9A 4QNNA 3VNQA 1TRHA 4YV0A 5DN6D 4FMDB 5JLAA 3FVRA 1PNRA 4NFHA 3VR2A 1X9HA 3PFGA 1PKXA 3RB8A 1ZWKA 2XUDA 4K86A 1KDPA 4XFDA 3RKRA 3TE7A 3UYLA 3CTMA 3KPYA 4GE0A 4H1HA 4J16C 1OX4A 3BGVA 1N2XA 1AHPA 4DJAA 3R7NA 2QYHA 3IO3A 5HJ5A 1IMJA 4J3NA 5FHRA 4MV5A 1YK1A 3O3MB 3NS7A 5FPQA 4Z9FA 5EC8A 2RHWA 1QRDA 3KE9A 2JLWA 4IQFA 1ATIA 3LSTA 3G59A 5FV7A 1D1QA 1M7BA 3WYFA 2QU7A 2J0UA 5KTOA 3QUQA 1TDJA 1TUEA 4LK3A 5T4HA 1QHYA 4U3JB 4B83A 4GPD1 1SBQA 1VRCA 2FMIA 3OD5A 5DHTA 2HRQA 4OKNA 3AW8A 3AKEA 5BR8B 2YXNA 3AJRA 5A2GA 1TA9A 3NOVA 3BRWA 1JHVA 1JNXX 2ZYDA 3A0UA 4RS3A 4DYHA 2NU8B 1VGQA 1Z6GA 4LHVA 5KAPA 1X7ZB 4DA8A 2ASVA 3GZTB 2C7GA 2ODPA 4MB6A 5K99A 3PNQA 2BFCB 3V7YA 1PYGA 3UPUA 4E03A 3PS9A 3A28A 2HF8A 1K9VF 4UVIA 3VPGA 4Q4DA 3EEYA 3LLVA 1P19A 3LG2A 3TIIA 4RZUA 2FMXA 1NU8A 2H08A 3EVGA 1NPTO 3M3DA 4MLCA 5AVRA 3FOFC 3BQNB 1W0KA 2XDAA 4YRIA 4RJJA 5L8VA 1UANA 1C0KA 1WMDA 2Q1XA 4MJXA 3LPAA 3MT0A 4YJHB 4DZRA 1NYLA 4C2AA 4B8ZA 5A2QA 3I9FA 3LPLA 2HCRA 2YY5A 1Q3KA 2ON6A 4RK7A 1HE2A 2CYBA 3K0FA 3DE0X 4P86A 3RRZA 4UU8A 1PQWA 4QTZA 5DSXA 3GRPA 4KXVA 1TJ3A 3HLKA 1ZOPA 1J0BA 3RIEA 3Q8LA 5B4UA 4CTKA 2YWGA 3FPHA 1EFPB 4BFVA 1ND5A 4DB2A 3ADDA 2XWQA 3GQVA 3R44A 1MC4A 3IPRA 4AECA 3HWSA 1AG9A 3SYKA 3O6VA 2OGZA 3GRYA 4CM7A 1A2BA 1TVKA 2J0VA 3SZRA 3JQBA 3L4EA 3RVSA 3L6EA 1PE0A 5A3VA 4GDFA 3W6ZA 2YW9A 3Q2KA 2I91A 2VOEA 3OUTA 2BKXA 4FOOA 3ZXUB 4FZ5A 5LNK1 3OETA 2WQ7A 3GZJA 1YZ3A 1I4LD 4JJAA 3AFMA 4UXIA 1TUGA 4NK4A 1GR0A 1USWA 3WJAA 4BUJA 1G2PA 1IN7A 1RXEA 4AF6A 5FYQA 2ATXA 2R6JA 1K7FB 3Q5EA 4I66A 3W8DA 4ZYZA 2D06A 2GTHA 3I2JA 3NC0C 4PZLA 3VZBA 3BDIA 3L0PA 5DP2A 4BKRA 1B8VA 3D0KA 4N3BA 3GEBA 1HZZC 4R98A 2BMAA 3ZVLA 1EFVA 4C4OA 3GK3A 4JC8A 1ZCZA 1SN7A 2YWFA 3DBLB 5JTTA 3CUKA 4QBHA 4P7KA 2O5CA 4G36A 3T99A 3KQKA 3TW3A 2VP5A 3ISVA 3KKQA 4JQZA 4Y9RA 4URWR 3I5YA 1XROA 3K09A 2C78A 4TWRA 4QYMA 2DG2A 2OB2A 4FGSA 4ZOBA 4K8RB 4LZWA 1SOWA 1IC6A 3P9PA 3CBGA 1CR0A 1GTJ1 2PQ6A 3GU3A 5FPSA 4YCDA 4U0JA 4EWLA 5AM5A 2FRXA 2H4YA 4BGEA 2XHZA 3LPCA 1SRRA 2XZLA 4WNYA 5KQSA 3UBMA 3I05A 1Y3CE 3WMGA 2COKA 4O4IA 1VLQA 4GXNA 3DPSA 3EP3B 3M9LA 3GRKA 3B1XA 1ZP6A 2XADA 3IE1A 1V9LA 4HTFB 3TD9A 1QYWA 4DGQA 2P8SA 3DMPA 1L2TA 4QHYA 4X5OA 3VI3B 1S8OA 4KGXA 4DLNA 2C61A 4QVKA 3FCAA 1UK9A 3TD2A 2R79A 3ZEIA 1KJQA 3G23A 3HY3A 3UMRA 1ZVJA 3BK1A 4JL6A 2XECA 4XYMA 3NHWA 3AWDA 1H9AA 1ACMA 2VTEA 1LH0A 3I6MA 3OZRA 2HSJA 4RA6A 3FSGA 5IBQA 4O8ZA 1QHHA 1P9WA 2EHDA 2LWIA 5HBRA 3GAFA 1XQVA 1JA1A 1XC7A 3WFIA 1AK2A 4GDMA 3A27A 1DOZA 1RHQA 2GLTA 1C14A 1N75A 1VHQA 2Z6AA 2Z0MA 2ZRFA 2I7TA 4TV8F 4PZEA 1Y1KE 1NRJB 2P0YA 2CW5A 1WBDA 3S5UA 3OJWA 2JGDA 3KIPA 4JLSA 4B17A 2Y66A 5EEGA 1XNRB 4QREA 1DIBA 2H2AA 5KQMA 5B1YA 3BGOS 1JEYB 3WIOA 4UHHA 3URKA 4RVFA 3CVYA 1MOZA 1GOTA 4JLMA 5IABA 4DR1B 5TPWB 4M1ZA 5TGZA 1UOQA 3HDQA 1A9XB 1M1YA 2V7QD 2F59A 1CDOA 3OAAA 3IMKA 5HF5A 3HYCA 4BMOB 1SXGA 4INPA 4PX3A 5AJTA 3PX2A 4TYPA 2XEXA 3WLKX 1SAYA 2OBNA 4MINA 3K9CA 3LUFA 2D1QA 4P92A 4MS3B 5J2TF 1I2ZA 2IYFA 4JFRA 3MWYW 1W4CA 1EDEA 4R01A 4MYCA 5C37A 1P81A 2O2SA 2Z4RA 3FCCA 1CUFA 1H05A 1JPJA 3A4VA 3CF4G 4G0XA 5YASA 3UJ3X 3W6OA 3FNRA 1Z29A 2X1MA 3GMTA 2ZWPA 1XTVA 4MWTA 2OV4A 3F3SA 4CQMB 1XN1A 4NU5A 2VK2A 5SZHB 3QMMA 4G5YA 4IR7A 1D6MA 3EMKA 4IQ8A 5JS6A 3E9QA 3QOWA 4WKCA 1E3IA 4DLSA 1XPRA 3AILA 3MCZA 1L3BA 3QV2A 5EE3A 1FTQA 1TM1E 3GP3A 2HSZA 1SUBA 1Q83A 3HO6A 4QU5A 4RCVA 2W6NA 3IQHX 2BFFB 2O7NA 1RHMA 1V25A 2PGDA 2WPDD 2PA3A 4P3NA 4Z4FA 3FBTA 1ZN8A 4NBLA 1MV5A 1AQIA 1JT9A 3IJ5A 4FGZA 2QD4A 5J58A 1KS2A 4OI4A 2HIAA 3U7QB 1NVVQ 1KQFA 1P7ZA 1S5PA 3IKVA 3B70A 5KWSA 5L53A 2XKJE 4OTZA 4AP5A 2F8MA 3W1WA 1TPZA 2IIVA 2R6ZA 2BKLA 3NHPA 4NU8X 3WK8A 3RFTA 4JK3A 4IIFA 3VQTA 5JEDA 2NP6A 4B3MB 3MJ4A 4PS1A 4JI5B 3WYNA 2NTEA 2HKIA 1II8B 2JJQA 4FEYA 5B3JC 3V80A 4E1VA 4ZXPA 4HT3B 3AFOA 2J85A 2HD4A 3C48A 3H2ZA 5CFPA 1XDDA 3HHEA 2VHCA 4YRBA 2GD2A 3WK4A 3PNSA 4BO1A 3CONA 3IIJA 2JHPA 2WMDA 2QTRA 4GOXA 1Q7GA 2OMKA 3WFJA 3R3SA 4G8BA 4LMRA 4RPLA 5AVWA 5DBHX 2O1EA 3I5AA 1W88B 3R3WA 4WXHA 2C9BA 1A50B 3OEHD 3DDOA 1Y1SA 2IHVA 1R2QA 3QEOA 1Z4MA 3EGDB 3ROGA 1K08A 3ZCSA 4FYHA 1A97A 1NKVA 2EIHA 2HA7A 2HU5A 2N1BA 2P2ZA 3LQQA 3QA3E 3R7BA 4TXMA 4W63A 3ZGLA 2UVPB 4Q6WA 3SQXA 3LBIA 4CRWB 4REOA 2IYEA 3FD8A 1NPYA 2P67A 3NI2A 1QIDA 4O2BB 2VRWA 5ICEA 4WE3A 3FFTA 4D9NA 3EXG2 2IEGA 5A05A 1SO8A 3DUFB 3KUKA 1DUVG 4AUEA 3BZBA 3EZFA 2XF8A 1WHSA 3LXRA 3MPUA 5IT9A 3CVXA 1R10A 3NP9A 3QYPA 5C3MA 3P4YA 5PNTA 3UV3A 3N8IA 1ML3A 4EG7A 4KGDA 1W44A 1Y4AE 1Y6RA 1ZVMA 3IQFA 3N58A 4IMRA 2SKCA 4PIVA 1H5QA 4QNMA 3F7MA 4YFYA 4C07A 4HV4A 1AMOA 3KSZO 1XZAA 2JZCA 1X2BA 4J2HA 1ONPA 1S9HA 3UAOA 1GV0A 2NZWA 1Y33E 3VO8A 2IBTA 3QNMA 4P4GA 4MLZA 2DT8A 4EJ0A 5D51S 1YBAA 4H4CA 5DM2A 4HWGA 4F6CA 5A04A 1Q0HA 1J99A 1PJZA 2X15A 3DM5A 4PRYA 4WL0A 1CZUA 1UKZA 1WUKS 3RSQA 3RSGA 5ARBA 1AGYA 4L08A 2PIAA 2H5LA 4ZODA 1RMQA 5L3ZA 4MSUA 2PY6A 3GUVA 4BO6A 2A84A 5M34A 2WJ3A