3OQBA

Crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
380
structure length
376
Chain Sequence
b'TTQRLGLIMNGVTGRMGLNQHLIRSIVAIRDQGGVRLKNGDRIMPDPILVGRSAEKVEALAKRFNIARWTTDLDAALADKNDTMFFDAATTQARPGLLTQAINAGKHVYCEKPIATNFEEALEVVKLANSKGVKHGTVQDKLFLPGLKKIAFLRDSGFFGRILSVRGEFGYWVFEGGWQEAQRPSWNYRDEDGGGIILDMVCHWRYVLDNLFGNVQSVVCIGNTDIPERFDEQGKKYKATADDSAYATFQLEGGVIAHINMSWVTRVYRDDLVTFQVDGTHGSAVAGLSDCMIQARQATPRPVWNPLHDFYGDWQKLPDNVSYDNGFKEQWEMFIRHVYEDAPYKFTLLEGAKGVQLAECALKSWKERRWIDVAPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oxidoreductase
publication title CRYSTAL STRUCTURE OF putative oxidoreductase from Bradyrhizobium japonicum USDA 110
rcsb
source organism Bradyrhizobium japonicum
molecule tags Oxidoreductase
total genus 108
structure length 376
sequence length 380
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3oqbA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3oqbA01
4MVJH 1SEVA 2HSDA 4IJKA 1ZO8A 5T64A 4E0BA 5C37A 4CMGA 1U7HA 4IBOA 1DIGA 3L4SO 2X22A 2Y66A 3H9EO 5IAAA 2J3JA 3UFXA 3N7UA 3EK2A 3BTOA 5G0TA 3KYCA 3ORFA 2I65A 3F3SA 1YOVA 1QRRA 3RUDA 1O6ZA 4GWKA 3RD5A 4XGIA 3WNVA 3GPIA 3G1TA 2PH5A 4R16A 1LLCA 4NJOA 3ZCXA 3IL2A 3LC2O 4NU5A 1MB4A 1K3TA 4M49A 4Z6KA 4AVYA 4K26A 1YS4A 4CUJA 2FPPA 4GX5A 3ZI0A 5CDTA 1QXSA 4TZTA 4HV4A 4M87A 1NASA 5A5FA 1GY8A 2Y1OA 1LBEA 4CV0A 3DBLA 3AU9A 2VQ3A 1VE9A 1U1IA 2YQ5A 3WXBA 4YA6A 1ZFNA 4CM8B 3WB9A 1XQ1A 4Z9FA 5A03A 1P1IA 2BFAA 3V2HA 4K6CA 2EJVA 1YBMA 5T8KC 1B2LA 3TDKA 1YQGA 3MEQA 2I66A 2NSDA 4D44A 4DLLA 1KYQA 2HLPA 2JAPA 3VTZA 4JBIA 4XYEA 1C1DB 3NX4A 5K0ZA 3COSA 4TRMA 3KYDA 1PQWA 5A9SB 1ULUA 1B14A 3RWBA 2ZTUA 2GRAA 2VYNA 2PZJA 4PLVA 3W8DA 5EQFA 1H5QA 5JYEA 2GPTA 4GAEA 3TL3A 1KS9A 3NT2A 1B3RA 3LYLA 2GZ2A 3OA0A 3PWZA 3SC6A 1E0DA 5KIAA 2JD2A 3DXFA 1PL7A 4E33A 3LLSA 3DOJA 4RPGA 5IJZA 5EJ2A 3QVXA 3C1OA 4FOSA 4RVHA 2DAPA 5BSFA 4CM9A 5JDCC 3VPSA 3PGJA 4OXKA 1DIBA 1FF9A 5B4VA 3PIDA 1CYDA 1CETA 2YFQA 3CTMA 3C3XA 1V3VA 4DWVA 3G0OA 3V2UA 5TLSA 4PGFA 1XG5A 3OFSA 4OMUA 4B4VA 3QIVA 1CIVA 4EUFA 5DBFA 3PXXA 4RQTA 5B4TA 3DFZA 5I7EA 3HN2A 1HT0A 1W0CA 2TMGA 1H6DA 1HF3A 3HDYA 4O6VA 5C7OO 4YJFA 4E5NA 3JQ8A 3RI3A 2QYSA 2VTDA 4UUNA 1VRWA 5DCUA 3CIFA 1UP4A 4R1TA 3UKOA 3ULKA 5DBGA 4I5FA 2D3TA 3B70A 4GL4A 4DA9A 2XXJA 5TT1A 1DC4A 4OQYA 1XA0A 3DBHA 4QFCA 2YDYA 3ZNOA 1O9BA 3ZW8A 7ADHA 3PYXA 4UEJA 4PG8A 4PLWA 1GYRA 2X0JA 2LDBA 4IDDA 4NBVA 4IZIA 5A4DA 5JFOA 3UN1A 2GD1O 4DLBA 3WSWA 4E32A 4BGUA 4GX0A 4DUPA 4LN1A 4J6FA 3IQDB 3IJPA 1J5PA 4P4LA 1YDWA 1E7YA 2FR0A 1LDYA 1ISFA 1EUDA 2EGGA 4IS2A 4GSLA 5CEFA 4MVJP 4BO7A 4KTTE 1UP6A 3M1LA 2P5YA 3QWFA 3IKTA 2OBYA 5DOZA 2YHIB 3UOGA 5KVQA 4DBZA 2JAHA 4WCDA 4BGVA 4A27A 2GN8A 3TPCA 4MVJI 4QTZA 1ORRA 5A02A 4CUKA 4W9NC 4D0SA 4BNFA 5B12A 1K6XA 5A3VA 3IS3A 5IZCC 3ZWAA 2P5UA 3FTPA 1RYDA 3PQEA 4J2OA 1E1LA 2G1UA 4CLRB 2UAGA 3HB5X 3ITKA 5GZ3A 1E3SA 1R0LA 3RUFA 2P91A 4J43A 4Z0PA 3GG2A 2WD7A 3H8VA 1JAXA 1I0ZA 1XCBA 1PGJA 4MVJE 1NPDA 4PVDA 1R4NB 3AI2A 3KO8A 3F4LA 4Q3CA 1FJHA 4RJTA 3GR6A 2DM6A 4L4SA 3G3EA 5T67A 3HWRA 3INGA 1UXGA 3F46A 3ZWBA 4NK5A 2RBEA 4I9HA 2C20A 1C0PA 1UJMA 3LZ6A 5G0SA 2I3AA 3ABIA 2YY7A 4IJWA 4TKLA 3DAGA 2Y1FA 1O5IA 1GQYA 5B4UA 1LSJA 3RUAA 3D7LA 1WMAA 3TZKA 2AQHA 4DQXA 3OIDA 4MP8A 1SCUA 4FFRA 1ISGA 3INRA 5HTOA 2I99A 2IRWA 4OXNA 1DDOA 5JMPA 3RC7A 1YXMA 4OOFA 1JLLA 2VRBA 4GGPA 3R0IA 3DOCA 2IYPA 4XGKA 4XJTA 3DZGA 3F4BA 1G0OA 4XB1A 3I9JA 4XB2A 4PLTA 3DTYA 1DFIA 2NLOA 3RFXA 2V7PA 4BKOA 1U8FO 2WYVA 3KYDB 4BNLA 4QX6A 4C4OA 3AOGA 4NQZA 2HJRA 5TSDA 1ZMOA 4XX0A 4MIYA 1LDNA 3GMSA 4FJ1A 3IAHA 4HWKA 5KJCA 3N58A 3WGZA 2G76A 4WLNA 1BTOA 4P22A 3KSZO 4RVDA 3QA9A 4E5YA 4DVJA 2VRCA 3K2EA 1T2FA 4Q39A 4IINA 4YT2A 4PLFA 2C0CA 2C7VA 2X7HA 3F47A 2JD0A 3V2GA 1PEDA 3AWDA 3I9OA 3QHAA 5H82A 5G0UA 3V1UA 5TQVA 1C1XB 5AXBA 3GRPA 4OH1A 1Q7CA 5IXYA 1GTMA 5L7YA 4WLOA 4HNGA 8ADHA 4TRJA 3U5TA 4UULA 1KY4A 3H9QA 4BMVA 4PCVA 4AJ2A 3ROMA 1NVTA 5CDYA 1QV7A 3ZWOA 2VUSA 3O8QB 1EUZA 1WZEA 2E6UX 3KV3O 1ZSNA 2C2XA 1RM0A 1P1FA 4E5MA 1A72A 2ZB4A 1GZ3A 3D3EA 1Y81A 3DWFA 5CDSA 4E3ZA 1PJBA 3IIEA 2O4UX 3HFSA 4ZGWA 1SMKA 3ONDA 4F6CA 3E1KA 1LLDA 2WSBA 1HZJA 5I9MA 1Y8QB 2PWZA 2NACA 5GY7A 4ID9A 5LC1A 4JX8A 4RVGA 1BXKA 1ENOA 2O2SA 1RM3A 1MFPA 1X1TA 1U9JA 3GGPA 4BNMA 5AXDA 2DBVO 3IKVA 1PL6A 4LSMA 1JDJA 1ID1A 1IYZA 2VHVA 3SJ7A 4W4TA 3AM4A 1HE5A 2H1SA 3DAFA 2I5PO 4JJFA 1U3TA 4I1IA 1R0SA 4N5MA 1ENYA 4Z9YA 1HL3A 1LXCA 1T2CA 3JD3A 1AHHA 1E3WB 4FOOA 5ER6A 3FTNA 5BSEA 4BO1A 3GVIA 1OC4A 1X0VA 3R3SA 4J3FA 3WGTA 4PG5A 3Q9UA 3GHYA 4Y9DA 2BI7A 3NUGA 3LK7A 3ZWVA 3WGOA 2DUWA 3VVCA 1SC6A 4CMEC 4DYVA 2EIHA 5F3RA 1PWZA 2WD7B 3V8BA 4Y98A 3JQEA 1HLDA 5TRTA 2BGMA 3LU1A 4U0KA 4BNWA 2BD0A 2NM0A 2Q2QA 4Y6PA 4J4TA 2EWMA 2VWHA 2DC1A 4DLAA 2JJYA 3E8XA 4YJGA 1X13A 1JWBB 1ZSYA 2NWQA 1PJ4A 5DF1A 5C7IO 1SEPA 3EVTA 1LUAA 1VC2A 4KWHA 2GLXA 4GH5A 4RORA 3ENNA 2B36A 5TJ9A 2DUUA 4L76A 1YB4A 3ZV6A 1LNQA 1Y9AA 3WYCA 3AUSA 3VDQA 1HDZA 1DB3A 4A0SA 3DBVO 4CPDA 2ZK7A 4K1LA 1W6UA 4QFDA 1XLTA 1T4BA 5TJHA 3FNHA 1F12A 3C1TA 3ZDFA 2CUKA 3VC7A 3Q11A 2OUIA 3E48A 4W7HA 2NQTA 3ITDA 5FEUA 2X5KO 4OQZA 3GVXA 3PLRA 4CMBA 4WNCA 4BO3A 4YJHA 2Q1WA 4KMSA 2R00C 4I9UA 4ALKA 1WDLA 4INAA 1I3LA 3O38A 3U4DA 4E31A 3ZW9A 2AW5A 3LC7O 3VAZA 4RF5A 4BO2A 3PK0A 1V3TA 4RLHA 3FHLA 4FR5A 1MP0A 2I6TA 5BSHA 1N1EA 2EW8A 1A4IA 4XYGA 4UEKA 4DTIA 1SB8A 2RH8A 2W8ZA 3CZMA 4JGBA 2PZMA 4BB5A 1NWCA 1SNYA 5DCWA 3RVDA 4JBHA 3C24A 1PGNA 3DONA 1YL5A 4W6ZA 1VL6A 1ZBQA 1E7SA 3C1AA 1B3BA 1ISJA 4J7CA 4AL4A 4WCFC 2DBRA 3VZQA 3UCEA 4OGWA 4TROA 5G0WA 4ZHSA 2IE0A 3ZWNA 4CMJA 1JWAB 3SVTA 5CDUA 1I33A 3MCVA 5KOIA 2YZ7A 5ICSA 2NADA 2Q2VA 4IGFA 2Q2WA 3NGLA 1NX6A 2AQ8A 1YB1A 1M2WA 3ZV5A 1FDSA 2HJSA 1F06A 2W90A 2W2LA 2OFPA 3LLVA 3LQFA 1H93A 4J9UE 3I52A 3FPCA 3ZWWA 3VVBA 1DRVA 3CUKA 4L0QA 3PPIA 3ASVA 1K2WA 4NBTA 1U4SA 5AXCA 3SEFA 1H9AA 2Z1MA 1H6AA 2X9VA 4J1QA 3GDOA 2PTGA 4IPTA 1ZKMA 2PD6A 4O59O 2EP7A 3GVCA 3RJ5A 1T1RA 3RC1A 3NT4A 1DAPA 1HYEA 2CY0A 3ONEA 1C3VA 1JKIA 1DRUA 1K0UA 1E3IA 1N1GA 4PLHA 3D4NA 2OL4A 5CHEA 4AJ1A 2X9GA 1WXDA 1FDTA 2W98A 2XAAA 4RPJA 2CDBA 3W6UA 2CZCA 1X7HA 4ITUA 3VPFA 4XA8A 3NRCA 4AFNA 2O7SA 3OEYA 3PIIA 4YQYA 4WLEA 2DFDA 4Z3DA 2BHLA 1DSSG 1I32A 1KY5A 1DLIA 5L4NA 1Y5RA 2VZ0A 2NV6A 4R3WA 4IDGA 2OBNA 3TJRA 4CM8A 2JFFA 1NFFA 4Z0TA 3BZUA 5KJEA 3DBRB 2HU2A 3S2GA 5F5LA 1CJCA 1H94A 2ZCUA 1B8PA 4M89A 1DPGA 4N18A 4XQGA 1NHWA 2X8LA 4DQVA 1C1DA 5FF9A 4WNIA 1UAGA 5BNFA 5A9SA 5K6AC 1KEVA 4J2HA 4J9VA 1B7GO 3M1AA 3ST7A 3WOHA 3JYLA 4OAQA 3NEPX 2H63A 1GPDG 3A28A 4I8XA 4OKIA 1ZK1A 1HKUA 1WLYA 4EUHA 1IZ0A 2QYTA 1IL0A 2W2KB 1R16A 3BTVA 3BTSA 1XKQA 2O3JA 2WDZA 3E6AA 1G6KA 4GSKA 4YAJA 2HAEA 3RAJA 1PTJA 4ZD6A 4Q3EA 5KTKA 4IGEA 3O9ZA 2OMEA 4CMCA 3T7CA 1I3NA 4EJ0A 4MKZA 4OSOA 3HADA 3F6YA 3H4VA 1KBZA 1W73A 3MWDB 5C3MA 5I7VA 4BO9A 4HKTA 3QVSA 2Y05A 1YBVA 3WTCA 1MGOA 1NQAO 1QORA 2HQ1A 2WMDA 4YJHB 5JCJA 2Q99A 1LDBA 3KYBA 3PHHA 4II2A 4G2NA 4RLSA 2AG5A 1V0JA 3W6ZA 2RAFA 1PZHA 4HY3A 3UGKA 1LLUA 3ICCA 2AMFA 3KRTA 1EZ4A 4AJOA 1E7MA 3PZBA 2GUGA 1QLJA 1UH5A 1WNTA 2VT3A 4YAKA 1Q2XA 2OORA 1E5LA 2PKRA 4O63O 4NZ9A 5KKCA 5TIIA 4CJXA 4MDHA 2RIRA 3OJFA 3DB2A 3AY6A 3QSGA 3LC1O 1JAYA 4FDAA 3WBBA 4R1SA 5HS6A 5DN9A 3GOHA 1LRLA 4EJMA 4CLOB 1W8DA 4J1TA 4BO8A 4Y8VA 5KKAA 2PKQO 1PZGA 2EV9A 4CM5A 3DR3A 4XDZA 2FPIA 2QW8A 4EDFA 4B4UA 3OETA 4BNIA 4A03A 4JCOA 2DVMA 1C0LA 1A27A 3JQAB 4DPKA 4GI2A 1JTVA 3PVZA 2EERA 4PLYA 4CV1A 5DOVA 4ZQBA 1LLQA 2POQX 2J5KA 3AUAA 1EK6A 3UXYA 3RC2A 2VYND 2DBQA 3DHYA 3TZQA 4RV9A 4MVJA 1KVQA 1I2ZA 1LX6A 4F6LA 4OM8A 2BH9A 1TLTA 2XPCA 4IJUA 4BIIA 1EDZA 4YYZA 5U1PA 3PLNA 4DPLA 3A1NA 1UDCA 4BNJA 1B16A 1K89A 3NDJA 1HXHA 3JYNA 4JXKA 4CLRA 4HP8A 2WD8A 3L6EA 4QXMA 3E9NA 3M6IA 3WGHA 3WMWA 4B7XA 3QVWA 1EE2A 2FRDA 3BMNB 1E7WA 1P1HA 1YWGO 2E4AA 3JD1A 2FN7A 3H65A 1R4NA 4GLOA 1S7CA 1Z82A 2DLDA 3DMYA 3HQ4O 4U6SA 2GN9A 3EYWA 4UVIA 2VUUA 4MP6A 4TVOA 4MOWA 2C07A 6LDHA 1A5ZA 5KJFA 5DBIA 4GKBA 4BNKA 1MXFA 3EDMA 1MFZA 4ALIA 2Q4EA 1P31A 3GN1A 4RDHA 4B7CA 4PLCA 1A9ZA 4J0FA 4OOEA 2HMWA 1KEUA 4S1VA 1NAHA 4A2CA 1TXGA 1UDBA 1OI7A 2GR9A 4CLEA 4YAIA 1D3AA 1XYGA 4WOKA 4WUVA 4FFLA 1GADO 1MLDA 4I5DA 1NFQA 3NTOA 1EQ2A 3ANMA 3EMKA 2FOIA 4CODB 3MJCA 1M76A 3BMOA 1UZNA 3JQBC 4ROSA 3K73O 5I9NA 5L7WA 1FK8A 3E5RA 5U9CA 4E6PA 1WVGA 3HUDA 2AEFA 4UVHA 4FIZA 4PFJA 3HJAA 3AY3A 3ZU2A 3B6ZA 4IM7A 5DULA 4NI5A 5JAQA 4RO0A 4AJNA 2H9IA 4ESOA 2GNAA 2WYUA 1ADGA 4LMRA 2A35A 3FF4A 3QJ5A 4KUHA 4XYLA 1IOLA 1BGVA 4WGGA 3TOZA 4X54A 1Q1NA 2PGDA 4KTVE 5L4SA 3V1TC 5L51A 2YW9A 4TRNA 3TZCA 1E6EA 3IP3A 2F1KA 3WGIA 5JLAA 2ZATA 1QG6A 1KC3A 3SJUA 3PYMA 2O3QA 3ON5A 3PHGA 2ET6A 4L4RA 3U9LA 4B4OA 5MDHA 1C1XA 1EVZA 5HRUA 1HETA 1RM5A 3LT0A 1AHIA 4NBRA 3I9MA 3DZBA 1TVEA 3PHJA 4GMGA 4PG6A 1M6WA 1U28A 3OJOA 4NU6A 4ZQHA 4DL9A 5CEJA 1OAAA 1P45A 3GPDG 2DPHA 1HE4A 3MTJA 5L9AA 2PD3A 1E92A 1H6BA 3DOOA 3O8QA 1DIRA 3JQGA 3FCOA 3QWHA 3ZHYA 5F1KA 2O7QA 3UUWA 1YBAA 2UVDA 3CH6A 2AE1A 1UXJA 3N74A 4GKVA 4Q9NA 1Y8QA 2O3RA 4BHTA 4CQMB 2WWRA 1GR0A 3HZZA 5AOVA 1ENZA 3ASUA 4OO3A 3JYOA 4K28A 2JL1A 4MIOA 4Z9XA 2C59A 4F45A 1BMDA 3GAZA 8LDHA 3FWZA 3QRWA 4IIVA 5IN4A 2Y99A 3UICA 2D0IA 4J91A 1T25A 4UVDA 5COBA 5T57A 4ND1A 5A05A 3TZHA 1GEGA 3ANNA 5C7LO 1E3WA 2X0RA 2EEZA 3KLMX 5A9TA 3RU9A 1JQBA 3INTA 1BDMA 1TT5A 3H9GA 4OXYA 3UHAA 3HG7A 1PX0A 3E03A 3OJ0A 2NVBA 4DC0A 2IDZA 5FI5A 4BKUA 1T24A 1A9YA 1ZEJA 1BVRA 3AOEA 4UEOA 5I8WA 2ZB8A 4HADA 2VRCD 5A9RA 4WLVA 3H2ZA 3G79A 4MJLA 4NG5A 1ONPA 1QYVA 5BSGA 3NT5A 2X6TA 2FSVA 1DXYA 2GDZA 3JQ9A 5DNAA 1OFGA 3RSHA 4CM3A 2C5EA 3Q2KA 2JFGA 2I76A 1ML3A 2NU8A 4BNHA 5HS4A 4GQAA 1I01A 3JQFC 2OHXA 1ZW1A 1LDGA 2X9NA 1NR1A 3BAZA 2ZIZA 3PYLA 1GCOA 2V65A 3UCXA 4D46A 3V1YA 4NK4A 2GN4A 1DO8A 4BKRA 3F1LA 2JFHA 5JYAA 2PY6A 4RQUA 3HDHA 2UV8A 3DMTA 3PHIA 1YO6A 3GK3A 5KJ6A 2EW2A 3O26A 4WK6A 2HKIA 1NP3A 2PZKA 3ZU3A 5IXSA 3OJLA 3VH3A 3C7CB 3BHIA 3FPLA 4FN4A 4BS9A 1N9GA 5JY1A 4CLHA 3DZHA 4GGOA 4Z0HO 3BMCA 5IDYA 1RPNA 4CMIB 3HNPA 3EC7A 2D5AA 2AE2A 2PKQP 4GPD1 4OYRA 2CVZA 1OZAA 1PJQA 4N7RA 2FR1A 3BMOB 3GRKA 1IZ9A 4J49A 1PJSA 3S2IA 1XQ6A 1HYHA 5ITWA 3BXXA 1GQ2A 1P1RA 3WWYA 2GO1A 1Z75A 3CE6A 4OJNA 1V9LA 1QP8A 4R51A 1Y9EA 3QVOA 3VOSA 1R4MA 3V5NA 3WJ7A 4CMAA 1YKFA 5CDGA 4H15A 3AUUA 5JC8A 1P0FA 1ZH8A 4RZIA 5LDGA 4PG4A 1H2BA 3PQFA 5COQA 1I10A 4B7UA 4DPMA 1PIWA 3NJ8A 4EBFA 2C54A 4GLLA 4E21A 2B35A 1A7KA 4D3DA 3GHHA 2NVUB 5JAIA 3S2EA 1NVMB 1YRLA 1WP4A 1BXZA 1PU2A 3LT1A 4XRRA 2EHDA 4S3MA 5JYFA 2RCYA 5F1PA 5B1YA 4RCVA 3JCZA 1KC1A 1Q0HA 1VJTA 4IS3A 4BGIA 3P2OA 5F5NA 3GEMA 4XZ3A 3JTMA 4A5OA 4FD3A 1E77A 1UXHA 4BKPA 3H5AA 4PLGA 1O94A 2X0NA 1B26A 4LMPA 5I8ZA 3NGXA 1NHGA 4P4GA 4B8WA 5IG2A 5ITVA 4BOYA 3JSAA 3MTGA 1G1AA 4BGEA 3I9KA 3JQGB 4HFJA 3RBZA 5ICMA 1DC6A 3OICA 4NBWA 3PZRA 2J5QA 3ZNQA 3ZWMA 1HZZA 2VWPA 5BR7A 3ROKA 1I24A 1BWSA 3PJFA 1SAYA 3ONFA 1NQTA 4UREA 2JCYA 2A4KA 3MOIA 4XDYA 5LCXA 2Y0CA 4R5HA 3KEQA 2R2GA 3RQSA 4EITA 4L75A 2XXBA 3SLGA 4DRYA 1N7HA 2DKNA 3CSDA 3NDRA 4RL6A 4UUMA 3PHLA 5ILGA 2VZ8A 4YR9A 2GERA 2Q1TA 4YBZA 3HFGA 3FNEA 2BKAA 2VYVD 4P8RA 3KSDO 1I30A 1YQXA 2O4CA 4QSMA 5JYDA 2PD4A 3DFUA 1B0AA 4GMFA 1VSUA 2IODA 1R37A 1PZFA 4J7UA 2CSUA 4QUKA 1ISHA 2JD1A 2ZB3A 1HYGA 5ILOA 3W8FA 4BV9A 3RIHA 1I36A 4WCFB 3RASA 1E7QA 1P44A 4G81A 1YL6A 1YL7A 2O2YA 2WE8A 1LRJA 1A4UA 4LGVA 4TVBA 3FSRA 4J4HA 3WLFA 3TSCA 1TT5B 2AEMA 3GVPA 3QLJA 2GASA 2RH4A 4WJZA 4HFMA 1UXIA 4IMPA 1YJQA 4LISA 3E18A 1WAMA 4CLDA 4Q3DA 4JQCA 2BGKA 1I8TA 1EVYA 3DBRA 3R6DA 5FYDA 1P3DA 2B0JA 3DZIA 4FFPA 3D4OA 3X2EA 4WEOA 4Y67A 5H83A 4EYEA 3VH1A 4MKXA 1U3VA 2PGLA 1ZXBA 2UDPA 3ZHBA 3SC4A 4O5OA 4ND5A 2YQ4A 1XR3A 1QR6A 3GZNB 5BQFA 1QYCA 3X2FA 5T5QA 1PZEA 1MUUA 5L4LA 5A04A 2DU8A 3E9MA 2AHRA 1YGYA 2W2KA 4FGSA 2PR2A 2H5LA 3NYWA 3GVHA 2QIOA 3EUWA 3Q9NA 1PQPA 3OJEA 4KQXA 2W2LD 4IDFA 4A73A 4CMKA 5L45A 2B5VA 1U5AA 1HLPA 1GUYA 2CF6A 1Q0LA 1ZK3A 3RUCA 3TF5A 2UYYA 1RYEA 1N9GB 4MINA 3GLQA 4IQ0A 1TA4A 2BFMA 3AK4A 3KSUA 2IZ0A 3BMCB 3DZFA 4CM1A 2Z95A 4LSWA 3KETA 1HEUA 2G82A 3WX0A 4BNGA 5KVCA 4PIVA 5JAMA 4EGFA 3WYBA 4W82A 4LRSB 1PS9A 4LCJA 4BKQA 5DP2A 4ZVVA 4OKNA 3RFVA 1U3WA 4XCVA 3JD4A 5T8KA 4R54A 1IE3A 4K6FA 3EZLA 4JJIA 3WNQA 3WJAA 4A7PA 2EKQA 1R4MB 1IHYA 2FSSA 2I9PA 3D64A 1S6YA 1MXHA 4TWRA 4YQZA 2EP5A 4FPXA 4F46A 3T4XA 1H2HA 5KVSA 4FSHA 2GZ1A 5G2OA 2VCYA 3TRIA 2O23A 2B69A 1O95A 2VTEA 1E3JA 1NBOA 3ZWPA 1M6HA 4IQ8A 4CLOA 2JCXA 1E1KA 5THKA 2JHFA 1Y8RB 2Q46A 1MX3A 3ICPA 4B79A 4II3A 4EEZA 2VHZA 2ZYAA 1PJTA 4Y6RA 1HRDA 3LVFO 3I6IA 4FFMA 5M6DA 2YDXA 3PWSA 1BW9B 3JQAA 5EMHA 3K30A 1LSOA 1DEHA 5JDCA 2QRKA 4ND2A 3B1JA 2DTXA 1AXGA 4H16A 3JQ6A 2Q45A 2TMDA 5DT9A 1U7TA 4R3NA 5JMWA 5EN4A 5JY6A 3UVEA 2NNLD 4E2WA 3K2BA 1OC2A 4WKGA 3VKUA 4WE3A 1FDUA 3GG9A 3OBBA 4J1NA 4XD2A 4XQ9A 3DZKA 2PK3A 3TZ6A 1RJWA 4RDIA 1ZZEA 4LK3A 3GQVA 2IZ1A 3KEOA 4ZRMA 2GCGA 3WS7A 3F5QA 4R5MA 4XQCA 3I4FA 3GAFA 3GGGA 1J49A 3BMNA 4D41A 1I2BA 2DTEA 2A94A 1DC5A 1NTOA 1BHSA 3UH1A 3OIGA 3HN7A 1PQUA 1A7AA 1PJ3A 2FHSA 5KNLA 4AJKA 3JV7A 3QWIA 3DL2A 1BSVA 4XQEA 3ZHXA 3I83A 2BRUA 5AYVA 2EXXA 2AQKA 5JCJD 5KJ1A 1X0XA 2Q4BA 5A06A 1JKJA 4ND3A 3WQSB 3KTDA 3BA1A 2P68A 4E5PA 4NR0A 5HA5A 3H3FA 1VPDA 3NTRA 3G1UA 3TN7A 1C0IA 1I5RA 4LW8A 4NFSA 5J23A 2D8AA 1GV1A 3I9NA 1WDKA 3K8ZA 2HRZA 2ZB7A 5IDXA 2BELA 3DMTC 4XGNA 4KUGA 1CQJA 4XIYA 3TL2A 1ENPA 4H3VA 1KVUA 4B3HA 3HDJA 5CG1A 1DIAA 3SX2A 1VJ0A 1XHLA 5A5EA 2CDCA 5G4KB 3C85A 4U0JA 4RPLA 1AXEA 1DJQA 1Z7BA 2PH3A 3GZ4A 3K9QO 4BMNA 4XR9A 1GQQA 3PQDA 3KZVA 4BQPA 3KLPX 3ADOA 1BDBA 3UW3A 1R66A 4M8SA 5CEEA 2XF8A 1E3LA 5K9ZA 2ZTVA 1ZCJA 3H6KA 4YAGA 3WGQA 2GN6A 3RKUA 4AG3A 1NQOA 2V6FA 1MC5A 2ZCVA 2B4RO 3ETEA 4BNUA 1DRWA 4D79A 4TMFA 4MVJD 1XGKA 4JROA 2IXAA 3VDRA 2EKPA 3CINA 4AICA 2V6GA 1AUPA 4FC6A 1JA9A 2D4AA 4YAEA 2EJWA 1EVJA 5AQ1A 1X7GA 3UAGA 4NJMB 2RHRA 3DHEA 5JPIA 1F0YA 2VT2A 4HXYA 3B20A 4ONEA 4ZQEA 5T73A 4HNHA 4M1QA 2FPGA 1EQUA 3I9LA 3I3OA 5H81A 1UP7A 1W4ZA 1JU9A 4URFA 3MJTA 3GUYA 2ZKLA 2SCUA 3LT2A 1V35A 3ZWYA 3OA2A 1Z74A 4QO8A 4KOAA 1QV6A 3RUHA 3JQ7B 1EMDA 3U4IA 4IUYA 3K96A 4E4YA 3DO5A 4MKRA 2PZLA 4PZEA 2DTDA 1ZVMA 2GZ3A 2YV2A 4RF2A 1DC3A 3SXPA 5COAA 4CQMA 1Z6ZA 1E1MA 1Y5MA 3IC5A 4IMRA 4WLUA 3S55A 2P9GA 5BNIA 2CFCA 4L8VA 4UUPA 3M2PA 3RKRA 3P7MA 3OH8A 4NFYA 3H9UA 4XIJA 4EUEA 2Q1SA 3PJEA 4CM7A 2NTNA 4UVGA 2C82A 1OBFO 4RGBA 4BV8A 3PP8A 4RZHA 1ZSVA 3I23A 3OIFA 4GVXA 4YXFA 3WYEA 1MC4A 3O4RA 2EKLA 4ALLA 4BB6A 4MPDA 7MDHA 3T4EA 2FR8A 3JYPA 3RC9A 5F1OA 4YT8A 3VKVA 2DPGA 1DAOA 3DEYX 4KDFA 4CM4A 2CD9A 1IHXA 1VKOA 3TWOA 1GL3A 1LDMA 4N5NA 4NPCA 4IDBA 1P1KA 1M67A 3GF4A 1KVRA 3L4BA 4AJ4A 2HMVA 1L7DA 4HX5A 4M54A 1UDAA 4BNXA 3CPSA 1U2DA 5EPOA 3DQPA 3WTBA 1B8UA 1HDYA 3U09A 1LQUA 1WPQA 5JO0A 3G49A 1N92A 3GEDA 2NQ8A 4E2XA 4WECA 4EI2A 2Y0EA 4CM9D 2HO5A 3PJDA 4E2YA 2VHYA 4R1UA 2C7GA 3D3WB 3DHNA 1KEWA 4HBGA 4BUCA 4DXHA 1DFHA 2VOEA 5A1TA 1T26A 2QZZA 2Q50A 4HUJA 3AY7A 4I08A 4KWIA 2ZYDA 2NTJA 3ZU5A 3QP9A 1GEEA 1SBYA 1PGPA 1ZJYA 3ROPA 2QQ5A 4D0RA 3KUXA 4I5GA 2JKVA 1PJLA 1E3EA 5ENDA 2E82A 4PN3A 1DBVO 4CQLB 3OF2A 4B4WA 3PDJA 5L7TA 1BXGB 2Y1DA 1FMCA 3GT0A 2CVOA 3WGGA 4YCAA 5I9LA 3EAGA 3I5MA 3DDNA 4FJ0A 3LT4A 3HHPA 4DMLA 3HE3A 1TT7A 5AVOA 1H6CA 3QE3A 3OMLA 3AFNA 1GZ6A 1U4OA 4CMIA 1GDHA 3GA0A 1TI7A 1I3KA 4EZBA 3IUPA 4P4NA 4Y6SA 3Q1LA 1O8CA 4R01A 2Z1NA 4CR7A 4IZHA 4ZU3A 1EE9A 1NNUA 3IUSA 3BMQA 3KM0A 4CMEA 1LSSA 3P19A 5GZ6A 4AJIA 1UAYA 2VWGA 3I6QA 2P4HX 4LVCA 3TFOA 2Q3EA 4DMMA 1VL0A 1P33A 5DDIP 1IUKA 2QZ9A 4FGWA 2YV3A 3Q2IA 1LA2A 3B1FA 3WIEA 2HMUA 2CVQA 2J6IA 5C5IA 4IQGA 2Q49A 2RHCA 5L95A 4KP7A 4Q3NA 1E6UA 4AJPA 1ARZA 2YYYA 2G5CA 2VHWA 4R1NA 2QRLA 1DFGA 3AM3A 4GVLA 4PRKA 1FDWA 2NVUA 4FCCA 1BVUA 3L6OO 4J16A 1ZK2A 2DQ4A 4AJLA 1VM6A 1Z7EA 1LRKA 3VPGA 4E12A 4RVFA 5DP1A 4XJSA 4IXTA 4YRBA 2CNBA 4PLZA 4XYMA 2QX7A 4E5KA 1DHRA 1QYDA 2NUAA 1HDCA 3MWEB 3U49A 1EDOA 3WFJA 3G17A 4DC1A 4MIEA 1O0SA 3A4VA 3NKLA 3BTUA 1H0KA 1ZJZA 4D3SA 5JDIA 3K5PA 4ZN6A 2AA3A 3A14A 4JNKA 4TSKA 1HSZA 3ETDA 2WM3A 1NAIA 5EINA 2B4QA 2PNFA 5EL0A 5AXAA 3PFFA 4WLFA 2C2YA 3ZU4A 2HMSA 3RBVA 5JW6A 2R00A 2E49A 4D3FA 2IZZA 1HDXA 4DQUA 1ZNQO 1ADBA 1NQ5A 1R12A 4YWJA 5TX7A 3STHA 1QMGA 1TEHA 2OGUA 1N2SA 4RPKA 2C29D 2NTVA 2DT5A 4U5QA 1SO8A 4JIGA 3SLKA 3EW7A 4Q3AA 4UUOA 1V8BA 3NDIA 4BMSA 1Y1PA 3D1LA 3HDQA 3WICA 3ZWCA 3GN2A 5ADHA 5JXWA 4LRTB 1EK5A 3MZ0A 2OXIA 5CFZA 3CEAA 2X5OA 2P4QA 1YH3A 4HFNA 1SOVA 3FBGA 3RU7A 4CV3A 4WCFA 3H5NA 3UF0A 2A9FA 3MOGA 2FY8A 5CPBA 1NM5A 5TNXA 4CM4B 3VH2A 4JJGA 2B5WA 2I67A 1G0NA 3R1IA 4ZA2A 2HK8A 1Q0QA 3WWZA 2OZPA 3WMXA 3H7AA 3ZHZA 1UR5A 1K5HA 2NU6A 5EERA 2X0IA 1GYPA 1RKXA 2ZQZA 4EW6A 4YEDA 2Z5LA 1D1SA 4YPOA 4PLPA 1XELA 2O50A 3FN4A 3VZRA 1N5DA 1YE3A 1F14A 2WEKA 3DAPA 4KUEA 3GUCA 1CDOA 1NVGA 2B37A 3GZNA 2X86A 4QQRA 4QECA 3ZZNA 2J3KA 4J4BA 4JK3A 1XEAA 1PGOA 3DTTA 1BG6A 2IEBA 2ZYGA 3RUIA 4QT0A 1QSGA 1U5CA 2ZJ0A 3FWNA 5THQA 1ONNA 3FNGA 4IDAA 1GUFA 1RWBA 4L4XA 1RM4A 4YTEA 2HDHA 2HK9A 5ENVA 2AXQA 1D1TA 1JW9B 5JC1A 4RF4A 4KZPA 2VWQA 2CDAA 1IPEA 2FZEA 4R9RA 4E13A 4PZCA 3LF2A 5TT0A 3KYCB 1GCUA 3FD8A 1LJ8A 4WPGA 1YOVB 2WE7A 3AJRA 4LVUA 3U62A 3UCFA 4AJEA 3P5SA 1X15A 1I3MA 4UAGA 4BNTA 3L6DA 3W4IA 1ISIA 1D4FA 3BMQB 3LF1A 2W4QA 2BF7A 2G17A 4YJDA 3DBLB 3QQPA 2O48X 3DZJA 2NU9A 3ANLA 3GNQA 1QLHA 3D5TA 4AJHA 4YT5A 1ZUD1 4IXWA 4NMHA 5CP8A 1F8FA 3C7DB 4XWYA 5K6AA 4J90A 1U2GA 5HBRA 4ALJA 2YV1A 3H5RA 1AN9A 3MJ4A 1Z45A 1B8VA 3RBXA 4ZICA 2BLLA 1MV8A 2B4TO 2X58A 4MVJG 2YJZA 4A26A 5JSFA 1F8GA 1WDMA 4FBGA 4HFRA 3S1LA 4N54A 2Q22A 1T4DA 1PJCA 1Y8RA 4EEXA 5ES3A 4CL8A 1LTHR 1Q7GA 1SOWA 3WBFA 4ZQGA 2PLAA 5KVVA 2F00A 3QWAA 1EVIA 4JLWA 2FZWA 2BMAA 1BW9A 2UUPA 1GD1O 2QHXA 4DBVO 2P2SA 4YB8A 4NH4A 3PGXA 1MG0A 2JHGA 1GAEO 3BHJA 1HDGO 1R0KA 1E7RA 2V6MA 5U4QA 1HSOA 3RUEA 5GZ1A 1ZMTA 2VOJA 5TF4A 5TS3A 4D45A 3GDGA 2PA3A 4H7PA 4GBJA 5ER9A 3L0DA 1WMBA 4FQ8A 3I1JA 4BNNA 5DZSA 3VTFA 3EGOA 4C7JA 3VPXA 3KVOA 3VZPA 3BYZA 1QYWA 1Y7TA 4ZJUA 1LU9A 2C5AA 1D7OA 2UUOA 3IOYA 3L4BC 3U0BA 2HMTA 1XDWA 1DJNA 4YJFB 4WASA 3FR7A 4P38A 2IYOA 3JQ8B 5JAZA 4ALMA 4DGSA 4DIOA 3IP1A 1N8KA 3WDSA 1HDRA 3TNLA 2FWMX 1Y6JA 1L1FA 4OSPA 5JS6A 4U7WA 1JKFA 2PGJA 4QO7A 2NVWA 3DBHB 3F1KA 2IXBA 2X5JO 3K6JA 3O03A 4J0EA 2J3HA 2HCTA 2B83A 3H3JA 2X4GA 1B15A 4WOJA 2Q1UA 3VZSA 4YVFA 2OOSA 3VHRA 3JQCA 1GZ4A 3IDSA 2GYYA 1PS8A 3HSKA 1Z73A 4BNZA 5CG2A 3MJSA 2VZ9A 4N5LA 4RVUA 3FNFA 4CL3A 1UZMA 3ZV4A 1LC0A 3BHMA 5F21A 2VNAA 4CLXA 1GV0A 3CMCO 1T2AA 3OECA 3VPHA 5JNLA 4ND4A 4Z3KA 3ZNPA 1PJ2A 3KHUA 3VH4A 1DLJA 3C7AA 3EHEA 4DREA 2P9CA 3JD0A 1CRWG 3OQBA 4U8GA 1QYXA 3KOUA 4BNYA 5EQDA 5G4KA 1ULSA 3P2YA 5JO9A 1P74A 4NHEA 2VN8A 3ENKA 3SBOA 3EY4A 4LCEA 4R69A 4XR4A 3GY0A 4YDRA 1J6UA 3AI1A 3WQRA 1UXKA 3W4KA 6ADHA 1C0KA 2ZQYA 3JQAD 3A06A 1M66A 4MVJM 3LDHA 3GC6A 1NPYA 3PI7A 1YDEA 3GEGA 2X23A 1CQIA 4PVCA 4YACA 2XOXA 9LDBA 4ZQFA 2BFPA 1WZIA 3PEFA 4GX2A 1Q7BA 4FFOA 3W1VA 1CF2O 2P9EA 4BO4A 1U3UA 1L7EA 1K6JA 3E9QA 4OIMA 1I2CA 1GU7A 4BO0A 1J0XO 2R6JA 3AM5A 1ADCA 4NBUA 4KQWA 4O0LA 5HM8A 4TRRA 4NJMA 3GH3A 3CMMA 1NR7A 3E5MA 1ZIDA 4FC7A 1O89A 4PRLA 4YRDA 1YQDA 1QKIA 2FP4A 1EEHA 2OP1A 4GWGA 5BNTA 1CEQA 1A71A 3QVTA 3RCBA 3ADPA 1EUCA 1KIFA 4IDCA 1KVSA 4MO2A 2E48A 3OM9A 5CPFA 5JBIA 4BL5A 2O3TA 1E6WA 1NWHA 5IDWA 4ILKA 1YONA 3JQ7A 3JQBA 2VYVA 3L77A 1UUFA 4RF3A 2X1HA 4W7IA 1PWXA 3ZGYA 2O3SA 4FS3A 5JDIC 3QY9A 4YT4A 4QEDA 3RROA 4NNJA 2Y67A 4Q3BA 1DOHA 1KEPA 3CZRA 3RFTA 3AUTA 5IDQA 3K31A 5I7FA 1V6AA 2YFHA 2DFVA 2Y1EA 4FW8A 4F3YA 4R68A 3FBTA 1LQTA 1R15A 3EZYA 3MJEA 4TKMA 5IF3A 3GFGA 2HK7A 4A10A 2I3GA 2YHUA 4FFNA 4BO6A 3D5QA 2QG4A 3ZH2A 3EVNA 1HE2A 4CR8A 3OEWA 4M55A 4TQGA 2V6BA 4MVJF 4IY1A 5LDHA 4JN6B 1N7GA 1HTBA 3IJRA 1GYQA 1NYTA 3U4CA 3NAQA 4JP3A 3A9WA 4BVAA 4E30A 3M2TA 1E1NA 1YVEI 3I4CA 4BQRA 2BI8A 5EIOA 4ZRNA 1XSEA 2FMUA 4NIMA 3U3XA 4PG7A 1C14A 1NFRA 1LC3A 2ZJ1A 2VNSA 1OOEA 3NV9A 3RJ9A 2G0TA 5GMOA 1ZK0A 4TZKA 4IJVA 1EFKA 1T2DA 5DCYA 2HRBA 1MA0A 2Y0DA 2GGSA 3WFIA 3L07A 4EJ6A 1NXQA 1SZJG 1JVBA 2LDXA 4GX1A 3H2SA 2HUNA 1P1JA 3FRJA 3QV1A 1IY8A 3MJVA 4CUZA 3AOEC 3LSYA 3D3WA 3Q3CA 4U6QA 2DBZA 3AI3A 4CV2A 2VUTA 1P77A 3AW9A 4B8ZA 1X7DA 3JQ9C 4IDEA 1H9BA 4XKJA 1GFSA 3WGYA 1CWUA 2ILTA 1GPJA 2H6EA 4O1MA 4DYDA 4CQLA 1J4AA 4PZDA 5KCZA 2ZTLA 2GF2A 2PFGA 4R41A 3F5SA 4UVEA 4ALNA 4FB5A 1BXGA 3PJGA 2AG8A 3ZNNA 1PR9A 1PS0A 3ZWXA 2NU7A 3HB4X 3W4JA 1VKNA 1EBUA 2EG9A 3AU8A 3ZV3A 5FI3A 1PL8A 1JN0A 2EF1A 2Y68A 4W9NA 4CQMD 3L9XA 1DIHA 2A92A 9LDTA 5IZCA 1SPXA 2J8ZA 3CXRA 5B37A 1FDVA 3Q6IA 1VLLA 3PTZA 5CAEA 1IULA 1D8AA 4RPHA 1EFLA 4J1SA 1R6DA 5IZ4A 1WWKA 4CM6A 5KWEA 4OHUA 5IFLA 3C8MA 3GMDA 1X1EA 5J9GA 1ONOA 3ZN2A 1PR3A 3KB6A 1LI4A 1NPTO 3JQDA 4R4JA 2WTBA 1JVSA 4R9SA 4DIFA 3IMFA 5G0VA 3KXDA 3JQFA 1XWFA 3B1KA 2J5RA 1DHTA 4BNVA 4L9RA 4AJJA 1EBFA 1XU7A 3OSUA 4YJGB 1E5QA 3OQ1A 3QWBA 5I7SA 5EESA 4WEQA 1AE1A 4DIBA 2ZTMA 3BIOA 1FXSA 3NJ4A 2D1YA 2D5CA 4NFHA 2JCVA 3WLEA 3S8MA 3TQHA 3WIDA 3FI9A 2YUTA 5JE8A 2BGLA 5T6BA 2QRJA 1XIVA 3GDFA 4B3IA 3GGOA 3K92A 5L53A 2AQIA 4W99A 3OHSX 2OP0A 2IEDA 3WR5A 4K9DA 5MGBA 3Q0EA 3PRJA 1TB4A 2WJPA 5G4LA 2OO5A 5BT9A 1MG5A 3F9IA 1U8XX 3OP4A 1LDEA 3JYQA 4NDNE 1KETA 3WQQA 2D2IA 1F17A 4XRGA 3ETGA 4RVSA 1VSVA 1ZEMA 2Y1GA 3FR8A 3WG9A 1X14A 3PWKA 2J3IA 4I9NA 1CERA 2VHXA 4JP2A 3U4HA 3D0OA 4FJ2A 2Y1CA 1ADFA 3PDUA 1YB5A 5JCXA 5HWSA 3R3JA 1P9LA 2O3UA 4C7KA 1VI2A 1KOLA 1IPFA 1PSDA 1OMOA 3TFQA 4CR6A 1HE3A 2EGHA 4MP3A 1ISMA 3JD2A 3DC2A 5FFFA 4CMHA 3E82A 1UZLA 4XYBA 1SB9A 4L74A 4JBGA 3T7EA 3NTQA 4M86A 5A3JA 1LSUA 1WW8A 4D42A 3D4PA 4D43A 1XU9A 3L9WA 3PFWO 3H9JA 1HDOA 4G5HA 3QW2A 1M75A 4E2ZA 1KVTA 1KERA 2AEJA 4XEHA 1P0CA 2GSDA 5IN5A 1T1SA 2Y93A 4J7XA 4BO5A 5TC4A 1PGQA 1GUZA 3KBOA 4I5EA 3GFBA 4OL9A 1V3UA 2YHIA 3W8EA 1T2EA 2CF5A 3OQ6A 4G65A 3CKYA 4YRAA 2WYWA 3GNSA 3GNTA 2D59A 5L3ZA 1YJ8A 3TOXA 1HWYA 5L40A 3AFMA 4IIUA 1BRMA 1ZXLA 1VL8A 4L73A 2CMDA 1K6IA 1VJ1A 4B3JA 5TGDA 2BFOA 1LEHA 1AGNA 3S2FA 1ZK4A 4D7AA 3ROQA 3WSVA 2E37A 1IB6A 5FWNA 4KDEA 2PV7A
chains in the Genus database with same CATH superfamily
1L5MA 4CIXA 1K6EA 5FBRB 1EFHA 2H1WA 3QQ5A 3TK1A 3F9CA 4IJKA 3KZKA 2N42A 1BFKA 5PGMA 4HQRA 1E5VA 1SQ5A 2PMDA 4JKOA 2QX4A 3FKSA 5F51A 4CMGA 1F48A 1MABA 1RWPA 1U7HA 4IBOA 4DY6A 4TYNA 3HCWA 5B58C 1CS4C 2ZI9A 3SI7A 5B3LA 2FK7A 3N7UA 1KAMA 3EK2A 4ZARA 1U90A 4KQ2A 4F5WA 2N1BA 4YRZA 4TL6A 2PANA 3KYCA 2XVYA 2H2GA 1D0SA 2A5DA 2DGDA 2PIDA 2PMBA 2QN9A 2IDJA 1O6ZA 2YYAA 2ZSUA 2BGNA 3VNQA 3WNVA 2X77A 4KHPB 3GPIA 4DILA 4Y2YA 4EUKA 4CUZA 3IAM1 3NNNA 1LLCA 4HSGA 2JIMA 3C5EA 3AR4A 3WKDA 1RRVA 1R4AA 2J3EA 3TMKA 1M10A 2BKEA 4S2UA 2W2TA 4CUJA 1K7CA 3UAVA 4GX5A 3I2YX 5AKJA 3ZI0A 4B84A 5C1BA 2NYUA 2DR0A 3L6UA 1GY8A 3O3MB 2KWIA 2PPLA 2Q6VA 1ESZA 4UXIA 1P2SA 1MPXA 2WWWA 1TCCA 3JS5A 4TQAA 3UOAB 121PA 1FMJA 4ZVNA 1O0BA 1P1IA 1GR1A 1YBMA 3O1IC 4DA6A 2AK3A 4Q1CA 2NSDA 4PHGA 4A8PA 4DLLA 5HYVA 1DCFA 1NUUA 3A2LA 3LPNA 5B5SA 1BMQA 3FNBA 4MYCA 4PPFA 1C1DB 4B85A 3OE1A 4BGDA 5KZMB 1Z0KA 2NUTB 5ALQA 3KYDA 5BOSA 1ULUA 4GXNA 4JYMA 4MQ6A 3ZZ0A 2GEFA 3EXHC 1B14A 3LM8A 2BI4A 3B5IA 3MSXA 4RYLA 5ANRB 1I7DA 2GRAA 4XJXA 1SCBA 5L6MB 1VRCA 4DIUA 4QXRA 1D2EA 2MDTA 3LY7A 3TL3A 1J2RA 3NT2A 1U1GA 2XTZA 2Z1DA 4GZMA 4NFLA 1Y5IA 1X7YB 3MK31 3O21A 4JLPA 1O77A 1F9EA 1JVNA 1NQWA 1DXOA 1E98A 3DKRA 5LD2B 3DOJA 1JAIA 1IQRA 3JZAA 5IJZA 1GPNA 5EJ2A 3RTGA 4PX2A 1Y6ZA 1F4LA 2MMGA 1U04A 3TBFA 4CM9A 3M9LA 1VHDA 1Z2AA 2C7BA 5JDCC 3MB8A 3TEJA 3PGJA 1E79D 4RJIA 5ERGB 1Y4SA 3PIDA 1CYDA 5AW7A 2YFQA 3AGPA 3CTMA 3LZDA 4FYKA 3ANXA 4DWVA 2WWVD 1TO1E 1UWLA 1QIJA 2IS2A 5TEWA 3ZUPA 1XAHA 2CFOA 3MUNA 2QPLA 2COUA 2WPNA 3OFSA 4QOGA 4RDCA 3S1AB 1VHLA 4K9QA 3ND7A 2X1LA 4HVTA 4B4VA 4HUTA 3WLLA 1BU5A 3NW9A 2W0SA 2OYRA 4EUFA 1KEEA 4GT1A 2ZXFA 2O8DB 2C96A 2OPBA 2UKDA 1O7JA 5K8CA 3HN2A 3TX2A 4MWBA 4ENVA 1H6DA 5IBQA 2P2LA 5DYGA 3ETHA 3SKVA 2XOKD 3SYKA 3CRZA 2VTDA 3V7NA 5DCUA 5ALZA 2HI0A 3RIGA 3ULKA 5ALNA 2D1SA 4QGFA 4S1PA 3B70A 5IC6A 1R0XA 2E89A 4P82A 1ETUA 1PFQA 4BQNA 1H2XA 1U8YA 1DC4A 4QNRA 5TT1A 1JHMA 1XA0A 3DBHA 5KYKA 3CA8A 3ZNOA 3FOFC 1YRQA 5A7GA 2GK3A 5IJ0A 2Z9BA 4B2YA 3K4QA 1GYRA 1XDGA 1KI1A 1Z2NX 1WD7A 2JIRA 3EGWA 4V0LA 2PLFA 3UN1A 1FA9A 1TM1E 3L40A 4E32A 1SCIA 1VMAA 5J3JA 4MPPA 5DI9A 3S44A 2CXSA 5HJ5A 5KYYA 1RWNA 1O57A 1JYSA 4P4LA 1Q1AA 1XVTA 3K0KA 3DO6A 1Q6ZA 3FUXA 4F4UA 4KV7A 1DKNA 1U0EA 1LDYA 2W48A 4RKWA 3VR6D 3MFYA 1EUDA 2C42A 5DMHA 5JZOA 4L27A 5AW3A 4MA4A 5BMVB 1WUTA 1KQFA 1V6SA 3TD9A 2A4MA 4HZUB 3QWFA 1PG0A 2GNOA 2HWWA 2Q4DA 4TLEA 2BL4A 1B6SA 1HUQA 5LUAA 5KVQA 3VZCA 1IJFA 1M5UA 2QE6A 2XXAB 4I1VA 2YWEA 1A5TA 2JAHA 3NHYA 5JR3A 2CNKA 3PR1A 1UDRA 1T3GA 5FTKA 2OM6A 1KK2A 2GN8A 3GLHB 2PL1A 4AURA 1ORRA 4WFIA 3TLCA 5YASA 4W9NC 5DJ5A 5FOVA 4YAFA 1OB5A 1K6XA 2IZ6A 2VXOA 4I9FA 5IZCC 3ZWAA 2P5UA 1RYDA 1CY4A 1AIPA 1T13A 1UQUA 2C5FA 3OZWA 5JCPA 4M9SA 2G1UA 1JR4A 5JH7F 4HL6A 4CLRB 2UAGA 5AK0A 4EG4A 4GI3A 4MROA 4HO1X 4J43A 4S0XA 2GCEA 1YA6A 2ZYTX 2J48A 4E5VA 2JI9A 3H8VA 2X8WA 3TLZA 1R5BA 4RS3A 3KQHA 3B6IA 1ZCZA 5REQB 1UPAA 1NPDA 5F7JA 1R6UA 3RRZA 3AI2A 2QTZA 3KO8A 3F4LA 1XRNA 4LI0A 2J9RA 2VAVA 3BE4A 4HN4B 4D02A 3DUFB 3GR6A 4OHKA 3Q7TA 1A8UA 2DM6A 2YWCA 4RJTA 1VTKA 2WG0A 3H2BA 1NMEA 2AC2A 3BJMA 2LW7A 1KSFX 4NK5A 4E7OA 2C20A 4I1OA 1C0PA 1D03A 2R7KA 1THTA 2JGDA 4MB6A 4MYDA 3TQOA 3EFOA 1U0HC 1VJ5A 1V5FA 2Y9PB 4R71A 4L15A 1O5IA 1ECLA 1GQYA 2H52A 2JBAB 3FNRA 4EHNA 5B4UA 3L2OB 3G8YA 1Q57A 4AK9A 4Z51A 3N6XA 1QF9A 1OREA 3D7LA 2NAPA 1KPGA 3FGNA 3FYTA 4MP8A 2B5OA 1U1FA 2IEGA 4FFRA 2F3TA 4M88A 1C9DB 2ODQA 1UMDB 3IAM6 4GOOD 1YA8A 1BMTA 5E0KB 2WIGA 1JG2A 3RC7A 1FDOA 4N1AA 3IE2A 1ZUNB 5H0IA 3UMVA 4AF6A 4HRYA 3R0IA 3DOCA 2IBMA 3I9V1 1FP4A 4RD4A 3F4BA 1A8QA 3AVOA 4DBLE 1QK3A 4PLTA 2ODBA 3WHKA 1DFIA 4YP1A 3RFXA 1VMIA 2CLFB 2V7PA 2WWFA 2XUZA 2YWFA 8ABPA 2B1IA 2K6GA 1NW3A 2WYVA 3QEMA 3B5EA 1OTYA 1QCCA 4D6PA 2GXAA 2WJYA 2BKUA 3A3YA 3EQ8A 5TGZA 4XX0A 5I9IA 5LQDA 1ZS9A 2WUVA 4KO1S 1FL9A 4TUYB 3JWEA 4ENWA 1OBVA 5KYWA 3KR1A 4YRQA 1LGYA 5B55A 4QFMA 5HOEA 3VU9B 5JSHA 3VYTB 4OQMA 5CD9A 2WILA 3RRJA 1KMCA 1GUAA 4HWRA 4ZDWA 1MENA 1NBWB 2P9TA 4J0GA 4WLNA 1BTOA 4P22A 1QQ5A 3UK0A 3KSZO 5J2TB 1E9BA 1NE7A 5JMTA 1UK6A 1IEQA 3IVMA 3QU9A 1U8TA 4XDGA 1ZRNA 1QGUA 1WXQA 3T1YB 4IINA 2P2DA 3F47A 2O7RA 5B2FA 2NVOA 3CX7A 1NURA 1U11A 3CY6A 3QH4A 3IQHX 4LRWA 4LTDA 3QHAA 3WL7A 2Z4TA 4R05A 4TZ0A 3WRXC 1RI5A 2OGSA 2ZBUA 3BPSA 4HTAA 4QU9A 6Q21A 2P6MA 3OT4A 3PRKE 1LWOA 4HDCA 3LX6A 4P4SB 3T1NA 5A4FS 2WHPB 1FW8A 5DSXA 1J0CA 5E9WA 1BA3A 3T3EA 4OFZA 2PUWA 1SUAA 1XCPA 4G1BA 3TYXA 1KY4A 4J3JA 4KOEC 3SSAA 1FRFS 1TYCA 3MCZA 3ROMA 4AJ2A 4F12A 5LM3A 4MS1B 1C8VB 1PTKA 1QV7A 4M6WB 3U37A 4YHHB 2VNJA 3NBXX 4BASA 2VUSA 4URWR 4B3BA 2IP2A 3KV3O 1ZSNA 3E2PA 1T9AA 1RM0A 3ZIUA 4UFPA 1W88B 1AGPA 4XLZA 3GCZA 4OA8A 1Y6FA 4CGZA 2VPYA 3ZVKA 1Y81A 4B3XA 1N7IA 1N5OX 5C1IA 5AI6A 3HFSA 3PVSA 4EI9A 4ZAZA 5KC8A 1J99A 4F6CA 2VRWA 1RXWA 2RGRA 1NN1A 3R9XA 4CTKA 4DA0A 5I9MA 1Y8QB 1B1AA 1T35A 1Q3TA 4N0MA 4Q1BA 2NACA 2QA5A 4MA0A 4Q5IA 5LC1A 4D5EA 1UBOS 1BXKA 1ENOA 2O2SA 3BX1A 3PXBA 2R47A 2ZRDA 5T3YA 5CB0A 5K2MA 4UM9B 1JJFA 4WINA 3E0QA 2HW8A 2PXAA 3DP7A 3IKVA 1YS6A 1JDJA 2VHVA 1KJWA 3SJ7A 5BWBA 2H2FA 1M8FA 3ZU6A 2H1SA 1WHSA 2BEWB 4KK3A 1SC4A 3PU6A 3FTQA 4JJFA 2B61A 4OBWA 4JEIA 2R6ZA 2JIZA 5JQGF 1MJNA 1THZA 3SXUA 4EQ6B 1T2CA 3FMPB 4G0WA 2BE9A 2HJVA 3FTNA 4QPJC 4H1VA 4BU0A 4EI8A 5BSEA 4HAIA 1T91A 2DQYA 3OPNA 4RVOA 3GVIA 4HLNA 4JMLA 2PR7A 3F3KA 2FGJA 5LVAA 1CY2A 1X0VA 3JR3A 3K2IA 4J3FA 3WGTA 3ZHCA 4PG5A 4I6EA 3Q9UA 3LBAA 2I22A 3PR3A 2PUDA 3R24A 3R6LA 4TV8F 1JBEA 5EP3A 4N3NA 5JEDA 5BVHB 3UJ9A 3D8BA 3VVCA 3HP4A 2F9MA 1B2RA 1W5AA 3QUBA 4FZ5A 4HEJA 2WD7B 4H1TA 4WWHA 5F2EA 5F3RA 3JQEA 3V8BA 4NBLA 1HFWA 5FUQA 2BGMA 4U0KA 4E94A 4LHWA 3GRAA 4IHJA 4J4TA 4AXBA 2FE4A 2BR3A 4OP2A 1WU8A 4YJGA 1GKYA 2ATVA 2WFZA 3MJFA 4B9AA 1K86A 1RRPA 5JZ9A 1N2OA 1IVSA 2CV1A 3KPJA 2W6ID 3EVTA 4R1LA 4KWHA 4GH5A 1H4TA 5ALGA 4EG5A 1D4AA 4EPTA 1AGRA 2JLYA 1K8YB 1KU0A 3ZV6A 4RADA 5C35A 3SDBA 5EJFA 4UUBA 3SQOA 3VDQA 2HYDA 4Q4HB 2BUBA 4A0SA 4DIDA 3RSOA 3IAUA 3REGA 3V46A 2GKOA 4K1LA 2IHBA 2ZFUA 1CZUA 2A7QA 2X42A 3ZHUA 5AVTA 2YKGA 3G7UA 5FUBA 1LZLA 1E1RD 1SCUB 1C7IA 2DRIA 2VJCA 3Q11A 1A8IA 4KRFA 3N2NA 1GKIA 2WFLA 3COPA 1Y6GA 1TVKB 1XA3A 2ZRQA 2EYQA 1O03A 4BLPA 4YMUA 4CKYA 4DS3A 2DY1A 2I3BA 3E48A 3HWWA 5SY6A 1B00A 2VLBA 1UDXA 3SOZA 2NT4A 2X0EA 4BVBA 4OXRA 5LA6F 4YXWD 1Q5PA 4G4GA 5KPJA 3Q8WA 4E13A 2QW1A 1C3EA 4ZO6A 3ICQB 1AK9A 2GBCA 3MBKA 4KMSA 3DLAA 1YI1A 1OWNA 1Z4NA 4U2FA 5EXTA 1ZGZA 4N03A 5AJYA 3OBIA 2IT1A 4IH1A 2EX4A 1LF5A 3K53A 2OXTA 3LC7O 2AW5A 3VAZA 3WKAA 4BO2A 4B3GA 4XSHA 2QJOA 3PK0A 2W2XA 1UZUA 1ANKA 2WKWA 3I9V6 2PUAA 2ZBRA 2ZWIA 1MP0A 2EBUA 4LNHA 4YRCA 5F4BA 5HW0A 1GDTA 5AVKA 2RBKA 2C61A 4NNPA 3PXDA 4XYGA 1KE2A 5BN4A 4BEVA 4DTIA 4BCBA 2AL7A 3HDVA 3PUKA 4UBOA 1ZIPA 3CZMA 4CKCA 1H0RA 1D09A 1Q21A 1BH2A 5C0OE 1ZM2A 3V7UA 5M5BA 3HSSA 2H1CA 4BB5A 5DCWA 1W59A 1DAFA 3ISJA 2R84A 1EFAA 3NIFB 3DONA 1FFDA 3SE0A 1JJAA 1ZBQA 3QU2A 4NLLA 2FN3A 4UNNA 3DZ6B 3C1AA 1B3BA 1ISJA 1KJQA 3E5NA 1YS1X 4HGZA 3RSCA 3WIBA 3UCEA 3IKJA 1O2DA 1T34A 4EMSA 1DV1A 4UPDA 4JD5A 1K1EA 4MWDA 4ZOCA 2Z57A 4Q01A 2R8OA 4JC4A 3WI7A 4Q7QA 1W5TA 2QVLA 2JA2A 2OYSA 1TMYA 3A6FA 3UXEA 2FXVA 2YFKA 4BLTA 4E88A 5AVQA 1U2SA 2O05A 1NX6A 2AQ8A 1DJLA 1FFEA 3V55A 3PI6A 1X7ZB 2BFDB 3DD1A 1JKXA 1FDSA 3A4TA 1F06A 3HJTA 3UJ6A 1L9KA 2GFQA 2W90A 3MCWA 3PNKA 1GNRA 1V25A 4OJMX 1D0IA 3LQFA 4J9UE 3TUTA 3AC0A 3I52A 3FPCA 4Y2SA 3KJZA 4M36A 2FFAA 3CUKA 3UATA 3PPIA 3Q5DA 1WY7A 4NBTA 3DXZA 4Q7LA 5L6LB 3SEFA 3GLGA 3FB1A 4C3VA 2IH5A 2Z1MA 4IMIB 1UBJS 1M2KA 3GDOA 3KJEA 1GZDA 1KI7A 4IPTA 3QYJA 4JLUA 1ZKMA 3CVOA 3GQBB 4O59O 1JB9A 2PSFA 5KTSA 3D4LA 4JA0A 5KUTA 1G63A 1SBIA 1LS1A 4I4TB 4RK0A 2QTMA 3TZBA 2AZXA 2CFRA 1C3VA 1P2DA 2FZLA 3UJPA 1E60A 4LRYA 1Q0TA 4H3SA 4PLHA 3ZKWA 1S2DA 4UARA 5H16A 1FDTA 2DHQA 1NATA 5MN5A 5IWAB 2XAAA 4G0MA 2CHEA 3WGUA 2OGZA 1EGHA 1Y42X 1QZTA 3DQZA 2CZCA 1X7HA 2M6RA 4R8RA 4B3SB 3T41A 3FOAA 3VPFA 2PUJA 2DPMA 3K6RA 3VQTA 3HBNA 1OV4A 3KKNA 3NRCA 4QDOA 4XA8A 4HEHA 4MJXA 2Q3BA 4MRMA 1FMLA 3PIIA 4AFNA 4CF3A 1WLSA 3V4SA 3VO8A 4JXZA 3PNLA 4HEA1 2B8TA 3VKFA 5FB3A 1N3LA 3TLXA 2XOEA 3A2MA 3BOSA 3O9MA 1DLIA 4RULA 4Y6LA 5AOBA 4PWZA 1NUPA 2PWYA 3GFRA 3B78A 3G2LA 3TAXA 3HKBB 4IDGA 4NU8X 4H35A 2ATCA 3RAEC 3CU5A 3W2HA 4GD3Q 3AL3A 3MS7A 3S2GA 1SBNE 1H94A 2C2MA 3WMRA 5C4GB 1F8YA 5BMOA 3L7NA 2DX7A 5KKNB 2CVFA 3QXXA 2R96A 2NPIA 4R9NA 2C4KA 4V1CA 2PPVA 2H9YA 1C1DA 4ZVTA 5NLLA 1N2XA 5L3QA 5TQ0B 1UAGA 4PR3A 2VP9A 1DT5A 2ZLBA 4PPGA 2ZRAA 2NUTA 4YHBA 3ROGA 2J0QA 2E7ZA 5K6AC 3QVJA 4J2HA 2OBBA 4O4IA 4MHTA 4WFKA 3JYLA 4ML3A 3FPFA 4BZXA 3NEPX 1PHRA 3W5AA 2ZAOA 3OZDA 3IGFA 3ZQUA 5ECDA 1IC6A 3CZQA 2WNSA 2PIAA 1HKUA 2IYEA 1SOMA 4WVFA 4H1UA 3RAGA 2AD5A 2ZJFA 2O3JA 1KZHA 3O8DA 1G6KA 5K99A 3ADCA 4BFYA 1VE7A 4JELA 2HAEA 2B7CA 4GE0A 4ZD6A 4UZSA 5ALWA 4IGEA 4R2JA 3NTXA 1V8ZA 3QKSB 3FA2A 3A10A 3NS7A 4JT9A 2W6CX 2HNBA 4CEIA 2A7XA 4MKZA 4Q37A 3ZVNA 3HADA 3H4VA 2DZDA 2FPXA 2YWJA 3EUFA 4FEAA 3AVUA 5A0VA 1JSZA 4L2IB 3V7FA 4LZWA 1I5OA 4LRQA 3DWEX 2FDCA 2Y05A 3QXSA 1G20E 4EB0A 4R40A 1O58A 2HQ1A 2WMDA 3OESA 5JCJA 3GWZA 3EWSA 2EBWA 1LDBA 2PSEA 4KB5A 1KO5A 4Z8XA 5IBPA 4C4ZA 2R8ZA 2IYSA 5LP6A 3T95A 1KPHA 4IOJA 5FAXA 1Z4LA 4FYPA 3CE9A 3FGPA 1CR0A 2XYVA 4TLCA 1MNQA 2HPZA 2F3RA 3DS8A 2I7TA 3PZBA 4NECA 2GUGA 4U3JB 3W7VA 4G0ZA 2FH5B 2OORA 1WY5A 1KI2A 2DR2A 5IF9A 5A0FA 1ES9A 4OB6A 5I9SA 5TQJA 5D3KA 2I3ZA 1GZSA 2WRZA 4LOJA 3WWCA 4LX0A 3DB2A 3QSGA 5FULA 1J90A 3THYA 3S99A 2JLUA 2JLVA 3RANA 4FDAA 2ASVA 4TLAA 4NY1A 5FOQA 3M34A 2WV9A 3AR7A 4CLOB 3GLIE 2GK4A 4N8EA 5TEVA 4BO8A 2GHRA 5JD3A 3UT5B 1OU0A 3DR3A 3RR2A 4AKIA 1ZD9A 2QW8A 3PNOA 3LUJA 1Z22A 3K4HA 1RABA 4FD2A 2WU3A 2DULA 4KFCA 3I42A 1U8AA 2KQUA 4BNIA 1QIHA 5KBYA 5I7AA 1Y4UA 1RAHA 5BMVA 1A27A 4L5AA 3UUGA 4B75A 4DPKA 1EWYA 2P3LA 1MO5A 3UV3A 3LIIA 4HZUA 4IVRA 4DCPA 1JTVA 2OKGA 2AZDA 3T35A 1EFRA 4PXAA 1KEKA 3RC8A 1G17A 4Q7KA 2QNIA 4OQQA 4NYJR 3TTWA 4FR2A 1E2HA 3AV0B 3DJYA 3GLHA 5CUQA 4Y18A 1FSFA 2VYND 4NICA 1G4HA 1Y3FE 1KTVA 1R8QA 4MVJA 1E9EA 2UVQA 1LX6A 1RWMA 1EJ0A 2PUVA 5IMBA 3R8FA 2JFBA 2ZWAA 2FG5A 1CKEA 2JC3A 3LE8A 1R9GA 2CNWD 2D7CA 2P3SA 4IJUA 3EDOA 1KRWA 4YJKA 4BNDB 1LFAA 3L1KA 4NMXB 1B16A 4JXKA 4CLRA 3P71T 5IVDA 4F5DA 3Q40A 4HWGA 1NT2A 3E9NA 3WMWA 2CNLA 3QVWA 1EE2A 3BMNB 3B52X 3VO9A 4GZ5A 5REQA 1YWGO 3BJIC 3E7WA 4CCAA 3VOTA 4TTRA 1P7VA 1XJQA 1S7CA 1PKEA 2IBTA 3H0KA 4PF1A 2POCA 3HYCA 3WNCA 1T6ZA 3VTKA 5G3ZA 2FSFA 2HXGA 3GLGE 3DUFA 1P62B 3H8JA 2OHJA 4JI2B 1WU7A 4DSZA 4TVOA 3C3BA 3I8XA 1JDSA 2PGNA 2XMPA 5FPPA 4CT5A 4PYRA 2A33A 1E3MA 1QG2A 1DQZA 4C5AA 4ER5A 2AUNA 2UU9B 1MFZA 2JBAA 1YVUA 1A50B 4RDHA 4RUKA 4M8IA 3TH5A 4ALIA 2BGJA 4PLCA 4M1TA 5ADWA 5JOQA 2Q8NA 1G9TA 3HVJA 3FZNA 3U80A 1DQRA 2K7FA 4S1VA 4LJRA 2OCLA 3BZWA 3HXKA 5AI9A 1A88A 5E7QA 1TXGA 2IHUA 2Q6TA 1N7JA 4YALA 2XUQA 1WZ2A 3I5UA 3EVAA 2YXNA 1GGEA 1Y3HA 4JLMA 4DZTA 4WUVA 2DETA 1GADO 3AT1A 4F3RA 3RVJA 1ZUNA 5HEKA 1NFQA 2F4NA 2JDID 5CFOA 5IUJC 1EQ2A 2FQ1A 4HEA6 3EMKA 3CRW1 1VE3A 3G0GA 2H2DA 1FXWF 2VDPB 1YK1A 2VSOA 1E5TA 3NCHA 3DH0A 3E15A 4F56A 3E5RA 2ONKA 1Y3CE 4E6PA 3HUDA 4D4MA 2QZSA 2AEFA 4OQEA 1YZLA 3F6BX 3NOQA 1A8SA 2IXFA 2X6RA 4KH0A 1B23P 5DULA 4AO7A 1FQWA 4TUYA 2RB5A 2XT0A 3I37X 2QUZA 4RO0A 3AINA 2WBLC 3ZBUA 1G2OA 1DBWA 1Q92A 5DTRA 4AJNA 3VU9A 1IZZA 1NBAA 2WHQA 5HE8A 5K45A 3RYCB 1V9CA 2OG1A 3FF4A 3NIDB 3QJ5A 3QLVA 3LPDA 4N3CA 4YGYA 3SR0A 1I3CA 3OLVA 4ADSG 3WWPA 5JYCA 2GCPA 3G2NA 5L4SA 5J2TA 3FMIA 5A7FA 3NJRA 4QNNA 3HJGA 2WWIA 3GYGA 3TZCA 1E6EA 3CPJB 3GLVA 3HR8A 1CY7A 3H6GA 4OQPA 4HK4A 2VG8A 1QG6A 1KC3A 3HEMA 3PYMA 4H60A 2G25A 3AG5A 1FCJA 1T4GA 2FEWB 3C4QA 4TZ6A 3E3LA 1H0SA 3GJ8A 3ON5A 1NUQA 5AICA 3RV3A 4ZT5A 2IY8A 1N2ZA 721PA 3JRWA 4OK3A 1HETA 1RM5A 1NVAA 3EGCA 4YCNA 4ER3A 3KB8A 2AF4C 4P4SA 3NM5A 3S81A 3RSHA 1XK6A 1GM5A 2DUMA 2FPGB 2CXQA 4L1KA 3X1MA 2WHPA 4GMGA 3A1CA 5CEJA 4DL9A 3L3BA 4ZQHA 5EE9A 1U80A 1UQTA 3IMGA 4NV0A 3TVTA 1Z2OX 1T1EA 4J76A 4E51A 5L9AA 4MS1A 4M6WA 1W4RA 1E92A 1RMTA 3DOOA 4J0DA 2C3UA 5F1KA 2O7QA 2OHHA 1JR3A 3NQ41 5KOYA 2L18A 3UJ7A 3QOFA 2YV4A 4KWCA 3OT5A 4AY4A 5CM2Z 1BX1A 1T0IA 1XQWA 4RSRA 3RVQA 5KSYA 2I6GA 1D4OA 5CM8B 2ZAMA 3I53A 4GKVA 4Q9NA 1Y8QA 3NDBB 1NLUA 4QJIA 1CZNA 3K1AB 4R7TA 2WTUA 1DQSA 3HKCA 1G8SA 1NIJA 2WWRA 5E7IA 1U9YA 2G0NA 2J59A 4C14A 2I1WA 4OO3A 3C6XA 3T34A 3OZVA 1DI0A 1KOGA 2PJDA 1SHTX 2G88A 1UBGA 3D6HA 2F62A 4OUDA 3CYFA 4MCHA 4P92A 4Z9XA 2YCBA 4F45A 1RWQA 1TOAA 5IN4A 2MINA 4J07A 3HXPA 1Z0JA 3EQZA 4AZ3B 4WSOA 1CY0A 2FF5A 2BEWA 2EQAA 3KV1A 1GUBA 1JMKC 1SD5A 1PYDA 3E27A 4X84A 1SUCA 2D0IA 4NU0A 3G2MA 1T25A 3IIKA 1Y7HA 4QVKA 1TYEB 4EQ6A 2BFFB 4ZXPA 1B41A 2C1EA 4PRYA 2G4LA 2G4CA 3M5WA 3MVEA 5JWHA 3HDGA 5A9TA 3SM9A 2RI1A 5K8UA 2J6CA 3RU9A 1CULC 4QM6A 1IQ0A 4KYVA 4QM7A 2ZT5A 1P81A 1BDMA 1TT5A 2XWQA 4KAJA 4MVYA 3HABA 3IXQA 4RSHA 4IF4A 5AI8A 4L50A 2OOKA 1WKCA 3L0OA 3ZLJA 1JV2B 2Y76A 4OG2A 3UTDA 2P4UA 4BKUA 1T24A 4R2IA 1ZEJA 2J3LA 4QAJA 5BVHA 5CDFA 5DHTA 1YB7A 4ACBA 2BJHA 2QQ0A 1L5WA 4UEOA 2IX3A 4JA2A 5DVZA 3TNYA 1ZJJA 4HADA 3GFQA 4UPVA 4WLVA 4YLGA 5H4HA 3OZIA 4PZAA 5BSGA 3GLHE 3V34A 1Z18A 4UXJA 1F2VA 3IJ5A 1Y8AA 1IJEA 1DXYA 3N05A 2GDZA 3BCRA 2ZJ6A 1OFGA 2PS0A 1H2ZA 2Q5FA 3C6KA 3C70A 2JFGA 3B2QA 3GMIA 3QK7A 3DGFC 1DG9A 1ML3A 3M6WA 2Y8EA 1FMTA 4YJ3A 5IYZF 1N6HA 2ACKA 3H86A 4BNHA 5AVSA 4DV5B 2I4NA 2GFIA 2OHXA 2QDKA 1GL9B 1AMUA 1LDGA 4JS0A 1YCHA 4MW2A 1N5LA 3ZEAA 2BONA 1IY0A 2ZIZA 1OAOA 3MRXA 5KI6A 4FT4A 4D46A 2QG9A 3V1YA 2Y4NA 2GN4A 4NDAA 4P5PA 5D51S 2QTTA 4Q4HA 2XBLA 3D0RA 2PY6A 4FHGA 2G6TA 5ALDA 1D2MA 3PHIA 3DMTA 5CB6A 1YULA 3ZDXB 1NF9A 1F7VA 2XUIA 8OHMA 2TSYB 5BV0A 2BGWA 3VH3A 3C7CB 1OFIA 3AR6A 2AT1A 1TVKA 2IHZA 1K06A 3K8QA 1MB0A 3G9TA 3GJ0A 4PZUA 5DWVA 4JYAB 4GGOA 3RK0A 2XDQB 3BMCA 5IDYA 2BR4A 5GOTA 4CMIB 3PD0A 3EC7A 4O4HB 2D5AA 3M6LA 4LYJA 4OYRA 2ZROA 3TDMA 1PJQA 2CVZA 2VDRB 2FR1A 4Y1RA 4ZMBA 1AURA 1N2EA 2CLEB 1LI7A 2OO5C 1XN1A 1IZ9A 1OX4A 3MTAA 4AJPA 4F85A 1Q0ZA 3OLZA 3S2IA 3J81A 1YZTA 4MDYA 1GQ2A 5G1PA 3FI0A 1JNXX 5I7RA 3OTOB 2XYPA 2XX3A 1V9LA 2RHWA 3BULA 4RHCA 5J63A 3T7RA 1V95A 5J58A 1UIRA 3IP8A 1R4MA 2VTBB 3L7DA 3WJ7A 1J70A 1L7MA 1FTSA 4LMBA 4H15A 2PWBA 3NU1A 3MERA 3MT9A 5JC8A 1T0PA 3FE2A 3PKZA 4G9GA 2GLTA 5LDGA 3UW1A 4KR6A 1RWVA 5KNBH 2O54A 1H9CA 3O8RA 1NVFA 3MXTA 1CJBA 1I10A 4EBFA 3N53A 1BS2A 1R8XA 1ZOOA 2F6RA 4R1MA 3P97A 3MUEA 1E1QA 2WKPA 4GLBA 4AO6A 3WQRA 3BSFA 1XDZA 4MWZA 1WP4A 3EIUA 3EOAI 1MH1A 4RFVA 2RCYA 3PCXA 5DT2A 5F1PA 3V4VB 4EO4A 1J1ZA 4A6XA 5B1YA 3HLTA 3JCZA 4ZAGA 1NLFA 4KQKA 3V4RA 1VJTA 3C4VA 2VJNA 3B3JA 1JI0A 4IS3A 3THOA 2VP5A 1EFPA 4BCDA 3C3MA 4XZ3A 4ZI3A 3U9TA 3WLIA 4PS1A 1COWA 4IDHA 5EZ6B 3H5AA 3EJWA 4JJZA 4PLGA 4QARA 4EFNA 3QPWA 2VLIA 3VZDA 3BIXA 2IEZA 3LOQA 4LBYA 4B8WA 1PNVA 1U02A 3DD5A 3EEYA 4K81B 5GP1A 1X7ZA 4D8XA 4BGEA 2FG6C 3COWA 3WGNA 1Z17A 2BFDA 1M3SA 3JQGB 3RBZA 1Y7PA 5ICMA 3AVXA 3QUAA 3OICA 5F98A 1S89A 3UAZA 5CDHA 4EL5A 5C52B 3RWMB 3EZ2A 2DFKB 1I24A 1BWSA 1NNLA 3BQMB 5U4XA 4I6JA 1HX7A 2A4KA 2R6HA 4IEFB 5J40A 1A9OA 4OFWA 4Z4GA 1Q1BA 3J7TA 4R5HA 1LB1B 4ILEA 5IFKA 3GQBA 5AK5A 2XXBA 1ZIXA 3CSDA 4RL6A 4TTAA 1Y4DE 4DNOA 1W7AA 3RYFB 2VZ8A 4I4TA 2GN2A 1AX9A 1JR3E 2GYVA 4YBZA 4GBMA 4YR9A 4AS2A 1BRTA 2C94A 2VYVD 1NN0A 2VCHA 4P8RA 2O4CA 5DYNA 4UNPA 1Z5GA 3UT6A 2ECOA 3L0BA 5IJXA 3WAJA 2PD4A 1W1UA 5BR4A 3PL5A 1XP5A 4S0ZA 3UJAA 1R37A 1P3JA 3WL3A 3GZTB 2QOEA 1LX7A 1N8TA 2FRDC 4QUKA 1HYGA 1WCV1 4UHDA 5EMLA 4FYIA 2WICA 2O5EA 2IXTA 1ACJA 4PX9A 4O2RA 2IOQA 3CZCA 4G5QA 4IV5A 1CUDA 4RPCA 4WDRA 1X1SA 4G81A 3K1YA 2R6FA 2O2YA 3GCXA 2IIQA 3SQLA 5JHGB 4P4TA 3FSRA 3AKZA 1C7ZA 5CFLA 1FLAA 2ECKA 1TZBA 3QLJA 1M6NA 2D0DA 3T3GA 1J0DA 1ZLYA 3OOHA 4WJZA 3UPUA 3HYRA 1YD7A 1U0SY 1O97C 5H3HA 2JAOA 4B0OA 2OXEA 5EJEA 5I5EA 1WAMA 1CUFA 4DBLC 3GPLA 2NU6B 1R8SA 4JQCA 2BGKA 4PTZA 1EVYA 2JGRA 1WBBA 3SQXA 1NYRA 5FYDA 3SVLA 5P21A 1QHNA 1FNBA 2C92A 1P9WA 3DZIA 4HQLA 3D4OA 4IKPA 3X2EA 1FBNA 3LKBA 5HIIA 2ZPTX 3BREA 2FPKA 3N7TA 1F1JA 1DQYA 2CZGA 3HL4A 1U3VA 2QD4A 5I8PA 2JA1A 3IWCB 5HPYB 2XITA 5TQ0A 1BOOA 4JYPA 2YWBA 3JRXA 9ATCA 4V0MA 1UFQA 2W11A 3GZNB 1GZ7A 4RV4A 2ZDHA 2WAAA 3B89A 5B36A 3X2FA 3TI7A 4M4SA 1GG5A 1XL1A 1WV0A 3V00A 1N6OA 1UKYA 1UWCA 1QGZA 1NG1A 2PVPA 4GP9A 1SPBS 1MO3A 2V6JA 1NJ8A 1N1MA 5H4GA 4FHCA 4P3XA 1XNHA 2D2EA 3IO3A 3VRHA 1AQJA 5FOTA 3H0EA 4OK6A 3U4AA 1SC9A 5IP5A 1JDVA 3LK6A 3TTUA 4DT1B 2LCFA 1G4AE 3NYWA 2QIOA 3EUWA 3PEYA 4I46A 4KQXA 2ZRNA 1PSZA 2H2IA 2W2LD 1K5GA 2VP4A 3IKLA 4HAWA 1Q0LA 5T4BA 3VR4A 3QKSA 5DLEA 1SCAA 4YMIA 2QI9C 4IQ0A 1CQPA 3N2LA 1EX6A 1E96A 4MUJA 3I62A 4CM1A 1XZIA 3LGSA 5CURA 3NBZC 4C4XA 2K4MA 4L2IA 1ZP6A 4MV6A 4BNGA 5BWMA 5KVCA 2IPOA 2WJ4A 5FRDA 5JAMA 5HF5A 4CG2A 5KQLA 3BXHA 4LRSB 3IOMA 1PS9A 4JU9A 2BSXA 3DDHA 4LCJA 5MFPA 4KU4A 2PZGA 3K5WA 4G5OA 4DA4A 4Q6BA 3FBWA 5HR5A 4D6YA 3WNQA 3QSYA 3EZLA 3KT8A 4JCCA 3OX2A 5KHAA 1IHYA 1RW4A 1MXHA 1ZD8A 2BSAA 4FOTA 1H2HA 5KVSA 1G7TA 3N0TA 4FSHA 1GCIA 2J9GA 1MJFA 4MQFB 2O23A 4ZYWA 2H7YA 1XTQA 2JS7A 3DVRX 4FFBA 2VTEA 1XRSB 1CUUA 5JZSA 1AZSC 2WSMA 4M9UA 2B3TA 1NBOA 2J30A 1M6HA 4CLOA 2W6PA 1HTTA 3O31A 3RG2A 3GBPA 3FRIA 3Q0IA 4RU1A 3UT5A 5THKA 1AKUA 3D59A 2AH5A 3ICPA 3Q7SA 4II3A 1OBOA 5D84A 4C7VA 1E2JA 4PAQA 4Y6RA 4YR7A 1FVFA 5AW6A 1MKYA 2VF7A 2CYAA 3DDSA 5CXQA 2Z8YA 1C9KA 1W1IA 3KSBC 2DQZA 3I6IA 5M6DA 3I2FA 3M33A 2YDXA 4QTTB 1OKKA 1JDUA 3G82C 4EW2A 5EOVA 3NBAA 2XHZA 4P58A 2HN9A 5EMHA 4BP8A 2I29A 1QKJA 2QRKA 4ND2A 3PEEA 4JJ8A 3NO4A 4IDOA 3SHOA 2P2GA 3OOEA 5DM4A 1GA1A 2GI4A 4B87A 2HHAA 6PFKA 3TG2A 1ZC3A 3T9FA 2I1QA 1K75A 5JMWA 3DEIA 3VC1A 4E2WA 1YACA 2NNLD 4WA7A 4YROA 3NOOA 3VJKA 3EZXA 5C8ZA 2QTFA 4MMXB 3I5XA 5FNZA 3VKUA 4LS3A 2B7BA 3GG9A 3OBBA 4H0FA 4J1NA 4JXXA 2QIPA 4U2DA 4BNDA 2O0MA 1AV7A 1E32A 1T2NA 4JBWA 2OCXA 3MWJA 2V7QA 5EVJA 3WS7A 3B6KA 2ZP1A 1H3EA 3COJA 3F6RA 3RHSA 4D9CA 5T41A 3V1NA 4R5MA 4XQCA 4TLMB 7AT1A 3GAFA 3GGGA 3BMNA 2WUFA 3ANSA 3RBAA 1I7CB 2J3QA 2AR7A 3QGMA 3AL2A 4QD3A 5FLEX 5HIMA 3F8WA 4H1WA 3A6EA 3FROA 1MTOA 4TKZA 1V1MB 4KPGA 1A7AA 4P83A 2FHSA 5IKOA 2P90A 4AJKA 2JEYA 2CK3A 3G59A 3JV7A 3QWIA 4C0QC 4XQEA 4MITA 1CUIA 1WE2A 3VR3D 4OV6B 1FTWA 2Q3MA 2D1QA 2R1TB 3AUFA 4LA4A 4UMEA 1TYAE 2YIVX 3LMKA 4HMOA 1L8AA 1X0XA 2GJSA 3FOBA 2J87A 2OM2A 3H11B 2X4LA 2XRYA 3CKMA 3KTDA 2RB4A 4GQBA 3CO0S 2X7XA 3ZYZA 1GQFA 3W2GA 2C4NA 2YVKA 4NR0A 3HYLA 3NTRA 1DC8A 1JDBC 3ZHRA 1DCKA 1IN5A 1D8TA 1JH8A 1QZUA 1YIOA 3I9NA 4MGEA 1WDKA 3MBOA 4NFSA 4UXHA 1UC5B 2ZB7A 4I50F 1E69A 1TK2A 5IDXA 3TL2A 1KVUA 4OMCA 1R5NA 1CRZA 1Q3KA 4O33A 3IDFA 1K3FA 1VDZA 3L6RA 4UCWA 3UJCA 3F7OA 5C8YF 2EL9A 1P5ZB 2MSLA 5F78A 3RVPA 3A26A 3N0VA 4CKBB 4QGAA 4BQOA 2QYOA 2Y0BA 1P4HA 5A5EA 1YFZA 4RPLA 3ZLBA 2HSJA 3I32A 1M8KA 3B6JA 3GZ4A 3K9QO 4JC5A 3D8UA 4BMNA 4HEQA 3A04A 3BT7A 2ZYUX 3KJNA 3C7KA 5CFRA 3LQ4A 2GBGA 1BKSB 3KZVA 3KLPX 3ADOA 4BDSA 4E70A 5C81A 1R66A 5BUQA 2VT7A 1PEYA 4KEAA 1A77A 2XF8A 5A4IS 2E5WA 1CNEA 4W8GA 2XT9A 2EKBA 1E64A 5CVEA 5K9ZA 2ZTVA 4GPAA 1ZCJA 1QZXA 4MSUA 3WZLA 3KKEA 2VNHA 3TLGB 3WGQA 3FTCA 4B81A 5B7NA 4AG3A 1NQOA 3ETEA 1X1QA 3ADDA 1QFZA 1D5CA 2I2FA 3R0ZA 4D79A 2IXAA 2YS7A 2HQRA 4K3VA 4Q7EA 4LE1A 4PGAA 3ZZTA 1GRRA 4CFSA 3ABOB 1V5EA 2D4AA 5JLJA 4K87A 2XA9A 1E1CB 1X7GA 1HTWA 1ZISA 1WUIS 1TF7A 3AETA 3GV0A 3K05A 4B40A 1C8LA 1QJ4A 2JGNA 3REQB 2FP4B 4ONEA 1KDYA 3ZIDA 4JDPA 4ABTA 2FPGA 1CP2A 1WXWA 4I1YA 3BGIA