3OQBA

Crystal structure of putative oxidoreductase from bradyrhizobium japonicum usda 110
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
380
structure length
376
Chain Sequence
TTQRLGLIMNGVTGRMGLNQHLIRSIVAIRDQGGVRLKNGDRIMPDPILVGRSAEKVEALAKRFNIARWTTDLDAALADKNDTMFFDAATTQARPGLLTQAINAGKHVYCEKPIATNFEEALEVVKLANSKGVKHGTVQDKLFLPGLKKIAFLRDSGFFGRILSVRGEFGYWVFEGGWQEAQRPSWNYRDEDGGGIILDMVCHWRYVLDNLFGNVQSVVCIGNTDIPERFDEQGKKYKATADDSAYATFQLEGGVIAHINMSWVTRVYRDDLVTFQVDGTHGSAVAGLSDCMIQARQATPRPVWNPLHDFYGDWQKLPDNVSYDNGFKEQWEMFIRHVYEDAPYKFTLLEGAKGVQLAECALKSWKERRWIDVAPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Oxidoreductase
publication title CRYSTAL STRUCTURE OF putative oxidoreductase from Bradyrhizobium japonicum USDA 110
rcsb
source organism Bradyrhizobium japonicum
total genus 108
structure length 376
sequence length 380
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3oqbA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3oqbA01
2FPIA 1YL6A 2H9IA 3GLQA 4GLOA 2TMDA 1IYZA 1VKOA 3KVOA 3RC9A 4GI2A 4ZQBA 4Z9FA 1QSGA 1JVSA 2FPGA 4XZ3A 4LRSB 4ALKA 2WE8A 2ILTA 1NBOA 1FDUA 1A7KA 3EY4A 2CFCA 5EN4A 4CM4A 4YT5A 5BNIA 5BSGA 5I9NA 2NLOA 5THQA 3EUWA 3P2OA 4KZPA 3WFIA 4DREA 3HN7A 3LSYA 1CWUA 4D44A 4R3WA 2EW2A 3JQAB 3FD8A 2EXXA 3ZNQA 5BQFA 1JKFA 1ZUD1 1DC6A 4A73A 1YL7A 1GY8A 3RASA 3E6AA 1Q0LA 1GPJA 5DZSA 5JDCA 4HY3A 1EVYA 3DHYA 3ZZNA 4JP3A 4BMSA 3QSGA 4YJFA 3DZJA 3O9ZA 4YT2A 1T26A 3S2FA 1T2CA 1ISJA 1E7MA 1XU9A 2W90A 3JQDA 4AJPA 2W2LD 3KRTA 4ZRNA 1A7AA 5F3RA 3V8BA 5L4SA 1C1DB 1Z7BA 2CF6A 3RUAA 1PJBA 2NTJA 3QWFA 4FS3A 3AK4A 1LQTA 2AQHA 4ZRMA 1ADCA 3AUUA 3BZUA 4Y8VA 4ZICA 1QMGA 2V6GA 2ZB7A 3WDSA 1DC5A 1LC0A 2WYUA 4CMIA 5C5IA 3MJVA 4U0JA 1C14A 2XOXA 4IZHA 4EGFA 4NJMA 3QP9A 2HJRA 4RVUA 3H9QA 2WM3A 3EC7A 2G0TA 3VTFA 3U5TA 4TVBA 3RKRA 4JBIA 4PLPA 3G49A 1NFFA 2BLLA 1JTVA 3DZFA 3I3OA 4OM8A 3MCVA 2HK9A 3INGA 3ZCXA 1VL8A 4M49A 3KB6A 1ENYA 2WJPA 4Q3CA 5DNAA 2O2SA 1R0SA 1MLDA 2BFOA 3WSWA 4B79A 1V8BA 5I7SA 1LRLA 1Y8QA 1TLTA 3FWNA 4CPDA 1ZCJA 3ULKA 1E3SA 2AQIA 1NP3A 1I3KA 1R4MA 1ENPA 3PHLA 1ISFA 3QA9A 1MC5A 1A72A 5ICMA 2YV3A 1J5PA 2GYYA 1A4IA 1PSDA 2JCXA 1LNQA 3JV7A 2X5KO 5L95A 1UXKA 4BB6A 4CM9A 2RHCA 3Q1LA 4I08A 3JD3A 3NYWA 4WUVA 4QECA 3JQAD 2ZB3A 4U7WA 3PZBA 4AJLA 4CM4B 2P4HX 1EUZA 1ZK1A 3I4CA 5COBA 2IXBA 4D45A 4YT4A 1WDKA 2C5EA 3JQ9C 4IDGA 2Y1CA 1R4NA 1GYPA 2IYPA 2BD0A 4ILKA 2FZWA 4WPGA 1ZEJA 1NPYA 3EDMA 1KVUA 2DFVA 5AQ1A 3M2PA 4YAEA 3ETEA 4F46A 1P1JA 3PTZA 2B5WA 3JYPA 1GU7A 1HRDA 5L53A 1E5LA 3AI3A 3PYMA 5IZ4A 3BMCA 4BNGA 1Z82A 1LDBA 3WS7A 5IXYA 4WOKA 2A9FA 1U2DA 1VL6A 1XLTA 2B69A 3BTSA 2QYTA 4H16A 3F1KA 1TEHA 3ZWAA 4CL8A 1QR6A 4J1QA 1OC2A 3RBZA 3ON5A 3PJEA 1PZEA 1Y5MA 4JCOA 4UVIA 4AFNA 4PG5A 5L4LA 5L9AA 3WBBA 1J4AA 4Q9NA 4ZQHA 3GVXA 3L4BC 4FJ0A 4WJZA 4CMIB 3QJ5A 3WJ7A 3ZWPA 4D41A 3PIIA 4TKMA 4XX0A 4CMBA 3DAFA 4BNXA 4RORA 3E9QA 1B8UA 1VSVA 1P77A 1V3UA 1XWFA 1FDVA 4YCAA 3ZNOA 1Q7GA 1GUFA 5JDIA 1ZW1A 4FFRA 1NVTA 4FSHA 4UUPA 3VH2A 4AJNA 1ZKMA 4MJLA 3DC2A 2OO5A 1IL0A 5I7FA 4HFMA 3WYBA 1YDEA 4XB1A 1R4MB 4PVCA 4RF5A 3I6IA 1G0OA 1I24A 1KC3A 3ETGA 3ZHBA 3DO5A 4LSMA 2UVDA 3GF4A 5T5QA 4ND3A 4BKOA 1HL3A 4E6PA 1P31A 2D5CA 4YT8A 1M67A 2BH9A 4KTTE 4XDZA 2GR9A 2O2YA 1R0KA 4L76A 4NQZA 3RI3A 5I8ZA 3ANMA 4AICA 4R41A 2GN9A 4K6FA 2HSDA 3KLMX 2IEDA 4IY1A 4W9NA 1LU9A 4BIIA 1R4NB 4FFPA 5DOVA 2BELA 3HE3A 1XELA 3PDJA 3S2EA 1C3VA 5EIOA 4TVOA 3F47A 4D46A 3OJEA 3LU1A 4DPLA 4NU6A 4R1NA 3WGTA 3GRKA 3FR7A 4NIMA 2Q1SA 3BMCB 3BHJA 3NUGA 3FNHA 5KIAA 2VHVA 3KYDA 1D4FA 2P91A 1BXZA 3UH1A 4CM8A 2C29D 5A3JA 4CLXA 1E1NA 3ZNNA 4B8WA 4PCVA 1K0UA 3OH8A 4RV9A 3WLFA 4XQEA 1YBAA 4NBUA 5A9TA 1KVQA 5JAZA 3H2SA 5JYDA 1MGOA 1T24A 4YAIA 1LSJA 3GN2A 3TFQA 3JYOA 3P19A 1N5DA 2PD6A 3FTPA 2IE0A 1CYDA 1HZJA 3CUKA 2QQ5A 3X2EA 4A0SA 2AEFA 2DTDA 4LMPA 4YJHB 3VPXA 3ZGYA 5KJ1A 1GYQA 2V6BA 3OIFA 1B2LA 2E4AA 4AJ1A 2YYYA 1NWCA 4BNNA 3ONFA 3AOEA 4IJUA 5TF4A 1YB1A 3TDKA 5IDYA 5IFLA 3K2EA 3M2TA 4CUKA 4MIOA 3KTDA 1J0XO 4ZU3A 3QVSA 2Y1GA 2I6TA 3PQDA 3T4XA 1L1FA 3NDIA 2VT3A 4BVAA 3B1KA 5T6BA 3O26A 1XCBA 1YQDA 2IYOA 4BNMA 4ZJUA 5JYAA 3ONEA 1X7GA 4L9RA 1LLUA 4CM9D 4WLUA 5JAQA 4Z0HO 2H6EA 4TWRA 3HFGA 3JQFC 3TOXA 3GVIA 2ZJ1A 1HLDA 4Q3AA 3HDQA 2PFGA 4F6LA 1RYEA 1YVEI 1QYDA 3UHAA 3DOJA 1P0CA 1X14A 4CQLA 2R00C 1EVJA 3PWSA 3I4FA 4XQGA 3F4BA 1MG0A 3FNEA 3L6OO 1SOVA 4GMFA 3IIEA 2O3JA 1ADFA 3CSDA 1BDMA 1BTOA 1NM5A 4R1UA 5KVCA 2OUIA 4C7KA 1BSVA 3KSZO 5GY7A 4DWVA 4L8VA 4LSWA 5ER9A 2PGJA 4LRTB 1MFZA 3KYDB 2EIHA 4CM8B 3S2GA 3OETA 4E0BA 2D2IA 1P1HA 4YPOA 1RYDA 3WWZA 4BV8A 4B8ZA 3KHUA 1X1TA 3E5MA 5DBFA 1FDWA 2J5KA 3PXXA 2HK8A 2FRDA 1ZIDA 1E1KA 4PLVA 2X7HA 3ZU4A 3ZHYA 4ALNA 1C1XA 3DMYA 3IP3A 5G2OA 2Y0DA 4D0RA 1O5IA 3DWFA 1H2BA 4AJOA 2X5JO 3K5PA 4OXKA 1YL5A 1JAYA 1LLCA 3IMFA 2Y0EA 3VKUA 1HE4A 2NTVA 4NR0A 3OIGA 2LDBA 4CV3A 4LN1A 2CVOA 1E1MA 1YH3A 3PLNA 2B0JA 4TSKA 3RD5A 3Q11A 4O6VA 3W6ZA 3HWRA 2E37A 1R0LA 3FTNA 1CEQA 2ZIZA 3GC6A 5HBRA 3L6EA 1SO8A 5BR7A 2X0JA 4R5HA 3QV1A 5CEJA 3H4VA 3FPCA 4R4JA 5U9CA 3NT2A 1ZK3A 4IDCA 3DBHB 4BNVA 1Y9AA 2R6JA 3GDGA 5B1YA 2I67A 1X0XA 5CPBA 1NWHA 4TKLA 5F1KA 1EFLA 5ITVA 2ZTMA 4DA9A 4DQUA 4MVJP 1Y81A 4P4LA 4PRKA 4E12A 2JFGA 1PX0A 4GX0A 2EF1A 2OOSA 5A5EA 3DFUA 5B37A 1T4BA 4IQ8A 5J23A 1Q2XA 1VKNA 4BOYA 1LLDA 3FHLA 4JBHA 4NH4A 4PLZA 2PK3A 4PLCA 2BGMA 4CQLB 3DFZA 2GF2A 1H6BA 1EDOA 2GNAA 1I2BA 3L0DA 1M75A 4DC0A 3EAGA 3FBTA 1LA2A 3IKVA 3RBVA 1JVBA 1PZFA 5CEEA 1NVMB 3C3XA 2X4GA 3HG7A 3SJ7A 1CERA 1DAPA 4H15A 1ORRA 3L6DA 5B12A 1EFKA 2Y1DA 3G0OA 3G1UA 3GN1A 3DZGA 4W99A 2PGDA 2OP1A 2O48X 4CLRA 2Z1MA 1PJ2A 1QRRA 3GMDA 2ZYAA 3HB5X 1HSZA 5TC4A 3IOYA 4BNYA 3V5NA 5HTOA 4FFLA 2BMAA 1CQIA 4BO0A 3VDQA 4JP2A 1C1XB 2UDPA 4E2XA 4A26A 2JKVA 1UP4A 4PG8A 4XJTA 2EGHA 4R3NA 2E49A 5K6AA 5A03A 1N9GA 3K30A 3VZSA 1JQBA 2A4KA 1VPDA 1EZ4A 4WCFC 4E5PA 4YRAA 2X86A 4WCDA 1DBVO 1GV1A 3BHMA 3K96A 4EJMA 3GUYA 3H9GA 4I9HA 1M6HA 3P7MA 3TFOA 4RVSA 4RVFA 3ZHXA 1ENOA 1WNTA 1LRKA 4O5OA 2POQX 1CJCA 4F6CA 3BMOA 2RBEA 1UXIA 5T8KA 1VRWA 4FIZA 1DJQA 4U0KA 1E3JA 1DFGA 4BO2A 4KDEA 1IPFA 1T2EA 3AUSA 4J0FA 3AWDA 3GOHA 3GGOA 4J0EA 4XCVA 2NUAA 4OXNA 3TN7A 2VZ0A 1YKFA 1ZH8A 2NNLD 4OOEA 2JAPA 4XA8A 4B4OA 1PS0A 5KNLA 3WSVA 4K26A 4IM7A 1TB4A 5COQA 2UUOA 1SEVA 4CODB 1GQQA 4RO0A 5I7VA 1E0DA 1KC1A 5ADHA 3ETDA 1A71A 4UAGA 5G0UA 1JWAB 2V65A 4CLDA 4I5DA 4RGBA 3GHHA 5BSEA 3TZKA 4A10A 5I9LA 1UP6A 4DIBA 3VKVA 4CMEC 1I3NA 4IDAA 2NU8A 4J49A 3GVCA 5G0SA 2PZLA 4J43A 3D3EA 3GMSA 3H5RA 4GSKA 4WLNA 4ZD6A 1WDMA 3G3EA 4QO7A 2X0IA 5EQDA 3VPGA 1TXGA 2ZB8A 4R9RA 1TT5A 2FWMX 1I3LA 4CLRB 1SBYA 3FNGA 3PJDA 1I30A 1MV8A 2FR0A 3R3JA 4J16A 2DBRA 3PHJA 3KOUA 4RZHA 2J3IA 2X23A 1HDRA 2P2SA 4ND2A 4OO3A 4MVJM 1KBZA 4BL5A 1EBUA 2EJVA 1IUKA 3MWDB 4BHTA 1U4SA 1WPQA 4HADA 4GH5A 2X9VA 3AFNA 4ND4A 4NK5A 5A4DA 1U8FO 3PGJA 2AQKA 4L4SA 3ZN2A 1UXHA 4CR8A 5DN9A 5ENDA 3ZV3A 4YXFA 1LX6A 2BGLA 1U3VA 1S6YA 1PR3A 3CZRA 2YHIA 3GAZA 4BQPA 1XIVA 2EW8A 4QEDA 4R1TA 2HO5A 5MDHA 3ZWMA 2I99A 3SJUA 3COSA 3BMOB 1KY5A 3NRCA 1YS4A 4YDRA 2X0RA 3H7AA 3NGXA 1GEEA 2AG5A 2J6IA 3H5NA 5A05A 2JD2A 1JN0A 3E18A 1MC4A 4CQMA 1SCUA 4BGUA 3GDFA 4JJGA 1PJTA 1T1SA 1NFRA 2VN8A 1RJWA 2YHUA 2GGSA 1DB3A 4YJGA 1OAAA 3ENKA 4OSPA 3ANNA 3E9MA 1HDCA 5CDGA 1F17A 4J3FA 4D79A 4O63O 3PDUA 7ADHA 5DCWA 1BMDA 5IDWA 4HV4A 3AI1A 3TQHA 1RM4A 2A94A 4I8XA 2D4AA 2DLDA 3I9NA 4CLHA 2C2XA 3B20A 4UVGA 1IHXA 2DT5A 4E5YA 1GD1O 2ZQYA 4MDHA 5G0TA 2EHDA 4A7PA 5G0VA 1VJ0A 4W82A 4FDAA 5T8KC 3JD0A 4J2OA 4TQGA 1N7HA 3I23A 4CV2A 1G6KA 1YONA 2VWHA 3GVHA 4OGWA 4WLFA 2C20A 3UCEA 3WGYA 2P68A 2YDYA 5CPFA 3RSHA 3U09A 1D8AA 2QG4A 1KETA 3DZBA 3NKLA 1NPDA 1LDMA 1ULSA 1V35A 2TMGA 3WGGA 1D1SA 4LVCA 2BHLA 2Y05A 3KLPX 5FYDA 5TT1A 2FHSA 4X54A 3I9OA 1R12A 1X7DA 1KY4A 3LT4A 1DIHA 4Y67A 3IDSA 1WLYA 1M66A 4JNKA 3CEAA 3L4SO 3N74A 4KQWA 5ENVA 5IZCA 2HKIA 4W6ZA 2W2KB 3UXYA 1ID1A 3HFSA 3IQDB 3UN1A 3C8MA 1DRVA 5TIIA 2P9GA 3ROKA 2YFQA 4URFA 4HFJA 2YHIB 4RPLA 3LC1O 1X15A 3AFMA 3PYXA 3F5QA 3HN2A 3WOHA 4RJTA 4WEQA 5ILOA 1BW9B 3GEGA 3VDRA 2QRLA 2NM0A 4N5LA 4ONEA 3HDJA 4QQRA 3AU8A 3NV9A 1LI4A 2DTXA 4CMCA 1M76A 2GN6A 3PI7A 2HK7A 4EI2A 3MTGA 4CQMB 4XB2A 2Q4BA 2YQ4A 4Q3EA 1PS9A 3SBOA 3SLKA 3WQRA 1E3WB 4BNUA 4PN3A 4P8RA 4FJ2A 3C7CB 4XR4A 4XQ9A 1H0KA 4ALJA 3ITDA 4RVHA 2XF8A 4YJGB 1OOEA 4QXMA 5HS6A 5CDTA 1E92A 1HYGA 3B70A 1CIVA 4PLYA 1OMOA 4WGGA 1WZIA 3TZHA 2QX7A 3R0IA 2PY6A 3MJTA 3NT4A 1HLPA 1ZMOA 5A9SA 2VQ3A 2FOIA 5C37A 2X1HA 1LSSA 2QIOA 2QRKA 3MJCA 1JKJA 2J3JA 2JHFA 3I9JA 2Q1TA 2VHZA 1DHRA 2PV7A 5F1OA 4MVJA 1N7GA 2I9PA 4YBZA 2PZJA 3FSRA 3ZDFA 4EDFA 1WMAA 4DPKA 4YQYA 1R16A 4F3YA 1DIRA 2Y1OA 3JCZA 3D4OA 1W6UA 2PH5A 1GADO 1XEAA 2JCVA 3C24A 3GZNA 4LCJA 5I8WA 3WB9A 1LJ8A 2O3TA 4HWKA 4NBVA 1GZ3A 1UP7A 2HMTA 2RHRA 2VWPA 4A27A 1P1RA 3X2FA 4IUYA 4KTVE 2X9GA 3ZWYA 3FCOA 2PWZA 5F1PA 1PR9A 4NMHA 2GZ2A 2B5VA 2O3QA 4NG5A 3F3SA 4BO3A 1U7HA 5C7OO 2AE1A 8ADHA 4CMGA 3CMCO 4II3A 5JMPA 1XGKA 3WWYA 4YRBA 3UCXA 2BI8A 5CP8A 1KEUA 1PIWA 2QRJA 1MXHA 1LDNA 3T7EA 1OFGA 3DTYA 2RH4A 2WTBA 1HDZA 1ZJZA 1XA0A 5JY1A 2Q45A 4OKIA 3KUXA 1MX3A 2ZATA 3R6DA 3ONDA 3ZU5A 2B4RO 4CQMD 3OJLA 5A02A 3HB4X 1DRWA 3R3SA 3NTRA 3FPLA 4KDFA 2NACA 4NHEA 4J1TA 3AUTA 1VL0A 1A27A 2EV9A 1DC3A 1A9YA 3O4RA 3PK0A 4CUJA 4KUEA 5A9RA 3MZ0A 2G82A 2NADA 2O3RA 3KO8A 1EBFA 3UGKA 3VHRA 3CKYA 2CUKA 1WVGA 2F1KA 3RU7A 5JO0A 4CM6A 3OECA 3IJPA 3Q6IA 4FW8A 1MUUA 1MG5A 1D7OA 1RM0A 5HA5A 5A9SB 3AM5A 5CDYA 4B3IA 3GUCA 4R68A 2CDAA 3DMTC 1JU9A 3ZWCA 1DIAA 4XRGA 3RCBA 3JQ7B 5U4QA 3ADPA 3H8VA 3WQSB 1HZZA 3GRPA 5DBGA 3UF0A 5JDIC 2VRCD 2HMVA 1HDXA 2C82A 4GX1A 2PKQO 3DL2A 1V0JA 1IPEA 3DONA 2A92A 4BV9A 4Q3DA 1UZNA 3GZNB 3FN4A 3NDJA 3RQSA 3LLSA 4NU5A 4RVGA 3DAGA 1EQ2A 3PRJA 4BO8A 4YYZA 1K5HA 1KERA 2HCTA 4XQCA 1UZLA 2XPCA 2GN4A 4YJHA 1YBVA 4L73A 5DULA 2Z1NA 4OJNA 3A1NA 3MEQA 1T2DA 5T73A 3A06A 3OBBA 5JBIA 3RUCA 3OHSX 3V1UA 3JQBA 4AJKA 5JDCC 3MJEA 2O4UX 1DEHA 3QHAA 4FQ8A 1MA0A 5JC1A 4N7RA 5JMWA 3EW7A 5TLSA 1GQYA 1S7CA 2E6UX 3DQPA 3H65A 4Y9DA 2GD1O 1T25A 4UREA 3AJRA 4E4YA 2CY0A 1NNUA 5CFZA 1LQUA 3DBVO 1DDOA 4B3HA 4DLBA 1H6DA 1OI7A 3QIVA 1FK8A 2ZB4A 3LK7A 4K28A 4U5QA 4U6SA 1XHLA 3KYCA 3IL2A 3ZI0A 2DVMA 3HQ4O 1YO6A 4NK4A 1U7TA 1PQUA 1VLLA 3F1LA 4FD3A 4WNCA 4FFNA 4XR9A 1VJTA 2VNAA 4JGBA 2O50A 3JD2A 4PLWA 4GKVA 1SAYA 1BXKA 1ZSVA 3ZH2A 4GQAA 3RVDA 3PIDA 4J1NA 3GEMA 3BA1A 2PZKA 3JD1A 1V3TA 4IIUA 5JXWA 3DOCA 1KVRA 4MVJD 1NQ5A 3ZWVA 4IDEA 4PZCA 4UVHA 4J7XA 4YAJA 5DT9A 3Q0EA 3PZRA 1JAXA 1AHIA 5DP2A 4GGPA 4H7PA 4FOSA 3AW9A 5DP1A 4Z3DA 4KQXA 5T64A 5TSDA 3E8XA 4HNHA 3AU9A 4ZVVA 5GMOA 3V2UA 2IEBA 1GV0A 3JD4A 2G5CA 4R69A 4RPJA 5EMHA 4PLTA 1RWBA 4J2HA 2OORA 4I9UA 1C0LA 4D7AA 1E77A 5A1TA 5IG2A 4NDNE 1YBMA 3RFXA 1YDWA 1KOLA 3N58A 4K9DA 3AY7A 1I8TA 1X13A 2RAFA 3JQCA 2HRBA 2HU2A 1C0PA 1SNYA 3W8FA 2OBNA 4GGOA 1V3VA 1DOHA 1B26A 2YY7A 3BMQB 3IC5A 1YGYA 1ZO8A 3IJRA 4W4TA 3LQFA 1H6CA 1Z45A 1P0FA 4WE3A 1ZSNA 3DZKA 5T57A 4O1MA 4E21A 1X1EA 4IJWA 3P5SA 1I33A 1E7SA 6LDHA 4EW6A 1BGVA 1O8CA 3M1LA 3PPIA 3HSKA 3DBHA 1IY8A 4CR7A 4DTIA 3DBRB 5KJCA 4II2A 4XDYA 3GA0A 2P5UA 3KETA 1GCOA 2C5AA 2WDZA 3KYCB 4BQRA 4CJXA 1E7YA 4OXYA 4P4GA 1LDGA 2HLPA 2OBYA 4OQYA 1XG5A 5TJ9A 1O0SA 1HTBA 3CXRA 5F21A 1SEPA 4IGFA 1ENZA 1HDOA 3LF2A 4IJKA 3JQGA 2QHXA 4IDDA 1SPXA 2OHXA 4IJVA 2NQTA 1PL7A 2RH8A 3RU9A 3ENNA 1ZNQO 1NAIA 2X22A 3GNTA 5KJFA 5THKA 3JTMA 2C7VA 1N8KA 3RUHA 4BO6A 1O9BA 3TPCA 4UUMA 3PHHA 1N1GA 4I1IA 2JCYA 3RKUA 2PLAA 1GUZA 3HDYA 1P1FA 3N7UA 4DPMA 5I9MA 2Y99A 4YVFA 2NVWA 4CMAA 4RF3A 4MP6A 3OQBA 4NBWA 4PLGA 4U8GA 3M1AA 4XGKA 1E7WA 5FFFA 3A14A 1KEVA 4L4RA 5TQVA 3T4EA 1P33A 1KEPA 4B4VA 3O03A 4W9NC 3RROA 4OYRA 3WGOA 3DEYX 3TOZA 1NYTA 2I65A 3WNVA 1B3RA 1FXSA 4GAEA 2QZZA 1MP0A 4NFYA 2B4QA 4QFDA 1HEUA 2IZ0A 2ZTVA 3QW2A 3GAFA 1HE2A 1VJ1A 2PGLA 3SC6A 4DIFA 2AEJA 3OEYA 4JQCA 4UVDA 4J9VA 4EZBA 2JJYA 4P38A 2ZYDA 4NFHA 1ZBQA 4MP8A 3UVEA 1ISIA 2AE2A 3AM4A 2EKPA 3EMKA 2VOEA 2VOJA 1DPGA 3E5RA 3UW3A 1AE1A 1E6UA 4Y6SA 4ROSA 5JO9A 4YR9A 3UAGA 2CVQA 1LRJA 3L77A 5A04A 1ZEMA 2GN8A 1HYEA 2VTDA 5IXSA 4BO4A 3OICA 3LF1A 1I5RA 4TRRA 1A5ZA 4RPHA 2PNFA 1EUDA 4IMRA 3U4HA 1DLJA 5AXAA 2Q2QA 4E31A 5BSHA 2AW5A 4XIJA 4OMUA 2FSSA 3AOEC 5EERA 3JQGB 5LCXA 4S1VA 4HBGA 5DCUA 3NEPX 3H5AA 3O8QB 1UH5A 5F5NA 3PFWO 1F8GA 1HETA 2VUUA 4W7IA 3QWIA 4XYMA 2FZEA 5G4KB 4AJJA 4BGVA 1UDBA 1ISMA 2VTEA 1FJHA 4RL6A 1ONPA 4GVXA 4H3VA 2YJZA 3FWZA 3KZVA 1PZGA 4HNGA 1PZHA 3VH1A 3EHEA 3TRIA 5L51A 1K3TA 3HADA 3V1YA 2EGGA 2HMWA 3I9MA 4BO1A 3TJRA 4FN4A 4EUHA 2CVZA 3ZW8A 2H5LA 4DC1A 4UUOA 3LVFO 2ZKLA 5KKCA 3ROQA 2I66A 3NAQA 4AJIA 1NASA 5BT9A 3Q2KA 3WFJA 2Q2VA 4E33A 2J3HA 5EL0A 4LCEA 2Y1EA 4ZA2A 3BHIA 2WSBA 1AN9A 5FI3A 5B4TA 4XIYA 1F06A 2FP4A 3BMNA 3GNQA 3ZV5A 4J9UE 2UV8A 1YQXA 2YV1A 4J4TA 1BG6A 3I5MA 1U1IA 1GZ4A 5IF3A 3SX2A 1YE3A 3NDRA 2JFFA 3DZHA 3DAPA 1VM6A 1W73A 4E2YA 3ADOA 3NGLA 3ZHZA 2PZMA 5JAMA 4Z0PA 5H81A 4N5NA 2HQ1A 4JBGA 1HDGO 1H9AA 1K89A 4KUHA 4FFOA 4CV0A 4DBZA 1KVSA 1XU7A 5ICSA 1O94A 1UXJA 2Y66A 3WX0A 3EK2A 4DVJA 4JLWA 1LBEA 1RKXA 4YWJA 1NQOA 5JAIA 1HWYA 4BS9A 4HXYA 4Q3BA 5KWEA 1DLIA 3GGGA 4XEHA 5JFOA 1R37A 1P1KA 3K8ZA 1RM5A 1B0AA 3UUWA 3INTA 4KMSA 4Y6RA 3AI2A 4JJFA 1YJ8A 3VAZA 2IZZA 2C7GA 3I83A 5KVQA 3WGZA 1Y6JA 2CD9A 5BNFA 4E5NA 4MVJI 1WXDA 1GYRA 1WW8A 1L7EA 2YDXA 4K6CA 3BAZA 3QRWA 4ZQEA 4ZQGA 1ZK0A 2DBVO 5IJZA 4XYGA 4PG6A 4J1SA 5JCJA 5L3ZA 4IINA 5EJ2A 3S8MA 4IXTA 2ZTUA 5L7YA 5JCXA 4HKTA 2PKRA 1LDYA 3W6UA 1ZXBA 1BXGA 3BYZA 4TZKA 3W4KA 1WDLA 2Y68A 3K31A 3OJFA 1FF9A 4D0SA 1G0NA 5AXBA 2HRZA 3U4DA 3QWBA 3B1JA 5ES3A 4R1SA 3VZQA 4DIOA 1PGNA 3CTMA 1P44A 4XWYA 5EINA 2DBQA 3JQEA 2FR8A 2BKAA 2DQ4A 1PS8A 2Q3EA 4XYEA 1VI2A 1Q7CA 3BMNB 4GSLA 1P74A 2VCYA 2W2KA 4OOFA 1DAOA 2NVBA 2ZTLA 3DXFA 3IUSA 2I5PO 4J90A 3BTUA 4YAKA 1WMBA 2ZJ0A 4MVJH 3WBFA 2GZ1A 3AUAA 1YWGO 1KVTA 2HUNA 3PVZA 3SLGA 5GZ1A 1FDSA 2O7QA 4M8SA 4R01A 3WXBA 1GR0A 1A9ZA 2NTNA 5KTKA 3QVTA 1BW9A 3GEDA 4FC7A 1B15A 4XGIA 3IUPA 4W7HA 1LUAA 5L7WA 3DR3A 3GZ4A 4I9NA 1M2WA 1LDEA 3Q9UA 4Z3KA 1HKUA 5DBIA 2CNBA 2BF7A 4IQGA 1KEWA 4WLVA 1E3WA 4KUGA 3S55A 4AJEA 4BNFA 3NJ8A 4YACA 3U49A 2CMDA 2CF5A 4XYBA 3E48A 3VPHA 1XYGA 4DMLA 2PA3A 3FBGA 1WP4A 3KM0A 4XYLA 4EBFA 8LDHA 1ZMTA 3NTOA 4UEOA 2H63A 5K6AC 4G65A 5U1PA 1B14A 2JD1A 2AQ8A 2VNSA 4CM5A 1G1AA 1JLLA 4GVLA 2VHXA 4BO7A 2X8LA 2FSVA 2W8ZA 2X9NA 1DO8A 5I7EA 3DDNA 3ITKA 1T4DA 3HJAA 4RZIA 2BFMA 3VZRA 4ALMA 1I10A 3L07A 1LTHR 4KOAA 4LISA 4TROA 2CDBA 3ZW9A 4DMMA 2OMEA 1IB6A 1BXGB 2WEKA 3LT1A 4Q3NA 5AYVA 4BNTA 3QLJA 2DPHA 1I01A 4GX2A 4K1LA 2YW9A 4EJ6A 2D3TA 5FWNA 1EEHA 2GPTA 5CDSA 4PIVA 1K6JA 2WYVA 4C7JA 2LDXA 4WK6A 2PKQP 3EZYA 3E9NA 3GFGA 4MVJF 3QVXA 2Q22A 5CDUA 4CLEA 3VH4A 3OQ6A 4MINA 3C1AA 1NTOA 1J49A 1GCUA 2VWQA 4J6FA 2FY8A 3K2BA 1QYXA 1BWSA 4GL4A 5CG2A 2YV2A 1UDCA 4UEJA 2WMDA 4OAQA 1PU2A 5JLAA 3RWBA 5CAEA 4I5GA 3JQ9A 5L7TA 3MOIA 1U5CA 5JSFA 3C1TA 3FR8A 4BKQA 1E7RA 5COAA 3D64A 2BFAA 4I5EA 4B3JA 4LVUA 2ZCUA 3M6IA 2NU7A 5AVOA 2VZ9A 3WGQA 1E5QA 4LK3A 3UFXA 2FPPA 5FEUA 1UUFA 1U4OA 1Z75A 3W8DA 1ISHA 2DKNA 2Y93A 4QTZA 4R54A 4BNJA 1UXGA 4ND5A 3DZIA 2DUWA 1DIBA 1PGOA 3KEQA 4ZN6A 3MJ4A 1XQ6A 2B37A 1N2SA 5JCJD 1MB4A 2YUTA 1Z74A 3OJOA 5BSFA 5FF9A 3JQ7A 1DFIA 4BNKA 3WGHA 3CZMA 4DRYA 2OP0A 1E3EA 5LC1A 4RLHA 3STHA 1V9LA 3L4BA 2C59A 3NJ4A 5EQFA 1PTJA 2O7SA 2UUPA 1GTMA 1NX6A 1JWBB 4DLAA 4J7UA 5HS4A 2DTEA 1DXYA 3FRJA 5L4NA 1I2ZA 1U8XX 2OGUA 4FR5A 4OQZA 4D3DA 3JQ8A 1NR1A 1E1LA 4ESOA 2QW8A 1B7GO 5JNLA 1AGNA 2Y67A 2FMUA 1H6AA 4PZEA 4QFCA 2RCYA 3C85A 3D3WA 1O89A 4HFNA 1EVZA 4R9SA 3LT2A 2Q4EA 1ZK2A 2D59A 2O4CA 5JE8A 4EUEA 4IDFA 1B3BA 4FGSA 3QVWA 3HZZA 1GZ6A 3PWZA 5LDGA 4QO8A 1B16A 2GLXA 3B6ZA 1K6IA 1LLQA 3TF5A 1EDZA 2EERA 2O3UA 4GX5A 3QWAA 4IMPA 1NHWA 2C54A 5ER6A 4E30A 9LDTA 6ADHA 1ZSYA 1L7DA 3H9JA 1SOWA 1H94A 3DHEA 1NQTA 3U4IA 3BTVA 1YB5A 5CG1A 1D3AA 3D4PA 3PYLA 4QT0A 3SEFA 4AVYA 3I9KA 1GL3A 1Y9EA 2J5QA 3D1LA 3KBOA 4Y98A 1EQUA 4NI5A 5GZ3A 3FF4A 3PWKA 3L9XA 4NNJA 9LDBA 2E48A 4EUFA 4DBVO 1ZXLA 5HWSA 1ADGA 4ZQFA 2X0NA 2NWQA 2VYNA 1SC6A 3CMMA 3H9EO 4TMFA 1NAHA 1GEGA 1GPDG 1YQGA 2I76A 4N18A 5KKAA 3QE3A 1BDBA 3PQEA 4FJ1A 2VHYA 1ONNA 2E82A 1W0CA 1IULA 3VZPA 5IZCC 2NU9A 4AJ4A 1VSUA 3WIDA 4MIEA 2HAEA 2D8AA 3D0OA 4AJHA 5TJHA 1W8DA 1XR3A 4I5FA 4YJDA 1T2FA 4E13A 3G1TA 2XXJA 5BNTA 3WMXA 4YA6A 2IDZA 4WEOA 3H3JA 3FNFA 4D3FA 3ZU2A 1U2GA 3D7LA 3S1LA 2PR2A 3GPDG 1ZZEA 1WAMA 2NQ8A 1JKIA 2PD3A 4G2NA 2V6FA 4WNIA 1D1TA 3KEOA 1PQPA 4RPGA 2VUSA 1ISGA 3HHPA 3JQ8B 4NZ9A 4F45A 1HF3A 3D5QA 2UYYA 4M54A 2QZ9A 2ZK7A 1XKQA 3TSCA 4EJ0A 2V6MA 1R15A 2Y0CA 4P4NA 2BFPA 4JROA 3D4NA 4YJFB 3D3WB 1DJNA 4BNWA 3VTZA 1JDJA 2HJSA 3VVBA 2WWRA 3BMQA 3I6QA 2EP5A 4ALIA 2P9EA 1U3WA 4RF4A 5DCYA 2Z95A 1X0VA 1AXEA 3WJAA 3GT0A 3JQFA 5TS3A 4DUPA 5LDHA 4IGEA 4Z9XA 4DQXA 4L74A 1Z7EA 1HSOA 1VC2A 4R5MA 2O3SA 2DAPA 3OA2A 3PEFA 3DBRA 4NJMB 3TZCA 3ABIA 3ZV4A 2VYVA 2R00A 3OQ1A 1MFPA 3OSUA 3ORFA 2VT2A 4LMRA 3E03A 4N5MA 4IDBA 4XRRA 1N92A 4OIMA 4CR6A 3ZWWA 1JA9A 3AM3A 3ZU3A 2BI7A 3WLEA 3CPSA 1QXSA 4MKXA 1U3TA 2G1UA 3B1FA 4KP7A 3RUFA 1Y8QB 3OJ0A 3RIHA 3G79A 1TI7A 4A2CA 1DSSG 4R51A 3LZ6A 3OM9A 2Q49A 1KS9A 1Z6ZA 4PLHA 3VPFA 2IRWA 1NQAO 1GDHA 2DBZA 4PGFA 2A35A 3GFBA 4PG7A 1EE2A 5HRUA 3CIFA 2GASA 3UCFA 1T2AA 3WNQA 3QWHA 2GZ3A 2Q99A 4BO9A 1EK5A 1PL6A 3ROPA 1ML3A 3MWEB 3GNSA 1YOVA 1DRUA 4RQTA 4E2ZA 1ULUA 1YXMA 4WLEA 1FDTA 2CZCA 1V6AA 2G17A 2HMUA 1PGPA 1E6EA 1O95A 4FC6A 1Y8RA 4PG4A 3Q3CA 4TRMA 1PJQA 4N54A 3GHYA 3WICA 3UKOA 4WASA 2NVUA 1NVGA 2J5RA 2Y1FA 3OIDA 1ZVMA 2GO1A 4A03A 1BRMA 1QLJA 4M87A 5JYFA 2DUUA 1PJ3A 1U28A 4IBOA 4CM7A 4O0LA 1ZK4A 4NBRA 4M89A 3TL2A 3UOGA 4BUCA 2EG9A 2BGKA 2JAHA 2Q50A 2GCGA 4IXWA 2C0CA 1PGQA 4IS3A 4IQ0A 1HE5A 5GZ6A 3GPIA 3EZLA 2ET6A 3F4LA 4XGNA 1PJCA 4PRLA 4AL4A 1Q0QA 2DPGA 2EEZA 3CH6A 5TGDA 3DHNA 2PTGA 2VYND 3PP8A 4TRNA 1QYCA 2GRAA 3VVCA 3HUDA 4FGWA 3KSDO 4PLFA 4GWKA 2D5AA 3D5TA 3PQFA 4AJ2A 3OEWA 1NR7A 3INRA 1SMKA 4MKRA 2WD7A 4CMHA 5A5FA 4OKNA 1P45A 1BVUA 4HFRA 1SB9A 3RUEA 2IXAA 2J3KA 3P2YA 3RJ9A 1QYWA 1SB8A 2VUTA 1PEDA 2EJWA 1R6DA 3A28A 3O8QA 5DOZA 1PJ4A 1N1EA 1XSEA 5G4KA 3V2GA 4J91A 3JQBC 3RAJA 2B35A 1U9JA 3QVOA 3WYCA 2XXBA 3WMWA 3WTBA 4LW8A 1ARZA 4HUJA 3AY3A 1GUYA 1YRLA 4QUKA 3WGIA 4GWGA 4CUZA 3PGXA 3JYQA 3U4CA 4A5OA 1LC3A 2AEMA 4Z6KA 4P22A 1NHGA 3LDHA 4GBJA 5L45A 3GG9A 3TZQA 3W4JA 3DOOA 2I3GA 1YOVB 2OFPA 4BO5A 3VPSA 3Q9NA 5M6DA 1B8VA 4WCFA 4FCCA 5J9GA 1CQJA 5HM8A 3U3XA 4DLLA 2EKLA 4G5HA 3H2ZA 3LT0A 4Y6PA 4BB5A 3GR6A 4RDHA 5KVSA 1Y8RB 5AXDA 4EEXA 2JHGA 5A06A 3V1TC 4IZIA 3L9WA 4ID9A 4AG3A 5IDQA 1U3UA 1VE9A 1QP8A 1J6UA 2NVUB 3RBXA 1KYQA 1HDYA 3ZV6A 1UAYA 3F5SA 1NPTO 2C2YA 4S3MA 3W8EA 2YFHA 2DFDA 1ADBA 3FI9A 2EWMA 4NJOA 1Y7TA 4D3SA 4Q39A 1IHYA 4CV1A 1XDWA 3I9LA 3UICA 2VYVD 4RLSA 2VRBA 3RUIA 2JFHA 5AOVA 4M86A 1LSUA 4DYVA 2OXIA 3NX4A 2F00A 4WECA 4B7UA 1F12A 4FB5A 4CM3A 2W4QA 5K0ZA 4QX6A 5B4UA 4BMVA 1AXGA 4DL9A 3MTJA 2WD7B 5TRTA 3WIEA 4BKRA 1YB4A 3PJFA 4JXKA 1UDAA 4B4WA 4CMEA 5H83A 3OMLA 3OF2A 3IKTA 5JC8A 3K9QO 2AA3A 1HT0A 3WYEA 1W4ZA 1H5QA 1Z73A 3GY0A 1CF2O 1AHHA 3R1IA 4YB8A 4CMJA 1I0ZA 1H2HA 5KOIA 2YQ5A 3RFTA 1OBFO 4J4BA 1C0IA 2CSUA 1PWZA 3W1VA 3KV3O 1DHTA 3E1KA 3GK3A 4B4UA 3U62A 4MVJE 4UVEA 3H6KA 3KXDA 1CRWG 2ZQZA 4G81A 4NBTA 3V2HA 4O59O 2NSDA 1KIFA 4E2WA 4Z9YA 3KSUA 4JK3A 1PQWA 4JJIA 5C3MA 2X58A 4WOJA 1DIGA 2W98A 4WCFB 5JS6A 2VZ8A 4E5MA 1QKIA 4CLOA 2Q1WA 4D42A 1Q1NA 1UZMA 1O6ZA 1H9BA 2DM6A 4MO2A 3S2IA 3AOGA 3LLVA 1FMCA 1HE3A 4WLOA 1QV7A 4CMKA 3OFSA 2PD4A 1E3IA 3LC7O 2PH3A 3OP4A 4CL3A 1RPNA 5L40A 5G0WA 1F0YA 4FOOA 1EMDA 5CHEA 2DC1A 2WD8A 2VHWA 1F14A 1K2WA 1PL8A 4UULA 2IODA 3ASVA 3E82A 3MOGA 3WR5A 2Q2WA 1QV6A 2ZCVA 3EVTA 4BKUA 1NXQA 4ZGWA 5H82A 5EPOA 5TT0A 5DF1A 1LXCA 4BGIA 1I36A 1TVEA 3I52A 1BHSA 5JPIA 4DQVA 4GLLA 3HNPA 4INAA 5AXCA 2B83A 5KJ6A 2EKQA 3JYNA 3O38A 3VC7A 4GMGA 3H9UA 1LSOA 1I32A 1QLHA 4YEDA 1E7QA 1HXHA 2Q1UA 5KJEA 1IZ0A 4UEKA 4EEZA 5IDXA 5KCZA 1TT7A 5TNXA 3W4IA 3SVTA 3RC1A 3KYBA 3ZWXA 4M1QA 4B7XA 4BNHA 1UAGA 4NPCA 1GAEO 5TX7A 1DC4A 2CDCA 4KWHA 4ALLA 1P3DA 1Y5RA 4J4HA 2I3AA 4DXHA 2AMFA 2B36A 3A9WA 4MVJG 5T67A 2FR1A 4E3ZA 5G4LA 4JX8A 4RPKA 3RFVA 5MGBA 2VWGA 4NFSA 2HMSA 3F6YA 3VOSA 1AUPA 1GQ2A 1OC4A 4OL9A 1K6XA 1BVRA 4RF2A 3C1OA 4E32A 4YAGA 3RC2A 7MDHA 5IN5A 3T7CA 2WE7A 1Q0HA 1LEHA 3GDOA 3ANLA 4YTEA 2NU6A 3VH3A 1QG6A 4IPTA 4GKBA 2NV6A 1PJLA 1NFQA 1UJMA 2JD0A 2P5YA 3F9IA 4CLOB 1EUCA 2GDZA 2JL1A 4DGSA 1R66A 1TA4A 3PJGA 4ITUA 3JSAA 1XQ1A 2X5OA 3GG2A 3ROMA 3RUDA 4B7CA 4R16A 2W2LA 1EVIA 4BNLA 3DTTA 3A4VA 1PGJA 2C07A 3TNLA 1X7HA 2GUGA 2X6TA 3WTCA 1P1IA 4MKZA 2Z5LA 4E5KA 4HP8A 3IAHA 4U6QA 4TRJA 3BIOA 3AY6A 4ZHSA 1ONOA 5JW6A 3C7DB 2P9CA 3ST7A 4CM1A 3EVNA 2R2GA 1WWKA 1QYVA 3WG9A 4IIVA 5C7IO 3JYLA 3K92A 1N9GB 4RVDA 4BMNA 5DDIP 1Q7BA 1MXFA 1IZ9A 2UAGA 4FPXA 4HX5A 3ZWNA 1CDOA 3BXXA 2D1YA 4M55A 4BKPA 1P9LA 3U9LA 1I3MA 2EP7A 2H1SA 3NT5A 4BNZA 3DBLA 5CEFA 1U5AA 4PFJA 3ZWBA 2YZ7A 1QORA 4EITA 2SCUA 2FN7A 2P4QA 5A3VA 2GSDA 3MJSA 3RJ5A 3ICCA 4QSMA 4RCVA 4LGVA 2D0IA 4RQUA 3IP1A 3EYWA 4L75A 5IN4A 1E6WA 3RC7A 1PWXA 4MOWA 5F5LA 4L0QA 1PJSA 1F8FA 2OL4A 1EK6A 2J8ZA 3PHIA 4WKGA 3G17A 4BGEA 3DB2A 3CE6A 4DYDA 4GPD1 2QYSA 4KWIA 2AXQA 3GH3A 4RDIA 1ZJYA 2Q46A 3TWOA 1E3LA 3SXPA 3K73O 2AG8A 3C7AA 3I1JA 3OA0A 1UR5A 2DU8A 3JQAA 4JIGA 1I2CA 4OHUA 1EE9A 4YRDA 1HYHA 2WYWA 2O23A 4PZDA 3TL3A 4MPDA 2V7PA 4EYEA 4MP3A 5JYEA 3JQ6A 4YQZA 1YJQA 4D43A 4L4XA 2GERA 1H93A 2G76A 1IOLA 4MIYA 5FI5A 3PFFA 3GVPA 1A4UA 1C1DA 3QQPA 3ZNPA 1SZJG 3GQVA 1CETA 3F46A 3GGPA 4C4OA 5EESA 4JN6B 4TZTA 4BNIA 2VRCA 1GFSA 4XD2A 4XKJA 1TT5B 3H3FA 1Y1PA 1ZFNA 3PHGA 3QY9A 3Q2IA 5C7LO 2BRUA 3IS3A 4Z0TA 1JW9B 4IS2A 1RM3A 2RIRA 3ICPA 2B4TO 3CINA 4OSOA 3EGOA 1IE3A 1B8PA 1M6WA 3SC4A 2ZYGA 4FFMA 3PLRA 3U0BA 4OH1A 3BTOA 5B4VA 4PVDA 2XAAA 4J7CA 2OZPA 1DFHA 2IZ1A 4ND1A 3LC2O 1WZEA 4UUNA 3NTQA 3ZWOA 5ITWA 3DMTA 5KVVA 3DBLB 3ASUA 3TZ6A 5JY6A 1T1RA 2HDHA 3HDHA 1C0KA 5ILGA 3K6JA 2AHRA 5IAAA 1OZAA 4XJSA 5K9ZA 3LYLA 4FBGA 3WQQA
chains in the Genus database with same CATH superfamily
4EMSA 2BFDB 2FPIA 2H9IA 3GLQA 421PA 2JEOA 1LW6E 3LUJA 4Q24A 5LU9A 2TMDA 3SHFA 1VKOA 4ZQBA 3RC9A 4GI2A 4Z9FA 1QSGA 1JVSA 1XKXA 3JU3A 4YMGA 4POOA 4LRSB 1UZUA 4ALKA 1DG3A 3OLWA 2QM3A 2ILTA 2WE8A 2FYTA 5B30A 3DBIA 1YFJA 2RGCA 3BGOS 3TYXA 3ZTYA 1EUQA 4CM4A 3HKDB 2CFCA 4K6OA 3UAOA 4DW8A 1J21A 1N32B 1LVGA 4QJ3A 2WG1A 4IQ4A 5DKFA 4BWFB 1T3ZA 3FCCA 1OREA 3ANXA 3WFIA 3C4VA 2R96A 3RTAA 4KXFB 5JSZA 3LSYA 1WHTA 1T91A 4R2XA 1SD5A 1XP5A 3JQAB 3FD8A 2H2FA 4V2UA 2V5VA 2OD2A 3MAGA 4KQ6A 1ZUD1 5DU2A 4LBYA 4A73A 4CKCB 1ULTA 4F2HA 3IAFA 2NG1A 1S2GA 4IH9A 4JB2A 3MTEA 3RF6A 1E6MA 2K7FA 4M9QA 3RUAA 3ENVA 4BMSA 1K7SN 3DDUA 1YI0A 1UPUA 1XMSA 2ZTHA 5HDBB 4P93A 3CONA 1I6LA 4FYKA 4YPFA 4G36A 1A7AA 1JBEA 1QHEA 4P7BA 5F3RA 3QUCA 4IIHA 3V8BA 4QUIA 2CF6A 2IVZA 2F3SA 3L0IB 4FS3A 4MAMA 3ETCA 1KO8A 1V95A 5HUQA 3RSSA 2VP3A 2RONA 2FSVC 4MWSA 1O4WA 4ZRMA 5LWHA 3A6GA 1U31A 1O6FA 4BQNA 1GHTA 1QQAA 1LC0A 2EBHX 4AMGA 2Q9AA 4CMIA 2MYPA 3TTVA 2G36A 2OQIA 1ZJ6A 1THTA 4ER6A 5B3KA 1C14A 4XIIA 2XOXA 4AO6A 3MWKA 5JNVA 4C7BA 4D3YA 2OHHA 4IZHA 3THWB 4JLOA 2CHGA 3EH1A 1AQYA 1OLSB 3N1UA 4G4SO 2PGIA 2VQSA 4G1EB 4B6JA 4B3XA 5KBYA 1CIPA 4OKSA 4RVUA 5F9FA 2WM3A 3HVJA 4EUNA 1HMPA 3BH0A 2PKWA 3O73A 3AFOA 4JBIA 4TV8B 3ZJXA 3SQOA 3ITNA 4FINA 4PLPA 3W05A 1BQEA 1PNVA 4L28A 3UOAB 3TXXA 3MCVA 4AKGA 3OO1A 3V2IA 2H11A 2C04A 2ZSHA 3H8JA 1JSLA 3KPJA 4I99A 4Q3CA 4YFVA 5FULA 1GPAA 2R25B 3NRBA 3OEHD 1X6VA 1RACA 3RRBA 5HSGA 3WSWA 3RIYA 4AMUA 4B79A 3HVHA 1LRLA 1Y8QA 2R8PA 2VEDA 1QZXA 3NBZC 4CPDA 1E63A 3HCBA 2G09A 3ULKA 2OEPA 3M1YA 3ZS8A 2XMSA 2W43A 2P5TB 4EI9A 5C0OE 1RNLA 4HC4A 1JXOA 3PTLA 1A72A 1G9TA 2CLSA 2VJMA 3AKEA 2DFLA 3H13A 2NX2A 1A4IA 1PSDA 3JV7A 1DTWA 4XSHA 5L95A 1UXKA 4CM9A 2VJBA 4OBWA 5GV8A 1CUBA 2EDCA 2H85A 4H0CA 4WUVA 2G6TA 1DTSA 4MV5A 4HN2A 3AVOA 2P4HX 1EUZA 1MDFA 2DKOA 3I4CA 4I1UA 3C5EA 2W9XA 4LBWA 1SBTA 4UCWA 5DX0A 4YT4A 2XBMA 3CHYA 1IPHA 3CM0A 1DS6A 4YLYA 5EGNA 1SHTX 4MV9A 3W6PA 2FZWA 5C31A 1ZEJA 5HK8A 5LL6P 2GEBA 4C4SA 5ALPA 2DFVA 2E4UA 2IVFA 4M9SA 4O2RA 3T7AA 4WDQA 3M2PA 4YAEA 3WDMA 4F5DA 1P1JA 1Q21A 4O8CA 2B5WA 3ZE2B 4BJHB 3JYPA 5IK2D 3URKA 1FZQA 3ZU6A 3NR2A 3W2IA 3AI3A 3CW8X 5EP3A 3BMCA 1Z82A 1IY0A 1T9CA 5IXYA 1YS9A 3KGDA 4FEGA 3SC2A 5JEDA 1DEAA 4C4AA 2A0FA 3DB1A 2QYTA 4H16A 2JCBA 3F1KA 1TEHA 5TQ2B 4CL8A 3IP5A 4QSHA 4YUYA 1F7VA 1Z47A 1KEKA 5L4LA 2J3DA 1PZEA 2BI4A 3EC2A 2M2IA 4JCOA 1PV1A 4UVIA 4L50A 3SDZA 3WYFA 5JH7A 4X7PA 3R5TA 3JX9A 2PANA 3TE6A 4ZALA 4Q9NA 4B7UA 3K6SA 3GVXA 3TD9A 1BWRA 4FJ0A 1EX7A 3PEYA 1HL7A 1UPXA 3WB1A 4FU0A 1GUAA 1KK0A 2M6LA 3OZXA 4BX2A 4B6RA 5JARA 4IICA 2X0EA 1PLLA 4BNDB 4ENPA 3QE0A 4MWDA 1QE0A 3W6OA 2WABA 4I1OA 4TKMA 4XX0A 3EWNA 4MKHA 2FX5A 1H4TA 2PKYX 5GAJA 2PSJA 1FP2A 3DAFA 3W1WA 4CMBA 5KINB 1QLWA 4HRYA 2XB8A 2JBWA 4M1EA 3GLGB 3R9XB 1Z36A 3AVYA 4H31A 1FDVA 2R751 5KWVA 3DVLA 4KWTA 5DSZA 1S1MA 2ZUVA 1C50A 1E9VA 1ZW1A 1V8FA 2IXFA 1XMOB 3HY4A 4UUPA 1WQ4A 3HNOA 1FTSA 4NVRA 5DV9A 4MJLA 1F0NA 1HE8B 4CEJB 1QFJA 3SYRA 3E9EA 2P6NA 3DTVD 4B0PA 4NXNB 3IE0A 5AIBA 4D8TA 1UOPA 4RF5A 2FSGA 3I6IA 1G0OA 1B6TA 1GOTA 1U2RA 3FETA 1KC3A 5LA6B 4WESB 5E1MA 1JBQA 2PNJA 3ZHBA 1EFVA 4LSMA 3ORSA 3QLUC 5CHYA 5T5QA 2XDYA 1Y3HA 3S27A 4P6VF 4NCAA 3PGVA 1L2TA 3EF1A 1G3UA 2H31A 1XF9A 4GNRA 2D5CA 2JH9A 4F4FA 1N1DA 3RRMA 2C9MA 2JAXA 3CW9A 1M67A 2QM8A 2BEUB 3MTQA 1THGA 4HDSB 2JHCA 1R0KA 1SR8A 3AVQA 2HT1A 3B6JA 5CH5A 1SKYE 3OURA 1U8CB 4M0PA 3UPTA 4YRIA 5HILA 3N2KA 1I80A 4JP1A 4IIXA 4JYBA 5I4BA 3C4JA 1QP0A 2KSQA 2ATCA 2ZE7A 3NPMA 2CHVA 5DOVA 1QH8A 1W1IA 2OYRA 1UBHS 1ZL2A 4UDOA 3RADC 1I2DA 2P0YA 2JGDA 3IUEA 4YAFA 4ZYTA 5CLIA 1KZYC 1XDGA 3WO1A 5EKUA 2E18A 4NU6A 4HZUB 3WGTA 4YUWA 3O94A 3HBMA 4NIMA 2Q1SA 3NWJA 3UW1A 4CETA 2HU8A 4OM7A 3ZQKA 2VHVA 3I12A 1M1YE 1L3IA 1ACLA 1BXZA 2NNWB 2P91A 4NU8X 1DINA 5AQEA 4YN3A 3R7FA 2AOUB 3UH1A 2VTKA 5JSQA 1E1NA 1K0UA 2WUGA 3OH8A 3ACDA 1YI1A 4O1HA 3QU2A 4GPAA 4NBUA 3H2SA 4JUFA 4R2JA 1SWVA 1Q1BA 1I6MA 2TS1A 3R77A 1AKYA 1LS6A 1LSJA 1S3FA 3GN2A 3WGNA 1ID8A 1QGAA 3P19A 1N5DA 3ZD8A 4I1RA 1CYDA 5IUNC 5FKJA 5IYZB 1COZA 4B6SA 2XD4A 1ZR2A 1JZTA 2AEFA 4LMPA 4YJHB 4A0RA 3VPXA 5KJ1A 2IBTA 1Y7IA 1XC7A 3IPYA 1M34E 4RH3A 4AJ1A 1TFUA 4WN9A 2WIFA 2X14A 4C2AA 4EHAA 3W3AA 4IJUA 5TF4A 1YB1A 1YS7A 3D2BA 2VA8A 2O1EA 3HBJA 2VNJA 5IJ9B 3O1IC 4O4LB 1H8ED 4CUKA 4P4TA 3O8OA 2RGRA 5CB4B 2HGZA 4ZU3A 3QVSA 4PQYA 4KQGA 3IO3A 1XLVA 2XDQB 3FF1A 2IYNA 5FWXB 1W0KD 3NDIA 1BGXT 3KAPA 4HMQA 3LUDA 3FOWA 3B1KA 2W4MA 4QUBA 3RS7A 1XFDA 1FRFS 1KAGA 5ESXA 2IYOA 4LXGA 2IYYA 4RIFA 4KPEC 3ONEA 4OJTA 3NVDA 1MIOA 1LLUA 4Q4AB 2WU0A 1K98A 3HYRA 1J90A 1V7PC 2B82A 4RD3A 4Z0HO 3A4TA 4I4CA 2YY5A 4TWRA 4C2BA 4N5DA 2QRHA 4TV9F 4ZAWA 3CCFA 3KPYA 2A3NA 3PKJA 1M2KA 4OQFA 2FPKA 3PX7A 3EPHA 3A4MA 3VU1A 2HREA 5AOBA 1CEXA 2ZUWA 4R83A 4F6LA 3RC8A 1C9JA 1QYDA 1F0PA 3UHAA 4TWJA 2ZB2A 5CVTA 2HA0A 2FMTA 3A1VA 2R00C 1EVJA 3I4FA 3DZ2B 4AS2A 4N8SA 3H18A 3F4BA 5DTIA 1P8JA 3FNEA 1IQUA 3KL2A 1ABEA 3ZV7A 4DCJA 2CBGA 2FB9A 2YJ5A 2IYXA 4UFOA 1OW3B 1EX9A 2O3JA 4PX2A 4DADA 2YJ4A 1GPWB 1H65A 4KYTA 3H6HA 2HW8A 1BTOA 1K92A 2YOGA 4R1UA 5ADWA 3KL4A 1PO7A 3OOSA 2QM7A 3WWCA 3E3LA 4DWVA 4OXXA 1DJMA 5CR9A 1F2UA 1BN7A 3OZTA 1U3CA 2EIHA 5EWMB 2D2IA 5EMKA 3FHJA 2Q28A 5HX7A 2HWXA 3WWZA 5DGXA 5CA0A 4QKQA 4KGXA 4Y9RA 5DBFA 1E5XA 2J5KA 1O96A 2FRDA 3PXXA 4RTPA 1FYFA 3SFTA 3TG2A 1S4QA 3TEMA 1CKEA 1NNLA 3SJBA 1JHQA 4AO7A 2JFWA 3C3PA 3EVEA 3QK7A 3DMYA 3OF3A 3CX7A 1GQRA 2O2DA 4QOFA 5T6MA 4G37A 4UUAA 4UZSA 1JDZA 4FGLA 4GR4A 1H2BA 1QC5B 2QD1A 3EFBA 1VL5A 2H5IA 3MWLA 4HS4A 1O97C 4JXJA 4GG1A 5K0BA 4AKIA 2EFCB 4X1OA 4NYMR 3ZDEA 1BYUA 2Y0EA 2NTVA 3IQFA 5TQ0B 2NSLA 2LDBA 4CV3A 3SSOA 4LN1A 5AM2A 1N4AA 1C0EA 1WDTA 1YH3A 2QVZX 5KTRA 4O6VA 3TGPA 3ER9A 3HWRA 2E37A 4MV1A 3FTNA 1CEQA 2ZIZA 3AEZA 5HBRA 1QYRA 3L6EA 5H16A 4JI8B 2X0JA 4R5HA 1L5KA 3FW1A 2HHHB 3H4VA 1XZLA 4O25A 4Y2SA 2BEVA 4HGRA 1U5BA 3UBTA 1ZK3A 1V8DA 4JENA 1U28C 1P5FA 3DBHB 1IRIA 4G5XA 4TYMA 1OCEA 3M1IA 1VKJA 2RGGA 4K03A 2G1AA 4MROA 2X9QA 1F8XA 3F6SA 1OGYA 2L17A 3RREA 1V4VA 3I01A 4JLAA 3N2IA 4P4LA 3THXB 4RAQA 1WE2A 4PM4A 1MABA 2BDEA 3DFUA 4XX1A 2HHAA 2I8CA 1T4BA 4IQ8A 1CV2A 1NOJA 2X2PA 3IHWA 1XZEA 3OJCA 4NONA 4QARA 2PBLA 1PKEA 2IP2A 4X45A 4WA7A 3DFZA 1OH7A 3S7ZA 1EDOA 4RHCA 2WWVD 2GNAA 1E66A 1M75A 5E6UA 4F6RB 4QYWA 5EE0A 2IPLA 3Q9SA 5KQSA 1FXWF 3C3XA 1V37A 2EP8A 2PTHA 3B7WA 4GPIB 4C30A 2WV7A 2B8JA 5TR9A 1ZDMA 1EINA 3DYIA 5FNVB 3FNBA 4H15A 1GRRA 2FH5B 3NOOA 5FOUA 1RXEA 3HGTA 4Q19A 4OLHA 4X6XA 1ZI8A 2H0RA 1M2OA 3E23A 3FDXA 3V4PB 2W58A 1KRXA 5GM1A 2WM8A 3DZGA 4KI7A 2L2QA 3T7TA 1R64A 3JATA 3FTQA 3HRKA 5ERYA 5CFQA 4IIGA 1WRBA 5KWSA 1PFYA 4AC9A 4YMIA 3LX8A 4KHPB 2LD4A 2QL6A 2O2HA 1IK4A 5TC4A 2XKAA 5TXGA 4PNPA 3PF9A 2FKAA 4ZPJA 5CM9C 1QWSA 3GRFA 3O3OB 4FFLA 1OA0A 4GXQA 3P52A 2UDPA 3LI2A 2D74A 2JKVA 1UP4A 4RQBA 4XJTA 2GDJA 4OBEA 4R3NA 4RE5A 2E49A 3AVTA 4PFSA 3QF7A 5A03A 3U0VA 3U1VA 1FP1D 1U0EA 3K30A 3DUFA 5ITSA 2SKDA 4BMCA 2X8JA 3WAJA 1EZ4A 1DEKA 3NFYA 4MUKA 1RVDA 2VJYA 4WCFC 3UOWA 1U0FA 2YC2C 4E5PA 2J3QA 5EMJA 3UC5A 3TW6A 1BE1A 1Y48E 2OBXA 4L8WB 4EJMA 5J3JA 3S8EA 1ZD9A 3HRHA 4RVFA 1OB5A 3TM5A 5HF6A 1G8GA 1T9HA 1OILA 4O5OA 1ZMXA 2G07A 2POQX 2DCMA 4JASB 4F84A 1U9ZA 2GKGA 1PNQA 2PDAA 1KEEA 2NO5A 5JR3A 1G59A 4N0DA 4DV1B 3EARA 3ILHA 4FOLA 2G88A 2VF4X 3RWOA 3U61B 2R5FA 4MZXA 5CFRA 3P0JA 3LL7A 4N8EA 1DJQA 1MO3A 2WDPA 3P2EA 4HG2A 2QLMA 3QVKA 4LVNA 1P8AA 1YTUA 1M0EA 3RAPR 1T2EA 2F8MA 3Q41A 4O4JA 2I7DA 1EK1A 3TQFA 3UHJA 4I81A 1KWGA 2PT7A 3E7XA 2Z3ZA 3TX6A 3VAAA 4YO7A 1YKFA 4OHWA 1ZH8A 4WDRA 2ATIA 1NKVA 3CR3C 4LX0A 1W94A 1GQOA 2GNPA 1NJ5A 2RHBA 4LY9A 3ZGXA 3Q8LA 3WSVA 2PN1A 1CC1S 4HBZA 4IM7A 2HR1A 1PKXA 4R1LA 4HQOA 4D8YA 3HXOA 3CVXA 4CODB 1YZFA 4QODA 4XXHA 5I7VA 2H4JA 1FLAA 1BU5A 2QN6A 4KE9A 3AG6A 1N2JA 3ETDA 2VK1A 4ZEVA 5AW6A 4MV8A 4Q1AA 1US8A 1QVVA 2V65A 3A1WA 4AIIA 4I5DA 4RGBA 3GHHA 4XVQA 4V0NA 3VKVA 1I3NA 2NU8A 4Y0VA 4LXQA 1KO4A 4KVFA 3NIWA 2H4HA 3WLKX 5FBVB 3K0EA 3NVKI 3FPEA 3H5RA 4KO3S 4GSKA 1LZKA 1BQ4A 3WRXA 3VPGA 4ZDIA 2AOXA 5EQDA 1W44A 3I2GA 4M1TA 3J7AC 1I3LA 1USGA 2WJGA 1SBYA 1CR1A 2COUA 1TF2A 2C95A 3FNGA 3PJDA 3R4VA 1WM1A 2FLVA 2PUJA 3PHJA 4DIKA 1OXSC 4PYIA 4Q82A 4RZHA 1P73A 3G5TA 4M3NA 2I54A 5CTAA 1AGXA 1HDRA 1Y5NA 4G1VA 1SUCA 2QJFA 1GGJA 1KBZA 2E2WA 2V45A 4ND2A 4OO3A 4HQNA 5GV7A 1EBUA 4BL5A 1SQSA 3PICA 4I2NA 4REQA 1TK9A 2VJKA 1KIMA 2ORIA 3NNDA 3I2HA 4NK5A 4QOJA 2PXHA 4I50F 3FPFA 4U7JA 4H7FA 4PC3A 4KIGA 5JXIA 4EHFA 2BR4A 3KE8A 4J2TA 3GPCA 2OCLA 1CNMA 2AQKA 3R0JA 3ZN2A 1RJFA 3OM0A 1WR8A 4YXFA 5FA5A 2BGLA 5DNCA 3CZRA 1BHQ1 2QUKA 2YHIA 4BQPA 1Y4DE 4DKXA 3ZKAA 4A8JA 4DDMA 4IUBS 3WLJA 3TK1A 1IXKA 3B1XA 4CF6A 1SXJB 2I99A 3COSA 1E8DA 3BMOB 3WL5A 1KY3A 1KMNA 1N3IA 1M2JA 2X0RA 3H7AA 3UBMA 2JEZA 2W71A 1LWOA 5JQWA 3A70A 3OY7A 4DR3B 1AZTA 3BERA 4X7RA 1T5LA 4LXXA 3T5MA 3NASA 5J4HA 4BGUA 2CKMA 1PK9A 3AR8A 1NFRA 2GBGA 2ZAOA 2GJSA 4Q4DA 1RJWA 2YHUA 3SHQA 4LOIA 2QI9F 2AB0A 4A92A 4OSPA 4EHDA 4WWHA 1AXRA 1F17A 2YNMD 1ILWA 2XB2A 1MD9A 1EP2B 1SVNA 4IZ6A 4L8YA 3WKEA 4F2GA 4ZCMA 1OFTA 1QIJA 5IDWA 3QOWA 4JVNA 3QEAZ 3AI1A 5F1YA 3V8PA 3AERB 1RM4A 1KO5A 2A94A 1ODJA 2D4AA 4I8XA 1X7YB 2OV6A 3ZOKA 1IWBB 1Y6RA 4MRRA 1E58A 1ZRMA 5FLKA 1IHXA 1TAUA 2AR7A 4LQDA 3TLCA 1T0BA 2EHDA 3D3NA 4QWWA 2Q6OA 4KQCA 1JQ5A 4HN9A 3NHSA 4JKYA 4C2TA 2C8JA 5JCOC 1G21B 5JAHA 1BWQA 3ADKA 1ZBDA 2ERCA 4J2OA 2WT9A 4TQGA 2Q3MA 1L6IA 2YWRA 2JGKA 4P35A 1JVNA 1G6KA 1NLMA 2VWHA 3DKIA 4PO1A 3W0LB 1I9CA 4M9XA 3TSZA 3WGYA 2P68A 4MVWA 4XWTA 3EWAA 2HPHA 2R7LA 3PV0A 3MD0A 5I9IA 4S1TA 1NPDA 1RQPA 2O2CA 3ESRA 4P9NA 4KV7A 2A0YA 2ENUA 4PINA 1ULSA 2I6QA 2YTZA 1TLLA 2RAUA 3DTNA 2I80A 2AD1A 4HI0E 1D1SA 2E5FA 3EXFA 3KLPX 5FYDA 4JLPA 2FHSA 4JLVA 5JD6A 4W1PA 4JI4B 4Y67A 3VKHA 1KY4A 3KZMA 1DIHA 3CF4G 3LT4A 4DV4B 4UXJA 4JNKA 3CVOA 4MLCA 5E2BA 3WISA 4QQFA 1U80A 4W6ZA 3X1WA 4ES6A 3HFSA 5K8TA 3DG9A 1RC0A 3AB3A 2FN4A 3GLIB 4PCUA 2X8BA 3CVJA 4TTSA 3GLFB 1KZ1A 2YFQA 3R7WB 5UKDA 4YDQA 4GS5A 1BAPA 4INZA 4IDPA 4RPLA 2BYTA 4XVRA 1OWNA 3PYXA 1CE8B 1JQEA 1FNDA 3AFMA 4L5IA 4L8LA 4WEQA 2H7CA 1BW9B 3G9XA 5IS2A 2VHCA 3BK7A 2QRLA 1SK8A 3AESB 4ONEA 3HDJA 2BIFA 2C7RA 2DUMA 4LV5B 1NYRA 2R6R1 5EG5A 1N2XA 2JIOA 3FCEA 1LI4A 1EFRD 1G17A 2DTXA 2I2AA 1M76A 2PMCA 4KHZA 2H17A 3PI7A 1E60A 5D84A 4ZANA 4EI2A 2J9FB 1T36A 4QYTA 4BZWA 5HJ5A 3HA2A 3R20A 4KE7A 3SLKA 1XRNA 4FNMA 4LWPA 5BT8A 3HBLA 1EXWA 3OT4A 3U4QA 1GGKA 4I4TA 1N2GA 1U7OA 3EMVA 3TZLA 1TD9A 1SC9A 4B81A 4HX9A 1RABA 1HYGA 3ESCA 5CDTA 2C0PA 1CIVA 3C8UA 1KDVA 5C46F 4LNAA 1SIWA 3R0IA 3B2NA 1HLPA 4MS4B 4Q21A 2IP4A 4G5QA 3T06B 2VQ3A 2F1HA 3L40A 3NUQA 5C37A 4HQRA 2J0SA 1QOQB 1USUA 4CIAA 4L7VA 3N0VA 2QRKA 2VT6A 4G01B 1EFUA 2J3JA 3PFIA 4MUGA 5C4GB 3I9JA 1FBTA 4O08A 2VHZA 3W6NA 1DHRA 2CNNA 1Y34E 2FZVA 3BAFA 1TUIA 5J5VA 2QXYA 4FFDA 2YWBA 3QJGA 4BMZA 2BZSA 1EB9A 2JFBA 2PZJA 4YBZA 4EATA 3GRYA 1WMAA 2HL6A 2E89A 3NLLA 121PA 4YRFA 5DYYA 5FNZA 3TNJA 4DPKA 4MJ7A 3UKDA 2VUIB 3V8VA 1FYXA 1RKVA 1BE6A 1DIRA 4ZVSA 5DT2A 3W5JA 1NF3A 4DHWA 4Q4JA 4Y1RB 3GL9A 1M7GA 3QIAA 3I34X 2JCVA 2XTNA 1YUMA 2AOVA 1ZIXA 2HJ9A 3SICE 4ZZ1A 5I8WA 2QPAA 1ZOOA 2ZSAA 3HVUA 3K16A 2O3TA 3ZEIA 5MF6A 1QFZA 2HZBA 2HMTA 3BCUA 4YR7A 4YGXB 2DECA 2YWJA 4LOAA 2AC4A 4X9XA 5HQJA 3E9YA 4KTVE 1GR1A 3FCOA 3PNQA 4Z8YA 2JLBA 3C87A 3CG4A 3MLBA 4RK7A 1K8XB 4RMIA 5B1HA 4Z49A 5JHHB 2GARA 5AVWA 2JLYA 4F9GA 4QFMA 1GPNA 3MMPA 2RBGA 4R1QA 5EJFA 1U7HA 5C7OO 2AE1A 1OX5A 2OCPA 1L9XA 3NBKA 4MULA 3TNYA 1T1JA 3W8RA 3WWYA 4YRBA 1D2CA 1E0JA 2BI8A 3LO5A 3Q6NA 3E3MA 5KOHA 3WIVA 3KTFA 2QRJA 1BZYA 2QZJA 3SBDA 1ITZA 5K03A 1FVHA 2ATVA 4NENB 4QOIA 2IYZA 1ND5A 1OLXA 5ICFA 5AKZA 4Q9LA 3WL4A 3MRSA 4KPGA 2ETXA 4D4LA 4PSUA 4E2FA 1J9ZA 1HDZA 4GPZA 3R3VA 2Q45A 2QN3A 1D4AA 4JLNA 1V16A 1FEZA 2PLRA 3MN1A 5AH0A 2C2KA 2ZATA 3EJ6A 2B4RO 2Z2IA 4C4RA 4CQMD 3B85A 2RGBA 4LMBA 3T99A 4X91A 1Y7HA 3BCSA 5JH7F 3C7TA 2IX3A 4P0TA 3LK6A 1NR5A 4M1MA 3IP8A 1SXPA 3OFJA 3OLZA 4KDFA 1E1RA 2NACA 4FR2A 4CKZA 1IY9A 5BR8B 2EF0A 2YINC 1E3TA 3V7WA 3K2QA 4YUXA 3UV6A 2EV9A 4FR0A 3NTLA 1A9YA 3TRHA 4CUJA 1XZPA 4R1PA 4HTAA 3X2SA 1NG9A 1T6BY 3A3YA 3TUTA 1EHIA 2NADA 2O3RA 1EBFA 2XECA 2XRFA 4PZPA 2OKCA 5KC8A 2CUKA 1WVGA 4WJKB 2F1KA 4MNTA 3VDNB 3C39A 3LZCA 1GCAA 2GWHA 4XEUA 1OX4B 4ECEA 5FWAA 2RB4A 5HRCA 4FW8A 2QI9C 1J24A 4PSVA 4C0QC 1UFOA 4KQIA 2YHBA 3AM5A 4IWYA 3NHRA 3X1ZA 2EOAA 4TXMA 5C5DA 2E7ZA 3ZCRA 5DRTA 1EDDA 2P0EA 4G1BA 4F92B 5FORA 2QG9A 3VYTB 2JBAA 2R1VA 2F64A 3LBYA 3ZWCA 4PSKA 2VK2A 1UJ6A 4M98A 8OHMA 2VNKA 3TJMA 5HCIA 3U17A 3GCWA 4DEVA 3FPHA 1HZZA 1N5JA 2BKXA 3UF0A 3PCRB 4HLQB 4EGAA 3H2IA 2ZUBA 2HBRA 1XNGA 3UJ8A 4L22A 2JLCA 3AJ8A 4BV9A 2FLKA 4RDCA 1PZXA 2C84A 2WLTA 1PEYA 2AR0A 4UM9D 4CCYA 3OG9A 3FIUA 3TLGA 4X93A 3GWZA 3IOBA 1T0UA 4TQAA 5DM1A 3RG8A 1P7WA 3D8SA 3PRJA 3G6WA 4RTRA 2NUTA 1JDUA 4DA6A 4EX7A 1ML4A 1HFWA 2GN4A 3GFTA 2JB9A 1OVGA 3BCRA 3DEZA 4N6OA 3SKVA 5EIXA 1BMTA 1PZNA 5DULA 3RS5A 1VLJA 1LTKA 2QMYA 2J45A 4IUDS 4EZIA 1SKQA 2TRSB 4DG8A 4D4MA 2C77A 2C3OA 3LHSA 3OBBA 4QASA 1VHWA 3N2ZB 3OHSX 3JQBA 1FJ2A 2P75A 2OO7A 3SEAA 3KVVA 2O4UX 2Z5FA 3IVXA 3WL3A 5LQDA 4CQNA 4FQ8A 4HO1X 1MA0A 3C6ZA 4N7RA 1QVWA 1K7CA 4GKJB 3FA2A 1L5HA 1S7CA 4EGJA 3UKJA 3TOVA 4Y9DA 4DLSA 1RRVA 4E4YA 4MYDA 2DHEA 3KKZA 4URZR 1XAHA 3TNFA 5B6PA 2W6MA 4NFLA 1DDOA 4I14A 1JALA 1A9XA 1H6DA 4ZREA 1DCTA 2ONZA 1ZUIA 1Z4OA 3K0BA 1ECPA 3QIVA 4ZCSA 5AUPB 1FK8A 2ZB4A 2BDUA 2FSUA 1J22A 1H1DA 2OD7A 5AVVA 5KPJA 3KYCA 3IWCB 5F23A 1QP7A 3FZNA 4DZTA 3A4NA 3F1LA 5M34A 2AFIB 3ZXYA 1G18A 2VNAA 3IT1A 4TZ0A 2VZLA 3J81A 1H22A 2EW1A 3JD2A 3UEOA 3D0KA 4GKVA 1SAYA 1NUTA 4IFIA 4A0FA 5HP4A 3EMDA 2P9BA 1XN1A 3QVJA 2WTNA 1AS2A 1N9KA 4JUBA 1HORA 4W1QA 3RG2A 2IQIA 2L18A 3Q72A 2EBFX 2HK6A 2Q07A 3HL0A 1V3TA 4LIPD 3JALB 1C30B 5AK4A 4GPTA 3HZRA 4M22A 2PRIA 4XI9A 2XUPA 3LW7A 4PZCA 1NSYA 4ICIA 4UVHA 4F8EA 2H0QA 3TI9A 1RKQA 5IU6A 2J6BA 3Q3IA 4DR7B 2AZTA 5F5XA 1OHHA 1IHUA 2PT6A 2IYAA 1CJKC 2LGJA 4DNPA 5DP1A 5F7XA 1TTPB 3GIDA 4ZCIA 4NXMB 1KRHA 4LRQA 5T64A 4ENUA 4W8OA 4DLRA 3OQIB 4ZVVA 1L8OA 3ZD6A 3V2UA 5IDVA 3WKAA 3JD4A 5IT9A 5C5EA 3U1TA 1G6HA 1GXSB 2G5CA 4YHHB 1FSGA 4AUMA 1SY7A 1YZLA 1U8UA 2NXJA 3GGJA 4D7AA 4ARZB 1TCUA 5A1TA 2XCRB 1NNEA 1YBMA 3M70A 1DQRA 1Z0DA 2A30A 4H0FA 1Z22A 4K9DA 1DBQA 4LJ5A 1ZG3A 2APJA 1I8TA 1X13A 3UAWA 2LUOA 3QEOA 3FMOB 5GVSA 2H54A 5HJ7A 1WV0A 2J7PA 1N33B 2J5XA 5GOZA 1LY1A 2YY7A 4WZ6A 4UOZA 1BHO1 1ZO8A 3FNQA 2QJOA 4F2PA 3IJRA 3I4LA 1U7ZA 1Z45A 1P0FA 4KFSA 2CL7X 1QCYA 3GJXC 2NZWA 5TY0A 2R6DA 4WK2B 4H1UA 4JVMA 4IJWA 4UC0A 4BEJA 2O14A 2VSFA 2VPIA 4TLBA 5CA0F 2G4VA 2C4TA 4YYEA 2V7VA 3IT2A 1HRKA 2VSNA 5KOJB 3B7GA 4CR7A 3A10A 4DR5B 4N41A 2FEOA 1HT3A 1N2CB 3BGSA 2BMVA 2IT1A 2CXRA 1PD1A 1RWVA 2WIBA 2C5AA 4IDOA 2ZGVA 2RGAA 3QVGB 2QX9A 4P4GA 3NB0A 2HLPA 2CJYA 2OBYA 2ZWMA 2EZTA 2P2NA 4FZ5A 2A9PA 2OBFA 3CF2A 2C7QA 1JFSA 5TJ9A 3E81A 2ZRHA 2GXQA 3HLKA 3LVBA 3LTEA 4MDFA 1SEPA 4IGFA 4EY7A 1HDOA 3SM9A 5JAPA 4TYQA 3DWEX 3M3DA 4JI7B 1II8A 1WX1A 3NEJA 3KKKA 2QHXA 1AKNA 2O1XA 2ECFA 2VC2B 2XWBF 3QX7A 4ZVLA 1MIHA 1I13A 2FPUA 4IJVA 2I2BA 1PL7A 2NAPA 2IOHA 2UVPA 4B3DA 3EPRA 1C9KA 2RH8A 3N2NA 4DUZB 1YF3A 3RU9A 1DQSA 1X2BA 5HM6A 1S96A 3PNPA 4GDMA 4XB6B 1NQXA 4LBZA 4JITA 3IILA 3B5JA 1LCIA 3GFPA 3T9CA 4DV6B 3S28A 1JMYA 1LVUA 3GMIA 3R0VA 1BFUA 4Y2TA 2ZYSA 5ECWA 1TZCA 1FDRA 4BP1A 5KMGB 3BXPA 4BMDA 2PLAA 2GA9A 2WVHA 4J0IA 3W2HA 4JLSA 5M5BA 2JAOA 4YALA 4EHBA 4DPMA 5BMOA 1JEQA 5TGTA 4YVFA 2NVWA 4BBPA 4CMAA 1A69A 1GZ5A 2RGDA 2VHEA 5DN6A 3TLEA 1JHOA 4UUQA 3M1AA 3RBAA 3LBHA 2GVZC 5FFFA 5JJIA 1GT91 1G8KA 3NHPA 5HYVA 4L4RA 3MF4A 4NWIA 4UBMA 1MMFB 5BUSA 3A6EA 1P33A 3OZBA 3T1NA 1MV5A 3DM9B 1KEPA 4B4VA 4BB9A 2ZRNA 3PDIA 3DEYX 2ZJFA 3RYIB 2PX6A 4U2BA 1W36B 1H2XA 2I65A 2CXTA 3WNVA 3DNMA 3RHTA 4Q02A 3RRYA 4D4HA 1FXSA 4GAEA 2B1JA 1N6RA 1MP0A 1WZUA 2B4QA 3IP9A 3R23A 1KJNA 4R9UC 1FNBA 1VMAA 2ZTVA 1ZH4A 4RA9B 3QW2A 4ZYXA 5BV1A 3SC6A 1HE2A 2PGLA 4JVOA 5DGDA 3WZ2A 2AEJA 3TZBA 2Q7XA 2QRPA 3ZUGA 4C22A 1I6KA 5HFNA 4KXUA 2R7KA 2WU8A 1EVEA 1I4EB 3PUWA 3HABA 2YIMA 1DV1A 2AMVA 3C74A 5ALDA 5B55A 4CLQA 2CNKA 3D2CA 4OG2A 2G25A 2IF2A 4YR9A 3DEAA 2YMPA 2CVQA 1LRJA 4UBOA 4FBMA 5A04A 5EPEA 3WGVA 4N3AA 2CKDA 2GK4A 4KE8A 4DKJA 4RV5A 2HB6A 1BDHA 1EUDA 2W48A 1JG7A 5AXAA 3QF4A 4M0MA 4E31A 2AW5A 2O5CA 1XCPA 1O6BA 2GD2A 2FCAA 2FSSA 2R68A 5EERA 2WBLC 3JQGB 4S1VA 5CLGA 5LCXA 1HEYA 4XPIA 5DCUA 1THZA 3WLIA 5IJAA 3O8QB 5C35A 4WZAB 4C05A 3VDXA 3PFWO 1F8GA 2IHBA 2VUUA 5G4KB 1NMXA 4TL8A 2FZEA 4WVFA 1YNSA 3EOBI 4UFNA 4XYMA 4X7BA 4BC1A 4DCOA 5JBQA 4GVXA 3TQQA 2IU0A 3GJ6A 3UAVA 5F52A 4IL5A 5CFMA 3AYZB 2W6CX 3HV2A 3KZVA 4EQ6B 4HNGA 3D8TA 3U2QA 4YGYA 1SOUA 3EHEA 5G1PA 3ZLBA 1P5RA 2P2LA 2PXCA 3DEFA 1QQ6A 3D8HA 3M0EA 4JB3A 3I9MA 1QGUB 4BO1A 4ZODA 2K5UA 2VHTA 3DYBA 3GUVA 4B32A 3ZW8A 4W6QA 1AQ6A 2QMEA 4DC1A 3BB3A 4ZHQB 2OV3A 4FMCB 5KKCA 4FILA 4ZYZA 4JLJA 4HJRA 5E9JA 1OT3A 1T5OA 3ZY2A 1NASA 1TVKB 4GL2A 4IIEA 1D9XA 3ORYA 3F73A 3R9IA 2Q2VA 1M5TA 1ESEA 1CQJB 4WKBA 4GI3A 1UADA 2YWCA 1NW8A 2CMKA 2NZJA 2Y1EA 2YASA 5FI3A 1AN9A 5B4TA 5BVGB 1SZDA 1TX4B 2FZLA 4XIYA 2YWFA 1W87A 1BFDA 4FFBB 4J9UE 4PPGA 1DQYA 3MTDA 2FFBA 4AKSA 2KWIA 1QRAA 1YE3A 4QC2A 3NDRA 1KDZA 2GPNA 2Q8PA 3CUWA 3RYCB 2EX0A 6REQB 4LOKA 3CWCA 4Z86A 1W73A 4BB0A 1NV8A 3ADOA 3NGLA 4E2YA 4RTOA 3L0CA 1O08A 2IHTA 4AWAA 5BWMA 5F3WB 1EZ1A 2WHQA 4JBGA 1H9AA 5TDHA 4DBZA 4FFOA 3H5VA 3LL4A 1XU7A 1NATA 3II6X 2F48A 2Q5FA 2WMOB 4K0KB 3UWMA 3WX0A 3IQZA 1P62B 2BP7B 1RKXA 3S70A 4ADSG 5DTRA 1TM2A 1BROA 1P5JA 3C97A 4TMKA 3EXHB 2FFAA 4HXYA 5DVZA 2CJWA 1YR1A 1E59A 2FRDC 4QDOA 5JT1A 3PRYA 4QD3A 5LP1A 1M8KA 2P4UA 3K53A 4N39A 3UHOA 4EW3A 2CLOB 3O74A 2YL2A 4JR2A 4P2BA 1QGYA 1HG0A 1G63A 3MWGA 4PQFA 1P1KA 3FOBA 3K8ZA 3VR2A 5JZSA 1RM5A 4XARA 3ZGLA 3ZQ4A 1L3CA 4DB2A 3LPNA 1GNQA 4GLFA 1GAJA 4EYQA 3RT1A 4Y6RA 5NULA 1KI7A 3PWTA 1C3JA 5GGYA 5B1EA 2IZZA 5EYPA 2C7GA 3UJ7A 1K75A 3A05A 1PWHA 5BV2P 3E7PA 1RAFA 4W9MC 4QIHA 5EXEA 5CD1A 4W5TA 1QQ7A 1I3CA 3K0CA 2C9CA 4ETWA 3HKCB 1GYRA 3RR2A 3KKQA 1EFTA 1GAWA 1GTG1 3I58A 1V7CA 2YZGA 3IUYA 5AJYA 1EFAA 2YBEA 1ZK0A 2J48A 1PEAA 1PJZA 4N03A 4XYGA 3SU8A 3DC7A 2WIKA 4QOGA 5IEBA 1Q77A 5JCJA 5L3ZA 3H8SA 2ZTUA 5KSPA 2PKRA 3D1VA 1G5FA 1J56A 1QBKC 1TA0A 4IO1A 4Q9IA 3QFCA 4TZKA 2AK3A 2TMYA 3E4DA 3W4KA 2Y68A 3PC7A 5K01A 4QLBA 1FF9A 4D0SA 2ZANA 5AXBA 2QVBA 2HWWA 1J1UA 3RYHA 3H2BA 4M38A 2BLNA 4R1SA 4OF4A 4P3YA 2Q2NA 4Y1GA 1M83A 3CTMA 2PR7A 5EINA 4OU4A 4MGYR 4AKHA 2H1OA 2DBQA 5WRFA 4GC5A 1XCJA 2V9CA 4LSZA 1I1HA 4HGYA 4ZU1X 1JDPA 4PYJA 4RLQA 3T3MB 4A4DA 3HB7A 4DSZA 2WJIA 1ELOA 2Q3EA 1Z6GA 1VI2A 2PZGA 3ECSA 3KU1A 2BTQB 3IMEA 3WK9A 3VUFA 2IZOA 2OZLA 2EQAA 3BHNA 4RHYA 1W8IA 3LUKA 2ZTLA 3M49A 4ND8A 4NABA 4QHTA 1WXHA 3QENA 1Y5LA 3C5CA 3ANTA 1XEFA 2WSSD 4ZCPA 4FGJA 5I4KA 4J03A 3V8RA 4CEIA 3WBFA 2DULA 2O8DB 5AVXA 1KVTA 1FW8A 5GZ1A 2O7QA 4R01A 4BLUA 2H4FA 4DYHA 1V43A 3B12A 5KQPA 1E32A 2XCOA 4K9PA 3FSGD 4A15A 3IEVA 3DR3A 4O02B 3A1FA 1GL9B 2AJBA 3T52A 4IFEA 3O4JA 3FUXA 3FCSB 4FVTA 1ZCAA 1HKUA 3ZY4A 1D8TA 4TXJA 1RXYA 2BF7A 4GRAA 4IQGA 2QW0X 1NKTA 1E3WA 4AJEA 4CFYA 1AZLA 3NJ8A 4YACA 2ZJOA 4EA7A 2CMDA 3RRFA 2D4HA 2CF5A 4LRXA 4LZZA 4XYBA 5DWQA 3GIWA 4DMLA 5M2QA 5HQ3A 3FBGA 3CX4A 1A5AB 3OTOB 1CZNA 4XYLA 1I7PA 1JWLA 1ZMTA 3LWZA 4UEOA 3WK5A 2ZG6A 3VR6A 2ZZMA 1JYFA 4AG5A 4I3GA 1B14A 2JD1A 5HIAA 1DI0A 2VNSA 4MITA 2QMOA</