3OQJA

Crystal structure of b. licheniformis cdps yvmc-blic in complex with capso
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
222
structure length
213
Chain Sequence
FKTETLTQNCNEILKRRRHVLVGISPFNSRFSEDYIHRLIAWAVREFQSVSVLLAGKEAANLLEALGTPHGKAERKVRKEVSRNRRFAEKALEAHGGNPEDIHTFSDFANQTAYRNLRMEVEAAFFDQTHFRNACLEMSHAAILGVEVSADMLELAVEYVIAELPFFIAAPDILGVEETLLAYHRPWKLGEQISRNEFAVKMRPNQGYLMVSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for nonribosomal peptide synthesis by an aminoacyl-tRNA synthetase paralog.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Ligase
molecule keywords Putative uncharacterized protein yvmC
total genus 86
structure length 213
sequence length 222
chains with identical sequence B
ec nomenclature ec 2.3.2.22: Cyclo(L-leucyl-L-leucyl) synthase.
pdb deposition date 2010-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16715 CDPS Cyclodipeptide synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3oqjA00
4Q24A 3OQHA 3OQIB 2X9QA 3S7TA 3OQVA 3OQIA 3OQJA
chains in the Genus database with same CATH superfamily
4N6NA 1OLSB 1H9CA 2R60A 2I33A 2BN4A 3JY6A 5DWQA 1TYDE 1NBEA 4JLAA 2NZWA 3SEZA 3K0BA 4JU9A 3OOSA 2X0DA 2H7VA 2I7DA 4IEIA 3AR3A 1XQ6A 2YHBA 4PS1A 3ER6A 3F97A 2CVHA 4G25A 4E5UA 5HM8A 1VXRA 2I76A 1XNGA 3KXDA 2I3AA 4P4SA 1E9RA 2FW6A 1OBHA 5CB4A 2VSXA 3HPQA 3SI7A 5FO0A 2IY8A 2QJTA 2VK2A 3NVAA 4E2YA 4KG7A 4WFJA 4JYAB 5DSXA 3DE5X 2VQDA 3C48A 5JRDS 4FYWA 3TKAA 1XK7A 1OAAA 2FXIA 1GNVA 1Q7BA 1RE0A 3O5AA 3CWZA 1YRAA 3JQDA 3DFIA 1FRVA 1Z0UA 2FW8A 4PAOA 2G1AA 2GMWA 2BTOA 2QLBA 1SR8A 3S99A 4ZV4A 1VPTA 5I7VA 2DQ4A 3BAFA 1LQUA 2C7OA 1DV1A 1YRLA 2VP6A 4CCYA 4E2ZA 1UBUS 1LLUA 4OV6B 1PL8A 3R3UA 2X42A 1COWA 1GPBA 2AKYA 3CF4G 4MA0A 1UBKS 2H4WA 4JASB 1PYDA 3IAXA 4JJZA 4LMAA 4Y2YA 4YRDA 4H77A 3WFZA 1FYXA 2WQ6A 1FOEB 2IBSA 1ZJ5A 1A7AA 2A0WA 2E0IA 2H59A 1CEQA 2BDUA 3BEDA 4BQRA 5DW3A 1ZNZA 4CTJA 2FX2A 4N40A 4E5VA 2XMBA 3BHMA 1B6SA 5L3VA 3PFWO 3EGDA 3KEFA 4XUCA 5IK2D 2WJ6A 3C1TA 1AKTA 3Q7SA 4OSOA 4QGBA 5F2KA 4B9AA 1CUJA 1UBGA 4HC4A 1FFBA 3KE8A 1XWIA 4WUTA 4HH0A 2WDPA 3TIVA 1U0HC 1G5PA 1EUDB 2VOJA 1D2HA 4IO1A 1T8YA 4G5XA 5L7YA 3GELA 3NASA 5ECWA 5AYVA 5JSHA 3OZSA 4NYMQ 5CUQA 1IPEA 1QAMA 3L77A 1W1IA 2MSDB 2J5KA 3PXGA 1US8B 2EBWA 1M83A 4B4OA 3FPCA 1Z0FA 4PNPA 3O3NB 3DV9A 3QU9A 1CUIA 2G5TA 1NP3A 3MXOA 2CLOB 3E5MA 4MQEB 4YJGB 3ND8A 2ZPTX 1O87A 1ZH4A 2WLSA 1GPJA 4I55F 5FA8A 3S8EA 3ORQA 3UUWA 5HRUA 3MUEA 2CLCX 2ICAA 2GXQA 3O9VA 2C0CA 2FZ5A 4NMLA 3T4PA 3IDOA 4IX1A 4NZPA 3GT3A 3O92A 4YR9A 2IYEA 1M8FA 4NMXB 3FFTA 4IOJA 3L4EA 2WU3A 1JPNA 1Y3CE 4FYHA 4PYOA 4JDUA 3K8OE 1WMEA 4ND4A 4R8MA 4XLTA 2Z6UA 2QMQA 3HV2A 2HXSA 5CX1B 1DT5A 2NPOA 1M7BA 4LOJA 4RSGA 1E0KA 3ZWYA 1UIRA 4FQ5A 3C97A 3L46A 3GBPA 1XD8A 4MLCA 4B3CA 3DOIA 1USKA 4PSDA 2Q9UA 1NJ8A 1VLMA 1WUJS 3PCRB 4M89A 1Q0TA 2HJ9A 1H9AA 1JALA 5D84A 4E09A 2E4XA 3EK2A 3MK31 1HTBA 3D0OA 4CNBA 3OZ7A 2QN7A 5F76A 2HMAA 3SX2A 1ACMA 3F47A 4CG3A 1R37A 2J0UA 5K6AC 1KAQA 4YUZA 1QO7A 2YOHA 1T36B 1G5RA 1DO2A 2FG6C 2DPGA 3EXG2 1QXSA 3BA6A 3H2BA 3LL7A 2IUUA 3VR4D 4B6PA 3QV1A 1LK5A 2A92A 5KYYA 1GTG1 3H86A 5D3MA 4DA9A 3UT0A 3VR3D 3VNQA 1HQKA 1BHSA 1TPZA 1CDOA 4JC5A 1XMQB 3DFKA 2VPWA 5FNZA 4ZHQF 3BYZA 3R3SA 3QITA 3FFAA 2I1WA 2YN0A 1VZ2A 3W05A 2OD7A 5KAPA 5CDHA 2ZWAA 2VSNA 4Z4EA 2C4HA 1P61B 3NYIA 3WLTA 1TD1A 5GINE 4I3GA 4LJLA 2I9KA 1XXLA 2QU8A 2J0UB 4L9SA 2CY0A 3IOCA 1TTQB 2B9EA 4GSLA 2BJVA 4AF7A 1D1TA 5T4HA 4BKPA 3A2KA 4HKTA 5JBNA 2BHLA 3O3MB 1J0AA 2I8AA 2LWIA 2NZ8A 1JZTA 2HMSA 4KWEA 4B3BA 4IDOA 3TUJC 1EZ4A 3T5BA 1EFCA 3OX4A 1CQIB 4LZPA 3MMZA 4WKPA 2QY6A 2PR2A 5EJEA 5DM2A 4F93B 2RH4A 3QLVC 3H5LA 4ZN6A 1AGPA 4B8YA 1AV6A 1JPJA 4BATA 4BRSA 2G77B 5A3QA 2XUPA 5INTA 4H0FA 2G4CA 3F7NA 2OXTA 4PPGA 3CLTD 4E4YA 1C29B 1PGQA 3CPJB 4X1OA 2R6R1 4RD1A 2O7RA 3V42A 1GZ6A 1HDYA 5ICGA 1TKCA 1LPSA 1JDZA 4JOSA 2PZ8A 4GVPA 2HHLA 1F0YA 4RTKA 2PH3A 1V5GA 3V1UA 1RP7A 1Z13A 3MWEA 1XCOA 4FDMA 1CHNA 1IBRA 1LSJA 3C3XA 3AEUB 3KR9A 2VSFA 4HOYA 3H75A 1MLDA 3QU4A 4Q9AA 2QQEA 5CNIA 3G0BA 4RA6A 2D6FA 3DV2A 2FN8A 3KVNA 2W2LA 3D1JA 3PQEA 3BGVA 4FE3A 4GNRA 3RCBA 1QE5A 1V5FA 3MQ2A 3UZUA 2ORYA 5KQPA 2NUBA 3IFSA 1EUCA 4L9RA 1LFDB 4LOIA 4BJ6A 1QYRA 4R1TA 3RWBA 2FE1A 4BJHB 1XGKA 2VT7A 1DCMA 5HF9A 3HM9A 5DM1A 3DZIA 4D8VA 3OTHA 1SPXA 3OZBA 2PX0A 1UJMA 4KVFA 3VVCA 3OZXA 3GLGB 4WRRA 2HGSA 3OKFA 3QUTA 1D1SA 5GGXA 1R6AA 4MV3A 2VATA 4P84A 5DX1A 1U7OA 3GFRA 3O4JA 4RVCA 5C8YB 2M6SA 3CMCO 2FJ0A 1IM2A 3LHIA 2IYFA 3HRHA 4WPGA 2ZSKA 4ZPJA 1GT91 3W90A 1N33B 1PT6A 1Q7GA 1LZLA 4QG7A 2Q4TA 2JF0A 2RGBA 3U49A 4CQMD 3MAJA 1E1YA 3VYUB 4BQPA 2JGDB 4Y6GB 1NDHA 1TGVA 2O2JA 5ERGB 4DA7A 2XYPA 4O4LB 1IIRA 4JFAA 1E79A 1FRZA 4N7MA 3KKQA 4OHOA 4H1HA 4Q3BA 1Z2NX 5T4BA 3T12A 4WESB 4Z8XA 4HTFB 4IDCA 4E31A 4J76A 1K7FB 2PG3A 2O3SA 3GLGA 1HDIA 3M1LA 3NBUA 5EGSA 1Z82A 5AVJA 5FULA 2PGIA 4BNUA 1N92A 1GIAA 2HJGA 3QHPA 3W5IA 4LN1A 4D98A 1PFWA 3JASA 1H65A 4FX2A 4MKGA 4BGVA 2BDEA 3I5XA 1WDMA 3GH3A 4JJ6A 3E3NA 1WHTB 1KI4A 1RD4A 3IX7A 2QAGB 1K3FA 1R9GA 4HYYA 1MQAA 1VKRA 3EPPA 5CVVA 2R8ZA 4F5DA 3A6DA 4NICA 1HGXA 1Z6GA 2FZVA 4TN1A 2Y0PA 3W5AA 1P8JA 3BB1A 1RI3A 4AZ3B 3EGEA 1QHSA 4V2IA 5A9SA 4RXTA 3W8EA 4KQ1A 3NBKA 1ODSA 4NONA 1NW5A 2Q7DA 4ZFNA 4MDFA 4LJ5A 4XDGA 3OMLA 2B3TA 3MINA 1QQ5A 1JEYA 3GFVA 1V2HE 5IDVA 6REQB 2VNIA 3UGQA 2GZ3A 1HM5A 2QUIA 2XY4A 4I50A 3OJFA 4FR0A 4ISBA 4JJKA 3OMXA 4UU7A 4BX3A 3NAQA 2HNAA 3RSGA 4B7UA 3W8DA 2RDMA 4GX2A 2A30A 2VF5X 4OLJA 2J09A 3ZBTA 2ZBPA 4S04A 2QZZA 4FDVA 1BEEA 4PZLA 4GU5A 3AR7A 3WX0A 3GLTA 1GSAA 5ALNA 2X6TA 4L4XA 3VBCA 4OAQA 3A31A 2LP4Y 5HA5A 2O9JA 3CE6A 1KP3A 3T4UA 2DLDA 4HNHA 1XKQA 2HAEA 2W2KA 5B2FA 1TQDA 3MTAA 3MZ0A 1MZVA 4OHBA 3GRKA 3AXTA 1RRCA 3F6CA 1EVYA 5LQDA 1BXGA 1WP4A 4WBSA 1H6BA 3AHJA 3KOOA 3USES 3ZXXA 1YR7A 2UXBB 4JUIA 4KP7A 4FYYA 4AY4A 2QX9A 2NZYA 1AHIA 1NBOA 1SC3A 1W0CA 2IRWA 3HS3A 1L3BA 3P26A 4IGIA 3UHJA 2DHRA 1YV9A 1B8UA 4IXTA 1LGYA 4V1CI 2YMMA 2R4UA 5JNRA 3UMCA 4H16A 4DR2B 1D6JA 4O63O 4D2IA 1OBOA 2RGRA 3JQPA 3R09A 4MV5A 3UCFA 4FJ0A 4CBVA 1DADA 3H5OA 5ITSA 3GXBA 4KE7A 4UMFA 3PTAA 3HY3A 2G7ZA 4GAEA 1JR3D 4QO7A 2PUVA 1RM5A 3V8RA 3QBVA 3ESZA 4GT1A 4B5KA 4CKCA 1RZVA 1RM4A 2AYXA 3QKIA 4FDUA 3D6UA 1WXDA 1DHTA 3KWJA 4BV2A 1MVLA 2YWGA 2P35A 3VU9A 2ERYA 4LZAA 4YDQA 3WKBA 3TEMA 4K9PA 1AD2A 2UZ1A 3CKKA 2GCEA 3RRMA 1N0IA 1UWKA 1H1DA 3GBSA 1TO6A 1LRKA 3R3HA 2Z4SA 3EC1A 3GIDA 2CSUA 3JVEA 1HLPA 4CKWA 5K0TA 5TGTA 3CRMA 2H18A 3EDYA 9GPBA 5H4HA 4OTZA 2ZM6B 1L1EA 1OXXK 1SCNE 2JFNA 3MB8A 1G38A 4X95A 1E1CB 5ALRA 1JTVA 5FFNA 4R1OA 2A7QA 3F78A 3LBHA 1WCYA 2PU5A 1O0BA 4AMGA 3ETEA 3IT1A 1TQ2A 3VYSB 3EY9A 2EF0A 3QX7A 5A71A 1KZYC 3KOWA 2RHMA 3NJRA 4BLWA 2AW5A 2UZ1B 2XF8A 5B30A 2BV3A 3WK6A 3EXFA 4FIZA 1CIJA 3SZ3A 1LDBA 3LLVA 2ONCA 4AMUA 3DYBA 1LLFA 3FMOB 3DVRX 5AMXA 2ODTX 2HPVA 3OQ1A 3TE6A 3L3BA 1H2XA 3UJ8A 4E5SA 4D26A 3OOJA 4DQXA 4O29A 4R3WA 2R6ZA 3EW7A 1YK0A 2Q3MA 1OJ7A 2IQIA 1H69A 2XTZA 3SFTA 1KS2A 1FDOA 4Y2XA 1SQ0A 3C24A 1B74A 1HSOA 2I4NA 3GZ4A 4QDZA 5TT1A 3WRYA 3QPUA 2E9SA 1RKXA 3GDWA 4MVCA 4ZOLF 2BJHA 3F6RA 1OVGA 3U3JA 1K06A 2D59A 2H54A 4FGKA 2D0OB 1DL5A 2GCPA 2BMFA 2PUWA 2CNWD 1CS4C 2AFIA 2XTNA 1P19A 5COBA 5AT1A 3V2GA 1ML4A 4XSHA 3BSYA 3S2YA 1LBSA 1A77A 2MYUA 2CDRA 7REQB 2A7XA 1AS0A 3H0KA 4PTLA 1ZK4A 4BFYA 2ZE5A 1NRIA 4BL5A 3CZAA 4IRMA 4D02A 1DWPA 5F9HA 3WSTA 1YOVA 1PFGA 4JP2A 5LYJA 1KBOA 2C20A 3DDNA 1NQAO 3ZWWA 3N8KA 3KAPA 1VSUA 3PR3A 3KJGA 3FTCA 3LRPA 4FMPA 3ESBA 4J0DA 3V4PB 5CLHA 5I5GA 4W1RA 1R12A 4Z9BA 1OTYA 1SOMA 1QFMA 2HV8A 3OJXA 4GXRA 4F38A 3T7DA 1Z4LA 3N0XA 1YS7A 3I23A 1BDIA 5DP2A 1AXRA 3F3SA 3U7GA 1W4RA 4WK0B 1RM3A 1A82A 2H9YA 1M0SA 1M10A 4K9LA 1YCHA 1RYEA 3OHSX 2W71A 5GIPE 2B36A 1KDVA 2XOKD 3M6UA 2I2XB 1W88B 2PT6A 2FPGB 3IQHX 3L92A 4GPAA 1RRMA 4IYJA 1U6JA 5J40A 2V03A 1XZBA 1S2LA 4EZEA 3AJ8A 4RKFA 4UTOA 3X2FA 1UBNA 1JS1X 3ZOZA 2R00C 4B3MB 2QTZA 4UTNA 2VHXA 1GU1A 5G4KA 4OBBA 5DGHA 1TAHA 3O82A 3ZHUA 1FFGA 4HX2A 5B1HA 3NLLA 3EWNA 5TSDA 3N1UA 3CTPA 3AO0B 3HL4A 3NO4A 2OK8A 5JZMA 3QXGA 4OL9A 1XCLA 2EERA 3FVVA 3G79A 4J07A 4NY1A 1D9XA 2L17A 2OILA 5CVEA 3CNOA 1Q50A 1S2DA 3F5FA 4KDCA 2XIJA 4TPKA 1QKJA 2VUTA 3D7RA 4F84A 3BMCA 3D4OA 1XKXA 4CKCB 4JLPA 5AKJA 2B8NA 3R7AA 2E37A 4HLCA 3RAEC 5LBTA 2ZWVA 2ZYWX 3NDRA 3SN6A 3UA3A 1GKUB 5DEOA 3LPMA 2EZUA 1KA9H 2Q5QA 2ZJOA 5C8VA 5KYKA 5TMPA 1W7AA 3CEJA 5KWJA 3TZCA 4M9ZA 4CKYA 1GXSB 4MA5A 5LQKA 3O8CA 2H08A 1XJ5A 3M33A 1OGYA 1U65A 1M8PA 2BJWA 2WVGA 2RKBA 1I80A 3H9EO 4KPFC 3HJCA 1MIOA 5PNTA 3WLPA 5K2OA 1N8TA 2OV6A 4G0OA 1LJ8A 1TT5B 3EVTA 4A27A 1HNZB 3BMCB 1V5WA 3G88A 5C53B 3EVBA 3I92A 5KSOA 2VRBA 4NL4H 2X0FA 3RUIA 4EJ6A 3GDFA 4TWIA 4LTNA 1E9SA 4RD2A 4Y8VA 2R6GA 4ML3A 2HA4A 3LQ4A 4N4AA 3LLSA 3HVKA 3B9RA 5BWOA 2H1VA 3MTGA 1M2KA 3BJEA 2ZI5A 9LDTA 2QZ4A 1R27A 4I3HA 1JU9A 2PFGA 4BFLA 3CH5A 4A1OA 3AKEA 1HBJA 1T1JA 2VJMB 1B6GA 5J43A 1EBFA 3EY4A 2IS6A 3NBMA 3F7TA 3SEFA 4PFQA 2R7KA 3I73A 2A0FA 1FQOA 3ASZA 4KK4A 2OFXA 4MYCA 1DPGA 3E70C 4H1WA 1OC2A 3RRZA 2H17A 2PH7A 1RMYA 3EHEA 1HOXA 4CL0A 3THXA 3H1TA 2FN3A 2IX3A 3M7IA 5HDBB 5B3JC 4Q3EA 5D85A 1V5IA 1Z47A 1T9GS 3GVPA 1RPJA 1IG0A 2NOAA 3QIVA 4PVCA 1I2MA 5J23A 2YS6A 5F77A 3MGGA 4FFVA 4YXWA 3SM3A 4OH7A 2CJYA 3LPAA 1OAKA 1AHHA 2FAXA 4KUEA 2I6UA 4LMBA 3WJ2A 4X44A 1Q1ZA 5C35A 4LYHA 5TRTA 4D3FA 3LUGA 3PJDA 1LDEA 2CMGA 3D6VA 4YBZA 1JTFA 1LD3A 4HEA1 5L3QA 2VPQA 4I9HA 2PZJA 4B2YA 3AR5A 4IDPA 5JFGA 1RLUA 3G0IA 1DIGA 4PHHA 4HQKA 5K8VA 3BM5A 1N5OX 4I4TA 1WSBA 5H82A 1BOOA 3R6DA 1KEKA 1WXEA 2DUMA 1X19A 4UM5A 3ROPA 5CCBA 9MHTA 1XT6A 1Z73A 5HIIA 1J90A 1HT0A 4KQMA 3GGOA 4ZQCB 4YN3A 2Y27A 4BAUA 1GQSA 4DQUA 3AFNA 5AVZA 1UMCB 2ZRPA 2C3PA 1V1RA 1Y1QA 4LY3A 4P3PA 4R9SA 5EINA 3SE7A 3WKEA 1OXSC 2TS1A 2V9PA 3GLHA 3CGGA 3A7EA 3K9BA 2JATA 1SULA 1A4XA 1AY0A 1KMIY 3HFJA 2HIMA 3TGLA 1NVDA 2ZT6A 3AL3A 2FW0A 4UPVA 4R83A 5L3QB 2YRFA 4D25A 4ND6A 3OT5A 4FGSA 1GNSA 1K8RA 1F6BA 1HYQA 4KKXB 3EXIA 4OJTA 4HAWA 4OCZA 4OU5A 2D8MA 3UJDA 1ZYUA 3QUCA 5E7IA 1P2UA 4H18A 5M34A 1OWMA 2Q4BA 2YDYA 3BWEA 3DE0X 3KE9A 3MGKA 4CI0B 1MOQA 3G2IA 2W6ID 4ROTA 4CM4A 1V96A 1W5SA 2AQKA 4P7FA 4P4SB 1TECE 5GONA 2I99A 2VUSA 5ADWA 3U4QB 1AHPA 1P1BA 3U7JA 5FXMA 2CSXA 3SZOA 2BKUA 5SZKB 4H6PA 3RUEA 2ZU0C 1G8AA 4MS3B 5KOJA 1JU4A 4F1JA 3VZPA 2EFYA 1MABA 4BFCA 1SXPA 2GYVA 3EDOA 1J21A 3WYGA 1R0XA 4IY1A 4B6GA 5K3FB 5JCJD 3A1NA 2C7PA 1P4SA 3BZBA 4A03A 3R3VA 4DR5B 1FVOA 2H0QA 2XX3A 3FCEA 3EGOA 3PGKA 1Y5RA 1N9GA 2XQIA 5H81A 5I8ZA 1C3XA 1TVCA 2JJ1D 3RS2A 4EHLA 2M98A 2JANA 1Z3CA 1VMEA 5AW4A 3VKFA 3CJQA 1ZWLA 2VP0A 4BEBA 5AVKA 5HRAA 4C7OA 5L51A 2C2XA 5HZKA 2EKBA 1IQPA 2IY7A 2WA2A 3I76A 3G2QA 1BVRA 1EVLA 2QMUA 4N7JA 1EGVB 4A82A 4F96A 1MU0A 1QVZA 3LW8A 2WAAA 4B80A 3KM0A 2AEEA 1U8YA 2FK8A 1P7WA 1XHLA 3LI2A 4Q39A 3UUFA 4LC1A 4WWHA 1NVAA 2Z9CA 1ISGA 4QEDA 3RSLA 3L06A 1EESA 3H5IA 4KXYA 1FSZA 1UK7A 2VBIA 3Q5DA 2Q27A 4IDQA 1PFQA 4NAVA 3DEFA 2Y0BA 5HOQA 2BGGA 2TYSB 3JD3A 3CYFA 1SRQA 3O31A 1IUOA 1LA2A 5BSTA 1XROA 1KHHA 2R8EA 3LT1A 5DW0A 1JX6A 4QU0A 1ZGBA 2BMAA 2J31A 1G8JA 1PD1A 2O1EA 1HDGO 2VDUE 3O8OA 4ZEXA 4R1UA 5EHZA 4EGQA 3I2FA 1P2GA 2PV0A 3PHBE 3UB3A 3L1IA 1NVWQ 2XB2A 1GNLA 1YI8A 1HRDA 1J7JA 5F23A 1SK8A 3OP1A 1ZCJA 4HAOA 3TGPA 2G6BA 3WC4A 1GAQA 3KKNA 3E7DA 4E14A 2JGKA 3STVA 4ND2A 1U4SA 4JY7A 2HLDA 4QEKA 3CO0S 3JYQA 3RC7A 4G97A 1XTRA 3B36A 2QMHA 2VJPA 3CBQA 3R4CA 2JH8A 1GTMA 2Z95A 3IAUA 5BNFA 4A26A 4AJNA 2XWBF 4M83A 5CGQB 1J0BA 2XZTA 2BGWA 4II3A 1KBZA 3LZ6A 3DL0A 1KNXA 2BHRA 2OGWA 3AEQA 2V7PA 3EG9A 5JMPA 4CF3A 1JHQA 2FF7A 1LV7A 5CM9C 3BA1A 4TRNA 3DC2A 4OB7A 2OXEA 5T8KA 1RFGE 3CF2A 4RCZA 1VB5A 2QL6A 1G8SA 1S4MA 3JSXA 3L79A 3WLOA 4RW0A 1C30B 1JVBA 2I7XA 4KQ2A 4YCSA 4Q7KA 5B5SA 3AR6A 3OQBA 4OAPA 2HK8A 5E2BA 5EKSA 1QHGA 4WERA 3N2GB 2WTUA 2HB6A 5LP6B 5BQOA 4MOWA 4KQKA 2VXYA 1G8HA 2ZBFA 3TBKA 4MW9A 2C88A 3D43A 1BOFA 1GD1O 1VZ3A 4HLQB 2X0RA 1JJAA 2VZ0A 3RS7A 2BRUA 3DBRB 3MRTA 4P1ZA 1V5EA 1JT9A 1E89A 4EI9A 4FPXA 3HJTA 2P9GA 3AUSA 3GLHB 3H2ZA 4IJKA 5ELMA 2JLCA 5IJAA 3ZD9A 2IY9A 1VMDA 2SCUB 5G1NA 5KJ1A 4I66A 1NI3A 3SVTA 1YRHA 2CT8A 4J03A 4QECA 4RHCA 4QFDA 1K8XB 2QRUA 1NG1A 3T3EA 1THZA 4RM3A 1LJUA 1B26A 1ELOA 1VHDA 5IKXA 3GMDA 3GQBB 3C7AA 2D1SA 5EVCA 2AE2A 2CHGA 2W6JD 2YJGA 4Y2QA 4ACAA 2YKGA 3F7MA 4ZQGA 4YS6A 1T43A 1YB5A 3AT1A 4TTRA 4EJ2A 3KCQA 2XNDD 3AVUA 2DLCX 1EWRA 3A6FA 3PVZA 1CUGA 4N12A 2PRYA 2VYQA 2AX3A 4KDEA 4ARVA 4PYJA 4PLFA 3DPUA 4BNGA 5JPDA 2X2EA 2GEUA 1MVOA 3JQ9A 3PLNA 2E3JA 3GEEA 1G5HA 1R0CA 1M3SA 4FOOA 2PZGA 2R2GA 1XDZA 4O2AA 5AHRA 3V1MA 3IUEA 3GAMA 2JNWA 3HB4X 1CQJA 1XPRA 2YVLA 4MJ7A 4XR9A 5C52B 3Q85A 3KQVA 3IO3A 4NBVA 4OXXA 2ADOA 5FOQA 3QY9A 1YZUA 1VRWA 3IT0A 4ZGBA 2H7XA 1ONOA 3C43A 4P32A 1VCIA 2YMQA 2JBAB 5B1SA 2C1XA 2ZRFA 4CF4A 4EB6A 5HIAA 2IOFA 4MO9A 5BV8A 2JGLA 2JJMA 1AIPA 1EFVA 1VGQA 1ZUNA 2JEZA 2BEKA 1KJZA 3C87A 3GC6A 3MBKA 4WXRA 5G3YA 1BCRB 4ZHSA 1F9AA 5JW6A 5LMCA 4AC9A 3HGMA 1P0FA 3BTOA 5L6MB 4UZFA 4FFNA 4EWLA 2AJLI 1FRFS 1QIIA 3NNNA 3A3OA 5HQTA 1UJ4A 1W5EA 1K0FA 2RH5A 2AFHB 2EWMA 1PSZA 2P9BA 3EEYA 5KJCA 1O57A 2GBCA 1WEHA 2AD5A 4TYYA 4KGZA 4FE4A 1G6OA 2L82A 4LE1A 4YRQA 2JLZA 3KS9A 2ET6A 3KZCA 1G8GA 1GFZA 1KAHA 2EC5A 4L8YA 1EJ0A 4DTCA 1NBAA 1JEQA 1V4NA 4M9RA 1XXHE 3TQOA 1Y7HA 3EX7C 3WIUA 3AVOA 4EHFA 4H6WA 5F51A 1CLEA 3JVIA 2ZJ5A 3NFRA 5DGXA 5TQ2A 1SZPA 1ZSYA 3MWKA 4MI1A 3O9MA 3VR4H 2PBRA 3ZWXA 1HDZA 3Q3EA 2OHIA 1ZM3A 3Q2IA 3FA2A 1NXVA 2OEPA 4KIGA 1RI4A 1VMKA 4G5SA 5EI5A 3TLGB 1WD7A 1R18A 2N3ZA 3OG9A 4JEUA 4DADA 4LQ4A 3TJMA 4JCOA 1CUUA 3CWCA 4KQJA 4MKZA 4DVJA 1MT0A 1HMPA 1UKYA 3BJZA 5G0WA 5JS8A 1N2CA 1NXOA 4GXTA 3I8XA 3I01M 4F5EA 1JEQB 3BQ9A 5E3JA 3C4QA 3VDNB 2CK3A 2VA8A 1V48A 1TA9A 1EVIA 2Q50A 2OUKA 4HTFA 4N1AA 1Q3KA 2WYUA 4KVZA 5AR1A 5KDLA 2ZI3A 3G0CA 3EIHA 3ZU4A 3A37A 2OYSA 3HV0A 3NHAA 2YZ2A 3HA5A 3P4XA 4JR0A 2BH9A 3L7AA 3M4YA 1ZUWA 3BERA 3GCZA 2AF3C 5K3BA 5FWNA 1WUKS 1XU9A 2VQ3A 2YYSA 3SK0A 1DNPA 421PA 3VHXA 5JR3A 2CCGA 2WAXA 2YJ6A 2ZRNA 3LP8A 4GYJA 4KFSA 4FYPA 4XYGA 5EY5B 1KOLA 3V4RA 3H5TA 2D8AA 1I6LA 4HH4A 5C8DA 1J39A 2QTHA 4G89A 5ALVA 5ILGA 3FTEA 4K88A 4CGYA 3L7IA 4DV6B 4RD4A 3R7BA 3ORRA 4MX8A 4QREA 1ENZA 4I4IA 5A9SB 5BXQC 1ISIA 3K0AA 3RGGA 3I28A 1U0BB 3ANTA 4CMHA 1UBRS 3ICCA 5UKDA 1XJQA 4G4JA 4Q1EA 4XGNA 3WKDA 1KYWA 1WLSA 1IUPA 2VAPA 5F5LA 5FBHA 4HGYA 4DC1A 4RAQA 1XWWA 2OMKA 4HDRA 3ZZMA 2B1QA 3GG9A 3KKMA 4ZXPA 1G291 4H15A 4MRVA 2C98A 3ANSA 4QQRA 4FDLA 4O8ZA 1CDEA 4RPLA 1FU8A 4PCUA 4EEKA 5TARA 4YCLA 4L95C 2AKEA 3R9WA 2J3DA 3NYQA 2YV3A 4QDTA 1DIHA 2PHZA 3OFVA 4Y1RA 3W6NA 3AUJB 3T3IA 1DKRA 1LS6A 2ZSHA 4OSEA 1JFVA 4BMVA 4BLQA 1CV2A 4OXQA 4D9EA 4F21A 1X1BA 3I1JA 5FL7D 2YIJA 3I9MA 2VPTA 4B1FA 1TEZA 4LKRA 1KDZA 2QI9C 2BPOA 2Y1OA 3B8HA 2BFDA 2GBGA 4RQAA 4WXMA 5E6SA 2P5TB 2JKYA 3GLGE 4OXRA 2IZOA 4OIMA 4PY2A 4UBMA 1G3QA 2QM0A 3W2GA 4BQFA 5H9WA 4G0WA 5EUQB 4ETNA 1EPUA 1WDWB 3G9ZA 5HCIA 3W4IA 5K9ZA 4KR2A 1YZQA 3DG9A 1JBQA 1JHUA 2BCGY 4CDGA 1OZ0A 4L8LA 5H16A 5AQ1A 1N7JA 3IE2A 3OU6A 2RONA 4HLDA 4GX0A 4J0HA 2P7IA 4FEEA 4ERXA 4BNIA 5A4KA 4E12A 2B61A 4FGJA 2J6IA 2WKQA 3BIJA 1Z35A 2I3ZA 1EDOA 4ITRC 4O3MA 2QW0X 4KYTA 2BGKA 3CINA 4G1FA 3B2QA 4ZEOA 4EDHA 4CF7A 4PXYA 2P68A 2RGCA 3RC2A 4F6RB 4NCKA 2XKAA 3NAMA 3QMMA 1YR9A 3GUCA 4A16A 4TQAA 3JQ8A 1ZGAA 2QL7A 3L6CA 4MVJP 4DBZA 5E3HA 2IEBA 5MDHA 3NQ41 5EOVA 1S1CA 2I87A 4TKMA 2LUOA 4MRAA 3SGLA 2WSLA 2VTBB 1XRSB 2E7ZA 4TRJA 3MYRA 2IV2X 2UV8A 4CEHA 1ABEA 4PLCA 1WMFA 4YRFA 4BZQA 3S1AA 3UUGA 4CL3A 3G2NA 3O2SB 5DLPA 4BO1A 4F12A 4C0QC 1JDNA 1OUMA 1SXIA 5IM4A 2J08A 5JPIA 3DNPA 4B46A 1E4EA 3ZWKA 3NTUA 4M9UA 5K4GA 4QOEA 1RZRA 4MS4B 5KCMA 3EEFA 4R7ZA 2QDKA 4HLUA 4ZCPA 5DN9A 3JQ8B 3JAKB 3MJDA 5CBPB 5TY0A 1RRPA 1TK2A 2OCAA 4LPSA 2JJ2D 4PX2A 3ZI4A 1FU4A 2OBLA 2VT2A 3K0FA 5AOCA 3TXXA 4MHTA 1VYUA 1B0ZA 1SU4A 1F4VA 4OP3A 1K5PA 4MVJI 2AMYA 3LDUA 3PS9A 4AJ4A 1LJLA 2B0CA 4AN4A 5LYJF 1WVMA 3B6MA 4GP9A 3TVDA 1C3VA 3UKJA 4HX9A 4WCFC 4YUXA 1B0PA 1G59A 2QVXX 5ALIA 3HN7A 4BPBA 4Z1OA 4Q9IA 3F6PA 1AJEA 3R9XA 1XVVA 3MWJA 4GGOA 4F3TA 4XEUA 3JQGB 1T24A 5KYTA 1XFAA 1G7TA 5ICFA 5D3QA 1RWWA 1L6IA 2Q2WA 3WDKA 3IA7A 3BHJA 4XLZA 3GJXC 3WK8A 2IU3A 1OREA 1GRNA 3QHAA 1VPLA 4KN8A 2ZRGA 4RADA 2JGFA 5IEJA 2C95A 5A6SA 2FHPA 1ZO8A 5E4JA 5AM2A 4MDEA 4WH0A 1RXIA 3QU2A 4Q1AA 3D64A 3G2KA 5IG2A 4BGEA 1IMOA 3K1TA 1A1SA 1C5KA 5ALSA 4DCTA 5JDIA 4I0WB 2IPLA 5DBEX 2WWRA 2Z1MA 4ARBA 2NV2B 3OF3A 1GCUA 1W44A 2FPIA 1V37A 1DKUA 2NV0A 1WXFA 2O20A 3CIOA 3IVMA 2XDWA 5JZOA 3B3QA 4H7DA 1BA2A 2KPOA 2XD4A 4IFBA 3AC0A 3MN1A 3UXHA 1NVVQ 5KWEA 5KC8A 3E2MA 1YQ9A 3TRIA 2B8TA 3EF1A 2CC2A 5CA0F 2FP4B 4IEFB 3V8PA 2EL7A 3Q3JB 1TAUA 1W94A 4RKRA 4MRNA 4DLAA 2CBGA 1P3DA 2C96A 1ZX1A 2CL0X 3RSHA 4BNMA 4TWAA 5DF1A 1LWOA 1U0GA 2BEVA 3DEKA 3K35A 5B64A 3H87A 1KDYA 3RVPA 3LRXA 1WUYA 1JFLA 3DWEX 4MCIA 4LRWA 4TTVA 5ALXA 4O4HB 3D9QX 5MGBA 4HVCA 4XPZA 1NAIA 3TI7A 4Z8YA 1ZPDA 3MXTA 2BAGA 3OM8A 1SXJA 4BLOA 3PDJA 1S1MA 1BXRA 2EGGA 2QAJA 2Y3IA 1YJQA 3GOQA 4W5HA 1RLJA 4AULA 5BWLA 4M9QA 4K0KB 4MUAA 1WPRA 2YW9A 2OHXA 4CWAA 2YYYA 3IPLA 2EX4A 1XRPA 2DFPA 3HRIA 4N49A 2Z0MA 3KU4A 2J67A 3L0BA 1R0SA 3DMTA 4IDNA 3H11B 1GSIA 1R88A 4URHA 1FTGA 3D8HA 4NBUA 1N2IA 2I4RA 2PA0A 1WPGA 1Y1TA 2PKQO 2QRLA 1G16A 2P8JA 2ILVA 1FEZA 3IMCA 1Q7EA 5F7XA 4MUNA 2H4YA 2ZGVA 1ZIYA 2BGMA 3EH1A 4ZQEA 3P20A 3T7JA 3D3JA 2OXIA 5E95A 4OGKA 1QC5B 1Y7PA 1SU7A 1QIJA 3DMGA 3QPBA 5FTJA 5KVSA 2VTBA 1VPVA 1Z4QA 2COKA 2NYRA 1W2HA 3Q8LA 2RGWA 3EOZA 1TM4E 4HGNA 2D5IA 4W6QA 1N7IA 4KOEC 3R0QA 3MJSA 3LY5A 1D09A 4M87A 3S2EA 5KNBH 4QWMA 4WW0A 1RAHA 4ABYA 1B73A 1T2FA 4LUCA 2HDOA 5SV2A 4QUKA 1YFJA 3ZG6A 1PNVA 5JXIA 2IUFA 3QLUC 3CZPA 3VISA 4GOXA 4EX6A 2IYWA 1RBMA 3KKEA 3MRXA 3PNBA 4C4RA 3L0CA 5LB4A 4DABA 3ZIDA 4FONA 2P9HA 2KX7A 1WHSA 1VIVA 3NW9A 4G5QA 1RAGA 5JQWA 3OLXA 4X93A 5FX2A 3CVXA 3V4ZA 1LX6A 3PI7A 4UQOA 1O97D 1T91A 2QYSA 2Z2XA 1WTCA 2V55B 1IHPA 3H3XA 1HLFA 5DNDA 1I14A 4LXXA 5E7QA 4AKSA 4Q3OA 3RANA 2KYRA 5LKRA 1SVWA 4J1TA 5A2GA 4XWWA 2Y66A 3IMKA 3HR8A 1JHZA 2HA3A 3ZXUB 4RH0A 1WG8A 3D4BA 4TRMA 2IIBA 5DK4A 3TI9A 2C4WA 1JG1A 5DNCA 1YHNA 3O1IC 3QI2A 4MWEA 4ZALA 4X3CA 3UWDA 1QVRA 3K8YA 4JR1A 1JU3A 3CZCA 4FNMA 3K2BA 4UBOA 1IE3A 4MQ4A 1RCUA 3SSAA 3ZKAA 3COWA 4F4JA 1ORWA 1X8XA 5D5HA 3FDZA 3K0KA 2O2SA 4B40A 3PPIA 4CN8A 4DC9A 1XMXA 3I0ZA 2NO0A 3CX8A 5FKJA 4C30A 1DKMA 1GL6A 3ILXA 3LNTA 4F72A 1U0OC 3ZWMA 1X8LA 4HCJA 1WLYA 2QUZA 4QGGA 4YJFA 3PUXA 2IXDA 1UEJA 4EY4A 2F7SA 2IHNA 5GZ3A 4DLWA 1FUYB 3TWOA 1G21E 3WS7A 3CRW1 3TQRA 1T6XA 2WZBA 1MC4A 2D0IA 1JQJC 1ZM2A 2C84A 3C14C 3WYEA 4DWJA 4F3YA 3VR6D 5ERXA 2C94A 3I83A 1UP4A 1WR8A 2OK7A 3I3OA 3PPXA 5A5VA 5DGCA 2AK2A 1X74A 3CJTA 3HDGA 1FDSA 1CK4A 1TMOA 3L8DA 2YVKA 1K6JA 3WB2A 3OPYB 4AI6A 4LZNA 1X86B 1TT7A 4OK5A 4PLTA 3ESDA 3L84A 5K8TA 5ED4A 5CK4A 1V8BA 4BJ5A 1OWLA 1ZQ1A 3P52A 5JXWA 1Q74A 3ENQA 1Z6YA 4IFEA 3MGBA 5DIZA 3RLFA 2PRSA 4GLBA 1W47A 3ETGA 4QKQA 2YFQA 1NZFA 1E32A 2Q6OA 1D1PA 3RUHA 3L8CA 4LX0A 3A2MA 2RD2A 2BFBB 2OQ2A 3V4VB 3VR5D 1PZFA 2G4VA 3QWAA 4U00A 1PK9A 4OREX 3LCJA 4L9AA 4TVKA 4A2QA 1VL2A 4OFXA 4PQFA 4QELA 2A5JA 3K6JA 5DLYA 1SUWA 3OM9A 2QRVA 2XI4A 3TXAA 3H1EA 2QT9A 1GXSA 1TCCA 1Z5ZA 3CG0A 1CXZA 5CLFA 1GLNA 2ZZMA 2Z2YA 5FBZA 3T3HA 4KHPB 2WP0A 4GC9A 4TMVA 1UT8A 1ZMBA 2FWPA 3IPXA 3WQQA 4DDVA 1XF1A 1ZVVA 2BDTA 3RVKA 3D8SA 3TRJA 1U2DC 2WJZB 2P0AA 3R2JA 3KQSA 5DPMA 3RIYA 3T7EA 2VHJA 2CBXA 4JX8A 1U9ZA 1D6NA 4DUGA 1Q92A 2TMGA 3ZHBA 2OO5A 2YN4A 2PA3A 3AP2A 3LH5A 4Q34A 4CM9D 3MJHA 4PO3X 2I3BA 4F3RA 4JBWA 3X1WA 4CLEA 2ENWA 2JIZD 2HZBA 1UZMA 7YASA 1SG6A 3O1HB 3QFFA 2F55A 4C0LA 1AMNA 2F8MA 4L2IB 5JCPA 2XUDA 1NKTA 2F43B 4R1MA 5HS6A 4DAOA 1OLUB 1NXWA 2B1JA 1JJVA 3ZD6A 1EINA 2P8SA 2YN2A 4DXHA 4QQKA 2H5LA 3GA5A 1QGED 3JQ6A 3M6AA 3NIGB 2A78A 2OHHA 3RYTC 4YV0A 4P93A 3OO1A 1TZBA 2W98A 3H4MA 1C9YA 3IVGA 1WZUA 4IIHA 4NU5A 1VCNA 4LF4B 4KEAA 1ODTC 4GI7A 4QFBA 1XFDA 3TLMA 3DMTC 5AJTA 2IYLD 2XMGA 2JI9A 3ZLBA 4MO2A 2VZEA 1W4BA 1CY8A 4PF1A 3VU1A 3ZHVA 4CPDA 3ADDA 1R3UA 3ONEA 1PEKE 4OLHA 4ONEA 1UINA 3P8ZA 4NFYA 4AAYA 4PAWA 1JAHA 4Y9SA 1L4MA 1VE9A 4QIHA 5JBIA 1OXTA 2PU7A 5LOVF 1R15A 2QX4A 1E1QD 1AXEA 4CMJA 1BIFA 5E6UB 4M8IA 5ICSA 2W11A 2EKQA 4RA6B 2H1OA 3SE0A 1OVMA 1P91A 3FDFA 4RE6A 1JIVA 1E58A 4H31A 1M1UA 2X7JA 1AQLA 2A94A 4J0GA 2Y9MB 3EPRA 1UBSB 1F48A 2A67A 3P96A 4KE8A 1ORHA 3WGUA 4JT2A 4XQEA 3C6MA 5HPYB 5IT9A 3A6GA 4LDAA 1JB9A 4LS3A 4YMLA 1KYYA 1IN4A 2J41A 4BKUA 3C3WA 2O3TA 3A0UA 1DJMA 3HHEA 5FAXA 5AHWA 4D44A 4IMIB 3G23A 3ZH9B 2FOLA 1Z0KA 4LISA 1K7EB 1SHLA 3I6MA 3DZJA 3KUDA 3QXJA 1U5BB 2DJIA 2P1ZA 4V0KA 5GOTA 3VR4A 1LPAB 4J1NA 4D57A 1TZ2A 4HN9A 2ZUFA 3WGOA 4PGMA 8OHMA 2AUNA 3CR7A 1JHYA 1IY2A 4O59O 4O4JA 1UZAA 4Y1GA 4CV1A 4POOA 1W36D 3KJEA 5LLSA 5KOIA 1Z29A 1DP4A 3ZDAA 4KXWA 4P3OA 3QVMA 1QH8A 4KXQA 1AQ6A 1XEXB 2AYZA 5KUTA 4TS9A 2OLJA 4HB3A 1G20A 1G3UA 1O6BA 2AUTA 1JGTA 1LRLA 3NBYC 3ASYA 5LZ8A 3EOAI 3VU8A 5BR1A 2W83A 1FP6A 5J2TA 3R7DA 4RF2A 4YMHA 1DKPA 1M6VB 2HDWA 3STHA 1G5TA 1C0KA 2CE7A 2RGYA 3C98A 3ES9A 4D4IA 4Z4GA 3A6PC 1HI9A 4B76A 2YCLA 5CM8B 2CJWB 4I1IA 4AZTA 1RYFA 3DM9B 1KARA 3RD5A 2ZJ4A 3A6KA 4I81A 2X23A 5KNBA 2VKQA 1RLOA 4IMRA 1W19A 3N39C 4HVAA 3PKIA 1PWYE 4EVSA 2ZZNA 4LV8B 3K70B 1X8JA 2ZBDA 3KYDA 3MCUA 3EAQA 1A2KC 2O2XA 2C0QA 4M2LA 3QW4B 4NCJA 3ZJYA 1PS9A 3VZQA 4YMTA 1R8JA 4ESHA 4EGJA 1JJBA 1OV6A 1YC5A 2PO7A 5K2MA 2UUPA 4DA4A 4MUMA 3FWYA 1CP3A 3C8HA 3GLVA 4LV5B 2IUSA 3GJTA 4DZRA 5I4IA 1GGHA 2P65A 3KWFA 1J8DA 4IH9A 5AOBA 5F9FA 2VSOA 4D0GA 3B6IA 3N58A 1DFHA 1JWBB 4WLVA 5IDYA 1SC9A 5KAMA 4CDRA 2Y4NA 4GKVA 4M0MA 2IDJA 3E7WA 1FNBA 2DFTA 1XJWA 4ZVSA 1EBBA 2HREA 4MKXA 2GF2A 1UBEA 3OFNA 4RL6A 4XGKA 4ZICA 3NVKI 4G81A 3FNGA 4I36A 2G82A 2EP5A 4MVJE 2W2KB 3S2IA 5AVOA 2HXGA 1CF2O 1VSBA 2OHVA 5AKGA 1AMUA 2XT0A 2AW3A 1IU9A 3FYSA 3QXCA 2ECKA 4P5EA 5J2TF 3F4BA 1OXBB 2GZMA 4C0BA 3DTVA 2G1UA 2X1VA 3X3HA 2QWXA 3P2IA 4MWDA 2V6MA 4XDHA 3CXUA 3I61A 1OWPA 1KMHA 2QAGC 4IWNA 1NDQA 2BGJA 3SD7A 4KIJA 3S29A 4RTOA 3CV3A 2OZPA 1SCAA 4E3ZA 1OQAA 3O8LA 5IAOA 3LBFA 4J3NA 2PX2A 1QF6A 3DV0A 1G42A 3GFBA 4KWIA 2AN9A 3I9KA 2AEJA 3PXXA 2W8BB 4J4TA 4DUGD 5KJEA 5I8WA 3BRSA 2WTXA 1GTJ1 4DGQA 3PA8A 3DPSA 3ENKA 4M86A 4W9NC 1CIPA 3C3AA 5JWHA 1ATZA 1LPOA 3MSXA 5JS1A 4OOEA 2ONZA 3T7AA 2PD4A 2IC5A 3DTVB 1EU1A 1V3TA 4WZBE 2XDAA 3TLJA 5CDYA 4UJ5A 1QH1A 5JZBA 4ESEA 3K8ZA 4D6XA 4DLSA 4X94A 1SK9A 2VUUA 2NVUB 2P1DA 1D2GA 1MD9A 4RVNA 1C30A 1MQSA 2OWEA 3SWWA 1N0VC 1K4MA 1F4PA 4TV9A 4IOMA 4WNYA 1N2CB 4C07A 2GJ9A 3U5TA 2C5EA 2XOXA 4BEVA 2NPFA 3PWSA 1OI3A 1Y81A 1Z5GA 1RWBA 1OFUX 2IPAB 4XM0A 4B4VA 2GBPA 1COZA 1POXA 1R00A 1SKYB 1H6CA 1VJGA 2NV6A 2ZPAA 4QNNA 2WA1A 4GQIA 3EG5A 1HY3A 1SVIA 3JALA 2ZTHA 5IH7A 1ZESA 4O2RA 3WGYA 3L7KA 1PUIA 3HN6A 3HYLA 3QOXA 1DEXA 1REQA 4NULA 4FFMA 1TKAA 2IPXA 3KAQA 4MAMA 5DI9A 3RYCA 5JXJA 1VYHA 2P9ZA 3QBTA 3QIAA 4ZO9A 3I34X 3TOSA 3TTVA 3CC8A 3EQ2A 4IVRA 1R6DA 4IQ4A 2GN2A 2AYYA 5F52A 3UMVA 3TB6A 1URPA 2ZKLA 5FEUA 1CEEA 1LPMA 4H35A 1RCFA 4DNPA 5GVRA 4K6CA 1U8TA 2BZGA 1UOOA 2OYCA 1OB2A 1M6EX 1EQUA 1NBIA 2WWTA 3CF0A 3ND9A 5EESA 5BSUA 4D0LB 1O6FA 1CU1A 1K8QA 4F3CA 3OZUA 1FMTA 2WYOA 4W7HA 3WSWA 2QQGA 2G17A 2FQXA 2HSZA 4ZC8A 4I46A 2H5EA 3A1DA 2QSYA 2O3RA 2RI1A 4B7ZA 1MGPA 4A91A 3VNRA 4B6SA 1JLLA 2JI4A 3LPDA 3B78A 4UATA 3CF6R 3OBBA 4XEHA 2WWXA 1F6DA 3E23A 4J6EA 4ZJYA 1B2RA 5DGDA 3U7RA 4EELA 3LWBA 4KPUB 4PYNA 3PQ5A 5HW0A 4EB6B 1C7EA 5FUMA 1B43A 4RWZA 5ARDA 4WL0A 1L9KA 3NZEA 4CZ2A 2C7GA 3QW2A 1PX2A 1M33A 4ZODA 1D7AA 3OY7A 3FGPA 4L3OA 2QSJA 1GCOA 3WK5A 1C7JA 3U44A 1BFKA 3C7CB 4MULA 1R50A 3GU3A 1GG2A 2QTMA 1JHDA 2FF5A 2F9FA 4H1UA 1UMBA 1AKYA 4LVCA 3KK0A 4J7CA 3AG5A 4QFMA 1IXKA 2Z1NA 3ET5A 4ZRNA 2JFZA 1ONSA 3QHQA 1X80A 2A88A 3SEQA 2GEJA 5EP3A 1XR3A 2FUG1 2I0FA 1RI2A 2W48A 3O7WA 2VXCA 5LMUB 2J45A 2QG9A 2ASVA 2XQKA 5KYXA 1WZNA 3NM5A 1XRQA 2Y1LA 5B7NA 1CUCA 1RYBA 2OWDA 4DMRA 1FC0A 3DQPA 3OQIA 5KDDA 5ANRB 2QUBA 2FMIA 1QYCA 3QKSB 1EAMA 1I7PA 3GD7A 1EDBA 4XQCA 5F1YA 1GITA 1Q0SA 3M4XA 1YKSA 2E85A 4G86A 4URYR 5EUMA 1NLYA 5EJ6A 3KT8A 1D4OA 2JBWA 3OQHA 1VI6A 5DTQA 1NBME 1I1NA 3P9PA 3KUKA 4GICA 4JB3A 4OU4A 4TXJA 5F5NA 4JVSB 2EL9A 3SF8A 1Z38A 1VC2A 4MVJA 1FNCA 1RRGA 2Q99A 1KFEB 1U31A 3UQZA 3AM4A 3RYIA 2FSIA 2VAVA 3O73A 4FT2A 3O2QB 3PK0A 4MQ5A 5ER9A 1XQYA 4KGXA 4B17A 2W4QA 3E9CA 3GFOA 3LUKA 8ABPA 4QBIA 3HU5A 3T0FA 4XYBA 4P81A 2CEAA 3MLAA 5IP5A 2VKTA 4PN3A 3NKFA 5CIYA 1DT3A 4HQOA 5H9VA 3UYKA 4IFTA 1XLWA 3M5DA 3MOSA 4F5WA 1LRJA 2POCA 2RKOA 3NVMB 1DXYA 1XTJA 4RV9A 1W93A 1ZJ6A 2O7VA 1E3WB 2PMCA 3OJCA 4NBWA 4BP8A 4YB8A 2QN1A 1XNJA 4RTQA 2BBWA 3U4AA 2FZLA 3ZK8A 1NZDA 1EQAA 3VR5A 4AROA 2FG7C 2CZCA 2HJRA 1DJQA 1UBCA 2DHDA 2J3HA 2Q5LA 1AF7A 2VJOA 3I6YA 2J5RA 1QRAA 3U7EB 4X1KB 1AQJA 3S2ZA 3VNAA 4BWGA 1ESZA 2OBYA 4LOAA 3G85A 5A4DA 3GLIB 2NYAA 3ZCTA 1DJPA 1I2AA 4DB2A 1KSJA 3JSAA 5TXGA 1N2ZA 1R6XA 2B4AA 4JUCA 2YWFA 2O8BA 4GLLA 2CWDA 2I8CA 1FPQA 3GAFA 3UK0A 4PLPA 1ZSVA 2VDWB 4JSRA 2JA1A 3MMSA 1OXMA 4FBGA 2GN0A 1Z8DA 3GEHA 1RWKA 4KQGA 1QQ7A 2WOOA 3I1FA 3C6YA 1J99A 1XA0A 4KDFA 4YRCA 5JEDA 2Y92A 4KR3A 3ND5A 4C5AA 4WNIA 5SYMA 5IKPA 1T9DA 3D3WA 3K0EA 2NIPA 3LZDA 4JUAA 2OBMA 4MLZA 4REQB 5LQSA 4OA5A 4CLDA 4ZVOA 3AEKB 2HA2A 3PB3A 1UQTA 1ZU4A 2BZSA 1MRNA 4IIFA 3RS9A 1HNWB 5E6SB 4Z2AA 4H7FA 2AF4C 4TS1A 3ST7A 4LC9A 3IUNA 2PIAA 4I55A 5AUPB 4C01A 1JLLB 1SRRA 2J48A 3EMKA 4AJIA 1LDYA 3OX2A 2D62A 5DULA 1U7ZA 2EHJA 2VDWA 1ECGA 3KCNA 1LLCA 3BRCA 5FNVF 1JFFA 4FN4A 3EQ9A 3GLQA 4H1TA 4RSHA 1RBQA 2GHIA 2G4LA 3DYIA 3ELDA 3KTAA 5KX5F 3UW1A 1AF4A 1AX9A 2GSWA 3HMKA 3RFXA 1JDUA 1UXOA 2VJCA 3TN7A 1CETA 4AYWA 8GPBA 1VKHA 3NT5A 4MW7A 5AM0A 3UH0A 3PIRA 3JYLA 1Y8CA 3I04M 3TNYA 3UF0A 2ZETA 2EU8A 3ZEAA 4ZCMA 4WY2A 3QZUA 1NX6A 3PNOA 1GN8A 3QVVA 1OFTA 1UMCA 1BJRE 2FPUA 2H5JA 1P1CA 3TQTA 2W2VA 2W6OA 2YJNA 4YP9A 4E30A 3DCIA 2VH1A 3OZCA 4C14A 2BUAA 5KO2A 3IDZA 2RC6A 3A7DA 1TKBA 2Z3VA 2WMOB 3PEFA 2ABWA 1TXGA 3NBAA 2QRZA 2HBRA 1RP1A 1RWVA 3AXSA 1UFVA 3QE4A 2E5WA 1LNQA 2K4MA 1B0UA 4G5OA 3RASA 1NULA 5GPBA 2YIVX 1HG1A 2JLSA 1AM4D 2P2LA 2OQIA 1BW9B 1SA0B 4HH3C 4UCQA 2ECQA 3QTLA 2JJ2A 3K9QO 3WTCA 3TB4A 1UQUA 2VJBA 3VSCA 4E08A 1FIUA 1FL9A 4H7IA 5C80A 1UKVY 1NG9A 1PDOA 1AUPA 3WYNA 1NPDA 1A95A 1Q5PA 1R4NB 2QN8A 4RZIA 4U2GA 4WXHA 4XGRA 3SOPA 3GA0A 1E3TA 1GU7A 5BN3A 1GPWB 1NSYA 4TL6A 4Y2TA 5JQGB 1O0CA 1H0RA 3HABA 3GJ7A 1KI3A 4XX0B 3Q41A 4YECA 5HQJA 3TNJA 3VYRB 3X1KA 2VNSA 1FRQA 1BYIA 3BBPA 5FA6A 4NYMR 4PZEA 2AHRA 1X7GA 5K4AA 3EN0A 3T8YA 1DAGA 1D5CA 3ZNQA 5A1TA 4X62B 3ZE0B 3AL0C 3R0XA 1R6BX 4OGLA 2G1PA 1CP2A 3DSRA 4GR4A 4UBJA 3BMXA 3DTTA 3VTKA 1J20A 3BT7A 3V9PA 3LQYA 4INPA 2CVFA 4DYVA 2CHEA 1OKKA 2I6TA 4HADA 4D0RA 3I62A 2BHSA 4TXHA 2CJFA 2PPVA 4MW0A 4X1YB 4Y2RA 1WSDA 3ZNNA 4EHAA 3GEIA 4LK2A 2PNFA 3VX4A 4PO8A 2PSDA 3LFUA 5E2AA 1W48A 2PL5A 2J7KA 4GBJA 4O4IA 3TPCA 1J00A 3WHKA 1M0TA 3R3ZA 3VYTB 1HV8A 3ZCXA 1A4UA 2ZCUA 4Y0AA 5F1PA 4BWVA 3W5CA 2PL9A 4G9EA 4HWTA 4NR0A 4OI4A 4CLRB 1U2TA 2XVZA 1KAOA 4F2WA 4LI3X 3BSWA 1EP2B 3E9RA 3LY9A 1FP4B 3MLEA 4JJEA 2OCYC 1P6UA 2OD9A 5K0CA 4G4SP 4ARIA 2WPNA 3AVXA 2VTVA 2RGGA 2UYOA 1M2WA 3GH1A 2P6MA 3H9GA 2O8BB 5DM70 1RAAA 5J5VA 1RKVA 5BSKA 3L4BC 4YUVA 3A9SA 4CMAA 5C7IO 5AVQA 5LZ9A 2POQX 2M6KA 3EFBA 1GPH1 5IEBA 3T5CA 4TL8A 4QLBA 1NE2A 4UAJA 3FOZA 2NTVA 1M5RA 1T2AA 1BDBA 2JCSA 2ZIAA 4G56A 5JCOA 4A8TA 4AF8A 5JH7B 3BFXA 4MI3A 3A9CA 4EM6A 4M9XA 1T6NA 2EG5A 5TQ0B 2CFOA 2I8LA 3HA3A 3UG6A 2P0EA 1H3FA 3MNFA 1NC1A 4BNKA 2YWRA 1A8SA 1ESCA 4DE5A 4MPDA 3SSMA 2WMDA 4ZCIA 2DT5A 4ZGGA 1JYEA 3A6ZA 1X2EA 1V9SA 3LYLA 1I8TA 5FYDA 5HBRA 4DBLE 1JQ3A 3C3EA 3N8HA 5CR9A 1QNFA 2B92A 1EFLA 3CRNA 3H5AA 4NYIR 2LIPA 3R41A 4GGMX 4Z1MD 5B3LA 4HV4A 2QYTA 3PGJA 4MRMA 4L07A 3ABRB 1GQ2A 4RAOA 5IAGA 3HSYA 4NCHA 4EMUA 3KQHA 3UJ3X 3HPRA 1PF7E 4QJBA 3GLIE 1BMFA 1DFGA 4OGGA 1AN9A 3HI4A 3W9SA 3NPMA 2LKDA 4DJTA 5E8JA 1ZITA 4C43A 1NUSA 2P2CA 4MW2A 3K09C 2GASA 4CT4B 1BEZA 4IOKA 2O5RA 3PRYA 3DW3X 1XVAA 2NU8B 4MVJG 4O4IF 3U62A 1KR2A 3F5QA 4Q1VA 3DD1A 1Q0LA 2B8JA 1J8YF 2GOYA 2OKCA 2V6FA 1R3DA 2NZUG 3T52A 4ASUD 1PR2A 1TC2A 3KHTA 5AKXA 5KC9A 5EG5A 3RTAA 2ZTLA 1L6RA 3ZYZA 5F3WB 3E4CA 1IZ9A 2RHBA 3BMQA 4FJ1A 2QTTA 3IDAA 3K6KA 1BNCA 1Z6PA 1CQWA 1Q0QA 3BB3A 3WIOA 5CLGA 2YQ5A 4K1LA 3LS2A 2HWXA 3KQYA 1D0VA 3O94A 4L5CA 2PZAA 1CQIA 1VLVA 3AF3A 4LJAA 1PUXA 4M1ZA 4YALA 5BWCA 1T35A 2FFAA 1FUKA 2ORVA 2X76A 2QVBA 3SYTA 4G5FA 1Z34A 6Q21A 2AEMA 4QTZA 1PNRA 3CXRA 1QHHA 1WNFA 2XNDA 2L18A 3A28A 2B5WA 3PQFA 5DHPA 1BVUA 3RAPR 5GZ1A 3HCCA 3GQBA 3J7TA 2ZRJA 4KN5A 4OGWA 2HJVA 3HUFA 1USGA 1O1YA 3P2KA 1RT9A 3TQIA 3EVNA 3MJFA 4NTZA 3Q87B 2XXBA 3L0YA 3UHFA 5CM2Z 2HF9A 2O8EB 1E9CA 1VHTA 3NT4A 3ULKA 1U8AA 2MIIA 4ZEWA 1FUEA 4DCOA 1QGYA 3I5MA 3AKZA 1D2AA 4RFLA 4BZZA 1IQUA 5D5PA 2QE7A 2YZMA 1WHSB 4K9MA 3O8RA 4G01B 3PX7A 2CMHA 1A88A 3U1VA 1U63A 3M2TA 4X8OA 1G18A 4XX0A 1HDRA 1O94A 3N7UA 5H68A 5CEEA 3WJAA 4ZAXA 2EIHA 1NOJA 4XVUA 5JZSA 4PQRA 3VKUA 3WNVA 4R2LA 3RS4A 3OJLA 1CJCA 1T4BA 2BFEA 1BQ3A 1ZK3A 3V48A 1PGOA 4R68A 1IC6A 1JBEA 2M1ZA 1NUPA 4FGZA 4DEVA 4HPWA 3J81k 5TPWA 3A4IA 4FQ8A 2TECE 2WKSA 3S44A 1RKQA 3OQ6A 2HHJA 4ND3A 1M2VA 2JFBA 1XMOB 3UB2A 3MTIA 4ZQFA 5SYNA 4NBLA 2FSVA 5F98A 1PR9A 1PQ4A 3P2YA 1ZK0A 3H9JA 3PXEA 4L50A 3UHPA 5JARA 5JPCA 5C5DA 1HH4A 1ZGJA 4QUGA 2OQRA 1BZYA 4N5HX 3ZBPA 4U0KA 3VDRA 3U6KA 4F8YA 1ISMA 3CPEA 2Z6QA 4P2GA 4CLOB 5B12A 5IJXA 3L8EA 4UDXX 3D7MA 3FDJA 3WGVA 4RORA 4RY0A 4DA8A 3MMPA 4J75A 1EUDA 2PWAA 4EATA 2EF1A 2LD4A 4HNUA 1K5GA 2Q1XA 3WGQA 3KZNA 1MBZA 4E22A 1X38A 4AJHA 4M4SA 1ABBA 3AY6A 2NAFA 3DP9A 4UM8B 3L2OB 1JDSA 4WESA 4HWKA 1UKEA 1UXIA 1US8A 3GFQA 3HSKA 2YJZA 3K9HA 4HH1A 1KXJA 4PPFA 5F64A 4A6XA 4BO2A 2XRYA 3UATA 1QRDA 2HCRA 3LCRA 1JIIA 4HB2A 2R8RA 3ANYB 3AGPA 3JASB 3LLUA 2HRBA 4QUHA 4KRYA 1THTA 5EEGA 3FTPA 4D9JA 1KI9A 4WXYB 5K6TA 3VI4B 2CLIB 4IJ6A 2OXFA 2RAVA 1CZUA 4BP1A 2BEUA 3PJRA 2PRJA 2AG1A 3V2UA 2P3QA 2QQ5A 1DX4A 3HJNA 3U40A 1USVA 4YJ3A 2D06A 1RE1A 3WLHA 4S0ZA 3VU9B 3UA4A 1LPPA 3CLSC 1LDMA 5FQOA 2QW1A 4C89A 4M0LA 3JCZA 5CRIA 1YOBA 8MHTA 2C2HA 4WBNB 2X5OA 2IXFA 1NMQA 4D1YA 2CXUA 1HOTA 5WRFA 3EA0A 3MINB 3RRYA 4JJ7A 3P32A 5BSGA 3ZGXA 4IWXA 2P6RA 2D2EA 1ZIDA 4TQ9A 1AZTA 2AC7A 1ZSNA 1S7CA 4TUYB 4ALKA 3LBNA 3Q2OA 4ZMRA 1WB6A 5A7HA 4KNYA 4NEQA 3C6KA 4F4HA 1T0BA 4IP0A 1IEQA 2WHYA 2VDNB 2H1WA 1ULBA 2XR1A 5F7ZA 1OU0A 3O93A 3DTVD 2DP4E 1FDTA 2FA9A 2QP3A 4FHEA 4A0RA 3G9UA 1YS4A 3JVUA 4AJKA 4QUJA 2HLHA 4ED9A 4D8UA 1C9JA 2G88A 3BCHA 5BPHA 4C0SA 5CXSA 1U2EA 3HKDB 2QMEA 1J24A 5E4YA 4LPKA 1PX0A 3CTMA 3GZNA 3Q8KA 4CCAA 4U2FA 1BAPA 1YQDA 1Z5OA 4X71A 1PNOA 3AM5A 2CV0A 3MJRA 1M54A 4M7RA 3OIVA 3P0JA 4UM9D 3RVJA 3SQMA 3U37A 2WVJA 3G5MA 4LXIA 5D7NA 4I1RA 3LRTA 4URUR 2NUTA 1D2RA 3FI9A 3EEOA 3LM8A 3PP8A 5M2QA 4ZVMA 3D8NA 4CR6A 1NVBA 1HDEA 4QU9A 4DMMA 2OFPA 4I9GA 4HBGA 1X39A 1Z28A 4E7OA 1L1RA 2V6IA 2ZRKA 1WW2A 4G3XA 1XEWY 1RBYA 5CT5A 4F0JA 2HFKA 1HQYE 3N07A 5DNYB 3EGXA 3OKAA 3KG2A 1E5VA 4YJ3F 1Y7LA 1AT1A 3FFXA 3U3DA 4OHKA 1Q83A 1RYDA 2QMYA 4G1VA 1SHZA 2BC9A 3QFHA 4KXFB 2DT8A 2CLEB 1RZUA 3KSDO 3NHSA 1MJGA 2IITA 3CZ5A 1ND5A 4OJMX 3T0IA 1KE2A 4P9NA 4MVJF 2OG2A 2XLBA 3II6X 3ROTA 2IW3A 4D9CA 1X1SA 4MGEA 3LT0A 2W2LD 1V4BA 4PWZA 2PMBA 4A10A 4C4PA 4EKYA 2OPBA 1ZINA 4GOMD 2NM0A 1EA7A 5JD3A 4NMMA 2R5WA 5B36A 4OOFA 1Y1RA 2DAPA 4KGDA 4AICA 5B57C 3PLRA 1XYVA 3IC5A 2NG1A 3DGFC 5AW7A 2W0SA 3ZV7A 1JSRA 4IZOA 3M5CA 4XVCA 1XTBA 2V8OA 2WZDA 3DOHA 1QX4A 2OCPA 3DV0B 3H5WA 2WHPA 1RQ2A 1LK7A 4LY0A 5LN1A 2DQYA 4HDSB 1JKJA 1WZ2A 2FR0A 1N75A 1DQZA 2HQ1A 3FF4A 3O2JA 4CKWB 4RESA 4BNWA 1IN7A 3K6SB 3IJRA 3E61A 3PD0A 3WK9A 3MFQA 4DCNA 1DAOA 3A9WA 1TEXA 3MCTA 1UZUA 2JIZA 3FETA 1GM5A 1YR6A 2CD7A 5J59A 3R0ZA 5BVGB 5IT5A 4DM3A 2L42A 4EMTA 2WK1A 2EFGA 3RB8A 2FWRA 3VKVA 1BRMA 1ORTA 3E9YA 1DLIA 3NHJA 3ZD7A 2IYXA 3DF9A 2QA5A 4WECA 4M0FA 4MYUA 5GONF 4HFRA 4YMSA 2O8CB 1YBHA 5L3SB 4AT1A 5TEVA 2HWWA 1E1DA 3HACA 2ZJ3A 1EBUA 1Z26A 4DCGA 3R9IA 4WJZA 3U61B 2V65A 5ALHA 4UEOA 3ZVLA 5IXJA 2GHTA 1TIPA 1JRLA 2ZPUA 4XZ3A 3BIXA 2Q2OA 3IR5A 1NXTA 5KTTA 5KTMA 1BDJA 1SNYA 3PFNA 2Q3HA 1V35A 2ILTA 1OB5A 1VDZA 2O3QA 1BN7A 1KZHA 4AECA 2H29A 2MWMA 1K5HA 1GAWA 5DHFA 4DV5B 4AL4A 4II7A 1RJFA 1IHDA 4JP1A 1A9RA 4P58A 4U8HA 4K9OA 4YV1A 2WM3A 4UHFA 5AJUA 5FLYA 2E2WA 3A14A 4TROA 4QSHA 4DJAA 2PAAA 2AZMA 1NKVA 3KYDB 4X8MA 4HQNA 3LVRE 1GY8A 4L75A 4JLDA 1KYQA 1HC7A 2XRMA 4WN9A 3BWBA 4ZQHA 1ZG3A 3R5JA 1ZN9A 1A27A 2JFWA 1GL3A 5ED0A 5C18A 5DMXA 4L7VA 1PZXA 4DANA 1WCIA 1R0WA 5FBRB 5A0TA 4PQYA 5DEIA 1FCJA 4L3WA 1DTSA 3NBXX 2C5GA 4IGEA 3TAXA 1GAXA 1SVMA 1XDSA 1RRKA 3HGQA 3OC0A 1UWLA 1I7QB 4UVIA 3K5HA 5FWDA 1ETUA 4KBYA 1RYMA 3FMVA 1Z4PX 4ICIA 1CS0A 2O3JA 3HKDA 3THWB 4Z4CA 1EX9A 1VLLA 5E9JA 4BIMA 1YL6A 2JHCA 3NS7A 3WGZA 5B1YA 2GILA 4HZGA 2L19A 5BRJA 1FP2A 1LW7A 1PR3A 3ROQA 5F2NA 2IP1A 4JKOA 4L72A 1OR8A 3Q3CA 3DZHA 2KLBA 3TM4A 3DVLA 1XALA 4ZYWA 1E59A 1XO1A 1N1MA 3PNPA 3RG8A 1S5PA 1IWOA 1U94A 3FOEC 1TW2A 3L93A 1C1DB 3FTNA 3IMFA 1XP8A 3E8XA 4Z7NB 5A03A 1PSDA 1ECPA 5D00A 2WJIA 4PONA 1GCIA 3IYLW 1QF7A 4DV4B 4X7BA 1MDFA 3H8WA 4IVQA 1W52X 3GMTA 5JVDF 3DBHA 3OOHA 3SG0A 4BBZA 2JEOA 1GUBA 3H65A 1GPDG 1MX5A 2AV6A 4R2MA 4M7PA 2C4VA 2W58A 3HDVA 5FTMA 1B8OA 2H85A 1MIHA 1OASA 4X20A 4YRAA 5L7TA 3T1OA 2RK4A 3I9NA 1A8HA 5LJLA 4KH0A 2QUAA 3LT5A 4AFNA 1EI9A 4AXXA 4GL4A 1H1TA 2XVMA 1F17A 4M1MA 2VPIA 1NC3A 2JZOA 3A4YA 1BSVA 3CA8A 5IYZF 3K1AA 5JD6A 2GARA 4O1MA 3WL6A 5FOTA 2Q3CA 1GKYA 4OMFG 5CURA 1AUOA 1VRVA 3UC9A 4IILA 4GI5A 1H66A 1E5DA 1PT5A 1TJNA 1DQSA 1RZRD 4UBKA 3BX1A 3BCRA 2GNOA 1JN0A 1YULA 2A14A 3STWA 1B15A 5AKHA 5LBUA 4CV3A 4CV0A 4P0QB 3EARA 4ZTBA 3L5KA 2PS1A 4EHNA 1Z6QA 2JAXA 1VHJA 3DDWA 3EH2A 3F9IA 1FX0A 1NIJA 3M1YA 4FSXA 2AN3A 4TQUS 1UAAA 1P1RA 4P5DA 3KQOA 3KOXA 2QRKA 3R6LA 1PZNA 4DIKA 1PR5A 2QTAA 4DNOA 3SQOA 5L4LA 4Q4CA 3EXEB 3A4NA 4K6HA 3O0TA 4TS4A 4WFIA 5ECYA 1P17A 3DMFA 4JEIA 2C2MA 3IQDB 2FWJA 1G64A 2DPXA 2H2DA 2M32A 2ZJZA 3LHFA 4HMPA 4KTTE 3KO8A 5DRTA 1MH9A 5EXTA 5M3BA 2FSSA 3OECA 3TLAA 3V3KA 4NEGA 4LZLA 4CM8B 4LJ6A 1ICIA 3HLTA 4Q12A 2QLMA 3V4LA 1WXHA 3L18A 3UPDA 1EUYA 4QNMA 5EZYA 1TTTA 1E2BA 1N3YA 5IC5A 1SUEA 3Q3VA 3NDBB 1U7TA 3OJWA 1ZW1A 3ABSB 3UAGA 1Z2AA 5B1DA 2RHWA 1PG5A 2WHRA 1XWFA 1ZVMA 3B3FA 1H4VB 1KZ1A 5J1SB 2CW5A 2F4NA 1DRVA 3I6QA 4BMSA 3LUAA 2KE5A 1R5NA 2PS9A 2Y76A 3QUBA 4PRKA 3MJCA 4UUMA 5E1MA 2BUBA 2WJGA 3WNCA 2ISQA 3PRJA 4FGWA 4Z0TA 5DI3B 3IAHA 1ADGA 1N4AA 4DAEA 2LGJA 5CAEA 4BMCA 1L4UA 2W37A 2QPLA 4IGKA 4MA4A 4RA9A 4RMIA 1AGRA 5IU6A 4B3FX 3C8MA 3GPBA 2O8DA 3K2EA 4AJOA 1UM9B 1VKJA 3LECA 3R5XA 1C4OA 4P4GA 3RF7A 2COEA 2EW8A 5KYUA 3SQNA 4AKTA 4TLEA 1E6WA 2JFFA 4M6WB 3S7ZA 4DV3B 2XCUA 4WZBB 3HMQA 4QODA 3G49A 5IN5A 4XJSA 5FNVB 2OGTA 3G02A 3V1YA 2G9RA 4D5EA 5IT0A 3N0RA 4LJRA 3CKLA 2XE7A 3MUOA 1XJ0A 4DDMA 3ZU6A 2DH6A 2BFWA 2RI6A 1KNQA 5LLDA 3NTXA 3H8JA 1PZGA 2DTEA 2WJ4A 2ZUCA 1YE8A 1N2CE 3DC7A 3KD3A 4TLBA 1YU9A 5ALMA 2V3VA 3BGWA 2E6KA 4K26A 2DSNA 4DJDC 1GUZA 1TM5E 3SQDA 4J7XA 1LI7A 4KR0A 4PNZA 1SUFA 1G6HA 1ZW6A 4MS1A 4UXIA 5IAEA 2C5AA 3KOZA 4N76A 1U28C 1E3JA 4WZBA 3KZXA 2GGSA 3T1VA 4BNVA 4PNEA 3THWA 5IC6A 1AQYA 2YWDA 1VTKA 4UVDA 2QD4A 4NQRA 3KTAB 4FDTA 1FS5A 2OCGA 4YRNA 1W5AA 3PNSA 4XB6B 1E98A 4KLNA 4EI8A 8ADHA 4NJMB 1Q16A 5ISMA 1P31A 1H5QA 2C0PA 1PVOA 2Q07A 3P0FA 4GVLA 5IZCA 1J9EA 2RHCA 1OTXA 3SX0A 4YQFA 3S5UA 1G7RA 2Z58A 3A3NA 1YB2A 5F12A 4AMYA 1JWLA 2R1ZA 1E94E 3K4QA 1MRZA 2GT1A 3MCAA 1Z75A 4QDUA 3CNNA 2QLLA 2VDJA 4LDNA 4AY6A 1PGNA 3BJRA 3RIHA 2A0XA 2IP2A 3CISA 3DUWA 4KITB 2I3GA 2V8BA 2CNBA 5I7WA 1JG2A 3GVIA 1X42A 2WWWA 4L9WA 2FX5A 5H3CA 3RC3A 2V7EA 3B6KA 4JQZA 4BC0A 2JCXA 1A1VA 1SVKA 1MEEA 2GDZA 4NU8X 3D2AA 5F7JA 2G9UA 2P5UA 2QRMA 4RH3A 4KQ6A 4GH5A 1DC7A 1YJCA 3O0DA 1NY5A 1RLMA 3ADBA 4BKQA 2C2YA 4MCAA 2BP7B 4U7JA 3FLBA 4Z3OA 2JRLA 3EDMA 2GZHA 3WR5A 4UE2A 3ZQ6A 2G5PA 3EIQA 3LGSA 4CR7A 4D80A 1X8KA 3AX6A 2H1FA 3SOZA 1HG0A 2PKEA 1Q1QA 2FLWA 5K3DA 3QVGB 3B85A 4GZ6A 4DOMA 1WSAA 1JQBA 3MW8A 2NMVA 2A1UA 5KNDH 3K70D 1MT3A 2FFJA 4QHSA 4XJVA 3FYUA 1S8AA 2VP3A 4P6VF 3T9CA 3BEOA 4ZT5A 1WY5A 2YH2A 4I08A 5F9MA 5I3ZA 3VSDA 1M1XB 1KK3A 1NQTA 1RACA 5FIUA 4W9MC 1LDGA 1YZHA 4MUEA 5IJWA 1NFRA 2IYNA 2NYVA 1QBKC 4QHYA 2B3DA 4WBNF 4YAOA 1NSFA 3HJFA 4L57A 5T3UA 2ZRAA 4AG3A 1J25A 1I3OA 1XNHA 3N3AC 4IKEA 3SFZA 3HXOA 1QU2A 2FLKA 1NMSA 3TAHA 3FB1A 3NFYA 3VOBA 4FOSA 3SYKA 3CKYA 3BXOA 3QVOA 1JKXA 2DQKA 4WZZA 4HS4A 4RENA 1PEAA 3GT4A 3MFYA 2IEYA 4H4EA 3VNBA 1QG0A 4BECA 3PRKE 4A5OA 1P7PA 3SHOA 5FYQA 1FVHA 1U2RA 2JARA 2NUPB 4C3OB 4DDTA 1CG6A 2XGJA 1NVXQ 3G2HA 3NONA 2HUNA 3E18A 4FNAA 3T7IA 3FBTA 3K30A 4PS0A 4UAVA 3RWOA 1QGAA 4LCJA 3PFHA 4M1OA 4EA8A 1S2OA 1FF9A 1GDHA 3WQHA 3AHIA 1T4GA 4ZU6X 4ZO7A 4ZPXA 3ZQ4A 4MTLA 3UJ7A 1UBMS 5FA5A 5ILQA 2ANBA 1QCYA 1P3Y1 3GN2A 3ILSA 2VF2A 3VYVA 1F3OA 3OOEA 1QE0A 3GV0A 2CKMA 4G07A 3CPSA 4O4JF 3S7TA 2HRDA 4TKUA 3VR3A 1BDMA 5DN6D 4OFBA 2AFHA 3WIEA 1C1XA 1LS1A 3THXB 1VLQA 1YBFA 1AHNA 5JALA 2OHJA 2PGNA 4NZOA 1YDEA 3KPVA 2IXEA 3LDAA 2G28A 1OMOA 4B2LA 4CFSA 2FMHA 3HNPA 1F8FA 1BC5A 1O9HA 2XDQA 4Z86A 3PGA1 2GEFA 4JMLA 4B2IA 1I36A 5B3KA 2YV1A 3LYHA 1EXDA 3MAAC 3VC7A 2VXBA 4F85A 5EWLA 3OJ0A 3C3BA 3QPVA 1EGMB 4BMXA 1KY2A 4PU0A 3UV3A 2X9GA 1VG8A 1NVVR 2NU8A 2CLKB 1K86A 3NVDA 4BNTA 3H8VA 1BW9A 2ATXA 4QRIA 4BASA 1LBEA 5EIBC 5LQNA 1JJFA 1UL1X 2GLUA 2FWIA 1OHHA 5GZ6A 2VP2A 3RTBA 4U9IS 3JQAA 2R79A 3OFND 2BMWA 1J97A 3BL8A 4YO7A 3JQFA 3MBIA 3UY4A 5EMHA 3TRDA 4KVAA 5HQ3B 1IZ7A 4QRDA 4BAGA 2X9VA 1KYXA 3V8EA 1BHO1 3FAZA 3D02A 4XM2A 3VSEA 1KU0A 1DZIA 4LC0A 5KYYB 3DQQA 4MDHA 4QXAA 1Q7RA 1T9KA 5I8PA 2XECA 2HJSA 3GGCA 4AIRA 3CT4A 1JEYB 4PTZA 3HB5X 1SM4A 1UPUA 1Q44A 1XZEA 2GAFA 2GYYA 3FPJA 3FPFA 5HWSA 1O4WA 1G6Q1 3C70A 4YMIA 4K9DA 2X1HA 3UAXA 2AEFA 3W2FA 3B1JA 2QZJA 1VI2A 4WNAA 4XDZA 5AXAA 1ZLXA 3CEPB 4PGHA 2RFLA 1V16A 3L0OA 3NIWA 1TYCA 4D43A 5BR4A 1ZJWA 3A6HA 4NS1A 2BFOA 1XTIA 3EWSA 1FYFA 2PLAA 3KYIB 1P39A 1NUHA 3NCHA 1NATA 4JBHA 1J0XO 4S1PA 4JU8A 3S2GA 2HMYB 2YTZA 4UXJA 3F2IA 3I58A 4RIIA 3L7CA 2FPOA 2Z5VA 2IKSA 4IJMA 5K3FA 3WWZA 1HE8B 1SZDA 2CB0A 2FUNB 1W0JA 1U1FA 4F4IA 3QPCA 4KUGA 4FB5A 4D9HA 1XTQA 3WA7A 4P7BA 3I9OA 3TS1A 4GKJB 4O4IB 4RCYA 1PK8A 4MB0A 4NV3A 1THGA 5DTEA 3U3XA 3UJHA 3SKVA 3FM9A 1J9ZA 4LMPA 2IHVA 4L16A 1E63A 3LVQE 4F60A 4QDJA 3UG7A 4D3YA 2PJUA 3ELWA 1V3UA 3PDWA 1P4AA 1FJHA 2ZDGA 5BYKA 1JQ5A 1WF6A 3DA8A 1DJOA 1E3IA 1MPTA 5DP1A 1MO2A 3G0DA 4R71A 5JDIC 1EIWA 1UDXA 3O95A 3E27A 2C42A 3QFSA 4MUJA 1DCFA 3K09A 3DHVA 2PX5A 2G71A 1Z5NA 2N46A 1T9AA 2I4TA 1ZEMA 4JXJA 3WRXC 4HGZA 3QKUA 2FPLA 4HNVA 1EGQA 1QK5A 1ZCBA 3U1BA 1N6OA 3AYZB 1Z4MA 4ZYTA 4LNAA 4R2IA 1ZNWA 5CMLA 3H83A 3IOMA 4DG8A 4BMPB 4DDHA 5MF6A 2WM2A 2ZDHA 5CDUA 1W0JD 3OH8A 1BGVA 1GUDA 2Q9BA 1MQ9A 1USIA 2FVXA 1VG9B 1B4DA 4K7JA 1J6UA 2GEVA 4P0PB 3LW7A 1EWKA 3VR1A 3LC0A 1FDUA 4E15A 4ECEA 3NOXA 4X8LA 1ZD8A 1Z6ZA 5JC1A 4E6EA 3QOFA 2J0EA 1X1AA 4PSKA 4MRMB 4LCBA 1RHQA 3KD2A 3COVA 1P7CA 1NF8A 1HFKA 2QM8A 3TAUA 2XMPA 3GLFA 2Q5HA 3HNOA 3OCJA 2QRNA 1IXYA 5FPYA 1DXQA 1FQJA 3MWEB 1NRXA 4M9CA 4DPLA 4Z49A 5JRZA 3WZLA 3P2JA 4FMBB 2PX4A 2XZLA 2HWUA 2DBZA 5KHLB 1J2JA 1UZLA 2Q6IA 1G60A 3ESAA 3VX3A 3QE2A 1U7XA 1YH3A 2GJ8A 4QJ4A 4CM1A 4J0QA 4UDOA 4F9EA 2HZ7A 1PJSA 4ECAA 1PLKA 4LFAB 4IDBA 3CUTA 1JDBB 4BNDB 2VR1A 3JAMA 5REQB 2C29D 2PUEA 3V6LA 3OZRA 5THKA 2GO1A 4MITA 2EBHX 3U48A 2OHOA 3LYUA 3GNSA 1XK6A 1NFQA 2P3SA 4L8WB 1ATIA 3UW3A 4PYIA 5JFTA 1CUYA 4BO4A 1MW8X 4DIUA 3DE4X 3M8KA 1JR2A 1RHRA 1R64A 1YHYA 1V7CA 2P11A 3PE3A 4OSPA 4RPHA 4ZI5A 3DE2X 1N3LA 1Y9ZA 3FNIA 1F12A 3T5AA 1DS6A 1DC5A 2OFFA 1C4WA 1T2VA 1DKOA 1WV1A 2V0CA 3LKZA 3ZW8A 4EYEA 2P1RA 4QYIB 1KDTA 4YJ2B 4R7GA 1WPQA 4BP3A 1OYVA 3S0JA 4ZT4A 5B4UA 1CSEE 4I2NA 5ALPA 2FUEA 3H1GA 3OCYA 1ML3A 2G9QA 3B9BA 4BN5A 4MW5A 4OUDA 1Q0HA 4L02A 3DBRA 3L4SO 2DKFA 4KB5A 4F2DA 4KR6A 2DC1A 1IRXA 2FFBA 2HF8A 3NC0C 1NR5A 1YD7A 2BFFB 1O94D 1SOVA 4UEKA 3DZCA 5CLIA 1JPVA 1V25A 1UDBA 2V7XA 1Y48E 1L4HA 1AZSC 2IYVA 4JOBA 4OVKA 3MAGA 3TIXB 4DILA 1I3MA 2MHCA 5LU8A 4EECA 2X6RA 1RADA 4G5GA 4PWYA 3W6PA 1N77A 4LNHA 1F0PA 4XA8A 2YFKA 1CZKA 4UHJA 3ZN2A 3H2GA 4G65A 3NORA 4IXWA 2XWPA 3EVAA 2QAGA 2PTGA 4JLJA 2AZTA 3ZGVA 2IEZA 3OP4A 4HDAA 1GFIA 4EG5A 4JLBA 3U6BA 2X4GA 1N57A 4G0YA 5EGNA 4C7BA 4UTRA 4C4YA 4EKDA 1KKLA 4D8TA 2JI8A 2QM3A 5CA0A 3V7YA 1W1UA 4YAWA 2EFDB 1XZQA 4ID9A 3TL3A 1GL9B 2HHCA 3W3AH 1D2NA 2HNKA 2FZEA 1II9A 1ZK2A 2WB4A 2Y1KA 4G0ZA 4OMDA 1NW8A 5K20A 1Y34E 5T67A 3DZGA 3MIZA 4KDRA 1K8ZB 1VDMA 3NRJA 3KLPX 4QYWA 5AOVA 5GOZA 1U02A 1LI5A 3AEUA 4MB6A 4E51A 3B3JA 4FC7A 1PVVA 1CY4A 1FTYA 3IAS1 1UMBB 4FOTA 4LGYA 5AK0A 2EJTA 1MO3A 3B3AA 4GPIB 4NOMA 4NC9A 3SXUB 1R2QA 5LIPA 5KKNB 2V9CA 3AERB 4QXMA 2RGNA 1H0SA 3DKIA 1P0CA 1Z33A 4BVGA 5HX7A 1PWHA 2W43A 1X80B 3VKGA 3RAFC 1NHGA 3L8MA 5CA0B 1QP0A 2NXEA 2LKCA 2D2FA 3FN4A 2QQFA 1KAEA 1WY7A 1ULZA 1KP2A 4D9GA 3R8FA 1P2TA 4ZO6A 2R9VA 3MQ4A 3ZDEA 4MZDA 4PBRA 4UBIA 5IUNC 1TYBE 1ZHHA 3C6QA 1CZRA 1XMSA 2B34A 1VSTA 2H06A 1IM5A 4LX8A 1ZXBA 2AQHA 2J5QA 5C1DA 5BVGA 4YCBA 1J2UA 3WB0A 5JROA 1Q21A 3BPSA 1JUDA 3AW8A 4X6YA 2O8VA 1TGYA 1QM5A 3IQEA 1MFPA 1W8IA 2HEIA 1B2LA 2J9XB 2H6EA 4N39A 3F98A 3U17A 1DKQA 2QTVB 3RS3A 1E20A 2PVCA 4MGIR 1SXJB 4AN1A 4CCSA 4EZIA 4YRGA 2IH2A 2P9CA 3GGPA 5CYOA 4YHHB 3CVYA 1N6NA 4ENQA 1ONPA 4MEJA 2P2NA 4LYYA 3J81A 1CUVA 1EHCA 2CMKA 2NO6A 1DXHA 2CXNA 1M6HA 4RPKA 5FO1A 1GV0A 3UJ6A 4QUBA 2LVBA 4NNOA 3LO5A 1ZONA 3TM5A 1A9ZA 4BRZA 2BWJA 3VGJA 3ZNPA 3SNHA 1Q95A 1LY1A 2PBFA 3BKXA 1QLJA 4HRAA